4IZOA

Crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
376
Chain Sequence
SPILPGAWLGMVGGGQLGRMFCFAAQAMGYRVAVLDPDPTSPAGAVADKHLRAAYDDEAALAELAQLCDAVSTEVPAASLDFLAQSTFVAPAGRCVAIAQDRIAEKRFIAASGVPVAPHVVIESAAQLAALADADLAAVLPGILKTARKGQVRVATAQEARDAYGSLGGVPCVLEKRLPLKYEVSALIARGANGASAVFPLAQNTHHGGILSLSVVPAPAASDALVRDAQQAAARIADSLDYVGVLCVEFFVLEDGSLVANEMAPRPHNSGHYTVDACETSQFEQQVRAMTRLPLGSTRQHSPAAMLNVLGDVWFGEPVTPPWDQVAAMPTARLHLYGKEEARVGRKMGHVNFTAATLDEAVAGATACARLLRIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of kinase Phosphoribosylaminoimidazole carboxylase, ATPase subunit from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
total genus 126
structure length 376
sequence length 389
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4izoA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4izoA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4izoA01
4YB8B 5BPHA 2V59A 2GPWA 4ZOLF 4ZQIA 2W6NA 3MWDA 3TINA 2NU7B 3JZIA 2X0SA 3RUPA 4O7NA 3QFFA 3VMMA 5I47A 3K3PA 4E4TA 3I12A 4M98A 4YJ2F 1EZ1A 3R9RA 5CA1F 5HBRB 1VBGA 1E4EB 2DLNA 2VQDA 2VR1A 3AX6A 2Z04A 1JKJB 1CE8A 2HGSA 4O2AF 2YRWA 4MV9A 1UC8A 4Y8VB 1W96A 1KJJA 2FP4B 5EZYF 1KEEA 3TQTA 2FB9A 2V5AA 5KX5F 4MV1A 4J6EA 4O7ZA 1E4EA 3E5NA 4I55F 3GLKA 3AW8A 1GGOA 2VPQA 2I80A 1CQIB 3GIDA 2CNUA 5JH7F 2GQRA 3LP8A 4ZI7F 4MV8A 5JVLA 2ZDHA 4I4TF 2XCLA 3HBLA 4XX0B 1EUDB 5BPFA 3R5HA 2W71A 1BNCA 2I87A 4FFNA 3TIGA 3OUZA 5H80A 5CB4F 5JQWA 1VKZA 1AUVA 3UFXB 4C5CA 2NPOA 4O86A 2YS7A 3KALA 2YZNA 1OBDA 2QF7A 1OBGA 2W6OA 3ETJA 3N8DA 4O84A 1KBLA 4MV6A 2DZDA 4MA0A 3VPDA 3V4ZA 5J2TF 3BSSA 3G8CA 4EA7A 4MV4A 4MV7A 2FPIB 3VPCA 1IOVA 3Q1KA 1Z2OX 2YL2A 3TIIA 4HNVA 3ORQA 2GLTA 4EABA 5C1OA 4FFRA 1CS0A 3RV4A 3MJFA 2GQSA 3JZFA 1IOWA 3JRWA 1ULZA 5BMVF 1KJIA 5LXTF 1KUTA 1C30A 1KJ9A 2PN1A 1JDBB 3SE7A 4O81A 2GPSA 5FNVF 4FFOA 3V4SA 1JLLB 3ORRA 1Z2PX 3R23A 4O7WA 4YAJB 3U54A 4HNTA 4TUYF 1JDEA 4EAAA 1W93A 1VBHA 4FFLA 3NUAA 4NYEA 1PX2A 4O4IF 1M0WA 3JRXA 3K5IA 1SCUB 4QSHA 2CQYA 2R7LA 4XYLB 4IIJF 4WBNF 2R7MA 2I8CA 4DIMA 4O83A 2P0AA 2W6PA 5K2MA 1UC9A 3VA7A 3DF7A 2R87A 1GSOA 4ME6A 1KC7A 2NU9B 2R7KA 4IWYA 2PBZA 4O82A 5IYZF 4O4HF 2HJWA 5GONF 3MWEA 4IWXA 4HR7A 2W6ZA 3RFCA 3WO0A 3BG5A 4O4JF 3VOTA 1KJQA 2PVPA 1B6RA 2YRXA 1M6VA 3WNZA 2YYAA 3TW6A 1KJ8A 3BSYA 4EA9A 3N6RA 2IP4A 1DV2A 5JVDF 2YW2A 1T36A 3G8DA 3BFPA 4O4LF 3ETHA 2FPGB 4DLKA 2Z02A 4M9UA 5D8DA 2R82A 4O7YA 2C00A 5C1PA 3U9SA 4XYMB 5CAEB 3Q2OA 1I7LA 2R84A 2CZGA 1EUCB 4TV9F 4YAKB 3KREA 4YJ3F 4GGMX 3R5XA 4O7TA 4M9CA 3KAKA 5JQGF 3KAJA 2ZDGA 4EA8A 4WD3A 4FU0A 2V58A 2VHEA 5LA6F 1GSHA 2J9GA 2QK4A 2YS6A 2NU8B 4O7LA 4M99A 2R6FA 1PK8A 2R85A 3U9TA 4IZOA 4FE2A 4TV8F 2R86A 2ZDQA 5LP6F 2YWVA 4C5AA 3HO8A 4RZQA 4L1KA 2YZMA 4MA5A 3OUUA 4EG0A 1DIKA 4O2BF 4HQ6A 2WYOA 4I50F 5CA0F 5HV6A 2XD4A 2SCUB 4O7VA 4MAMA 2FPPB 1DV1A 3K5HA 5KKNB 1AUXA 4HNUA 2YZGA 5LYJF 1C3OA 1A9XA 4ZHQF 2NU6B 1I7NA 1GSAA 3U55A 4FFPA 3RV3A 4MV3A 4YBZB 3BSWA 1GLVA 3R5FA 4O7RA 2W70A 4FGRA 2NUAB 4C5BA 4XZ3B 4EGQA 2YZLA 4FFMA 5C8YF 2OLSA 5DMXA 1Z2NX 3WO1A 1B6SA 4IHJF 3VPBA 2CNVA 2DIKA 5LOVF 5J2UF 1BXRA 1WR2A 4EGJA 1M0TA 1A48A 4O7SA 2W6MA 1EHIA 3LWBA 2DWCA 3HB9A 2R7NA 2CNQA 1EYZA 2W6QA 1CQJB
chains in the Genus database with same CATH superfamily
2CXHA 1KZ4A 3NP9A 4ER6A 2FEAA 4I4NA 4XDGA 2X1HA 3LECA 3QVGA 3CLTD 4XH9B 4OTZA 1PLJA 5H3CA 3PCTA 4PFJA 4B17A 4BN0A 1JU3A 1RQNA 4ED3A 1GP2A 1T6ZA 1RKXA 1TF2A 2HNBA 2IYEA 2PZFA 1KYTA 2WYHA 2XWPA 3FWPA 2GTIA 4WKPA 5ICCA 1YFZA 1B42A 4REQA 3WMXA 1V45E 1N6NA 1NL3A 4ALKA 3LL4A 1ZDMA 1X0VA 4M3NA 1N0UA 2NU7B 3DAOA 4RLHA 4B3DA 3RB6A 1K6IA 5JSQA 3LIIA 2H2GA 4D0SA 2WZCA 1MX1A 1SA0A 2J3LA 4IY1A 3S6JA 4AZTA 4BIIA 2HF9A 4O3SA 5L9XA 3DG9A 3C3YA 3GEMA 3ZDFA 2HV8A 3VNAA 4Z4HA 4FLEA 4E4TA 1K8QA 1PSWA 1V8OA 2IPAB 4IXWA 4KAJA 1JMKC 2JAQA 2VH2A 4TTTS 3WRWA 5KJCA 3G2HA 4K0KB 1RYHA 2VJDA 2Y0CA 5E9AA 4CKCA 3D1JA 3KYCB 4JB2A 5I51A 1MABA 4G4SP 4Z9XA 1L3BA 3LY5A 4G89A 1T43A 1Z5PA 5EXSA 1WNFA 4BBPA 3W0LB 3E5RA 1YSCA 2C4TA 1DKNA 1J00A 2Y0PA 4KHZA 1OIVA 4YJ2B 1Z5GA 1E2BA 3T8YA 4NBUA 3F2IA 4WVLA 4RPIA 1PP4A 4YGXB 4L4YA 3LDUA 1ZO8A 2DLNA 3CHYA 3EYWA 4BO9A 2FZEA 2X6TA 1JPUA 2ZJOA 5BYAA 4J0EA 4JGBA 1CEEA 2YCHA 3LQFA 3D43A 1QNFA 1E9SA 2W6ID 3ZWPA 1P3Y1 3RRZA 3UJAA 1SBQA 2O07A 3EW9A 3HL4A 4GX0A 2MYPA 1YL6A 1XAGA 3RGZA 3GW8A 4Y8VB 1TQHA 3KQMA 3M1YA 2FP4B 1KAHA 3DVQX 5A4FS 5JFGA 1RAEA 2FFHA 5KCMA 3W8NA 1A0OA 3C85A 3GLGA 2LZ0A 1YZNA 4XGNA 3TQHA 5DGHA 3D4IA 4OXKA 4QDUA 4I2NA 1J0BA 2C1XA 5JNRA 1ZVKA 2E4VA 3K4HA 2AJ8A 1PDVA 5IAJA 5CITA 3I01A 3KPVA 3NAMA 4YUXA 4MKXA 4R3UC 3E6AA 5BW6B 1Z0UA 1KAGA 1PFVA 1JSXA 1JXAA 4F4JA 4YMWA 3GLRA 3FROA 3ETDA 1TO6A 4BMOB 4LY9A 4G1CA 4Z86A 3VHXB 4NBWA 1BH6A 2XTNA 5CLJA 4W99A 3LP8A 4NWIA 4KZKA 4MRRA 1D6MA 3P5SA 3VC3A 1XTZA 2M2IA 2GEJA 1RRVA 1X8LA 3IEIA 5AW4A 5I5UA 1SD2A 1JHOA 3ECSA 4C14A 4QPNA 2BKLA 4RTNA 3KTFA 4KIFA 1B7GO 4D2IA 5F77A 2Y4OA 3KX2A 3SJZA 1KEEB 1E2FA 1SQFA 3RKUA 2OD7A 3CPJB 1WQ1R 5F76A 3EFHA 1GOTA 1DWPA 2CLKB 1JV2B 3K70B 1RPZA 2LVBA 4FVTA 4JT9A 5IJ9A 4IH4A 3QX8A 1N2ZA 3V55A 1GTSA 2QT9A 2FW9A 2W9XA 3ADPA 1W73A 3KKQA 4HWPA 1V8PA 