4IZOA

Crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
376
Chain Sequence
b'SPILPGAWLGMVGGGQLGRMFCFAAQAMGYRVAVLDPDPTSPAGAVADKHLRAAYDDEAALAELAQLCDAVSTEVPAASLDFLAQSTFVAPAGRCVAIAQDRIAEKRFIAASGVPVAPHVVIESAAQLAALADADLAAVLPGILKTARKGQVRVATAQEARDAYGSLGGVPCVLEKRLPLKYEVSALIARGANGASAVFPLAQNTHHGGILSLSVVPAPAASDALVRDAQQAAARIADSLDYVGVLCVEFFVLEDGSLVANEMAPRPHNSGHYTVDACETSQFEQQVRAMTRLPLGSTRQHSPAAMLNVLGDVWFGEPVTPPWDQVAAMPTARLHLYGKEEARVGRKMGHVNFTAATLDEAVAGATACARLLRIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title Crystal structure of kinase Phosphoribosylaminoimidazole carboxylase, ATPase subunit from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Lyase
total genus 126
structure length 376
sequence length 389
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4izoA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4izoA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4izoA01
4M9UA 5LP6F 2CNQA 1AUXA 2X0SA 4O7YA 1WR2A 4HR7A 3KAJA 1VKZA 4TUYF 2YZGA 1EYZA 4YBZB 3DF7A 1DIKA 3KAKA 3R5HA 4O4LF 1GLVA 2PBZA 2R82A 4O81A 5JH7F 5KX5F 4C5AA 3TQTA 3TW6A 1CS0A 4FFLA 1T36A 1JDEA 4XZ3B 1CQJB 3KALA 2GQRA 3ORRA 1W96A 4NYEA 2NU9B 4C5BA 1A48A 1OBGA 2R85A 4YAJB 1M0TA 5JQGF 4MA0A 3HB9A 4IWYA 4RZQA 3WO1A 1JLLB 3GIDA 2V58A 4C5CA 2C00A 4YJ3F 1M0WA 1UC9A 1C3OA 1I7NA 4DIMA 4TV8F 3NUAA 1E4EB 5EZYF 5LA6F 2VHEA 2W6PA 1JDBB 2I8CA 3U54A 3VPBA 2ZDHA 5C1OA 3V4SA 5HBRB 3U55A 4YJ2F 3I12A 3R5FA 4YB8B 2IP4A 4ZOLF 1KBLA 2YRXA 2P0AA 2QF7A 1IOWA 2CZGA 4FFPA 4E4TA 2NU7B 4MA5A 5J2TF 3RV3A 5I47A 3R23A 4MV8A 4FFOA 5DMXA 3MWDA 2GPSA 2NU8B 2R87A 2HJWA 2WYOA 3U9SA 1C30A 3JZIA 4O7LA 3JZFA 4XX0B 4ZI7F 2CNUA 5LXTF 5C1PA 4IWXA 1Z2OX 2PN1A 3OUUA 3RFCA 2W6QA 3BSYA 3LWBA 2FPPB 2NU6B 2R7MA 2CNVA 4MV1A 1DV2A 4WBNF 4ZQIA 1GGOA 2GLTA 5K2MA 3WO0A 2R7KA 2DIKA 5HV6A 2Z04A 1KJ8A 3BSSA 1I7LA 4O7RA 4O2BF 2DWCA 3R5XA 3JRXA 2YZLA 1CQIB 1KJ9A 4FU0A 5JVLA 4HNTA 1VBHA 3TINA 3VPDA 3K5HA 2W71A 3VMMA 1JKJB 1E4EA 3RUPA 1GSAA 4EG0A 2QK4A 3BFPA 1CE8A 1BNCA 1SCUB 3K5IA 1KUTA 2R6FA 5C8YF 2YS6A 2YL2A 2VQDA 4L1KA 1GSOA 4HNUA 4MV7A 3TIIA 4ZHQF 2FP4B 4DLKA 3E5NA 2I87A 2DZDA 2W6MA 4O84A 3N6RA 5LOVF 5JQWA 2FPGB 4FFMA 1GSHA 3SE7A 4O7WA 1Z2PX 4Y8VB 2OLSA 5BPFA 1W93A 4ME6A 4EGJA 2W6NA 5CB4F 3MJFA 2V59A 5CA1F 4MV6A 4MAMA 3R9RA 2GPWA 3ETHA 4M99A 5D8DA 4EABA 3N8DA 3UFXB 4YAKB 3G8DA 4EA7A 3AW8A 4IIJF 4I50F 2DLNA 4FE2A 4EA8A 3G8CA 1KJIA 4IHJF 4GGMX 2YS7A 1EUCB 4TV9F 1B6RA 3QFFA 2YYAA 3RV4A 1KC7A 2NPOA 5J2UF 3VPCA 5BPHA 4O4IF 4O83A 5CAEB 4XYLB 2GQSA 5CA0F 3KREA 5H80A 3WNZA 2YZNA 5BMVF 1UC8A 1IOVA 3BG5A 4FFNA 2FPIB 1EHIA 2YWVA 4M98A 4MV9A 4O7VA 1KJQA 5JVDF 2YW2A 3V4ZA 1A9XA 4EA9A 4O7NA 1KEEA 2FB9A 2Z02A 5LYJF 5IYZF 2PVPA 2NUAB 2HGSA 2R7LA 3ORQA 3HO8A 3K3PA 3TIGA 2YZMA 4HQ6A 4O7ZA 4O7TA 3U9TA 3Q1KA 5FNVF 5GONF 4FFRA 2R84A 3Q2OA 1VBGA 2W6OA 1OBDA 1M6VA 4O86A 3JRWA 4J6EA 4XYMB 1BXRA 3OUZA 4O4JF 2VPQA 2R86A 4WD3A 5KKNB 2I80A 1EUDB 1PX2A 2V5AA 4MV3A 3VA7A 1EZ1A 2CQYA 4I4TF 3ETJA 4IZOA 1KJJA 2VR1A 4O82A 4EAAA 2ZDQA 4M9CA 4EGQA 2SCUB 1AUVA 2W70A 4O7SA 3LP8A 2XD4A 3GLKA 3MWEA 2ZDGA 4FGRA 4MV4A 1Z2NX 4HNVA 2YRWA 3AX6A 2R7NA 1DV1A 4O2AF 2XCLA 2J9GA 1ULZA 4QSHA 4O4HF 3VOTA 3BSWA 4I55F 1PK8A 1B6SA 3HBLA 2W6ZA
chains in the Genus database with same CATH superfamily
1ZNYA 1KYYA 1X74A 1L8OA 1GPMA 3QE4A 5K01A 4S1PA 4NDZA 4Q7KA 1JN0A 1QH9A 2WWXA 2VK4A 4YHHH 4OOEA 1E59A 3H3FA 4YFYA 3ESBA 3TI9A 1XZJA 4A3JG 2OLJA 1FP4A 4TROA 4ZIRA 5DM4A 4N6NA 3UCXA 1I3CA 2JRLA 3A3YA 2LGJA 2XHZA 4NBWA 1C7JA 3DKIA 1GA6A 1NZJA 5LQAA 1P4SA 3TBFA 2YHSA 4G63A 2FJ0A 3LOQA 5C8YB 5DASA 2YCBA 3ZWWA 2H2AA 1P9LA 3L6RA 3LW7A 4S3MA 4YMTA 5JISA 4CNQA 1QP4A 5CDSA 2OK8A 1HZJA 3T1VA 2YINC 3IDAA 5J2TF 2ZJ4A 2W57A 2BFBA 4AJ9A 1JA1A 3ZNOA 2YOFA 2HLDA 4ZICA 1TXGA 5J2UA 5JZOA 3P19A 2IU4A 1BOOA 1CNMA 3FMVA 3KS9A 1UJCA 2GF9A 1XL1A 2W6IA 3DBHA 1KYZA 3TW7A 2W2PA 1BE8A 2W6CX 1JV2B 1W9HA 5A02A 3FPEA 4O4LB 1T43A 2BWJA 5FI1B 3BH0A 4IWNA 3EQ9A 3V6HA 4OYHA 4GQBA 4MCIA 4AQDA 1YUNA 4B3SH 3IIIA 2DPXA 2PGXA 4YRNA 1JE1A 2Q9CA 1F3OA 3LRTA 3H19A 2KM1A 4O4JB 1E9CA 3OI7A 3RUHA 1QSGA 3BS4A 1YU6A 4RFSB 3PQ5A 2QSZA 3TOVA 4C14A 3ZDRA 2OCIA 2BFDB 3LPCA 4JB8A 4QXOA 4LXHA 4MV6A 2WKSA 3B3GA 5KS8A 1Z29A 5BSKA 1Z4KA 2D8MA 2PNFA 1DINA 1OWTA 4UDXX 4KRGA 5CU7A 1R8JA 5HHTA 5UKDA 4HLUC 5D3MB 3JZDA 1IPEA 1PNRA 3AEZA 5J2UF 1EFRA 4G5SA 1Q5PA 1H0SA 2G5CA 5BV1A 1PWXA 3AF4A 4QBKA 3URKA 3RT7A 3CX4A 3OLYA 3HJBA 3RSSA 1DB3A 3LGSA 4GD3Q 1MAUA 3VGJA 5J1SB 3BB4A 1X7DA 1ORIA 5T4FA 4Q4HA 5DVZA 2GZMA 4ARCA 4LISA 3F73A 4QOHA 4DA8A 3SNHA 1J8MF 3PP8A 1TDJA 3VISA 3KKMA 1LPBB 1PI3A 2DBZA 3FWNA 2GAIA 2ZT8A 2DFPA 4YP0A 2QMOA 2FEOA 2XCPA 3I34X 1SC9A 3D2AA 2VUUA 3COWA 3PNMA 2IW3A 2Q6LA 2IEYA 3P2OA 4HJRA 4NI5A 1KH3A 3NHWA 1U2PA 4AQ7A 1W35A 1XZGA 2F64A 1H1TA 2KS6A 4R40A 3F7TA 4B6PA 1WNFA 3E48A 3BCHA 2XMPA 3ET4A 5HGJA 2OCPA 3HB7A 3RK0A 5LKRA 4UUQA 1A9RA 3H5IA 3RRXA 2L42A 4M8NE 2WI8A 3C97A 5L9XA 4IXNA 4TL7A 3CEMA 1WBDA 2IT1A 5AICA 4TKZA 3AHIA 3IBTA 2J41A 4Z5XA 1EKPA 2ZAIA 5SYAA 4LH6A 3RUCA 5CJ2A 3C3KA 5I5UA 4LJYA 4JJFA 4PC7A 1G5QA 3MN1A 1T29A 3SM3A 5A3QA 1WKVA 5IKPA 1M2GA 4BKPA 1DIGA 2QRVB 3HRIA 3GFTA 1WTAA 2BHTA 2D1FA 4XB6B 1NVXQ 3GLRA 2HSGA 1DBQA 3EOZA 3HT5A 1DPGA 3GA7A 1U3FA 1I3NA 3N5CA 3PWSA 4BBJA 1O7JA 4J9QA 4KSBA 5DPMA 4FDMA 4K9LA 1AVTA 3OZ7A 5IAGA 4YR9A 2FCAA 2IZ6A 3MJ4A 2C2BA 4WINA 2QT1A 3I12A 2RGYA 2FMIA 2YHBA 1CY1A 1B16A 1F7VA 2CVZA 1FFYA 2ORVA 4BCCA 3TZKA 3H9BA 3W7BA 3WNDA 5LZ9A 2FMTA 2AFHB 3D7MA 3S2ZA 1CY2A 3LE8A 3VZDA 5FDFA 2AJDA 5B7NA 4P4SB 3GUHA 3TLYA 1L5NA 1YNOA 1E1QD 1MC8A 2J0UA 3TZQA 3KSMA 2EFGA 3ML1A 4AO8A 2UXBH 2Q2NA 1Z2AA 1YI0A 4IH9A 1CU1A 4WXMA 1S9HA 3BOSA 2YVKA 4ZVSA 3V8VA 3PNOA 4O5OA 4PO8A 4LOIA 3V97A 1ISPA 4ML3A 1LS6A 3EN0A 1YVUA 1NV8A 3ZCTA 3PPWA 1TK9A 3TFOA 2W2MA 4UPDA 1OBHA 2ZQYA 1Z15A 2I67A 3B9BA 3K9HA 4K9KA 4N0QA 3ZD8A 3H87A 4Q3BA 2G7ZA 1VZ2A 4G0YA 2PMFA 3HDYA 4DDUA 5KS2A 1GSAA 2XMSA 3FUXA 2WD7B 3FWZA 5HF5A 1N77A 3D4PA 4E3WA 4F60A 2NW6A 1MGOA 4J7AA 1XDBA 2WHXA 2VP9A 4DC0A 3O5AA 3GIIA 3H5TA 3DVQX 1JLMA 3QXCA 4EARA 2JGLA 2EZTA 3OWHA 3P0IA 3VAYA 5HK9A 3KTAB 5CDGA 2MOKA 3JQEA 1WXWA 5JIBA 1E69A 2A0XA 5K8IA 2JCVA 3HV2A 4UZFA 4LRUA 2AGPA 1P5FA 2CNDA 3SBOA 5B6PA 1E7QA 1FJGH 1HDXA 1ZR4A 1N0UA 2EGUA 4C89A 4MO2A 2IBMA 2E6KA 1VLMA 3BE6A 3KQWA 2EZ8A 2BTQB 1CT9A 3C2QA 3V7UA 2V6FA 4JU9A 4ZYWA 5THKA 4DMHA 4CFYA 2IEAA 5HF9A 3DE5X 1ORHA 3Q40A 2AEMA 1LTHR 4JBGA 2WMNB 4FYKA 4KVFA 2OBXA 3PFFA 1NYTA 3WGJA 4Y6SA 4QZVA 1GITA 1ESEA 2DUUA 5J59A 1HOTA 4FMCF 5DHSA 4RZSA 1KARA 1LK5A 1CLUA 4LE1A 2PPVA 2GCOA 2II6A 3EY9A 3B5EA 3QPDA 1FEZA 2H7VA 1P7VA 4II7A 4QFDA 1J1UA 4UDNA 3L0YA 2R2GA 5B3JA 3BJEA 3NHJA 4KPFC 4DNQA 4EHNA 4LYAA 5TX7A 5JFTA 4JI8H 2J67A 4KR2A 4UARA 5LLTA 2CLFB 1IU9A 2FGJA 2H8GA 5KKNB 5CCXA 3GTOA 5DH9A 3W77A 5FIUA 1EZZA 4QQFA 4BTLA 4GOND 3GXBA 1XCMA 4DDWA 2RI0A 1HLFA 3E03A 2BMJA 4D9BA 3KVOA 1R4ZA 2QZJA 2MR6A 4XWTA 4IV8A 3Q3HA 2DERA 2P9CA 2JA5A 3EMBA 4D4HA 5SICE 2HSJA 1ECJA 2XB8A 3HKBB 2ZBUA 3LKVA 3D3WA 4ZYLA 2WJ3A 2WHPB 4Q05A 4RU1A 2PKXA 1NBAA 4UE6A 2VKTA 3ABIA 4BGUA 4XWOA 5AR1A 3EDQA 3TSYA 3ZIUA 1W96A 3B7WA 3A8TA 4JYZA 4PWQA 3HK2A 1PD0A 1OJLA 3LBIA 5AJWA 2YUTA 3QXJA 3HXQA 1X70A 1W0KA 3OA2A 3RB8A 4KAAA 1XP8A 4QPNA 2WTXA 1CZUA 3I5AA 2RG1A 2DECA 4KE6A 4BV9A 4NZOA 1DU4A 3DOUA 1DOZA 2C99A 5H82A 3ZDDA 5LOVA 2ERCA 3H1PA 4KQ2A 2FSHA 4LVNA 4N3CA 2DFTA 2E1PA 4RHXA 3A9WA 2VHQA 2XA2A 4HSGA 5KYYB 4GR4A 1L7OA 4DSZA 3PFBA 4IUBS 1VRWA 3ZWXA 2GVNA 2V0NA 3T3DA 4E14A 3DP9A 2O2XA 4LFBB 5MHTA 5AJXA 3DTGA 3PHHA 3AHGA 1CY7A 1FVOA 4MAFA 2BGKA 2PWBA 3I9FA 5E0KB 4XX0B 1NF3A 1A3GA 2AN5A 4OSEA 4J0CA 1TEVA 5C1PA 2NYUA 4X5OA 2OGSA 2O8VA 4YT4A 4GKKB 1E60A 2WSSA 4N8SA 3GIKA 3BSYA 1DG3A 3AQ4A 2EC5A 3TVYA 2YXPX 4D98A 1HTWA 3HYSA 1QGDA 4E1BA 3U4IA 2VOEA 4O1HA 5FFMA 3TX2A 1UBEA 2PK3A 4HEHA 2H5EA 2REQB 4K6OA 2DUWA 1W2GA 1M1XB 5F9LA 4FU0A 5LQMA 4LV5B 2PVCA 4UAVA 1LQUA 2FRDC 5DYGA 1JLKA 1KWGA 2VWQA 4IJWA 4ZZIA 1K98A 1QFZA 4A8JB 1T0HB 3KHSA 1QYVA 3NBYC 3L5KA 3A6PC 3H1TA 4WT7A 4Q7QA 5J47A 1RU3A 2NP7A 2QRGA 5I3CA 2B6NA 3KOXA 3SLGA 3UMMA 4U8HA 2Z95A 5CJPA 3DFIA 3AEQA 1V45E 4AP5A 1RJQA 2J5XA 1OLUB 3FDXA 2JANA 3TEJA 4O3RA 2PJDA 3GB9A 5LOVF 1QHHB 3HXOA 2C8LA 4RVGA 1XGKA 4G0MA 1ZUIA 4EQZA 4ND3A 1US8A 2YN2A 1K4KA 1SH7A 3L79A 1UMCB 4ETIA 2O03A 3DV0A 1ECCA 3PZBA 4WRRA 3A7DA 4Q39A 4R8VA 2FW0A 1EFCA 2A57A 2XBUA 4RSGA 3MT7A 4Y0NA 5KYUA 1WIWA 1NMSA 4BNYA 3KUCA 3OZIA 1Y5MA 3E22A 1DFGA 2Y0PA 1NQTA 4RK1A 5FWDA 3ACDA 1IOVA 4GAEA 3JQCA 3ETEA 2A9KA 1WB9A 3LPDA 3K09C 2QUIA 4DQKA 4BUZA 1MX5A 1NBHA 5K0BA 1NBMA 1E0DA 4ZEWA 1UXJA 4UTVA 1J06A 3OWXA 2Z08A 3PXCX 3WKDA 2WVAA 4P36A 4YN3A 3PFHA 1KS2A 4MPTA 3OH8A 1MB0A 4FFRA 2R7ZA 3NANA 5ICMA 3JYNA 4CUKA 3BXEA 3FKSA 3ZXXA 3R5JA 1WM1A 2R86A 4QUHA 2X8JB 2PGOA 1AIPA 3F98A 4IIHA 1N5MA 4NAVA 3ONNA 3BACA 5TE9A 2PD3A 1KK1A 2VDQB 3UAZA 2H1OA 1T1SA 4RWEA 4Q3CA 3IQEA 4I1UA 4KGZA 4RJKA 2BP7B 4Q47A 1FVXA 4D0LB 3F96A 1T8PA 3AKEA 4BRWA 1BE6A 3B5JA 4ZI5A 4BHTA 2XZLA 4F4WA 1E18A 4TRRA 4HQNA 1N57A 2XUIA 3U7QB 2OO5A 1U2DC 1EQAA 3I3OA 4FUTA 3FF4A 2WU8A 3CZAA 1BS2A 3RGGA 3WRVA 2YR0A 2BQRA 3I62A 2ISCA 2QLMA 1O9GA 1MA3A 1QQAA 4J1SA 1LRLA 3S8EA 4GOKA 