2JFWA 1SIWA 5TQVA 3CXRA 4UBJA 2FSHA 4PX3A 3CRRA 4UUPA 1MH1A 1X13A 3N2GB 4FFNA 1Z4IA 2CNKA 2CUZA 1XZQA 3HDJA 4GVPA 4ARAA 4C0LA 2C9YA 3BORA 1MW8X 5ETJA 4AP6A 3X1ZA 3GPBA 3VRHA 5HWSA 2NPOA 5CX1A 2WM9B 4YR0A 1GZDA 3FPGA 1QOZA 1L4BA 2PKCA 1G6OA 3EGIA 3H1AA 2AOVA 3O8OA 2X0FA 5JANA 5FPTA 3K16A 1XMOH 1ZEJA 2DUMA 1P19A 3AKYA 3RKRA 4CKWA 4ARCA 1TW2A 3GG2A 5CNIA 1H22A 1AKYA 3BF7A 3GWZA 1N8TA 3AXTA 5ECGC 2GX6A 2JJ2A 4YTEA 5P21A 1N1EA 3AMVA 5CXXA 3NNDA 2RCNA 3HOVG 2D5CA 1OWOA 1YMVA 1Y6JA 1XF9A 2BEJA 2ASDA 1RM5A 4N76A 1WMAA 4Z2YA 5IUNC 1PFYA 4M8NE 2HY7A 1BXZA 4TKMA 3SHWA 4QBHA 2X4GA 5BVGA 2DPJA 2DCUA 2EQ5A 4I8DA 4DMRA 2YRFA 4QXQA 3FD8A 1ZK1A 3UFXA 5CLIA 2A0FA 4QFCA 2EJVA 2FLPA 1N3YA 1AQJA 1XCBA 3T1QA 3DEYX 3JTMA 3SP1A 1DKRA 1Q16A 3H5RA 4HLNA 3V2UA 4YCBA 4G4SO 3AFOA 3GF4A 1BFKA 3KBOA 4RGBA 2CNBA 1G8JA 4KGXA 1L5OA 4EM6A 2HDHA 5FAKA 3KEGA 3RTCA 1U0FA 3S24A 1UOOA 1A1SA 3W6UA 3F9RA 3KU4A 4K8OA 3GVPA 3FUVA 1Z2CA 4F8JA 1X3LA 5EQFA 1KQOA 1WF3A 4E3ZA 1NPDA 2K2WA 3C98A 4TLCA 2XX3A 1IE3A 2J0UB 3ZDRA 4EB8A 5B4UA 3GT0A 4P84A 2DT5A 3RIYA 1TNDA 5J4HA 4X45A 3DAYA 1H0HA 3TXYA 3QXHA 1LPOA 4KYVA 1EA5A 1V39A 5AIAA 5C7OO 3EB9A 1HDCA 5FL7D 2NU6A 4R1TA 3FRIA 2JJ1D 2GPSA 3I5UA 2Z2ZA 3JQAA 3OPYB 4J16C 5I9TA 4A1FA 4EY7A 8OHMA 1U31A 5EHZA 1W1IA 2K7FA 2V9WA 2CEAA 1Y7LA 2W2NA 1PEAA 1T9CA 2ZSKA 2CNLA 1GXSA 4EFBA 2ZTSA 1LRLA 4FYMA 4LSWA 4GZ6A 2HSWA 1F38A 3DBLA 3CX6A 3Q5EA 4N3BA 5C4IA 5C7LO 3E58A 2DHEA 1N2OA 3GUVA 3ICQB 1BWSA 2BMDA 1JDPA 5L8VA 4X90A 4Q03A 1JYFA 1O03A 4G8JA 4ZA2A 2TSYB 2IBTA 2H2AA 2DH5A 4PZ0A 1TFUA 4LFBB 2O2IA 3VNUA 1N0HA 3FBGA 5E7JA 3AR7A 5FBKA 1NMXA 5HFNA 3L0ZA 5JCZA 5LXTA 1YHYA 5C1IA 2YNMC 5AOCA 3AR4A 3K35A 5T57A 1PEDA 3VYTB 1UBMS 4UAJA 2ZUFA 4ESVA 2UUAB 2WB1A 2FYTA 5DGAA 1R9MA 1VJ5A 2SBTA 3B1ZA 4HXEB 3DL0A 3EXEB 3RYTC 1V5WA 5BXYA 1T1JA 4XYLB 2EL7A 3U7HB 2VLIA 5FOWA 4K86A 3OCJA 4R1MA 3GTGA 3QV2A 4DZZA 4MKFA 4R9UC 1X7ZA 4PV7A 4NZ9A 5FH9A 2AB0A 5H1YA 3EIUA 3NPAA 3WLNA 4J90A 5DAAA 2J0VA 1NAIA 1JQ5A 1WKCA 4LKRA 4ODIA 2J4FA 2WOJA 4JZKA 4Y1RB 2G1UA 5A2QW 1DBSA 1UBCA 1DQRA 3SEAA 3QOWA 1US8B 1XTIA 3AF2A 4M55A 4UUOA 4HV4A 5A5FA 4EW3A 4ABTA 2B1GA 4MS4A 1PG2A 3ZIDA 1Z37A 2GVDC 2YV4A 2CMFA 1CG6A 4BKRA 1KI9A 1J20A 2VA8A 3DWEX 3OURA 3R20A 5THXA 2BTEA 3NHJA 4LI3X 4DIDA 4YRKA 4R69A 1M6YA 2GD0A 3HBJA 4UD2A 3WRYC 1QCDA 2BEVA 1OXUA 3PCXA 4XWOA 2RJ3A 3PQCA 2PBZA 1KP9A 4U7WA 5TF0A 3GFSA 3HADA 2NO0A 3M2PA 4KDCA 4RKFA 2J5KA 4X6LA 1GL7A 1E1DA 2O48X 1Y1VA 1DRWA 3HYCA 3LOUA 4B81A 5K4AA 1LBTA 3PD1A 5FBLB 3BWYA 4TVSA 1GFZA 3RSFA 4D7AA 1XEWY 2O2HA 3B1KA 1E7RA 3IP3A 3MS7A 1KDOA 3HEAA 1WSBA 4RZ2A 4UHCA 2W6ZA 3PF9A 1ZNYA 4YXFA 2P91A 5FAXA 3BD6A 4GQBA 3HDYA 1S2NA 1A9YA 2FMUA 4JJ8A 4HUTA 1DKUA 6ADHA 1JG3A 3ME5A 4UFPA 3FVRA 3MWLA 2WSMA 2V4RA 3EARA 7ADHA 4KPYA 1FJGB 4U7GA 4LYYA 4QO8A 1VB3A 4YR2A 1JSCA 4EMBA 4I5GA 4LYDA 4UTRA 3R7WB 3KYCA 4MV5A 3AK4A 1Q6ZA 3C8HA 4M37A 2GZAA 5HILA 4KOEC 5DTQA 2VNIA 1H2AS 3BXPA 3S2UA 5F1OA 1QQ5A 1B0AA 2F3QA 1OWLA 2QYTA 4WW0A 3IDQA 4EPXA 3DQPA 5KNCD 4DV5B 3CF2A 3ETLA 3CV3A 3R74A 4GNRA 2JH3A 4YRBA 1WU8A 1L5NA 2DU8A 6REQA 4XYLA 1Y7PA 2GFHA 4AICA 4KR7A 4GLBA 4BE7B 4UU7A 1ZD1A 4CCYB 4RCZA 3VU8A 1G38A 1W46A 2NV0A 4FBTA 2WVHA 4Y2UA 5IYDG 2QLBA 3DCNA 5EIFA 4ZVOA 4BVJA 3GFGA 3FOAA 1M7GA 2OBLA 3FM9A 3PZRA 3LC7O 4KN8A 1OI7A 1IY0A 1VLHA 1S0UA 1Z17A 1CUHA 5J1SB 4I9NA 3GPDG 1D4FA 4RQUA 1WCWA 2NZ2A 3DE2X 3CVYA 1YS2X 1POXA 4ZAWA 2IXTA 4A2AA 2O2JA 2NZXA 3R6TA 4AZSA 1UXIA 3EVAA 2ZIUB 4J9KA 1C4WA 1CUEA 1NJ2A 3KAKA 5JQGF 2DX7A 2H9AA 2VRCD 3BD7A 4KXLA 1TT5B 2V7BA 5BWUA 4M0EA 3U7RA 3ZVNA 2R8HA 2QUIA 2OILA 5EL0A 3EZYA 3GC6A 4YGYA 1R8JA 1YU6A 1FRVA 3ONDA 5IBRA 5C51B 3LCCA 2FUNB 4OI4A 5KNDA 1ZRNA 3NVDA 4OQYA 4Y6SA 2D6FA 4KRFA 1LC0A 4QDJA 4K28A 2N42A 2IF0A 3L6DA 2YMPA 4FYVA 4DMCA 3DAPA 3WNDA 1KAQA 2ZRBA 1HDZA 2D2EA 1R2QA 3KR1A 3OJWA 4PFSA 4PNHA 2N75A 3SXUB 3ZR4B 1G8MA 4HOYA 2AR0A 3S8MA 5A7GA 2GT1A 2UXBH 4BNLA 3S1AA 1RM3A 2VVTA 5KYXB 2COJA 4DRYA 2XRMA 2QK4A 1NVDA 3L7LA 5TARA 1W6UA 1IXYA 5IH7A 3HP7A 1EDOA 3FVWA 5SY6A 4PYQA 3RHSA 3U16A 2JA7G 2CBZA 3I09A 1Q0ZA 1OY1A 3QYPA 1VGVA 4J0FA 4PZDA 3ASYA 4LK3A 4TLDA 2XGGA 2QTTA 1VIYA 2I4NA 4JLPA 5EE3A 5EIHA 5HIJA 3P45A 5IDYA 4BJHB 2HDOA 1ENPA 1VRCA 4I99A 5D3MA 2IPNA 4DA4A 2NACA 3KQSA 3TZQA 3WLRA 4A15A 3KOMA 2X8AA 2Y92A 4FLFA 1H93A 4CKYA 1UH5A 3AETB 5E25A 1DWUA 4Q1BA 4B6RA 4BNYA 5E1BA 5CNJA 1JT2A 2VKQA 1YMUA 3L82B 3NRCA 4Q3BA 1FXUA 1WABA 3I2YX 4UEWA 4ZO7A 4CL2A 5KYWA 3G0HA 1C7EA 3E7DA 3B6JA 5DWVA 3HL0A 4EYKA 2VA2A 3A0RB 1MHPA 4BO2A 2PM8A 2YY7A 4F2DA 4G5OA 2UZIR 2EDAA 4YMLA 2CZCA 3AEUB 2UVPA 5J1TB 2B4TO 2R97A 3MR5A 4HQ6A 1L8AA 3JAMW 2QLTA 3GIQA 3H04A 4KMSA 4PZAA 2Z1DA 5KTOA 3CUYA 4TLMB 1HZZC 1SZDA 3F6EX 4JT4A 5CK5A 3SC2B 2Y76A 1CUDA 1KYVA 3I2GA 3C24A 3N8HA 2CUNA 3HWWA 4QBFA 4R7TA 2IX3A 3TQ1A 4EBDA 1ODKA 3R0ZA 3V8BA 1TZBA 3N1UA 4F8EA 1L5QA 4DARA 4PSAA 4HYYA 1KY5A 2FW1A 2PMEA 5HV6A 2AA3A 3P5BA 2QTVA 3SY8A 2GVZC 2J3DA 5B7NA 4X8OA 4PLYA 6GPBA 2XTJA 4G81A 2WG1A 4ZCSA 4GKKH 5TQ0A 2WJIA 3UJDA 2KPOA 2ZXEA 5GGYA 4DRXA 5BVHA 2RI1A 4MCIA 1T13A 2NUBA 2VJKA 5IVIA 1KDRA 2WJJA 2BEWB 2YASA 2HLNA 2YX1A 2VZ9A 4UCTA 4LOJA 3X2EA 2AU0A 1PO7A 2X1VA 2ZUVA 4ETNA 2OOKA 2C7RA 1COWD 3GPCA 3MWYW 1L5GB 1LEHA 2CNWA 4B0OA 3PCRB 3GJ4A 4EKEA 3WK7A 4D45A 3U55A 1ZH6A 5EYPB 3JVVA 4MQ4A 4FFPA 4BWYA 2XVMA 4EY4A 3V8QA 1GYRA 3I8XA 2HR1A 3T0IA 4IXTA 4JEIA 4CKXA 1JG7A 2VHWA 3T15A 4CQJA 4RMGA 5K8JB 4LDNA 1FQWA 1STOA 4J7AA 3AVXA 1T6BY 4E7OA 3K9HA 4YDRA 3DW1X 3NV7A 1FXSA 1U7ZA 1AA9A 4S1NA 3G8BA 1RI3A 4CZ2A 1EAYA 1YRLA 3GFOA 2PY6A 4BRWA 4XZ3B 1V2GA 1ADFA 3OTQA 3ZIAD 3GJ3A 4L8YA 3NBMA 4MQEA 1EBBA 3V9PA 4C89A 4ARVA 3OY7A 2J07A 4KPFC 3BACA 3RF6A 2MR5A 1J90A 4F4HA 1TCVA 2ZS8A 1XZAA 4J7XA 1EFVA 2AN5A 4MEAA 3RAQA 2VOBA 1KA9H 2HJRA 3GWGA 3HB4X 4BJ5A 2P90A 1AKQA 5KFRA 4GL2A 4QD3A 1BG6A 1V47A 4A2PA 1DTSA 3UH1A 4DR5B 3ZU4A 2V4QA 1G5RA 4BFLA 4WLVA 3IG0A 3PUXA 3RT9A 2WC1A 2Z09A 5JCXA 1DDOA 3HC7A 3HEMA 1LY1A 1PEYA 5CX1B 1JJBA 2HW8A 1GRQA 3GG9A 3P2YA 2B2XA 3NRBA 1LPAB 2NUTA 3PFCA 3JAKA 4FT4A 1VPLA 2QUZA 3B20A 2Y27A 3B12A 3D59A 3FGNA 4FBMA 4JV1A 4G8CA 3BCSA 3FX2A 4PAOA 2NOAA 3WL8A 5BSVA 4DR4B 4CMEA 1WW8A 3KT3A 2VHXA 5CNMA 2B63A 4JENA 3RWOA 1ZAUA 4QLAA 3UVEA 4F3YA 5B57C 2C7OA 3TSZA 3EQZA 3DC2A 4ZCPA 1N77A 1JVBA 4PC7A 1JDBC 3MR3A 5T5QA 1GPKA 2Q2WA 4BCDA 3ZCPA 1NF2A 5GV7A 5IDQA 4AMBA 3GGCA 1P6QA 2ET6A 3VBCA 1JL3A 4RK6A 4YUZA 1HT3A 1E2GA 2GAAA 2QLNA 2B0JA 3O1JC 4TSFD 5CCXA 3TINA 1SO8A 1MG0A 4WWHA 4ZQEA 3TLXA 4CF5A 3EZXA 1PGQA 3GEPA 1RRKA 2C98A 3PC8C 5D5QA 2X0SA 2Z4RA 3IAAA 5KAPA 1RWBA 3JQFA 3PXBA 4OAQA 4Q9NA 2WTEA 3W7VA 4DBLC 4PVDA 1DG3A 2CVZA 2ASEA 3UANA 1LBSA 5EJGA 5HJ5A 2YVKA 1FU8A 4Q5IA 2J9FA 1P3DA 2LTAA 2AHOA 3IHTA 5GY7A 5WRFA 4D1YA 4X8HA 5DSXA 3OTIA 4KWHA 5LQJA 1XZEA 4U7FA 5CFQA 4BV8A 1ZHSA 2IY7A 1GRNA 4DANA 5I7OA 5BR4A 3AFHA 2PU5A 10MHA 5FNZA 5LBTA 1VBGA 1CE8B 2WEKA 2ZETA 1SOWA 1CCWA 1AK2A 4FSDA 3RK4A 3LVQE 5C8XA 4QUHA 3P9CA 2P6RA 3I9OA 3W1GA 1EX6A 3IBGA 1BX1A 1O8BA 1KBZA 2XF8A 4RPCA 2GAJA 4TMVA 2Q0XA 4C0JA 1IBKB 4TSKA 2FRVA 3Q3JB 2P6PA 1KBQA 2EWMA 3EZFA 4B33A 4B84A 3A1NA 4YT4A 3AI2A 4B74A 2ZWIA 3LQSA 2UYQA 2J9FB 2NG1A 4WKOA 2Z43A 3G9XA 4AZWA 2JLXA 3HYTA 3TZ6A 1VSUA 4PBTA 3SXPA 2WSBA 1JSZA 4MA4A 1GGMA 1VRVA 1MB3A 3GFVA 3F6CA 2G71A 4DEVA 5CG2A 5A05A 3TEMA 2W7TA 5DI3B 4YUAA 5CTJA 1QK4A 3E5NA 5KT5A 2F62A 4AUKA 4ED9A 4F4FA 4LFAB 4AF7A 4L9WA 3BWXA 4U0KA 5DGCA 3ID6C 4LSXA 1E2QA 1T5SA 3Q41A 2HDKA 2NMVA 3PUIA 1P5HA 1SVNA 5HKLA 3SNHA 3EPLA 2I80A 3ZKWB 4ENTA 2ASJA 4NMMA 4RMJA 1TD1A 3F8TA 1KDZA 4HRAA 3LAWA 5EINA 1QK5A 4CF4A 4JT8A 4RNDB 4WKNA 3TI9A 4BFZA 3NAZA 1RWMA 3O8QB 1E32A 5EWJA 1THTA 1P5FA 3PKZA 3SIRA 2K2QB 2NU7A 2FFAA 2X9GA 5I9MA 5EHIA 4MVJA 1OPRA 1O57A 3HVKA 4DN6A 2L69A 4UEQA 3R0IA 1PZMA 3U26A 3LTEA 4RAQA 3GLHB 2VDNB 2Z30A 2XMZA 3L4KA 2EWWA 5ITWA 1A69A 1Q1BA 1XRSB 4KHPH 1GDHA 5BSKA 2W2LD 4Y9DA 1U7HA 3OEHD 3Q6NA 1OI3A 2B34A 2AL7A 5EJ2A 1E1YA 1L7AA 1J2RA 2VIIA 4M1KA 3VKFA 4A73A 4ETMA 1RXIA 1QG2A 3OUZA 4HZUB 2FWMX 1XZNA 5LD2C 2C2MA 3GJSA 1OU4A 4R8SA 4RZ3A 4YRPA 1E2EA 2W7OA 3GCZA 1Z3CA 4RV4A 5B2ZA 4Z6KA 5AOAA 1SQ5A 4B6PA 1N9KA 2GESA 2Y1GA 4M7WA 2FR0A 4R6XA 1GWNA 4YRFA 5DXAA 2B8JA 3F9IA 3MAJA 2HK8A 1OBDA 2GMWA 2MDTA 4GSKA 1MZPA 3HLKA 4LX0A 1YTLA 1DAMA 4D4HA 3ICWA 1X77A 2GCGA 4LMPA 2MCFA 4FZVA 4EHFA 1BIFA 5DIFA 2BD0A 3NGDA 1QC5B 2GR9A 3HKCA 4W63A 5JYBA 1JFFB 1NW4A 4RDIA 2I2XB 3G0GA 3UB2A 5LBIA 3ROXA 1KEVA 2BBTA 2XMCA 4WNIA 2AG6A 5JWRA 4DL2A 4BEBA 2CDRA 5C8ZA 2W00A 4B5LA 2CD7A 2X86A 2FPIB 1Z4QA 2O9JA 3PEEA 3RC7A 1MRNA 2A33A 3AR6A 3WGMA 5C46F 4DPKA 5ALGA 1XCGB 4WEQA 4DMMA 1CXZA 2QRKA 3N2KB 4IF4A 4K6KA 4ED8A 1Z8HA 4F5ZA 5C1OA 5I8PA 1CQXA 4IFIA 3PF8A 4Q05A 1Q44A 3AIMA 4NFHA 4Q3AA 3NS7A 4CG3A 2I91A 3DP9A 3T1OA 2VJAA 1N5JA 1UWLA 2AH5A 2QD2A 2M9MA 3HU3A 3O4IA 4UU1A 3AV0B 1QTNA 3LK6A 3NCTA 3PVSA 1I1HA 2ZJ4A 4ZI7B 5JHHB 1NULA 3ELUA 4LDRA 3WL5A 1QIJA 1YRHA 4JY7A 1FJHA 1FSZA 2O7QA 1XLTC 4GOMD 3A7DA 4WNAB 4AURA 4B44A 2PWAA 4U39A 4JLOA 3C7CB 3F6SA 3A7EA 3AF0A 1L7MA 3I83A 4QFMA 3O8OB 4M83A 1FSGA 2VPIA 5BQ5A 4AC9A 1F4PA 4DGSA 4RVNA 4H7DA 4ZXPA 5EJ4A 1O0CA 3U0BA 1Z5UA 1E98A 4ROTA 5EGNA 2R8ZA 2JBHA 3GTOA 4X93A 4YHBA 1AXRA 2WY2D 4BO6A 4HWOA 5A03A 5KC9A 4LSMA 5LMUB 4G1EB 4KLZA 3RGWS 1W52X 2NADA 3TLYA 1JZQA 3U54A 1GSIA 1P80A 2IYVA 4B6QA 3KD3A 2QVGA 1W93A 3IQGX 2WYIA 3CPEA 5ALVA 1KPGA 1YZFA 5JCPA 3B3GA 2VT6A 3DTVB 3RRNA 4U7CA 2OV2A 4UBLA 2BGMA 3LRXA 4G56A 2D2IA 3HWX1 1MBZA 1YQ9A 4WNAA 5JCOC 1Q1QA 4YHHH 2HRCA 1TYDE 3DE6X 3DZDA 2Y6VA 3Q8RB 3Q88A 4QJ5A 1U8FO 3THXB 3HV0A 4QUAA 2PU7A 1U0TA 1DBWA 1ECLA 1UMDA 1KVQA 3E9YA 5KYUA 3FDFA 5BW8A 4JV0A 3NB0A 2PNJA 2FSPA 5TEWA 1KJYA 5KYTA 3OQ6A 3ZWMA 1GM5A 4G6ZA 5J2TA 1J24A 1M7HA 1U9ZA 1QAQA 2ZU6A 4BVHA 3WB2A 2B21A 4OB8A 3TDKA 3QFSA 1DX9A 1W4RA 4QFBA 5T4EA 3UAOA 2HK9A 5BWBA 2ID4A 3C0KA 1E2MA 3D2LA 5TE9A 5KNBA 1C7RA 3RIXA 3B52X 2R48A 3IXMA 3UT5A 4ZTZB 2RJNA 4UU8A 1Z0JA 2HI0A 3QENA 3MM4A 3THXA 2GJSA 1UC9A 3CRMA 1U5AA 1BQEA 2PIDA 3EISA 5DYWA 4N49A 2I99A 5L3VA 1I4OA 2IE8A 2GPBA 3RO7A 4EYHB 4QRDA 1NXQA 1SKQA 3ZIUA 3VVLA 1VZ3A 2VBCA 4XQGA 4L27A 2GM3A 2QTWB 3OMXA 2VLBA 4APMA 1XCLA 2IBSA 2Q28A 4QUIA 5DM2A 2VQEB 1D0SA 2FRXA 3SYMA 4CIDA 3VUEA 3NXSA 3OZ7A 3Q8MA 1EXWA 4W5QA 2GD6A 1ZMRA 4XIGS 4BKOA 2O59A 4OH1A 