2Q07A 3EIQA 4N3BA 1P19A 2Q50A 2VUGA 1JRLA 3WB0A 4D96A 4PPYA 3LLUA 4FGWA 1T0PA 2VK2A 4IM7A 1SVOA 3AUTA 2OV8A 1X9GA 4ZT3A 1J6UA 1FS5A 2JLVA 1ZHQA 3L4JA 2IYFA 2ZUWA 1RLUA 2HJGA 2QTLA 4Q45A 2A9PA 3OQIB 2VT3A 3AV3A 3CKYA 3CUWA 1H3FA 3ROQA 1Y1WG 4BP1A 3E58A 1VBFA 4RESA 5IAJA 3L8ZA 5CE8A 4DQ0A 3WHPA 4RV5A 4Z1MD 3UKOA 5E4YA 2V6IA 2BCJQ 3NIFB 3OCJA 1U2QA 3UAWA 1PZMA 4OFZA 3VU8A 2GK4A 5JBQA 3OETA 1OC4A 3PVCA 4IAOA 3DG9A 4ZYXA 1V8PA 1VSVA 4TTSA 3PZRA 1GFWA 1MPXA 1BDBA 4MGIR 1MQ9A 2AD5A 1E0KA 2MMCA 3WAGA 2COUA 1QONA 1JBQA 5BR1A 2A1TR 4YBZA 3D3KA 4WLVA 2WQ6A 3F49S 1HDOA 4BMSA 5FXMA 1BEUB 2QORA 2H8KA 2CNVA 4M53A 2UU9H 4MV1A 4E31A 5CA0B 2G63A 1PWEA 1YKGA 4QQ8A 2WAOA 2VN8A 4EO7A 2KJQA 4B4DA 1W88B 4R2IA 4XSVA 5FOQA 2JASA 1LRKA 3QA3E 1JIJA 3GTMA 3VNSA 3NGDA 2VQSA 1U99A 4Q9DA 1ZH4A 2RI1A 2AZTA 4AJ4A 3FMPB 2OO7A 1CUHA 1NE2A 3RS7A 2ID8A 3K72B 3VMMA 3P0JA 1V1RA 5KQGA 1Z34A 2D1SA 2BBWA 5JS2A 3R7NA 1LTQA 3A3NA 3QVVA 1UAYA 1PFKA 4RZUA 2WIJA 1U1DA 3DL4A 4DY4A 5ILGA 4BBAA 2NPFA 4DJAA 3R8CA 3HCOA 2Q0QA 3KLNA 1ZSYA 5D5PA 4J9LA 3JALB 1L5SA 5DHAA 1PJSA 2XMBA 1G6OA 4M54A 4AWXA 1Z5GA 2Y1KA 4FE3A 1XK5A 1O03A 721PA 1KYXA 3ZWKA 2QYSA 3UM9A 1FLNA 2J5RA 4YCMA 3UXYA 4GYKA 3WQHA 5I5SA 1QMPA 5AK3A 1N6LA 3P5SA 5AIBA 3MINA 4HLDA 2R47A 3D3NA 3WGGA 3OLCX 2R9VA 1PWZA 3FSEA 4ZTBA 2UXDB 3JD2A 1X1EA 1KT8A 4KNWA 1OZGA 5KOHA 4A1FA 3AC0A 2H0RA 2IS4A 4C0AC 4X1KA 3GH3A 1G21E 1UPAA 4ER5A 3JWHA 2BT4A 5F9NA 5F1KA 2YICA 4D74A 1EHIA 1JLHA 4OFBA 3CPSA 4P7GA 1O9HA 3LDGA 3KTDA 2PS9A 1KEEA 4ZO6A 4L4XA 5GV8A 4J2OA 3VSDA 3A32A 1DQYA 5JYDA 2HU7A 1QAMA 3LQKA 3HO8A 4Z0PA 3IP6A 4XJXA 5CVUA 4Q9JA 2IX3A 1ZH0A 4YDHB 1Y9AA 1VOTA 5AXAA 1SUEA 3JY6A 3F97A 4QLBA 4IOJA 3K0CC 5JXGA 1AKVA 3QSGA 2EKPA 4CQMD 5KT4A 1LW7A 1UKAA 3V6LA 1FFAA 4P34A 4ER7A 3WGVA 1IXSB 3QHPA 2JGDA 2C92A 1ZIYA 1S10A 3R3XA 4IRKA 3K92A 1PX2A 1UT5A 2OECA 4P98A 2WG2A 2ZJ2A 4UBKA 2ZDQA 2EVWX 5DYNA 4GQAA 5F51A 3INRA 3IUEA 2VUHB 4BO5A 3HB4X 4W7IA 4ECEA 1AXGA 4U7PB 4MUBA 4MX8A 2W48A 4HQ0A 1WUHS 4DLUA 1J0CA 4RTNA 5EGSA 1YS1X 1BEZA 1M7GA 3BSWA 5ES3A 4BWSC 1RJDA 3PPXA 2WFAA 3FDZB 1X7YA 3IILA 3NTRA 5KX5A 5JCJD 1W9MA 1YUMA 2B8EA 1TWHA 3K8OE 4OX9Y 3NBYB 1TQ6A 5AW3A 1YZVA 2P4SA 4KWHA 3ZQUA 4R71A 4E51A 1AS3A 3N7UA 4ZT6A 1EGMB 3VVMA 3A25A 3STTA 5H81A 3FKIA 2RG7A 3NNNA 2UYYA 5EJIA 1JH8A 5F5LA 4A3LG 2Q7XA 4C0SA 1V41E 4MULA 1R9NA 3C5EA 1QH8A 4J0FA 3RHFA 3TG2A 1RZRA 4NJMB 3VM6A 1KJZA 2K87A 4JJAA 2Z98A 3LH5A 1RCTE 3DXFA 1RZVA 3TZEA 1PJAA 4F3RA 1UKYA 4F06A 4Q0YA 1H2FA 4BJ3A 3SGLA 4F92B 3PHJA 1KSJA 1WCIB 1IUKA 3N2KA 5EWEA 1OMOA 4JVSB 2JLUA 4DV7B 2R8ZA 3RW9A 1CUGA 3FOWA 3NKVA 3H4IA 5JZSA 2VXYA 3TNLA 2QRHA 3A6DA 5DMXA 4KZKA 2QTVA 5CM9C 3UT5A 2B1IA 4C2TA 3K1AA 5KFDA 4ZV9A 4O2AB 2ZE6A 5J23A 1FXWA 4JOQA 4BO8A 2J4DA 4FNGA 3F6PA 3FE2A 3MAJA 3GLUA 5JALA 2R8JA 2YJ6A 2PKCA 3A4TA 4U2GA 4H6PA 1XDZA 4Q21A 3JVEA 4H31A 4FR5A 3TBHA 1BU8A 2XMRA 2CXQA 1VBMA 1MX1A 5K0SA 4QU5A 1II8B 3EUAA 1ODTC 2GCEA 4EEXA 3U0BA 2IZOA 2JARA 4LRSB 5FLKA 4AMBA 2G9ZA 2O2HA 4GOOD 3A1VA 3RG2A 4OQLA 2MU1A 5J5CA 3MRSA 3K0FA 3CUYA 4H6WA 1ADYA 1E8DA 1IHXA 2DFLA 3RUFA 2EJ0A 2AGQA 4ENUA 4XCQA 2O7QA 3EQ8A 3CW9A 1PLJA 1XL0A 3EA5A 1FA9A 2EJ3A 1VCNA 1K8XB 2YL2A 1V3UA 4XQGA 4DBZA 2TS1A 4BO6A 5ECDA 2DP4E 1QO9A 4WXRA 2G8NA 4Q16A 1PLKA 1K1QA 1KO5A 4HD8A 2ID9A 1C1YA 3R20A 3RS3A 5JO0A 2E2IA 1VKOA 2R5WA 3UAOA 3NC0B 4UFPA 1CUJA 1CUVA 2Z2ZA 4W6QA 1CUWA 2O2DA 2WJ4A 4X6LA 1FIUA 1DG1G 1KMMA 1WBJB 1Q95A 2GAFA 4PAQA 2D3WA 5FEUA 3FPBA 5E7IA 1GPUA 1VE5A 2P75A 4BX2A 1Q22A 1FXWF 2AXQA 1Z8DA 3GU3A 4KX3A 2VP5A 5DB4A 2VUSA 3EIUA 3PQ3A 2PV7A 4QPZA 1TM3E 1MOQA 4V1CI 1SUCA 1KJQA 4YS6A 4NFHA 1UWCA 2Q4EA 5E7MA 4W6ZA 2PHZA 1TWCA 3RIZA 3BWCA 3NTOA 4RIEA 4AP9A 3IXLA 4N9QA 1Q20A 1BVYF 1VHWA 2CHQA 4F3CA 3T5CA 1DJQA 4XDHA 3HFJA 4RA9B 5CM0A 6REQB 4TLMB 3TRIA 1E6EA 5LA6A 2OR3A 4KWTA 1UJ4A 3ZKWA 4A2PA 2QHXA 2LE0A 4C4TA 5F64A 5KPDA 1P45A 1GYRA 1HE5A 6AT1A 1IN4A 1GCGA 4ZT7A 2JJMA 1L5FA 5E25A 3DW1X 4CMCA 5K0FA 2G67A 4A0HA 3RTDA 1CPYA 1KAMA 4QWBA 4LF9H 1ULUA 4RD3A 4MW6A 3LP8A 2VWHA 1VJDA 1TYDE 5JAHA 3CZMA 3TUIC 3VNNA 3HMQA 4ZMSA 2VRBA 5IF9A 4C6TA 3N59A 5A62A 4ECQA 1Q6YA 5CB8A 2HGZA 3B3QA 3I2IA 3L7AA 2PLWA 3N28A 3PTLA 5EY5B 3QHQA 2QRKA 4RTQA 5KFTA 1CR1A 1S8AA 1LFDB 5ITVA 4XQ9A 1V11A 2CKDA 4XWAA 3W90A 4B75A 1VJ1A 2QQ5A 4P31A 4Q02A 5DNEA 4NZNA 3KPYA 3TLXA 1BX1A 3CLVA 4RMIA 1FSGA 5AKYA 3CEPB 2O5EA 1K86A 4Z4FA 4XJSA 3EVTA 1VI2A 4CEJB 2OFOA 3GIDA 3HVJA 4ZZ3A 3GGOA 1FMTA 2QMZA 2PWYA 4YJ3F 2FSFA 2WF9A 4P22A 3SXUB 4NRDA 3THXB 3P2MA 4J9PA 5LA6F 3IERA 4OXRA 1JKMA 4N6OA 3AFIA 4OYYA 3VPBA 2DWOA 4GWKA 2WFLB 3PSAA 3DVSX 4BASA 5DMHA 3F5QA 2QY6A 1JFLA 1KQOA 2H3EA 5DX0A 2CF5A 5KTSA 2NU7B 3GV5B 4BZXA 5EHIA 4X66B 2EOAA 1OGIA 1DX4A 4KSYA 3LK7A 4JAVC 2DFKB 3HFRA 4K2AA 3DDCA 5HQ3A 1EVYA 1U7PA 2I3GA 1D4ZA 4BBZA 4HWPA 4O4IA 4X6YA 1ZONA 4DV6B 2GCNA 3PLRA 4POOA 3MFQA 2VC2B 4J07A 2XD9A 2BDTA 3UCFA 1CQJA 3JV7A 2WOOA 1IL0A 4Y1FA 4X8LA 1X8XA 1CETA 1VHTA 3O4RA 5ALTA 1KBZA 2JEIA 1BWRA 2EBHX 1AQYA 2YBEA 3AR6A 3ADOA 1W5BA 2ENUA 3A1CA 3OFND 2GEVA 3LV8A 2UZ4A 4YP6A 1EX7A 3LF2A 4PFKA 3KHUA 4WCFC 4W5RA 3LGAA 1OR8A 4JWTA 3LYAA 1XAHA 4KN6A 2ZS7A 5ARCA 2XDAA 3OQ6A 4C1NA 2GA8A 1BGXT 1VPWA 4JGBA 3PJFA 1NN1A 5KZMB 1EFKA 3IKLA 4UD6A 3ZCUA 2F43A 3TS1A 2VA8A 1EKFA 4PYQA 1ZOIA 4JGIA 4XCVA 5BN3A 2FE3A 6Q21A 2YWGA 5BSFA 4QPDA 3UV6A 3HYLA 4UE2A 3ENQA 1WPRA 3ZEIA 4WA7A 3F6YA 4R0VA 4OHPA 2WJVA 4DTCA 4DRZA 2W11A 4G36A 3B13B 3HJRA 4WK4B 1E9EA 1DKOA 1QQBA 1X3SA 1SBCA 4RE6A 4GECA 5L1JA 3UOAB 2IPOA 4RD0A 2FRDA 1RS0A 2OHXA 4RANA 1OX5A 1JNXX 3IEKA 4BVLA 4LRYA 1GAXA 1CHDA 2B25A 2JIMA 4OQFA 1LU9A 2FEKA 1XA0A 4FC6A 4A2CA 3WA7A 1Z5NA 2IDKA 4Z6KA 5K3SA 5GVRA 1SQ0A 5GIPE 1DT5A 2ZB2A 5ALLA 4NP6A 3E7XA 1V4BA 4O4IF 3OZVA 4Q1BA 2P4UA 3OKCA 4FHGA 4WGGA 4OJYA 4REMA 3TTXA 2FSVA 1WMSA 1LSUA 2IY7A 4JCOA 4OAQA 1YVPA 1CJSA 4IZIA 3KEFA 3AERB 2H85A 4H16A 1HNZB 1HBJA 1KR5A 5LMNB 1YCGA 2OFPA 5A0TA 2JD2A 3M4NA 1Y48E 5AOVA 1XMOH 1UBSB 4K8RB 5HBGA 2YXLA 3UQ8A 3N39C 2V7TA 5D7BA 5F1PA 1N8TA 4NCAA 5J58A 3HSYA 4BB6A 2KHZA 3CISA 2J5QA 2VPQA 2EWWA 2JEYA 3KE9A 5K0JA 3AZQA 3PLNA 1B1AA 3K09A 3NONA 2C1ZA 1B3BA 1X94A 1ZMBA 3T9FA 2C2YA 4PQGA 1T8UA 2COEA 1VGQA 4FMDF 1CUFA 4LI0A 3OSZA 2JBAA 1E64A 2Z1DA 5HZHA 2W58A 5BN4A 3VNVA 2BBOA 1XPJA 3O21A 2NVOA 3AF6A 4ZV4A 4ZRMA 4QSMA 2OV1A 2QG4A 4ONEA 5M5BA 4NOLA 1OYVA 4C7KA 5FV7A 2Q5EA 4PG5A 4M0JA 3W1BA 4JD5A 4MW9A 2DLDA 4JV5H 2VHVA 1X8JA 5EIEA 2HA4A 3RPEA 5C0OE 3RADC 5FOTA 4CTJA 3MPUA 1Z6GA 4Y6RA 2ODAA 1I1QB 4B1FA 3H8WA 1GR1A 5CBPA 3BWBA 1G63A 5BWCA 2D1TA 1PFYA 4CLRB 1IM2A 4R1NA 3WBJA 2GARA 1U4NA 1W25A 3IFSA 2X8LA 2H2FA 3PDWA 5LDDC 4YRZA 3QJGA 3VKVA 3ROKA 1WV1A 4IRUB 4WA8A 3B1VA 3WBKA 2ADFA 5AVRA 2CLIB 5CP8A 1GEGA 1YQDA 3PYLA 3HYRA 3O2JA 3WLJA 5DOVA 2VHCA 3ZU2A 3ZHVA 5E2IA 2FWNA 3CR7A 3K1JA 1Z88A 3TAHA 1BJRE 1ZGHA 3VPAA 4OX9H 3EYYA 5JYCA 4C4YA 1X19A 2P2GA 1XZHA 4XARA 3GT0A 1ODJA 5DYTA 5ER9A 4TS4A 1BFKA 2GN8A 3AYXB 1ZD5A 2HCRA 1PD1A 1YOBA 2JA1A 2XECA 1OU4A 3ZD9A 2QM8A 4PZZA 3WMFA 4L8FA 3UK6A 1EP9A 2AU0A 2DIKA 3WNBA 2Q3CA 2XZTA 1NW3A 5K6AC 4MUFA 1QZZA 5JI2E 3ELBA 4O7RA 4GEGA 3GQCA 3OHPA 3HKEA 2C5SA 1E9DA 1GL9B 1DAEA 5LD2B 3L07A 1AGPA 3G85A 1TZMA 2AJLI 2E7ZA 3RUPA 3VQTA 1BQ4A 4Y6GB 1DADA 1DCTA 4GGOA 3BPSA 3CNEA 3CF4A 1GXSB 3ZV3A 1KUTA 3DBLB 2Y67A 1YFZA 4EI8A 4KUHA 4ZVPA 3KHLA 3RHSA 4OK6A 1MMFB 4LOJA 3C3BA 1T8SA 3V6JA 3ENWA 4DA9A 3DFMA 4AMZA 1VBKA 1RI2A 4MVCA 4RX1A 4KQIA 3IEVA 1UXKA 3PXUA 1JQAA 4YRQA 5A0FA 1HQCA 4BLSA 1TEHA 2H7XA 4CMAA 4R5HA 3KOOA 3USES 3Q2IA 3E9QA 3Q7TA 4QL3A 4L28A 3TDKA 2VTBB 3RB0A 5TF4A 2RI6A 2YVAA 1N0HA 4AG3A 3HH8A 2VJAA 4J0HA 1T3HA 4BS9A 4OXYA 2OGZA 3SXPA 4BZPA 1HFJA 3ZYZA 1FP7A 1O6BA 3ONVA 3OF5A 1U8FO 1EVJA 5ERGB 1FLAA 1I51A 2QX4A 1GQQA 3N0RA 5BUQA 4GLXA 4B43A 2OUKA 4X64B 3FTNA 1NT2A 1Z6ZA 2B3TA 1Q0UA 4TMWA 3JQ6A 4HTFA 5M34A 3TAXA 3QVSA 2O3TA 3KX2A 5KWJA 2ZBDA 1J39A 5KTPA 4D4KA 4PVDA 5KYKA 4J1NA 1T4CA 4HX2A 3CPJB 2P4QA 3VU9A 4PQFA 5JTTA 2PKYX 5EC8A 4NOJA 3P1JA 5C7LO 4CT4B 2Q3MA 3ZK9A 3L06A 4HYQA 2CK3D 3UA3A 3I1JA 1G3RA 4GR9A 3EODA 4DPKA 2UVQA 3H17A 4A93G 4WZAE 4YUVA 2BGUA 5A9SB 3P27A 3X1JA 2CWDA 3OVMA 4QOSA 4TYYA 1DAFA 4QXPA 2LPMA 1HGXA 1W73A 3GXOA 3FZEA 4MSUA 3MWEA 4YNBA 3WADA 4R3WA 1Z6XA 2PKRA 2XBLA 1NUTA 1LF0A 3DB1A 3MOSA 4RLSA 4NARA 4LTMA 3EVZA 4MUYA 3O4GA 4BWGA 1XZNA 4ZJPA 3G13A 4WCFB 5JRJA 2PFKA 1C9NA 1RYFA 1ND5A 3K0CA 4YUXA 3CEAA 4NSNA 5BR7A 5A1TA 1QM5A 1TF7A 4CF3A 3EF1A 1N25A 2UVUA 1EB8A 2FFQA 4IKOA 3ZLBA 1TJYA 5A06A 2NT3A 2R8XA 4D6YA 1NNEA 2UVPB 3WL8A 1TKCA 4HN2A 2GBCA 5G02A 4OPMA 4C3VA 2HLHA 3TLZA 1S0UA 1CS0B 2XC9A 3HZHA 3L9WA 4D0SA 2DPHA 4B6QA 1QGZA 4F3KA 3W06A 4D9NA 4QVIA 4BGDA 2JEOA 3WO1A 3PICA 1WV0A 1JDPA 4RIFA 1GKLA 1ZPDA 3C6XA 5DP1A 4M1ZA 2W6PA 4NICA 3CWQA 5GWXA 3RIEA 5K3WA 4D57A 4JLAA 4JI0B 4PO1A 5JCZA 4DOMA 4QARA 4GI2A 1KQPA 1M66A 5KTRA 4C4OA 4CHTA 2I3DA 1BGWA 4QNNA 3CR3C 3JR3A 4PE5B 3KVRA 3NFRA 5C53B 4EYGA 3JZFA 3OTOH 1QH1A 1KZGB 5L53A 3B52X 4KGVA 1UKVY 4Q6WA 4TRNA 4X8HA 1WMBA 3EG9B 2HIHA 4MVWA 4AMUA 4M1TA 2WJPA 1HFEL 3BDVA 4NH4A 4L51A 3W05A 5H02A 3BGOS 1TO6A 4JP2A 1BMTA 1QGED 2VJCA 4JIGA 4AZSA 1IN8A 1FUIA 1PS0A 1N34H 5J5AA 3SMQA 2PL9A 3GGSA 1T10A 