5AKLA 1XMXA 1N5KA 3B5JA 4M7EA 4RH3A 3MQFA 2GUGA 3PGLA 1F2UB 4YJKA 2HJWA 3DYBA 5TB5A 5IXJA 4IW3B 3P26A 4MI1A 4OJKA 4OKIA 3E2PA 5K6TA 3JU3A 1AN7A 2HOQA 4Y67A 4HR7A 1FYFA 4PG6A 3Q0TA 3JZ6A 2WVJA 1ZN2A 4FD2A 4M8IA 4LHXA 3BJMA 4PU0A 4F5WA 2O8CB 3WO0A 1ETHA 4OEHA 3ZCTA 4CKWB 5EWGA 1CQWA 2W83A 4O4JF 3JWEA 2HA3A 2UKDA 4GOND 3P2JA 2OMKA 1P4SA 2YRXA 4L5IA 3TLAA 4YMUA 1JW9B 1M6VA 4KI7A 5AICA 1HDYA 5AI9A 4DWOA 2ZWAA 1OGIA 2PV7A 2VRBA 1D4ZA 5D87A 1U9IC 2AC4A 1D2NA 1VJ1A 4L5AA 2UYCA 4EP1A 3KDSE 3PHGA 3UG6A 4O4IB 5ANRB 1TUBB 4P4GA 2QRQA 1X7WA 4UU0A 3FNBA 4DUGD 2X3UA 1XU4A 1ZD2P 3TSYA 2FEWB 2YFQA 3TG8A 3LD9A 5E2AA 5KOHA 4WLOA 3ASVA 1EIZA 1HMPA 3H9GA 3AH8A 3I6QA 2UU9B 4DZTA 1J0XO 2IK8A 2ZXFA 2QIPA 2O8CA 5JNSA 4CDGA 3KUUA 1KMCA 4QICA 3ELWA 2WKWA 2Q4EA 2K5UA 2BZSA 5HZGA 2JD0A 3PNVA 1E66A 4XYMB 5M2QA 1GNTA 3W8EA 1YL7A 2H8KA 3OQ1A 3ZCVA 2EKLA 3LIPA 1A27A 2XHZA 5ENDA 1W4CA 3ZJ4A 2FWRA 2H1CA 1MGPA 1GKUB 3SJAA 4RWEA 1GR1A 1ZK4A 5EIOA 4TV9F 5BWOA 4NCIA 4PQEA 3I23A 2HVRA 4YAKB 4ZTUB 3KREA 1A04A 1CJBA 3QU2A 3W5DA 3EAQA 3WNQA 4G25A 5B30A 1YC5A 3P0RA 4QM7A 1EJ0A 3MQ2A 1UCFA 2G5PA 3G02A 3PQ5A 2N3ZA 1XFDA 3UW3A 5K0ZA 2WAQA 1L5VA 1Z0AA 1L4FA 4B6SA 2A6PA 3MCZA 3K6SA 4W5NA 4EPYA 3FLEA 3CVWA 1Z0FA 5B1EA 3THYB 2ZUEA 3MGAA 4IX9A 3IQZA 1Z0KA 5EP1A 1NVVR 5ADUS 2GFQA 4O8ZA 1MZBA 4QYIA 4CUKA 3BMCA 1FPQA 4F60A 4O3NA 2G70A 3N0RA 1MP0A 1YDWA 1B04A 3EXHB 1JIHA 1I36A 2B94A 4HPJB 3WS7A 3FWZA 5IU6A 4BZXA 3OIGA 1DBRA 2O1SA 1K75A 5ALFA 3T4XA 1GDTA 1DXYA 2VZ0A 1GTJ1 5CDHA 4MUIA 1H2YA 4K3UA 2C1EA 3TRHA 2BFPA 2W2KA 4EA6A 2ZB8A 1CNEA 1ZIPA 5DVZA 3ZVKA 1KRXA 4BZPA 4CCSA 3O8QA 2E7ZA 2JGEA 2NLOA 1T5LA 3SBOA 2IV7A 2A5YB 4H77A 1FC0A 2J9ZB 3RREA 3U9LA 2PX8A 3OPQA 1USKA 3KKZA 3UT6A 2J7PA 3BBPA 3BMQA 3VR4D 2ZM6B 1TB4A 4RHFA 3UY4A 1KR2A 5F9FA 5ICMA 1AD2A 3GUHA 4INZA 1EB8A 1KVTA 3T0GA 5JTTA 4EUEA 3EYAA 1NN3A 1QGYA 4RKYA 3H2SA 2I3BA 3MXOA 5P8WA 5FTJA 2HYDA 2I3AA 2PJUA 2DUUA 4PYMA 3WZ2A 1KARA 2CCJA 1E0JA 4MA5A 2C61A 3AZPA 5BQXA 1AQLA 1ZCBA 5K03A 5KVVA 4C88A 1AC5A 2R2AA 3AIOA 3A9TA 2FZWA 4ECXA 3O8LA 4PS0A 5J2UB 1EHYA 8MHTA 1APBA 3VI3B 4PGHA 1QO7A 2OHJA 3CWCA 3MT0A 2PE5A 4FIDA 2OYSA 4UPEA 3COYA 4S1WA 1ZIOA 4BQEA 1HPLA 4MR7A 3ZWKA 1RYZA 3EVFA 2YXPX 4B3HA 2H7XA 4D9FA 3PLAE 4QBKA 1WCIB 3EGVA 1SC1A 2A0KA 1ACLA 4KSYA 3EIEA 4QFDA 1FFXB 3AJDA 1AU9A 2IBMA 4M21A 3ESCA 3ND5A 5CFZA 3K1AB 4MUKA 2XBMA 1E3JA 1FS5A 1CZNA 3A2LA 1M6NA 7MDHA 5KJ1A 3SQXA 3CZQA 5CBKA 2HU2A 2DBZA 1R00A 2OXIA 1FY2A 4AB1A 4JOBA 4HN4B 3JR7A 2P9HA 2O3UA 3ZWCA 3TBHA 4D96A 5JDCC 1USUA 2GUWA 2VAMA 3M9MB 3ZZUA 4P1ZA 1NW3A 3NKVA 4N40A 5DN9A 4EHAA 4MW1A 4TTRA 1BGWA 1M54A 2WWFA 1LTKA 3RSCA 1NFRA 3PI6A 5BV7A 4U6QA 1ZJ4A 1ZMTA 2W8BA 1TLTA 2QX7A 1WSAA 2ES4A 3EPRA 3KWMA 4I5FA 4QQFA 5EJEA 5I7SA 2IHKA 3R0QA 1DAPA 1KK0A 2GWHA 4GOLD 1RVDA 1RZUA 3KTMA 2ZCUA 1VBNA 2AR7A 3P9ZA 2QRZA 2FQWA 3RTGA 1M67A 5FTNA 5TV2A 4Q12A 2XIJA 4I66A 1I7PA 3DR5A 4J9SA 1XZHA 3ESDA 3K2IA 3OIFA 1YZUA 1B2LA 3B7PA 3DV0A 3IPCA 2YH2A 4BQPA 2I8LA 4KQ6A 3EDRA 3IAEA 3K94A 4AMGA 3L5OA 5AKGA 5IAAA 1S4QA 4TV8B 5KS8A 2XYHA 4OBWA 3H0GA 4HDKB 2X9QA 1CUVA 2D4HA 2QX4A 3FFWA 1FP2A 3TZKA 5IT0A 2BDEA 4IDBA 4JXUA 5E1DA 3ZD8A 2HRDA 1WDMA 1MVLA 4GW3A 1EM8B 1U7OA 4HH4A 4BKPA 4YAGA 5LOVB 4U4AA 3W5VA 2PAFA 3T5TA 1NNSA 1PVDA 3D8BA 3ZOZA 1G7RA 4IP0A 3L84A 3BUSA 2O7NA 2ZVDA 3L4BA 2IUTA 4MWEA 1DQNA 2G08A 3LA8A 3NLLA 1Y9DA 3PGVA 1BXRA 1F1JA 1L5MA 3TLEA 3QJYA 4Y1EA 3IQFA 1VA5A 1XZCA 4E11A 2ACEA 1YQQA 4M2LA 1POWA 5KPDA 3S2FA 5A5GA 5GWXA 1HC7A 3RARA 1NJ8A 2QMYA 4JJZA 4AYXA 4U2GA 1N1MA 4EQ6B 4JI7H 5H3LA 5KTKA 2C2OA 5FWAA 3CJRA 3LA6A 4W9RA 2H92A 5ECWA 1UQTA 3LQ1A 3EUFA 4GX2A 4P5PA 5GJVC 3W04A 1E9FA 3GFTA 1W85B 3NOQA 3DULA 4AJPA 1EQ2A 3QHPA 1CIVA 2BBOA 2JHGA 2V59A 1KI2A 2PLWA 3TRIA 1J7KA 3P9KA 3PITA 4TLAA 4BEJA 4CYMA 1W36D 3DBHB 3VJRA 2YMQA 2K6GA 1EWVA 2GZMA 1YR1A 2VQ6A 4ZHSA 2PUFA 1FMCA 4ND3A 3BGDA 4JMPA 2VDRB 1GTVA 1OXBB 1N48A 2YHSA 1X7YA 1NTOA 3JZIA 1LXCA 1QKIA 2HEIA 4ZV7A 4F86A 1QIKA 2FN7A 4MLPA 5C4GB 2QN6A 3QFFA 2XF2A 2FP4A 3BTUA 4WY8A 4D3SA 2CKMA 5LKRA 3HKEB 4BN4A 5B4VA 1QHYA 3S40A 1CZRA 2FWIA 4D0GA 4C4YA 1C3LA 4WT7A 1TIKA 3R9RA 4EG3A 1GAJA 4RXMA 2OB1A 5EWMB 2W7PA 2V4ZA 3HXQA 5CA1F 4A10A 2VAVA 4BLWA 4LTMA 2VK2A 2XTMA 4RIFA 1K8YB 1UOQA 3OZIA 5HFJA 3TRJA 3TSWA 4CV1A 1HG1A 4G0NA 1Z35A 3O2JA 4JQZA 3V1MA 2PYDA 1TCBA 1J1IA 1E3WA 1YS9A 2BR5A 1O08A 2OESA 3PDHA 3C8DA 3QG1A 4D92A 3UG7A 1EB9A 1YS7A 1T2DA 1C9MA 1X15A 4Q3KA 1IWBB 4LNAA 2PH5A 3LNTA 4YUVA 1PWZA 3RAPR 3AI3A 4YR9A 3D9QX 5C8VA 2E0IA 1EK6A 4EO9A 4U8HA 5DN6A 1EESA 1OLSA 2ZBVA 3U09A 2VN8A 4O59O 4O4IA 1KSHA 1RACA 4UATA 4NG5A 2XMQA 1WW3A 5KC8A 3FB1A 2VC2B 2ZAGA 3GFFA 3PRKE 3PHIA 3WGKA 4O7ZA 5KSZA 4PTZA 4H31A 4J0IA 1E2DA 2PH1A 2BCEA 3L4JA 3AG5A 4N5IX 1XQ9A 5H59A 5K3FA 4EI7A 1TEXA 1TO2E 2CEKA 3INGA 3L0CA 1FJGH 2FQ1A 4JBNA 4M9SA 3IAS6 2OAGA 4ZVTA 2IKQA 3ZQUA 3DDSA 3SM9A 1RIFA 4RCNA 3HGQA 3WGYA 3TXXA 1F1BA 4U9IS 4O3QA 8AT1A 2FWAA 4RPGA 3O47A 3KUDA 3UJ3X 2WIAA 5GM2A 1IUPA 3UA4A 2JIDA 2Q1YA 1T8PA 1SUPA 1W9MA 1GADO 2MINA 1L1QA 1T35A 1JDZA 2G6TA 5EEHA 1HQCA 2OV6A 3KEQA 4HJXA 5AP9A 1E63A 1OZAA 1QGZA 