3STWA 2VQEH 3U13A 2V5VA 1RRPA 5CBKA 2OP1A 5EEHA 1U0OC 4NENA 3U16A 3T94A 1PR6A 2XUFA 1YB2A 3AI7A 3HVUA 3SDSA 3A06A 1C41A 1P2GA 3U3ZA 3KHRA 4M1SA 2PMDA 1OI2A 2FPWA 2PIDA 3ZTWA 2BHRA 2VT6A 3W9SA 4E2YA 3A1FA 1ECGA 3IDOA 2A9QA 2OAEA 4W4TA 1Y4DE 1RJWA 4H60A 4P5EA 4ETWA 1NI5A 4BLWA 4GP9A 2IC5A 3QI7A 3PNKA 2FWJA 2JEZA 5AHKA 1T4GA 4NU5A 4A8JC 4Q3NA 5AH0A 3CKKA 4EH1A 5F9HA 4UHKA 3EPKA 2AC4A 4WKOA 2ACKA 2JKVA 1IJKA 3RQSA 1GRNA 3ZE0B 4HPXB 2X5XA 2KMLA 4CWAA 2WQZA 4JI1H 5LXTB 5A4AA 3PRHA 2ZI5A 3OD1A 4EUNA 4XYLB 2FWMX 1FSSA 5EE3A 4JJZA 3QKWA 3RQIA 1N9KA 4J0KA 2JAOA 3PBKA 1XRPA 2YRFA 3V7NA 4O7VA 3P32A 4K6NA 5A3RA 1JEQA 2BRUC 4YJGA 2C7RA 2JGNA 2WABA 3LXUX 4C2UA 4MR7B 2XYGA 4L9RA 1U0NA 1R3UA 4PZ9A 1MU0A 4KFCA 1MCZA 3GNQA 5CGZA 4E2WA 4HZUA 2HSEA 4QAJA 3QKSA 5C37A 1CHNA 1J1ZA 1XZBA 2RAVA 3D3EA 3OEWA 2QL9A 1BXRA 2HNBA 3WTCA 2B9EA 1PQUA 4TTQA 4F84A 3I76A 3DLIA 4EJ0A 4HYEA 3Q8MA 4I4LA 4XUCA 3QX8A 2V9WA 2JIZA 3MBKA 4K28A 3OZXA 1X2BA 3E9DA 2V7PA 4J7UA 3UA4A 1ZQ9A 1ZL0A 1V35A 4NG4A 1G64A 1HYBA 2GBLC 5IPFA 2AT1A 2EKLA 3EGXA 3BJMA 5DBEX 4JT2A 2PUJA 3U56A 2Y6VA 2HPHA 1ET0A 3VDXA 3AHCA 3VHXB 1EYZA 1U1EA 5EWLB 4HZGA 2FSPA 4B3IA 2O5RA 4EFNA 3KPVA 4ZU6X 4I9FA 3I5XA 2XRFA 1I94H 2RGWA 5DHPA 3GFBA 1H5NA 5IJXA 4K0KB 2X23A 1PDOA 4HAIA 2WWVD 1E0SA 4NPCA 4X44A 3L7LA 3DBRB 1IN7A 4DE5A 4M0PA 3S44A 4MMYB 4XDZA 3O9MA 4M0LA 1A48A 3OOYA 1T5HX 1U0FA 5P8WA 2WP0A 1DDGA 4L02A 4N7JA 1CX9B 2FVYA 2W2LD 1IM5A 3Q7QA 4GF5A 5KFCA 5KFJA 1JR3E 1D2MA 3M6VA 2JDID 2HY7A 4FLFA 3I61A 1QVRA 2CLKB 3GEEA 3HGMA 2DSTA 1ZJ6A 1LNQA 2VPSA 3LZDA 1VL1A 1PYOA 4RIGA 1L7PA 2A1IA 4QTTB 1HURA 4DANA 3IHTA 5DGXA 5IT5A 3GZ4A 2P2LA 4Q18A 3F7MA 1AG9A 1V3VA 1I80A 4TSFA 4Q4CA 2R92G 1FFHA 3UJBA 2IHZA 4Q7EA 4RABA 2QLTA 4BVHA 3G7UA 1XI2A 1XNJA 2QN3A 2G9RA 2YNMC 3ICOA 3ICWA 2JFPA 1YT5A 1YR6A 3EDRA 1VMAA 5A9TA 4C0LA 2GNPA 3OM8A 1EHYA 2GQ0A 2VA9A 3SBEA 3IUBA 1VS0A 4BQEA 1G8MA 3VAAA 1KAQA 4DKXA 1KAGA 1UQRA 1M2OB 2J0QA 4LDNA 5C8YA 1WF6A 1ILEA 3T7RA 1XTKA 1G1MA 3OM1A 1M83A 5FLMG 3H2IA 3U5TA 4ZO8A 1YDFA 3MWGA 4LGMA 3I30X 4KE8A 3K5IA 2OXTA 4I8IA 3F67A 3M33A 1ZEMA 2GD6A 5CX1B 3T7AA 3LLCA 3KJFA 1DX6A 4H17A 1NNLA 2BMAA 3T7SA 5BVGB 1J22A 2IDZA 1H94A 2GRUA 5DP2A 3FRJA 1DBSA 1WE2A 2ZRIA 4OQDA 5HRAA 3H7AA 4Z9AA 4PS0A 5D3QA 4YAKB 2IX9A 3U44B 1K3UB 1P3DA 4FIZA 1IDN1 2FKNA 5DLQC 4BFTA 5CIYA 4L72A 4O4LA 1PEAA 1KS9A 3N8KA 2M1ZA 3NRJA 2IH5A 1DO8A 1THMA 5DK4A 1O95A 4PRYA 2YZNA 2DWUA 1PW7A 2V65A 4GX1A 1R5OA 2FWPA 3SNOA 2YWVA 4OHFA 2WZCA 4B8WA 3IHLA 3BHNA 4ED8A 3J80W 3M6AA 1P44A 5JBNA 4DNXA 3UH0A 1SVUA 3AI3A 1WNTA 3QMMA 5KU1A 5E3IA 5C5CA 2YZ2A 1ZBQA 3NTUA 3R5TA 3L1KA 3Q8RB 4RFSA 3UJPA 3OICA 5LPNA 1SO8A 2BFDA 2J30A 1A2OA 3R6LA 1G8HA 4DLNA 5ALKA 1CUSA 4HNAB 4MW2A 3AKYA 4NKRA 1A71A 3JD3A 4HF7A 2YQ4A 1RT9A 1P1BA 2ZIFA 1OKKD 3SSOA 1YFKA 4R1MA 1EE1A 2RK4A 4EZEA 1W0CA 1Y8RB 4FT4A 5CCDA 2WDPA 4F4FA 1FVFA 1ADFA 4Z4IA 4KB5A 3DLCA 2ZP1A 2Y1EA 1TVEA 4FHZA 3L4SO 3BK1A 3LVBA 4NEQA 2QZZA 2FW8A 4FN4A 1IWBB 4B74A 3R8XA 5GAJA 5T4BA 3TL2A 3AW9A 1FQOA 3M1IA 4FS1A 3G8AA 1KYQA 4ZVLA 1KFCB 1VIMA 3O1LA 1FYVA 4O4LF 3AUAA 4Q24A 2NVUB 2PMKA 1U0RA 3BXGA 1WPQA 3G6VA 2PL3A 1NXVA 4JR2A 4AP6A 1YRAA 3C6KA 3PJGA 1D1QA 2HMAA 3DXYA 2PCJA 2O6HA 5F7JA 4E6EA 3LPLA 4F1JA 1P4GA 4FBMA 5KSYA 1JBKA 2IBTA 2VJPA 2DULA 3N2LA 4U7DA 3ROFA 1H6BA 4KPUB 1G8JA 4KO2S 1WQ4A 4F7DA 1QRTA 1CJUC 1KFBB 5K8LA 5I4KA 1TK2A 3FZGA 4M2LA 2BFNA 3HCEA 1THTA 3AR2A 3EBOA 2YW9A 1CKOA 1EP2B 2J6SA 2ZSJA 4US1R 4KN9S 5FOVA 3KETA 1ITZA 3JXEA 1G0OA 1URPA 1JHOA 2GN4A 3MYRA 2O0LA 2DLCX 1XD9A 3K6RA 3T6KA 2G1AA 3TIFA 3LC0A 2GILA 1VYVA 5CB4B 2XCIA 4WZBE 1H2ZA 2WYVA 1LPOA 1P4JA 1SEPA 4LX8A 4XGNA 4D8WA 4P6VF 3RM3A 2XGSA 4IG4A 4C7VA 4GUAA 4QREA 3FOAA 3BF7A 5EE1A 2I6UA 1NW8A 2A84A 2XGGA 1R0LA 4QWEA 4TSKA 1MRNA 3KBBA 4PLHA 2ZYWX 4HAVA 2QRVA 1ZINA 1NM5C 2I22A 3PDUA 2WKRA 1JMVA 5TQ0B 4FC7A 3KAQA 4LF5H 2PRZA 3ASZA 4OEHA 4GPIB 3LHKA 2I2XB 4R54A 3O82A 1SJ9A 3QENA 3PUYA 3MD0A 3T3NA 3N2NA 3NDBB 4EG0A 4DADA 2E89A 3IMCA 1GKKA 3NC4A 2DYKA 4L7QA 1W5FA 3PC8C 1JFSA 1L5ZA 2DQKA 2ZRMA 4TV8B 4QBHA 4TT3A 1PJ4A 4MV7A 3HA5A 1B4DA 5K6AA 4ATNA 3A27A 1XZFA 2PYIA 2AFHA 3JSAA 3EIOA 3FETA 4HCJA 3IAM6 4JOBA 5DSZA 4R41A 4DL6A 1A8UA 4HP8A 1XTUA 1CDZA 2CC2A 3FDSA 1XEFA 1P74A 3KYDB 2WB2A 2P2YA 1W4CA 4DIFA 4F21A 2B37A 3ZD7A 3LBNA 5ENVA 4Y67A 1SG9A 2OBFA 4PO9A 3TEKA 2XVMA 3GMIA 4CE6A 1HXHA 4R7ZA 1GM5A 4F50A 4B7UA 4JP8A 5A4DA 5JAOA 3B1ZA 1C8BA 2F4NA 1LLCA 4J16C 3HVIA 2G77B 3FBTA 4D6XA 4M9ZA 4RAQA 2X0KA 5D5QA 4C08A 3NC0C 1Y63A 1Y6QA 4ERNA 2HQ1A 3FPAA 3CKMA 2WD7A 5KT7A 4IS2A 3RUEA 5IKXA 3FUVA 1T36B 4HLQB 1I6LA 1GDHA 1M1UA 1KRWA 2NACA 3LA8A 1U9JA 3FHOA 4JBNA 4BJHB 2NNWB 2GOYA 3SX0A 5TT0A 4YR0A 5SY6A 3KTAA 5CLHA 1QDLB 1RSZA 5I48A 1P5JA 4HEQA 4OBXA 4M3NA 5KCZA 3AB3A 4ZCQA 4KO4S 4BBPA 1WP4A 1TRKA 5K4GA 3IIMA 1GPAA 3ETJA 5KO2A 2NYRA 1IH8A 2RKBA 2HH9A 4LAFA 2WAXA 1E1LA 4MV4A 1Q7RA 1A8IA 2BTQA 1M2NA 3BJYA 1JDUA 2LUOA 3WFZA 2O1WA 5HILA 2JFQA 1P1HA 5HIJA 1U3WA 3SY8A 1X7HA 1JFFB 4G0QA 4IIXA 1TAUA 1N4DA 3MAAC 4YAGA 2VDVE 4HLNA 1TAGA 1JA9A 4EATA 2L19A 4U63A 3G0OA 4LA4A 4J76A 2E4ZA 2IYQA 3RRMA 4JGGA 5HPYB 3T3HA 3D7SA 1MRZA 1IDOA 2AZDA 1DSSG 1NBEA 5AOAA 1RR6A 3OLWA 2I03A 4CQMB 4PLTA 4HFNA 1HH4A 5E6UB 3HWWA 3IV7A 1XKLA 2GK6A 2EFJA 5E2BA 4KITB 1VE7A 5EJFA 4AIRA 1JHVA 4HATA 5BSHA 1CJMA 5D51S 4PSDA 2HO4A 4F4HA 4J9OA 2Z8ZA 1U3TA 4TXLA 3TD6A 1C4XA 1CYDA 1QPZA 4TXMA 4D8VA 3UJ7A 3JATA 1T0JB 2VHJA 2G04A 3LCMA 1XQ6A 5BN1A 2J0EA 3SJZA 3QWAA 2L69A 4D80A 3W2IA 4ED3A 3ZHRA 2FMXA 4W8HA 2OLEA 4BFCA 3CE9A 2CLOB 2QF7A 4BGIA 4M9RA 4F9FA 2FOLA 3O90A 1HK7A 1RKBA 4D92A 1TGVA 4XKJA 3QE3A 4YAWA 3BIFA 3ADDA 2BV3A 4D5EA 3RSOA 2C42A 1Y34E 3MM4A 1U11A 4ZPXA 1TU4A 4G0ZA 1A4UA 2FRXA 2D1YA 5BYJA 4FQ5A 1FE8A 1HE2A 1ZG3A 4NE2A 1N2SA 1YL5A 3OPXA 2QTNA 1ULBA 3C4JA 4G1CA 2GB4A 5IKEA 2Q1UA 5CH5A 3SX4A 4AJKA 4EZIA 5EJ6A 3F8WA 3OZGA 1N0IA 2C9BA 1ZY2A 2QRNA 2KYRA 4ECTA 5TGTA 4PAGA 1RLIA 1QWOA 1X8LA 4NBTA 1HF3A 4H4CA 4MQEB 4TS1A 3HCAA 4HLUA 2QM0A 2A3RA 5FNVB 2AKEA 1IQUA 2GPTA 2Q7DA 5KYYA 4GPZA 2NXCA 2RHLA 2QAIA 5IJWA 1RRKA 1Y1WA 1NIPA 3ZE9A 5I60A 1C4KA 5ICEA 3OOHA 3N6RA 1P31A 4OYLA 5DN6D 4QNRA 3KZOA 2XOEA 3V4FA 1P80A 1V39A 4I4TB 4JBHA 1FZTA 4XX0A 5K8VA 3PU6A 4V2IA 4LK3A 2DFDA 3U1VA 4IQGA 5FPRA 1DXOA 2O1XA 4NBUA 2CXTA 2KWIA 1RQ7A 3HEAA 3MTBA 3G8DA 3TQ1A 3TI7A 2NSHA 2VDOB 2VZ9A 4CR7A 3KYJB 4D25A 3FGNA 5IH3A 3DOEA 2BR0A 4OHBA 3NHFA 1WCWA 3KXIA 3TM4A 1IPHA 4RH3A 5CUQA 3VR4A 1WETA 4O83A 4X60A 4RCYA 2JLYA 3RVSA 5FFFA 1RQGA 2HOQA 4XLLA 1UC8A 1O5OA 1P8JA 2XPCA 1JP7A 4IGAA 1Z73A 4EFBA 1JR4A 3BIXA 4DLYA 4A8JA 3L0OA 1BMDA 4YCSA 1TT5B 2CEKA 2VWGA 3VZBA 4BC0A 1DDOA 2CB0A 3BF8A 3WYDA 2PANA 1E2GA 1OLUA 2MINB 4IL5A 4H59A 4GMGA 2QN9A 4TLAA 1QHHA 2BM0A 1EWRA 2BFFB 1D4AA 1UMDB 1CUUA 1UMCA 4H35A 2F3TA 4RSMA 3TQSA 5HMLA 2BRUA 3FPHA 4E5KA 2BKAA 3USZA 1E9RA 1JSXA 4X1OA 1G98A 2QX7A 4X0EA 4WOPA 4TZKA 2QUAA 4MVJA 3L6DA 4LVOA 4N40A 4WKBA 2MR5A 1DX9A 3EQZA 2HDNB 2OK7A 1SKYE 1BJKA 3D6MA 4MGKR 1IN6A 3ILXA 4M9UA 3MIIA 4EPRA 1AUXA 1VHDA 3FMAA 1TYCA 3TRKA 2IHKA 4FQ8A 4P4LA 4E07A 4ARAA 4JUFA 1TB4A 3ZHUA 3RBDA 5KX5F 2R00C 1YZYA 2EBUA 5KVSA 1VZ3A 2EXXA 4Z1MA 2Z58A 3KTFA 3PPIA 1U8AA 4E1AA 2PR2A 2UZ3A 2GK7A 1Q12A 1MAHA 1BXZA 3C1UA 2GBLA 1KEPA 1PGOA 1YQGA 2RJOA 3E53A 1XQ1A 3TD9A 1QE5A 2AZ4A 4PZDA 3QZ8A 1B0AA 1U2RA 1IK6A 2PZBA 1E89A 1AOXA 3GG2A 5B7PA 1GUYA 1E5XA 1Q3TA 1A5AB 1Q7EA 2JAPA 3CN9A 2ZUTA 2GMWA 5DLYA 1WPXA 1CUZA 1OZHA 2B0JA 4TZ0A 3B6EA 3RVPA 1WCYA 1E5LA 4GBJA 2XNCA 2LV8A 1NXOA 2IUEA 2BZSA 4Y6PA 3I2JA 1VPDA 1FNMA 1U0TA 4N5LA 2XQIA 2GFHA 4RBNA 4B46A 2D13A 5LQJA 1SOAA 3U7QA 3N2IA 1PAUA 3QBTA 3Q8KA 4LYDA 4MVJF 3DFFA 5U4XA 2K5UA 1RYBA 2O3UA 2O07A 4FVTA 3H8SA 1I32A 3AVUA 4KJZA 1RLMA 1DDIA 3MUFA 1S3FA 4IIVA 4JB2A 1KPIA 1COZA 2W2OA 2EERA 3M9MB 2DC1A 1WOMA 4R83A 2RGCA 3V5NA 4P86A 3GD7A 1H8EA 5KTNA 3R0VA 1HTBA 1RHKA 3VSEA 2IU0A 3NP9A 5IBPA 2AW5A 1O89A 3GCWA 5FWNA 4MZDA 1PG0A 2WTNA 2YMPA 3FSGD 3DLTA 1Y5RA 1NNSA 1CY8A 1Q15A 2VQFB 1ZN7A 1E4YA 3BA9A 3KEQA 3OQIA 5GJCA 3BWVA 3O3CA 3KT8A 1I2DA 5KC9A 1R5NA 1ODSA 1AJEA 4U9IS 3KOMA 2ZS8A 1Z06A 2YNMA 3MS2A 3TNJA 3QE2A 3W79A 4GDFA 2LZ0A 2YZKA 2DZDA 3RTBA 2DTDA 2WHEA 4WDQA 3DS8A 5LD2C 4QQRA 2NVXA 5IM5A 3OX3A 4BGEA 4NIMA 1M75A 3LKZA 2BEWB 3M5WA 1E94E 5D8DA 4TVKA 4ECRA 4OGFA 1Z4JA 1DC4A 1MKYA 4IJUA 2ZRGA 1JIQA 2XZPA 5IKOA 3C4VA 3C3AA 1KO1A 4Z4CA 1CIVA 1RKVA 1ZRSA 2QJRA 1XFAA 4FDAA 1W88A 3P71T 2ZEJA 1QF9A 2CYAA 2JVIA 4LWPA 1C9MA 1G20B 2Q27A 1PL8A 3NEPX 2X5NA 5H59A 2E5WA 4KIFA 2G1PA 4RZRA 4CIXA 3AY6A 2I7XA 1O54A 2PSEA 1F6BA 3VI4B 1BZYA 3L9XA 4DMLA 5ALPA 2CLMB 3HN2A 4C88A 2PUDA 2O2ZA 2CVPA 3QE9Y 3RJ0A 4HWGA 3EEFA 3KWJA 2HF8A 3S2IA 1XZEA 1TA8A 3LFHA 1EX6A 4M87A 3AJAA 1TI7A 3LP5A 4QDJA 5FHRA 1VLLA 3CRW1 2QE6A 4J3JA 1KZ6A 1IJFA 1HQYE 2XAUA 3EWNA 3WI7A 2IIBA 1B2RA 1HA3A 3A2LA 3JALA 2IVFA 3MSXA 3S2FA 2P2SA 1B8PA 2GUGA 4R5MA 1E4OA 2RDJA 3LLVA 5IAKA 1Q0LA 1S2NA 3WNQA 3AHEA 3C7DB 3GJ4A 2YOGA 2R93A 5EINA 4E03A 4FSDA 4PG8A 5AUOB 2W8KA 5HKAA 1TWGA 3HJCA 1RQXA 2VZEA 5JLAA 1SVIA 4E1VA 1AB5A 2PKQO 3IEXA 4MRSA 1GPJA 4CCAA 3SIXA 1GAWA 4D4JA 1T2NA 3N2GA 2JA7G 4HGZA 4DQLA 3K8ZA 5CDFE 3A3KA 1OF1A 4WADA 2R65A 2AQKA 4GI7A 2JFBA 