4I4TF 1UBUS 3P2KA 2C2YA 4NBTA 5BW5A 4R40A 2OCPA 2DABA 2HJSA 2FAXA 2PFGA 3LQ2A 4TMWA 4A9AA 4D25A 1QRUA 4NXMB 4LF5H 4G07A 4H1TA 3D3KA 1FB5A 4X1YA 4BVBA 1ZXXA 4JYBA 3C7DB 1FW8A 4C0QC 2E18A 4E5NA 1NQXA 1JNXX 4JUFA 2DERA 3V7UA 3HFJA 1KEPA 4HNHA 5KVCA 2ZQ5A 3F7MA 1RR6A 2LKCA 3DL4A 3OM0A 4PZ8A 4JV2A 1EDBA 2OWOA 5JQWA 1A77A 1NATA 1VKZA 1TVMA 2J3HA 2R8BA 4BQNA 1NU6A 3X1KA 5D85A 3UFXB 1P29A 4L3OA 1XYGA 1M5UA 1SBHA 4YRTA 3AHDA 4KVAA 5FA6A 4H17A 4KPEC 1EVJA 1ZVQA 1HLGA 1U2RA 2VCYA 3BTOA 2RIPA 3BB1A 5EMMA 3CZAA 3PDIA 3U2QA 4OYHA 2HXSA 3L0OA 3BGWA 4JBYA 1UEJA 2C04A 5KPJA 2HHHH 3RYHA 1X14A 3AOEC 2PSJA 3GYBA 3ICVA 2V9PA 3KYBA 4EW2A 2ANCA 1U8YA 3KTDA 3WK6A 4S12A 1U8AA 4HC4A 4CC5A 4ITVA 5BV8A 4N6OA 2QM7A 4IZ6A 1SOAA 3NJRA 3ROEA 3GTJA 1T5OA 5JALA 4EY8A 3KZXA 1KTVA 221PA 2NZ8A 4UHDA 4YQWA 3N8NA 1W4ZA 1EKXA 1JUDA 5JBNA 4LJSA 4B7XA 1B8NA 3PPWA 1RTTA 3F8NA 2AI1A 4AY4A 2RGUA 3GB8B 2KI5A 4QGSA 4PO8A 1B26A 1Z5WA 3ETCA 3MMSA 3KAPA 3I64A 3T1TA 3I0MA 3KELA 1LBEA 2E4XA 2JHCA 1ZAYA 1QVAA 4HNQA 3SBDA 4CNBA 1K5HA 1N3LA 3LCMA 1ZQ1A 4HH0A 2O3SA 5K09A 4HGNA 4PZLA 1B0ZA 3ZLVA 4QPPA 2CXQA 2CFIA 5TR9A 1JIKA 1UWKA 4H7PA 1F14A 5CDTA 4R2KA 1EP3B 2IOHA 3DOEA 1JLSA 1QGAA 3DVAA 1G9SA 3C2QA 2YZ2A 1XLWA 3L02A 3LHFA 4RM3A 3KTOA 3V6MA 4BX2A 3E22B 2OG2A 1RFLA 1NP3A 3EVBA 1U2GA 4BUZA 3PQ8A 3TOZA 2BFDB 4B8ZA 3ZNNA 1HNZB 2UAGA 3A0UA 2XCTB 4WOKA 4FLMA 3K70C 3MJ4A 2C7VA 2LPMA 5IJ0B 1P8JA 3BJEA 5DE3A 3CGGA 3B3QA 1M34B 2BM8A 3F98A 4WN9B 4HHEA 5E4JA 5T8KA 5MDHA 2DQKA 3I6BA 2WF5A 3N8GA 2VUIB 4A8JC 4M8SA 4JA0A 3ZKAA 1DC7A 3NHPA 4YAKA 1UJ5A 1QAMA 2RGNA 2ATIA 1UKZA 3N76A 1BD4A 4OATA 3U1TA 3ESXA 4MWDA 4PLFA 2JEJA 5ESDA 5FLKA 2CLSA 2X0JA 4QO7A 4AJOA 2PTGA 4KG7A 5CR9A 4BXOA 3PVCA 2BHTA 1C80A 3NBZC 1JDVA 4OJQA 4Z5XA 2IU0A 1HF3A 3TF5A 3Q9LA 1V8FA 4IRXA 3CKMA 5G2OA 3PXXA 1Z6AA 1B8UA 3C4QA 2HRQA 2IRWA 1XU9A 1FLDA 1IQPA 2BQUA 2HA6A 2J67A 5E4TA 4EO4A 4GOKA 3RM3A 3A9CA 2DSNA 4GEGA 4WXEA 2TMYA 3O82A 1PZGA 3OY2A 1HDEA 1DIGA 3H13A 1M6WA 1ZCJA 2PL1A 4XIYA 1AHPA 1ZBDA 1GGHA 1TW3A 5FEMA 3LVFO 1FJXA 3ET4A 4XCXA 1IEXA 3WQBA 2GM4A 5HS6A 1X9IA 3A3NA 4JJGA 2DHDA 1LV8A 3WAJA 4DR3H 1NSTA 3B85A 5CEFA 3S8EA 1G6KA 2QQGA 2PUAA 3LUHA 2PR2A 1Z28A 2COUA 1W9HA 3DP7A 1GNLA 4CCWA 3RAEC 3G9TA 3PUJA 1K89A 3EGEA 2Q4OA 3KVOA 4KQWA 4QXMA 5J5VA 2IGBA 1CQIA 2QL5A 4O08A 4C30A 2QJOA 2XQFA 1RDFA 3CN9A 1Y9EA 4ME6A 3HUEA 1XAHA 4JSYA 3MCWA 3V33A 1UKAA 2FW7A 4C0WA 2NU9B 4FOPA 3RUHA 3K0SA 1E1LA 4OHCA 5KDDA 1NUPA 4Q43A 3C3WA 3PD7A 5LOVA 1U3GA 2QN9A 3D8NA 1MX3A 2ATXA 3FB4A 1RWKA 4D97A 2A1UB 3VUFA 5LMNH 3L9WA 4K46A 1WR8A 3CW9A 3KKNA 4QPDA 1GGEA 4R1LA 3KU1A 2YOHA 3SVTA 2AXNA 1KXJA 1TVEA 3F96A 1PU2A 3ZVLA 4TTSA 4M60A 4YCCA 1USWA 2OV8A 3KTAB 4IRMA 5FOUA 3MWEA 1QONA 1WSWA 4DBLE 4YRGA 3ZE1B 1ZAKA 1YDFA 3JYQA 4LI0A 4P83A 4YJHA 3UOWA 3W4IA 4JELA 4LJ6A 2WU3A 3IQIX 1WHTA 1I1LA 4MEBA 4Q01A 2QEQA 3LHDA 4KO3S 4GPD1 1XN1A 1UBEA 2GNAA 1KO7A 4Y2RA 4RIEA 1UMCB 1ZJJA 1C7JA 2NU9A 1XDGA 1BXKA 4IMIB 4DJAA 2VA3A 1GD1O 2FA9A 4URZR 1TEHA 1W0JD 5CT4A 4BNXA 4RYLA 3UWPA 2FI1A 1MR3F 2GPNA 4K6OA 4HH1A 3NYIA 2IP4A 2A9JA 4YP5A 4J9OA 3VKUA 5HNKA 2WHPA 3VBEA 2BGGA 2FW0A 3VGJA 3G17A 5MF6A 4DVJA 1VI6A 1RYBA 4QPJC 5G3ZA 4RM2A 3BGSA 3CF4G 4YHHB 3PYMA 3DXZA 1B6TA 3H87A 1CD5A 3LHIA 5B6JA 1BWPA 4EG6A 1F7VA 3TIVA 3PEFA 1YQTA 4DLBA 3U1BA 1R4NA 2F3SA 3C41J 3IKMB 3X2FA 3M33A 2FQQA 3ND7A 1L1RA 1O94A 2CKDA 2LCIA 5LDHA 1GG5A 3EGOA 4IOKA 2AD5A 1RHKA 4IKOA 5LZ8A 2C00A 4TM5A 3G2KA 1KK1A 1ZL2A 4FE3A 1P2VA 5CAEB 1Y4AE 3FDXA 4U9HS 3GRZA 1LDMA 2Y9MB 3AFNA 4LDJA 2KM1A 3O73A 1BFDA 3WYAA 1T25A 1PBTA 5EKXA 2QTHA 2VDJA 4GWKA 3D0KA 1W59A 1FLAA 4YRIA 1LQTA 2MT9A 1SXJA 4GGMX 2ODBA 4LXYA 4NESA 2LDXA 4OX9Y 3ILSA 3P9SA 4JYCA 1V1RB 4U7PB 4BDTA 3C3EA 4ZAZA 4BBSG 2FCRA 2J0EA 1KQFA 2JIMA 1WV1A 2Z6QA 3GJYA 1OBFO 3AHIA 1LV7A 1L9XA 3Q85A 1BD3A 5HIIA 5HM6A 2GB4A 3TZLA 3T5AA 3U61B 3RUAA 4UOEA 1FQKA 3M8KA 4FCTA 2PUBA 2PV0A 3H83A 4RTKA 4KPUA 3R7FA 3UV3A 2J87A 2AOUB 4J49A 4WTOA 2R96A 1XA0A 3IELA 4B7ZA 5K0FA 2Q3HA 2A3NA 2YIDA 4YDHB 5JNWA 3TR6A 2H57A 4XQCA 2UXCB 3OQHA 5IEBA 5CH8A 2Q5IA 1FUYB 3V1LA 5AW5A 3GZNB 1KHHA 4JLJA 2HKIA 2PKEA 4MQFA 4UMVA 1OXVA 3LPAA 3MTGA 4NP6A 5FNVA 3VKWA 5INTA 4BASA 5C81A 5FWYA 4Z4GA 2AKEA 3KJNA 2E1PA 1SELA 1PJRA 4GBED 4BFCA 4FOTA 2PWPA 5FUMA 5F3WB 5CDFA 2IXDA 2PGAA 1W88A 4V0QA 1EXDA 4WA8A 2JIOA 4BPRA 1H2XA 4E32A 1HYQA 2GXUA 2PRYA 2I7VA 2C82A 3TYXA 3IRVA 1AZTA 4ZMBA 5CDGA 4B3XA 5BN1A 6YASA 1PK8A 5FPSA 3NHUA 3ZN2A 3OQNA 4P53A 4WFKA 3CEHA 2FLKA 3OJ0A 1VLJA 3COWA 4IV8A 1GPH1 5DBFA 3KL4A 2C20A 4JT2A 3KV3O 4LVNA 5GIPE 3ITDA 1PT6A 4M1TA 1Z06A 1OAAA 2R86A 4A2CA 5A1TA 3P2IA 2RKBA 3H4VA 4OHBA 3TFWA 3NHFA 4XWKA 3ZGNA 3VYVA 4JP5A 1MH9A 5ALDA 3FE2A 4HDAA 5AUPB 1PRYA 2XTAA 1PR4A 1NY5A 1UZAA 4OSEA 3TZHA 5IWCA 5G53C 1KH3A 1EFVB 2YZMA 4HFNA 3V9AA 1GA6A 1NRWA 1KO8A 4D9IA 4QGHA 2OCLA 1VPWA 1KFJB 1B1CA 3I9JA 1OFIA 3LGAA 2NM0A 1RZ3A 4IDCA 1QS0B 3DWGA 3O4VA 3I37X 4QDTA 5BSRA 3BK7A 2CUKA 2TYSB 4YREA 3G6VA 4EVRA 3NEYA 1ZU5A 2WIDA 2ZZNA 2D2XA 1ECJA 2W98A 3MFYA 5G4LA 4EBFA 2VJQA 2ZEJA 5EQDA 2Z2YA 3T6KA 4XJVA 2BUBA 5KOYA 1QVVA 3PEYA 2EJ2A 3RAFC 1CKNA 1AG9A 3JVDA 4JP1A 2ALZA 1S9FA 2G1AA 3AQ4A 3AYXB 4AJJA 2B36A 1YKGA 1CQJA 1VXRA 3SHOA 3H0GG 2PD6A 4UVIA 3U3XA 3O6VA 4OHMA 4YXWA 4BLOA 2IWRA 2Y0EA 2NNWB 2QRNA 4Q9JA 1E0SA 2YUIA 2RB4A 3DE4X 4PO1A 5EZSA 4IG4A 4RVSA 4R9NA 1H9BA 1FUUA 2PGNA 4JC8A 3WGNA 4W9NC 4S05A 4Y9TA 4J9UE 5FFNA 4YMSA 1DAGA 1K7EB 2C4HA 3I53A 4OOEA 1QQBA 4W8HA 2OBBA 5FP0A 4RACA 1T34A 4X6XA 4EGCB 4JU9A 4FZ3A 4AXBA 1SCUA 4A3FG 4H0FA 1C8VB 2IP2A 621PA 5L6MB 2RDJA 5IWAH 4MIOA 2D7DA 1X80A 3LKZA 3IVAA 5BN3B 3ZE6A 5K3OA 1W88B 1P0FA 4FE4A 4MGZR 2Y71A 1XD2A 3DOJA 2LRHA 3FPAA 3QKWA 5DB4A 4Z49A 2VWGA 2TMGA 4F4XA 1IJKA 1Z4KA 3GRVA 3QPAA 4U6NA 2DHRA 3X1MA 1EBUA 4FP9A 4GI1A 3EPGA 4BVEA 5JE8A 2JLVA 3COZA 1YD7A 5EZ5A 1JB9A 4RTLA 1TCCA 1ES9A 1FDUA 3RRMA 4C07A 3DMGA 5CLGA 2KLBA 1UEIA 1UDAA 1D5WA 4XX1A 2VDQB 4RXUA 5HUQA 1GG2A 2RHGB 3BQMB 3GHHA 2ZE8A 3WB0A 3DD1A 4BVKA 1LDGA 4WASA 5LMCA 3INYA 3D54D 3PX2A 5AW2A 1C7FA 1J8VA 3LCUA 2ZM6H 1H5UA 3L4BC 3OQBA 1XXHB 5FI1B 4RIIA 3JQGA 2PVSA 3BRQA 3O8CA 5C8YB 4E6PA 2Q2NA 5DCWA 3E0QA 3ZHXA 2RHMA 2V6JA 3SX0A 2Z5LA 4NDNE 5KAMA 4DCTA 4CUZA 4JFAA 3FVQA 1MB0A 3C14C 3KG2A 4JROA 4DR1H 2E9SA 1YS1X 4W5HA 4WBXC 2BFNA 4R4JA 1OFUA 2Z6AA 3N0TA 4ECVA 5ICEA 3W5BA 1NR5A 1HFWA 3WBJA 3QELB 4O63O 5K0GA 2OUIA 3SLGA 2AWOA 1EQUA 1WJGA 2AJDA 2BFEB 3ESYA 2C84A 1SKMA 3AVPA 5ERXA 1CQJB 4HXYA 2FEPA 4FR2A 4OHKA 4YFVA 3AO0B 2WPDA 3QUAA 2JLCA 3UYYA 3W7AA 2O19A 3JVUA 1WAMA 1U6IA 1T26A 1VE3A 1QIIA 4QT0A 4RL4A 1QWOA 5CK4A 4H08A 1R9NA 3UA3A 3W2GA 1HWYA 2Q6TA 2EQBA 4N9QA 4DPMA 3GCXA 5K1ZA 1BMFA 2VUSA 1GILA 3BMNB 4GE3A 1KGSA 4G5YA 2JAUA 1F8XA 4XVCA 2WJ3A 1VIVA 4IIDA 4KV9A 1RWQA 2ZI6A 3TEJA 3OX2A 4ZQGA 1IAVA 3BX1A 3IQWA 2VAWA 3AUXA 3UMVA 1TI7A 4ONEA 4K6HA 3DLIA 4LYFA 1JALA 3HWRA 2RK3A 3DT9A 3I2HA 2EJUA 3Q6MA 3HLTA 3G5LA 3YASA 3IERA 3IHWA 4JL8A 3B9RA 1GZSA 3L6CA 5IW8A 1AQNA 1T9GS 5BN4B 1WDKA 1U8ZA 4Z2AA 2J0QA 2ZIAA 5JQGA 2HPHA 3KFVA 4OSOA 3CF0A 2F3TA 3SZOA 3EXEA 1E3MA 4RESA 1XMSA 1PQPA 5G4KA 5BW4A 4LUCA 1E4EB 1URPA 3DEJA 4AG6A 4S0ZA 3T1VA 3U40A 1CVLA 3VR6H 3I42A 3IILA 1GQYA 5EP3A 1HTWA 4GDFA 4U3JA 1NDUA 1OROA 1U0GA 2QDXA 3CZ9A 1WUYA 3FNGA 3QPDA 2UYOA 1W0CA 2RH4A 3Q7EA 2HGSA 4RABA 4NMXB 3RU3A 1YF3A 3GRKA 1QVRA 3S68A 4BEWA 2Q07A 1J8YF 1UC8A 3JYLA 3EPJA 3O3MB 1K1QA 3IFSA 3OPXA 3QIVA 3B9PA 3D7RA 3QBVA 3QYFA 4JAVC 4M38A 1L5LA 3TQTA 2GM9A 2OHGA 3IBTA 2IJGX 4CMAA 3DD5A 1E62A 2GASA 3PE3A 1NU8A 4RGQA 3SG0A 4TVIA 1E4YA 4EBCA 1W0KA 2HQOA 1NUTA 3SNOA 1U6JA 3W90A 2ONCA 3UPDA 1U2ZA 3ECCA 4R9VA 1UFQA 1D0IA 4YV2A 5KHOC 3K5WA 2WD8A 3WHIA 2OYRA 2VDWB 3N2EA 3WGQA 5H81A 1A98A 2GXAA 2VYNA 4NMWA 3T3EA 5J43A 3GIDA 4KNYA 1UL1X 1VKHA 3HKEA 3WV4A 4AMYA 1BMTA 3K32A 1KGDA 4MV8A 1LS1A 3G2NA 1QLHA 4HS4A 3EW7A 3G0OA 3RANA 1U9IA 3MS4A 4D9CA 3D6NB 1CKEA 3DDOA 3EGXB 1K2WA 1GFIA 1X7YB 4FYWA 2FPWA 2ICAA 2JS7A 3R7DA 4NE9A 3TD9A 4BPBA 4PYNA 4D4LA 1N5RA 1FL9A 3JASA 1PJTA 3M34A 1L7QA 5SYMA 3TOCA 4BNGA 4ESEA 5CDSA 1P7WA 3WYNA 4ZGWA 3VR5D 4NS1A 4E5PA 5BURA 2I5PO 2XYQA 2OZKA 5CVDA 5J4YA 1FVXA 2UXCH 4IUDS 5L4SA 3ADKA 5F23A 2GBPA 1AUQA 5F4ZA 2W71A 1WXXA 5DLGA 1U8TA 2XB4A 3A1EA 3GJRA 4RJKA 2LCQA 2X0EA 3CLUC 2VSFA 3BS4A 4UQOA 1X74A 2J31A 1HDXA 3L8EA 4RA9A 3WYBA 4ML3A 3ILHA 2B9EA 3QBDA 4HQ0A 4XD2A 3Q8QB 3CLTC 4BBZA 4GMXA 1SCKA 1SNYA 3ET5A 5G0WA 2JF0A 1Y8ZA 1MZVA 3RRJA 4RHXA 1VRWA 2JFBA 5GONA 2AYXA 1ET0A 5DXJA 4HNSA 3KAQA 4RAZA 3VHQA 3KQPA 4BJ1A 3ZHTA 4E51A 4NYIQ 3DTVA 4G0ZA 2FSVA 2RC5A 4GYJA 4JR2A 4CHGA 5JPDA 1Z8DA 4AYBE 4ECRA 2JCBA 3ESRA 3A1UA 5JY1A 5ALPA 2V45A 1LTHR 2JHPA 2GO1A 3DOUA 3TZEA 1NYQA 1G7SA 2TMDA 1YVDA 3FPBA 4FQ7A 1E99A 3HNRA 1CY2A 2W6OA 4KQJA 3KQKA 5BWNA 5C0OE 3EZLA 4BFVA 1N6IA 1SC9A 2HL6A 3OTGA 3RIZA 4ZC1A 4TZKA 3PC8A 5FDFA 3FPJA 4QLBA 1MAHA 2ZPUA 5LM3A 2UVVA 5MFZA 4DL6A 4M4SA 3QVVA 1F6DA 4BNVA 1NXXA 2V7EA 2QVZX 3KVYA 3G0BA 3LZ6A 4GMDA 1Z2OX 1G0OA 1V8DA 4TVOA 3W2FA 2NQ2C 4E5SA 2JGDB 1PR9A 1R5BA 3GN2A 1IJEA 1FYVA 3ILVA 4IILA 3ST7A 4J07A 2B83A 3S4YA 1YK0A 5I5GA 2B8TA 3A6LA 1DBIA 1ZGAA 3HOYG 3W1VA 4ECYA 4UTOA 3WBBA 4DPLA 3CLUD 1BVRA 3UEOA 4BFXA 2X77A 4FW8A 1BCRB 4LTNA 5EKDA 5SYNA 3ZTYA 2NYVA 4K0KH 3WKEA 2AN9A 4IOLA 3TL3A 4QLOA 2PL9A 3O4FA 4FDVA 5F1PA 2PCJA 4MW9A 4BFYA 1OI2A 4A8JA 2I1QA 5JMTA 3FWYA 2FPGA 1ZD3A 3FZGA 1U9YA 2EJBA 4UJ5A 3RRXA 1KUTA 3GCWA 2HCRA 3L5KA 2OORA 3TQQA 2IEIA 4D4IA 1SBYA 3FOEC 3TW7A 1IJBA 1DAIA 4HRVA 4JUZA 5G41A 1ORIA 4MVXA 3FCXA 3I9FA 3SEFA 3GFRA 4LYHA 1CJKC 3NBZB 4NCJA 2TECE 2ZJBA 3TI7A 1J22A 2OL4A 3V2HA 2OAP1 1JFRA 1Y1QA 2DPGA 3OFVA 2QX6A 5LA6A 4FFOA 3NO4A 1Y9AA 1FYXA 3ORRA 1Z5ZA 2BM9A 2FTKE 3AFGA 3QXJA 1ONBA 2M1XA 4UMDA 1VI5A 1GQSA 4HNTA 2GN9A 4IGEA 4Q4HA 5SZKB 3N42B 2IKSA 4G63A 4EF6A 2B98A 3E1SA 1RHRA 4OFBA 3V4VB 2Z8XA 1A5SB 1CY4A 4M0CA 1BXGB 2GS9A 3DUFB 3ZV4A 2CJXA 2QW8A 2ZUDA 3SHTA 4CKBA 2NXEA 1M1YE 2VJMB 4QDOA 4DHEA 4XM2A 3EPIA 2WZDA 5E6SB 3OJCA 4DLRA 1I24A 5FPPA 1NG9A 4Y2XA 2ZCJA 2H1HA 4LF8H 1QQ6A 2COIA 2I2AA 2MJLA 5EJIA 1Q0LA 2XUFA 2ORED 3U62A 4XWWA 3QF4B 1HR0H 4FE7A 1ZH0A 4FNAA 4KXXA 4A3LG 2QTNA 2BFFB 4RNMA 5KVQA 1Y8AA 2I1LA 1E9RA 3NRJA 3RT1A 3SYLA 1KNXA 1UJ4A 2ZRAA 2AMJA 2EZ8A 4DM3A 4FHGA 1UDXA 4H15A 4Q9IA 3LY8A 5TJ9A 1EGAA 