1UXGA 3UY4A 1KFEB 1T2CA 5IHPA 1XVTA 3OTHA 4B6JA 1TAHA 3MJHA 2P0YA 2CGEA 4CQLB 3WHKA 4FFLA 3RTXA 1ISGA 3SEQA 4DCMA 1CLEA 1RTKA 4BQQA 2C5BA 2O2IA 1W8IA 5DLEA 3HCDA 3CTMA 1WWKA 3DKRA 4CQNA 2ETXA 4TLCA 4IDFA 3SHOA 5KJ1A 1YUBA 4ZALA 3HZRA 1F2UB 5JANA 5JC8A 1JUDA 4OXKA 5TSDA 3H9CA 2ONZA 4P7FA 4K3VA 1NXSA 5KG7A 3BGDA 2I8CA 1L8QA 1RRGA 3ACBA 4UEKA 4ZYUA 5C1DA 1LZLA 2P62A 4FW8A 3QMVA 4MNTA 4YT8A 2V9CA 1F0KA 2JHFA 4YVFA 4C6SA 3NCHA 1R6AA 4MRPA 3KHTA 2IUTA 3F3KA 1V8ZA 1XWWA 2D2FA 3MHPA 4BKMA 3W5CA 5AW2A 2QMYA 3FDZA 1T35A 2ROQA 1P4HA 4I50B 2I8LA 1I7PA 2J9XB 4DSAA 3SI7A 4RD6A 1YRBA 4BNXA 2Q2TA 1O08A 2GKGA 4LYYA 1E2LA 3R3VA 4QPPA 2H92A 3JAWB 2F3SA 1NBME 3GI1A 3K6KA 1I2CA 1C3EA 4S35A 4P2GA 3PKJA 2OV3A 3ZV4A 1I33A 2JEFA 5EUCA 4RUCA 4NJMA 1MEJA 4F2PA 4AJ1A 4EG1A 1GVHA 4I9UA 1HKUA 4AN1A 4TMFA 1IM8A 1AGYA 4QJBA 2YX1A 1QKIA 5J40A 3TXAA 1NJ2A 4TWBA 3N41B 2QQGA 1WCIA 1JHZA 4I66A 1BKDR 4AIIA 2QJFA 4GG1A 3PD7A 3BMOA 1SCJA 3NHBA 3T5PA 4HS9A 1NVWQ 4C9BA 4IX1A 4OP1A 3NEYA 4QG7A 1E3LA 3IDZA 2BLNA 2QYZA 1P2VA 2W6JD 1G1AA 1NM5A 1MFPA 2EYQA 3OBBA 3INNA 1Z8NA 1SCAA 3BWMA 4GRIA 3EVGA 4OG2A 1FCJA 2B94A 3SIPA 2NZJA 1IBMH 2AMFA 3OPYB 3PNSA 4NFSA 3OOWA 3MRXA 4O2AA 1JIHA 3DAHA 3NHZA 4YO7A 4KBGA 2G06A 4ZQBA 3BFXA 1GQFA 4MARA 2FHPA 1O97D 4QOJA 3PHCA 4Y1RB 2I4MA 1II8A 3P5BA 2GA9A 3KVVA 4J1QA 4PW0A 3N6VA 3VH1A 2RDMA 4CYMA 2REBA 1A7KA 3TLEA 1KZ1A 3T35A 3WLOA 3NYWA 2OO3A 1H9AA 1LZKA 1SUAA 2H1CA 3IS3A 4NDAA 4EQ6B 4H0FA 5LDGA 2NUPB 4F45A 1L4FA 2Q45A 3G1TA 5TS2A 2PUBA 2ZI9A 1QIGA 3QVTA 4PLFA 4BNNA 4ERXA 1P9RA 3ZEAA 2IYXA 3FCCA 3BTSA 1YWGO 3TN7A 1Y8QB 5DBFA 2C97A 4GRAA 3GFGA 1XTJA 3PHLA 3TRJA 4HAUA 4JLWA 2UYGA 1PJLA 3WGNA 3TSCA 1FFCA 3EIWA 1U2DA 4Z3KA 4ZA2A 1RHMA 5JD5A 3UJCA 5LMUB 4IYRA 2Z9BA 4J16A 4PFQA 4DLZA 5B12A 3GUYA 4PBRA 1NDUA 3RSZA 5C1IA 4BVGA 2GZAA 2V5AA 1OXKB 5KNCD 2LCQA 2W00A 1YJQA 3B7GA 2VEOA 3QLTA 4GOXA 3ZDYB 3A36A 4DBVO 1DC8A 3H2SA 4QOFA 1KSFX 3TMKA 4O2AF 2P5YA 2VTKA 2FK1A 4QSHA 5I5WA 4EUHA 1E77A 4OBEA 3RFFA 1ATIA 1SVMA 2W7TA 1EXMA 3PE4A 2FOIA 3QUSA 2ISSD 2HLPA 1C9JA 5LJIA 2P7HA 5LZ7A 2H0AA 4FYHA 5KG3A 2L2QA 4D02A 1RWNA 3ZQ4A 5AO9A 2PBFA 3RSCA 3TL6A 3A05A 3U3OA 4BNTA 3HG7A 2ATIA 5JY6A 4EG6A 1NVKA 3G2KA 4RA9A 4OJKA 5C7OO 5EOVA 6REQA 4YJFB 3BD9A 1C0IA 4C3ZA 1C3LA 1HUQA 3D8BA 2ZIAA 2ZSUA 1UJMA 3L04A 3RK1A 3WRYC 2DT8A 5FBRB 3FHJA 3KZVA 3WHIA 1A7UA 1L7XA 1RXSA 4MMZB 5GONB 3VR3D 4HGRA 3OZBA 5L3RA 1AK2A 4K6KA 5EZ5A 4RKEA 1EJ2A 3G2JA 1UJ6A 1D8AA 3THSA 3WICA 1K9VF 1K7EB 2C9OA 3LX6A 2GZSA 2BHLA 4GIBA 1PQYA 3PLAE 3WL7A 2J3HA 3PKZA 1TPZA 3R23A 3I6ZA 4JKYA 3RAFC 4ARSA 3W2TA 3IPCA 4EF4A 4HDQB 5ALNA 2PUCA 1QHSA 2OKGA 1QHGA 5IT9W 3MJVA 1S01A 3KHHA 2W4MA 2YBDA 3AVPA 2R8EA 4EUEA 3CZRA 4RU9A 1L1FA 3QW2A 3PCTA 3F6SA 3KD2A 3IE0A 4U9UA 2BH2A 2FW9A 1FBTA 1K6JA 1IBLB 5EMMA 4NU6A 4CEJA 3ZTTA 5B7GA 4UNIA 3WK4A 1U9CA 3RC1A 4BY7G 1YJBA 3F2IA 3PDIB 1B6GA 1QK5A 2J09A 1HL3A 4M1YA 4UTOA 2F4VB 3SXUA 4MRVA 4LTNA 3AVYA 4BB5A 3KJQA 5EIFA 4EJFA 3THXA 5C81A 2VDJA 2QV0A 2GPNA 1DC6A 1UAAA 1UBTS 3O8BA 2PMZA 1NLMA 2B34A 3U7FB 4YROA 3BFPA 4Q37A 3WJAA 2WFLA 4FKZA 5TPWB 2HMUA 5BWMA 5JYEA 5T6BA 1QOZA 4IDBA 1QFXA 2NU7A 3FTEA 2ZTSA 1MA0A 1G66A 1ULSA 1USIA 2D62A 4IFTA 2APJA 2WYHA 3FYDA 2Q1TA 3T95A 4MCAA 2VF8A 1U2TA 2FPRA 4NY1A 5LC1A 1KXJA 2H08A 3PDHA 1G41A 3AILA 3UPUA 2IYYA 1ZD4A 1RMTA 3RRJA 5DRTA 2O3SA 3E3AA 1CBUA 3GHYA 2C2EA 2QYTA 4O3NA 2FLNA 3KR1A 5BPHA 5AQEA 3H42B 4C87A 2FWRA 5CLFA 2HNKA 3AKZA 1QHXA 4LJ4A 2OWDA 4NXMB 1TD9A 4RHCA 3TKLA 2FW7A 3BQ0A 5DU2A 1J5EB 2D3TA 4LSMA 4IDDA 3STYA 1WUIS 4MI1A 3GRYA 3UW3A 4RC9A 2DWQA 2R97A 4V0LA 3GRRA 5IWAB 7AT1A 3GBPA 4KIGA 4E5MA 5DYIA 2HK6A 1TW2A 3KELA 3B1JA 3CM0A 3A4VA 4GH5A 1LDGA 1L5HB 3NM4A 1WRBA 1WAMA 3G89A 5CT6A 5K6TA 4JI2B 1H2BA 4MA4A 4UNRA 4UTRA 2HNAA 4IIUA 3WDSA 5BNTA 1P1KA 4EGCB 3DMPA 1C0EA 3D3QA 3GLVA 5KQMA 2VATA 4RD1A 1GAQA 1IONA 1ZH2A 3QMWA 1M5TA 3GX1A 2UYCA 5TMPA 2JFNA 5KFXA 5HR5A 3OT1A 4ZEOA 4LQ4A 3VKHA 3H4BA 4FR0A 2Q1SA 1KF0A 2WJZB 3EXFB 2JAWA 3IALA 2Y0CA 3QY0A 1RMQA 4KACA 1WCMA 1KOGA 1R4MB 4REOA 4GMFA 4M8SA 4YRLA 1Z26A 3CSUA 3UGQA 3VC3A 4HQRA 3ROMA 3G23A 4JHXA 5BOSB 3A6EA 4ECYA 1PSWA 1HQKA 3AERA 4O81A 3IGFA 3ANSA 2ADOA 4O2BB 3UXMA 4A2AA 3HY4A 3WIBA 1GCOA 1JQDA 4PFSA 2C3PA 1VC2A 3BJRA 3DW3X 3Q9LA 1YCDA 5D5HA 2GGSA 1E4VA 5KFEA 1VI5A 4RJIA 2GTHA 1Z22A 1JZTA 4MA0A 4AJLA 3GO4A 3F2VA 2HHCA 4TMZA 3EZFA 3ICEA 4IF6A 2XNDA 3KOYA 4ZHQA 3LC2O 2YWEA 4R81A 4DV4H 4E13A 2XWJI 4D41A 4UOZA 821PA 3NHRA 2GT1A 3RS2A 5I4BA 3PE6A 3F8TA 1I2MA 4XR4A 2BFEB 4B34A 4B76A 4LXXA 1MJNA 2V4UA 2JI8A 3DQQA 4ENPA 2G25A 