1BW9A 1L4GA 1WHSA 2WM8A 4U8GA 4GF5A 3SYTA 2X1MA 3UJBA 2ZYWX 2I8CA 2Q6KA 5J3JA 4K8RB 1GPAA 4OQZA 4HEA1 5A6SA 1IB0A 1UANA 3PUWA 4X20B 3VDMA 4X0EA 4NQZA 5C8YA 4C0BA 3RTXA 1WXWA 3PT9A 2P0AA 4M0DA 2FLNA 3RF2A 3BH0A 4L8VA 5LZ5A 5DISB 3BULA 4X44A 3M4JA 4IGIA 3JYNA 5I48A 4X97A 3R75A 3BHIA 4CJXA 1N5IA 2IYPA 4KQHA 3CLSD 2YXLA 4JQOA 4K9QA 2KE5A 1R10A 2CFCA 3HY3A 4LV5B 4W1RA 2D5LA 3A3KA 3UATA 2J0SA 2YMLA 1P1IA 3MGKA 3W6OA 5BR8B 2B4KA 3EVNA 3O38A 1Z6YA 3HQ4O 5BN5A 2B3DA 4JI0B 2ZRGA 4OHYA 4QM6A 1J42A 3ICOA 1Y98A 1Y8CA 4GC9A 4MRMA 4U00A 3UHPA 1NSFA 1QZZA 1VIMA 3GRYA 2IH5A 2BFBA 2E55A 1TXGA 4XEHA 3LDAA 5AMXA 2W90A 4Q4AA 4X66B 4PWZA 3N2ZB 4LECA 1LPMA 4I55A 3LT0A 5LQAA 2DC1A 2VDKB 4LC0A 4R2XA 2HJGA 5MN5A 4IS3A 1ZD5A 1RLMA 1N6LA 3FAKA 3HY4A 1YOVB 3F6YA 1DAKA 3QWFA 2QRVA 1QE3A 2ZUTA 4E15A 3QJGA 2NYAA 4ZU6X 1SKBA 4GT1A 2Y1EA 4MNTA 4WK4B 3PZPA 1ZITA 5JPIA 4RB2C 4RK7A 3OFJA 1DTEA 4KYUA 1R16A 2YZKA 3BFJA 1SVOA 1Z29A 2GARA 1KKMA 1RAFA 3D0RA 5FBZA 1ZUD1 2YVQA 2HA4A 3ESQA 1ND6A 2IP1A 5DT2A 1Z0DA 3DQQA 3B2NA 2OLJA 3LC0A 3UPTA 4Y9SA 4Q6WA 3UQZA 2PJRA 1I2MA 1ZOPA 5E4YA 1NW8A 1UZLA 4FEGA 2VRWA 5HKAA 1HLDA 1T36A 2W2PA 3AEZA 4HDSA 1V4VA 4P32A 3HCNA 1A8HA 3K53A 1R64A 3T5JA 2PUVA 1FBTA 3CN7A 4KWEA 4BQFA 1PV4A 3ZC3A 2VHZA 2QTLA 3RIMA 4MS3A 2C94A 1L7DA 2FJPA 3QY0A 4JQCA 4TQ9A 3SYNA 4LXTA 3A11A 3VOBA 4AZ3B 5CVVA 1PVOA 3PLRA 1JT9A 2VUUA 4A6EA 5EWLA 3EF1A 3RADC 4BMNA 3U9SA 3U48A 1PSZA 2G77B 4GPAA 2H8GA 2QT1A 4ROSA 1P91A 3FLBA 3TX6A 3KLBA 2CZGA 1SPBS 3OTWA 1H5NA 1IBCA 4HPWA 4AS3A 3ZHSA 3MJHA 2GYUA 2ZR9A 4OLHA 4OX9B 4QU9A 1JG4A 3BQ1A 1U9CA 1ZJ5A 2ZIWB 3MYYA 3AVWA 3DLTA 3T3DA 1AZSC 4OU5A 1E6CA 3PW7A 5TMBA 3HCRA 1Q5PA 3Q3VA 4KO1S 1KC1A 3ND8A 3VPHA 3VC2A 1WOYA 1B8OA 1JECA 3A26A 3RS4A 4ACAA 1G66A 4EGFA 5HDBB 2WFAA 4B3BA 4JV5H 1Y3AA 2DLDA 2R1UA 2R7AA 3MB8A 2WB2A 1AS2A 1SXJE 1R0RE 5ERGB 2WTBA 1JBKA 3GDFA 3KYDA 1C7QA 3U56A 2H7VA 3Q8WA 2VHEA 2QAIA 1A9SA 3E82A 1G1MA 3HBAA 4LY3A 5EG5A 3PXCX 1G21E 3P27A 3ONWA 3JWGA 4N8DA 2JJMA 3KETA 5J40A 1BQ3A 1TMGE 4X71A 1RPJA 3V5NA 1GSHA 1YQGA 1FDRA 3GTPA 1OBVA 3F5FA 1R9TA 1WB9A 1K9SA 1P1KA 1ULTA 3FUUA 3RK1A 1SEVA 3LCRA 3NBKA 3STXA 1ZD8A 3OX4A 2CLHB 3VXKA 3D02A 2QRLA 3LH5A 4RQTA 5D7NA 4ILEA 3U9TA 4HDOB 4LS3A 3M7IA 5B36A 5BRAA 3BHNA 1V9PA 3KZ1E 2PLAA 2ZI9A 3KT6A 4WFJA 3IIEA 2VHYA 3UNXA 3IT2A 1A9QA 3N3AC 2AFHB 4KKXB 4JC5A 4WJLA 4XJSA 1RYNA 2R8YA 4C5AA 3V8PA 1YMQA 2DR0A 3G49A 1F2DA 2CDNA 2B63G 4L8FA 5BSGA 4PDBA 3FYCA 3TJMA 3TL2A 1FFGA 2JANA 3PK0A 4TMXA 4JLNA 4QUJA 2XC9A 1A9RA 2CMKA 4DIKA 3EC7A 5B3KA 5IKPA 2HTFA 2WPNA 1HNWB 1KC3A 4MVCA 2ZRPA 4EG0A 3EXFA 1VJTA 4WA7A 4ZODA 1BJTA 3OM9A 4WN3A 4FXPA 4BO1A 2GPYA 2XA9A 3CE6A 3ZDQA 2FDRA 2APJA 2F8TA 3CSSA 1FQJA 2WPDD 4DR4H 2IIPA 3A1WA 2WYOA 3EQ6A 2DMRA 2F43A 5ALWA 5C5DA 1INLA 1SUSA 5KDLA 2RDIA 3B53X 3CCBA 3T9CA 3CE9A 3HJTA 3MELA 2VUMA 4UTXA 2I65A 1PJQA 5KNDH 2WIFA 1OXMA 5DNCA 2A5LA 2BUAA 1GL9B 3VVCA 4C6RA 4F9GA 1PNRA 1E64A 4BNWA 5KSOA 4KBFA 4DDVA 1S0NA 5IT9W 3OG9A 1R18A 4Q19A 4UTPA 4PHGA 4CCYA 3UB4A 4Q93A 2X0IA 1N6PA 3OICA 1SIUA 1S8FA 5DM70 2ZJ2A 1NASA 2VXYA 4NLGA 1G3UA 4P3NA 4GKJB 3JATB 4G26A 1PR6A 5DBIA 3GZNA 1CIJA 5DGTA 1OREA 3VZCA 2P6MA 4Q9HA 3WK9A 3IO5A 4YAJA 4G84A 4AJLA 1EQAA 4RL6A 5BN4A 4F2HA 4KRYA 5KS2A 3MTQA 4PYKA 4JL5A 1SAYA 5ED0A 4HVCA 4OI1A 1PS0A 1D0VA 1EWYA 2D3TA 4PRLA 1E6WA 4G0VA 4B3RB 4MV3A 4RD2A 3WKCA 2ZE6A 1WUHS 3NQ41 1H8ED 4R05A 1UAYA 1AQ6A 4S35A 4A4DA 2RBGA 4Q4LA 2C2DA 2WR8A 3KT0A 4PIVA 3DPSA 3FSGA 3V1TC 2WICA 4HDNB 2W70A 4B6FA 2JAOA 1PWXA 2EIXA 2P9JA 1P39A 1YRYE 4FWBA 1QV9A 4RKQA 3UWSA 3EXHC 3RYFB 1YOBA 1EX9A 4EMSA 4F5EA 1PD1A 3NANA 3ULKA 3TECE 4IF6A 1SVIA 3ZX5A 4EF4A 1XALA 3RYIB 3IUJA 1TAUA 2HQBA 1J97A 1HSOA 2AV6A 4KUEA 5ENVA 3MW8A 1E3WB 5M3BA 2C42A 3NASA 5AK4A 3UT5B 3ZZTA 5IZ4A 4BU0A 5AKKA 2WUGA 3WLKX 3N8IA 3O7WA 4NZYA 3FOWA 4J3FA 1HMYA 4PC1A 4Q3LA 2WWRA 3P9IA 3R5KA 2R4QA 3WIVA 2A1HA 1BWRA 1JAXA 5ICSA 4EEKA 3H2YA 4ZOLA 3IR7A 3H5AA 3PIIA 1B1AA 4PGGA 1RWOA 2VHJA 4R8KA 3WV5A 4QEKA 3NATA 2OA0A 1CR4A 2OBNA 4BX8A 2XE7A 3UUEA 4UUGA 2Q5JA 5FV7A 5C4XG 1DJLA 1NF3A 1T4GA 3BPSA 5LUAA 1YCDA 3QITA 2PUEA 1T0UA 4MHSA 3ENVA 2B0CA 3HG7A 1EYZA 5DX1A 3DOCA 1JQKA 2QXTA 1PJLA 2RGNC 2W48A 2QXYA 1XR3A 3KQTA 4AZ0B 3IPRA 1SM4A 1SGWA 3ZDAA 1E3QA 1W35A 2HA2A 3HYSA 3JW8A 2OFXA 3GP8A 5BPHA 3NTRA 4AP9A 4WH0A 1ZGCA 2BEWA 3C3CA 4ZOLF 4P08A 1E5VA 4ZT4A 4DC9A 1C3VA 4CLHA 4BLSA 1BHSA 2CUTA 5B6IA 3QSGA 4QJ4A 1P5RA 1BMQA 2A9RA 3P9NA 3OZBA 5A6SB 4JI2H 1J2TA 3RU2A 3AYHB 2FMTA 3IJRA 4B2PA 1VS0A 1DKLA 2ILVA 4ZREA 2J32A 1G55A 3EDCA 4OJTA 4ECAA 2EC5A 3IX7A 3HY6A 3LQYA 4Q4JA 4JU8A 3WWZA 2WNIA 1YVPA 5G3YA 5F2OA 2V03A 1Y6RA 2C7PA 2BR4A 2D0OB 2ZB7A 3GTKA 1KK3A 1IN7A 2XRFA 3JQFC 3QUCA 3N7TA 3GFBA 4GOXA 1OH7A 3RC9A 1I6WA 2XW6A 5JS7A 1E18A 3FDSA 5JH7A 3ZBUA 1DJPA 1Q0RA 1UJMA 1Y4UA 4TWJA 4UCXA 5KQSA 3CVXA 3E15A 3WYDA 3AM3A 4WOCA 4GLFA 4NBNA 4F4ZA 1KMHB 3SEQA 2PLFA 1ADJA 5AJUA 1EWTA 4N41A 5BMOA 2FPUA 3ICEA 3LFHA 4CEIB 1P4AA 2DSTA 2VQDA 1RQ2A 2P8SA 4QIWE 3WKBA 1UKCA 3NAGA 3EXG1 3QFTA 1F7UA 1ZGBA 4DV5H 1CW2B 4Z8XA 4RNNA 1NI4B 3EG5A 4CMEC 2YRWA 2ZJ6A 4MV9A 4GGOA 2R6DA 3OIWA 7YASA 5FPHA 2QPLA 1PUIA 4FOLA 4AFNA 1LI5A 1U2SA 3CLRD 4D0LB 5HA5A 3BE6A 1IM5A 4ZYUA 2FB9A 2Q3CA 1NXVA 1PL8A 2IYXA 3PFHA 2JFNA 2JIZA 3K0HA 4FJ0A 4FQ5A 2G36A 4IJQA 2VCHA 4R5HA 5GJWC 1TZ2A 1EVQA 4FZJA 4F4IA 2JHFA 1D1SA 2R2GA 4DCJA 1TTQB 2GTHA 3ENWA 3AOGA 3AI7A 4Z4EA 3X3HA 4YRRA 1OZGA 2ZSFA 4LXHA 3PNBA 1C14A 3W8FA 5L6LB 3PGA1 4KFTA 1GUZA 2VNJA 3C5EA 5CNKA 2AEEA 3IIJA 4MR8B 2QRVB 3NHMA 3VOSA 1N8KA 4FI3C 1JEEA 4CIBA 4ZEWA 4TMFA 4Z9BA 2XUOA 4TQSA 2EGUA 2OMEA 5IC5A 3M9XA 3SZGA 1OF1A 1YFKA 5M29A 4UHHA 4C9BA 5JBIA 1Y48E 1R0BA 5JAMA 3CZMA 3A9RA 1DU4A 3HB1A 4DLNA 2R1VA 3UZBA 3VKVA 3GLIB 1ZCZA 2XWBF 1KS9A 2A9PA 4OL9A 1BSVA 1F3LA 3DBOB 5EP4A 1LA2A 2PQ6A 1P2TA 4QWMA 2PX2A 4DHWA 2F67A 3TIFA 1THMA 2NYRA 1TU0A 1JTEA 4DG9A 1QCCA 2IELA 5BPFA 2SECE 4GM0A 3TGWA 1KJZA 3WMWA 1FXWA 2PTHA 4HVAA 3ZE8A 4MXDA 2IGTA 4LZLA 2Z98A 4KQIA 2HMTA 4DB2A 3B51X 1OQAA 3MCUA 4XFKA 2P7IA 4MDFA 2I1VB 5KYGA 3PPVA 2GDJA 3ZK7A 1Z45A 4AMZA 4I4LA 5CB4F 5I5WA 3ED1A 5AVTA 2ZTUA 3Q15C 1A7AA 3ROGA 2VT3A 1DUVG 3I9V1 1LZKA 4N0DA 1Z73A 2YUTA 5ALHA 2FN4A 3MCTA 1KMHA 1F0PA 2P2SA 4YP7A 5T14A 1MEOA 3MIZA 1ZZGA 5CB4B 1JEYB 1E79D 2NVYA 5IAOA 4IDNA 3UF0A 1MTOA 2YS7A 1GARA 1JPJA 3CZ4A 1F8UA 1EFAA 2H0AA 2PUJA 2GRJA 4IDAA 3F3SA 4ZDIA 4N6NA 1W30A 2X4LA 3BMQB 3H2ZA 3H11A 3L1HA 4G4JA 2J5BA 1MAVA 1TPZA 2NQTA 2XBUA 3M6IA 4IL5A 5HFAA 1KBLA 3GGSA 1C4KA 4XLLA 3EWAA 4QULA 2WTNA 1PFUA 4JI1B 1T2UA 5KYKA 2YV1A 3TNFA 3TTTA 4M6WA 3U4HA 3ZDBA 1BZYA 1ZNQO 1YB4A 4WBNB 2JDID 1IIRA 4EYSA 4WSOA 3AUJB 1DG9A 1FP4A 3FNQA 1G3QA 2MSNA 3DB1A 4O0MA 3TD2A 1QNLA 2IZ0A 5DZSA 1R0YA 3VPCA 3O74A 4C7VA 1L6IA 5TT0A 1NBMD 2AJBA 3PSHA 2C5BA 3IUMA 1O9BA 4V0MA 1OJ7A 3ZJTA 2FN9A 3WG9A 4QYIB 3NHBA 1T6NA 1Z68A 3E3MA 3GRUA 5DH9A 2C78A 5J58A 1HNXB 4DM7A 1U7UA 3ZE0B 1ZR2A 2XIGA 3VHLB 3LBAA 2VQEH 4A2QA 1IM8A 1NI3A 2XYVA 3I4MG 4RVHA 5AW7A 2FR8C 3AM4A 4RE5A 2XV1A 3IV6A 2SCUA 4E09A 5C9ZA 4IS2A 3CVJA 1XJQA 2I4MA 1W1WA 3U7QB 3LHKA 4RY8A 5EXDA 4OHZA 3HRHA 3L0DA 4Y0AA 1ZW1A 3V6JA 1EUDA 2BGUA 5DBHX 2EW1A 3W2TA 3G13A 1HYBA 3I6IA 2Y2VA 4GKJH 3AILA 2J7PD 4CC6A 4HAIA 3VR4A 4BU1A 5LWHA 1KO5A 2GBIA 2G06A 5LZ2A 4BO0A 2IPLA 2CL6X 2O3JA 3BKXA 4FHCA 3OTOH 3HCAA 5KZMB 4I1PA 1GU7A 5HW0A 3QBJA 3NEPX 4MTCA 4QBIA 3LQ4A 3TOXA 3IOMA 2F8MA 3H9UA 1IFXA 4KSBA 2ZXUA 3NWEA 1I3KA 2EATA 4YAJB 3Q3CA 4QBGB 3E3OA 1P1CA 5CVEA 4JX8A 1FNDA 1F9EA 3DR3A 4PG7A 4FX5A 2PDAA 1ZN9A 3A32A 3THRA 2X22A 4MQBA 3ROFA 1BDHA 3NUAA 3H2JA 2C59A 1ADYA 1AKWA 2H59A 5BY2A 4JLAA 4L9SA 4UPVA 1UPTA 1JQJC 7GPBA 4QTXA 4PS1A 4ZOQI 1D7OA 5T67A 1BMDA 2H2WA 2J6CA 3AG6A 4A6DA 3ZD9A 3UK6A 2MOKA 4DCSA 1BEUB 5KT3A 2I66A 4B3FX 2DR2A 1M0EA 3GELA 1E1RA 4RMIA 3PFNA 4BWSC 2A58A 3PHCA 3PXEA 3HCBA 2YJTD 5CEJA 2HT6A 2VYCA 4RZSA 2I76A 2X5JO 3WNCA 1U98A 5EMKA 3U0GA 3F9CA 4LJ4A 2ISCA 3OZAA 2YW9A 2HEGA 1EIWA 1QHNA 1U9JA 2VRCA 2OEPA 4WHMA 5E7IA 4DTIA 4A36A 1N32B 3NR2A 2DTEA 3GR6A 3G8YA 5B58T 3UJHA 3HABA 3KFLA 4RPHA 3KQQA 2WOOA 4WDRA 3VVBA 3LT1A 2VFAA 1YJ8A 2WRZA 1ZP6A 2Q46A 3OBBA 2ZQZA 1LS6A 5KT4A 1NBIA 3G9UA 4BX0A 4WK2B 4P4TA 4CM1A 1T9DA 3NM6B 4BB0A 1CNFA 4RIGA 2JJ1A 4EBBA 3VO9A 2XYGA 2H06A 4IHKA 4FDMA 5ER6A 1A7UA 2P5SA 1P7PA 1VDMA 5KYXA 1YRBA 1QGUB 3CY6A 4MROA 4YQZA 4DKXA 2P4EA 3ETNA 3L4EA 5HM8A 1KDPA 2F43B 4LG1A 1AB5A 1E2LA 4Z51A 1KDVA 2DTXA 1NONA 3CR8A 4ZYZA 3VKGA 1C41A 4O82A 4KE6A 2B2NA 3THWA 3UC5A 2YBEA 3CX7A 3OH8A 2P62A 3EVGA 2EHDA 5LA6B 2FNAA 2YN4A 2ZUWA 2HDNB 2OO5A 4IKEA 3B48A 4A0HA 3MRSA 3ROZA 3UTDA 4PR3A 3TCXB 1GQQA 2YN0A 2YNMD 3O4JA 4IWNA 2O1EA 1M76A 1MAWA 1XPJA 4GECA 1EXNA 1AUPA 3GQBB 3ZBQA 4CMIB 3QI7A 3H5WA 3TX2A 4YMHA 1QGUA 3U4QB 4M76B 1DC4A 1QAOA 4ZDWA 1NBWB 2BZGA 2DJ5A 3BGOS 1V51A 3OKAA 4J3JA 4U2DA 4ZKDA 2A0WA 4YWJA 2QTVB 5CCEA 1JHZA 1ZI9A 5CFNA 2R8PA 1CPYA 1L7NA 1GFSA 5A4KA 3SS8A 3IJ5A 4MGYR 4NX2A 3C4JA 2IEAA 3KKKA 1UT6A 3LBHA 4LC1A 3MA0A 4NNOA 4FSHA 3G8DA 1HURA 5FLXW 1GZ7A 4NH0A 5FOQA 4W8OA 3OUTA 3N2LA 3B9BA 3DUWA 2PT7A 1L4NA 1U3UA 4UAUA 4X8LA 5JATA 5GADl 1AKVA 1W4BA 1K6XA 1VXOA 1ONSA 1G7CA 3LGSA 4L3VA 2OO7A 1G5FA 2PUHA 4N5NA 4C4OA 4NYMQ 3ZNOA 2PMZE 1JLRA 4ENVA 5HRAA 3PE4A 4ZJZA 4TGLA 3E70C 1CY0A 3H5TA 3AZOA 2BHNA 3ACCA 5H02A 3B13B 4KREA 3FNRA 2A67A 3BQ0A 2XWSA 4Q9KA 3NZEA 5E6RA 3NH9A 4R2IA 4R54A 4CLRA 3CPSA 3ZY2A 1DBQA 4ZIRA 3HVIA 3NT4A 2PA0A 2R751 1G19A 2GKGA 4P6VF 4N9WA 4FFVA 4L0QA 5CA0A 2ONJA 5BUCA 1SVSA 3KXYT 2WFLB 5JXGA 4KDEA 3C3MA 2WE7A 1PNTA 1UBKS 1IBSA 2P6UA 4OXNA 2ZT7A 3MR2A 3G1TA 3O8NA 1YB1A 4GC7A 2ETVA 1NM5C 3ENNA 3P2MA 4LPKA 5I5TA 2I33A 4DMUB 5BV0A 3OHSX 2GQ0A 5CLFA 1L4MA 3Q2KA 1N7IA 1TQDA 2JGFA 2VCEA 4GPZA 2GKOA 1YA4A 3AQIA 3TVTA 4BLRA 1J49A 1S2GA 4WMLA 4PWYA 3IAUA 1GO2A 5LQKA 1J70A 1RYSA 2BDUA 1RK6A 1NW6A 1N7GA 2FQYA 2VT2A 3OZEA 4RANA 4XZ3A 3IL2A 3MFQA 3I3OA 4DBZA 3PW5A 3AT1A 4A0GA 3FWHA 2QG4A 3ILYA 4QJIA 1U2TA 1S8NA 5EE1A 3W6PA 3BMCB 1Y3IA 3DDZX 4EMTA 3L6OO 1IXZA 4CMBA 1C0IA 2M32A 2Z2XA 1WG8A 3AUKA 4MMXB 2ZAYA 3D3JA 2ABWA 5D51S 2QLFA 1AZWA 3H1PA 4DCMA 4NCAA 2A92A 1RLIA 1P16A 4WCFA 3FTPA 3VR4H 1ZW6A 1JEOA 2PRIA 3FR7A 5KG1A 1MOZA 4UHKA 1C9DB 1PE0A 4RNCA 2SKEA 2YFYA 2H2HA 1WLYA 2VUMG 3I76A 1HEIA 2XA2A 1IUOA 3A6FA 4HATA 3I5YA