4L95C 4TWJA 2Z9DA 1AF4A 4D97A 3DGEC 1SC1A 1O87A 3RVBA 5I7VA 1Y5IA 3TFWA 1CY6A 1Z38A 4K6GA 5BUZA 3IUYA 3LWBA 2Y0DA 4KFTA 4KG7A 4Q03A 3PEFA 1C1DB 1J9EA 3SGIA 1W87A 4OBWA 1NVDA 1R0CA 3A70A 4ZZ1A 4CLRA 4UUPA 2HB6A 1C7IA 1C9YA 2BTOA 2FFBA 2WUVA 3GLHB 1VB5A 1XTTA 2ECOA 4BXOA 3CA8A 3VDQA 3T5KA 1Q2XA 2FFHA 3HGTA 1LBSA 4P32A 5FPOA 3EQ7A 1E2JA 3R7SA 4TN5A 5K3OA 1SD2A 2RB5A 2HMSA 2QMQA 3LCUA 3QKUA 4MTDA 1GRRA 4JC5A 2CHEA 1GGNA 4IF4A 3E18A 4ZHQF 1CE8B 2X77A 2P8JA 1ZJWA 4EG5A 3ME5A 4ESVA 1Z47A 3JWPA 4JLJA 1NVVQ 4G5OA 2DWPA 4O8CA 1LPSA 5CVCA 4L9AA 3MCZA 4O3PA 2YV5A 4YACA 5IJZA 4ZVRA 2A0KA 3V1NA 1WU7A 4UDYX 4WK0B 3E8SA 5HFAA 1GTL1 4KSCA 4NJEB 2HIAA 3AW8A 2Q6TA 2UKDA 4FE2A 3DKPA 3RF7A 1M6NA 2WA1A 5KUTA 4Q3OA 4KIWA 4CNBA 1KRHA 2X4DA 4YA6A 2PEYA 2UV8A 3IBSA 4P3NA 3VTKA 2AEEA 4CM8B 5EP1A 3CZ5A 3CRNA 1TOAA 1DTWA 4J49A 2DY0A 4OK5A 1XU9A 2E85A 3FR7A 3CUEF 4ODIA 4EA9A 3DL7A 4HEA1 1F48A 1XRNA 4WNYA 1W4LA 3VSBA 1ZU5A 2HBZA 1LX6A 1GXSA 4PGAA 3DYIA 3DBLA 4F8EA 2BHNA 4WKGA 1D07A 2JLRA 2JHGA 3ZGXA 5IC4A 1JTEA 5LNK1 3HY3A 2XI4A 4DDKA 4IRDA 1E3QA 1QC5B 2NTJA 2PKEA 2PKWA 3FFXA 4QYSA 2ZBFA 2HYIC 2CXUA 1K2VN 5GZ1A 4HNSA 4UKDA 4BRZA 1EA5A 2OC4A 1D8TA 5JHHB 1W7AA 1VLVA 5K51A 4TLLB 4INJA 4MTCA 4DAEA 3CPEA 2VAVA 1NJGA 3BGSA 1MZVA 4OV6B 2JFYA 1YZFA 2VTBA 4GOLD 3HUFA 4G89A 2WHQA 2JGIA 4KUEA 4O6VA 4KKVA 4UNSA 4CRWB 5E1BA 1GVNB 4AY4A 2Y2VA 2WFMA 5JWOA 4DAAA 3IQZA 1UPTA 1XBTA 1XRRA 3LT5A 1SKUA 1EP1B 1TJNA 2J87A 3T9CA 4HWTA 1BRTA 1N5KA 4OFXA 1M3SA 4R84A 4D3DA 1WB5A 4WACA 5DLGA 1ZP6A 2E2HA 3TQTA 5GMOA 8ADHA 3J80A 1P6UA 3KVYA 3C16C 2B4RO 4DUYH 3H5OA 3OCVA 2DOKA 5AK5A 3NVMB 1F6DA 3O0DA 3UATA 4QBFA 4ENSA 2JVJA 1QLWA 2V9PA 4DN6A 1O2DA 3IMGA 1KJWA 2O19A 3VNAA 2RGNC 2WR8A 1Q1BA 2Y9PB 4N3GA 3I4FA 4LJ5A 3QYJA 3OM0A 1IZ7A 1LK0A 5A9SA 3T4EA 1QFJA 4JJEA 4V0RA 1EFVB 2UUAB 4UEQA 2C2KA 4DV0B 3TDNA 4F96A 3HBFA 2QDXA 1V9PA 3FCEA 1SXQA 4V0SA 2A9VA 1A2QA 1WW2A 3A11A 4JFRA 1R8QA 2I6QA 4BE7B 3LDHA 5F21A 4MCHA 1UZLA 5KFKA 4WCFA 2I6SA 3DWIA 3LZCA 2B7LA 1OY1A 3BCUA 2CUTA 2OM2A 2ZQZA 3GEHA 2HWYA 4N82A 2OD7A 1OVMA 4LJKA 1PZXA 5MF6A 3ZGYA 4MLPA 1KY5A 3OJEA 4G4JA 3DC7A 3ZXYA 5KNBH 1N8KA 2UVPA 1UK8A 3N8HA 3V1MA 3AGQA 2QTCA 1FTQA 2FXVA 3KKPA 2HM7A 4L22A 3T1YB 4HUQB 2VYVD 1DKNA 1OXBB 2VXCA 2L82A 3KXPA 3E5MA 2P3SA 3PR5B 2MYNA 2C9MA 4GWLA 2D2EA 3VC1A 2CNBA 4BKUA 2WIGA 2J07A 1KOJA 4K26A 1TKBA 2B4QA 4WVFA 3BT7A 2IS1A 4OCZA 3VYTB 5CT4A 3BAZA 2CJPA 5EPEA 2DUNA 4O4JA 3EXHB 5C8YF 5L3SB 1NW7A 4D0RA 3FMGA 3C3EA 1JPVA 4N0MA 2CL6X 5CLIA 2X15A 3RGXA 4Y8VB 1KEWA 2OLSA 2B1QA 3IUMA 2AC2A 5DYWA 3FSRA 3OESA 2I7TA 2ZSIA 4YMWA 2C4NA 5C31A 1X39A 5E3JA 1S7GA 2P90A 3P2EA 3LNCA 5D3MA 1SC3A 3EG9A 2XUHA 3UXEA 5EXSA 4C0BA 2XT9A 3L1UA 4LVCA 2C7BA 2XMDA 1JHAA 2FW1A 3ER9A 3M9LA 2H54A 4GGMX 1CV2A 1ZD2P 3CPHA 1IYDA 2ZG6A 1AZWA 5IBQA 2WHYA 1JFVA 4QFMA 4ZT5A 2C0QA 5M04A 3K4PA 1ESDA 3EB9A 2UDPA 3PE3A 2VPPA 1XEWY 4MDYA 4EG7A 5HS4A 5ER6A 4CHGA 1S4MA 1KJNA 4X8MA 1KBQA 2HJRA 1QHNA 1WXGA 3OMXA 1T5TA 1PJBA 3CNOA 1E9BA 1PT7A 4A03A 1YDGA 1J90A 5H3CA 1TAEA 5BV2P 4NCJA 4NYMR 2OP0A 3U3RA 3RTGA 3IA2A 1OWOA 3GJSA 1KHTA 1I2ZA 4X63A 3Q12A 6ABPA 5H0IA 3FWPA 5EL0A 1E1QA 2C22A 2QL5A 4O4JF 3KJIA 4K7JA 2PZLA 4FEEA 1MORA 1P62B 3ROTA 2UVRA 4LF6B 5DHFA 1EXNA 1Y89A 3E7FA 1HNWB 3B7PA 5LXTA 4GSLA 5FTJA 3H9QA 3HB5X 4X90A 4XYLA 1K63A 3R24A 3VOTA 2OMEA 5CDHA 4INAA 1FW6A 1D6SA 1W5EA 2M6RA 7MHTA 1VQ1A 1OJ7A 4JI3B 2JDIA 4WKPA 1XQ9A 4P58A 4MR7A 5IAOA 5IVHA 1DXHA 5BMVB 4G0NA 1JALA 4RF4A 5C5DA 4D9HA 1JHYA 3GEIA 3T41A 1IZZA 1PR2A 3IP8A 3K20A 5DLDA 1WMDA 1OPXA 2OCBA 4C0WA 3WLAA 5GZ6A 2E5LH 4XGQA 3K3VA 4ALIA 2VTVA 3O1IC 5DKFA 5IWCA 4M55A 1E98A 5CT5A 3PW7A 5JNSA 4IVQA 3NJ4A 4R6WA 3A4MA 2GI4A 1MFZA 2PT5A 5EZQA 2OHHA 4W9NC 2FZ5A 3D0RA 4ZVKA 3H2KA 2YFQA 3E3OA 2VVTA 2FG5A 4ALJA 3MJDA 4ER3A 3OX1A 1GZUA 4LC1A 1U8YA 3LJKA 1E5TA 4QICA 2PQ6A 1B15A 4P4SA 2MWMA 3CRQA 1VSBA 5GTDA 5EKUA 3WK5A 4DPMA 1N56A 3DKVA 3WRYA 5LXTF 2FJPA 4B35A 2OPHA 3VHXA 3B6JA 5EWLA 3ESAA 4RV9A 1J2UA 2PN1A 4KX5A 3WV4A 3RFCA 4UMVA 1P2SA 3RRYA 2HF7A 1CJKC 1YCHA 2HWWA 3ZK8A 1FDRA 4O2RA 3BAAA 4RH1A 4A82A 1NP3A 4YMUA 3VAZA 2I4LA 3DBRA 5EERA 5THQA 5ILQA 1UXHA 1L3BA 1CQIB 4WFKA 1MT3A 3ZWNA 4L85A 4FONA 4MJLA 2XUJA 2H4JA 3L8CA 1E2BA 3BB1A 1QYIA 3DMRA 5MFZA 2EAUA 3IN5A 5DCYA 3A4LA 4AQYH 2AQHA 1S02A 4JT8A 4I1YA 2ATXA 2R6FA 5KFFA 4HNRA 4Y2YA 1N3LA 3KDSE 1N78A 1NP7A 4N0DA 1ODCA 2ZM6B 3PUJA 3LO5A 5EAIA 4TS9A 2BI4A 3SQNA 4MHTA 4KMMA 5J4HA 3FMFA 4JC0A 4OBBA 1BTOA 2C4KA 4QXQA 4FMBB 3C4QA 3WLRA 1CUBA 4MR8B 5JWHA 2XIQA 3SHWA 1U2GC 5IDQA 2X9LA 3RRNA 3BULA 1DCKA 1GL7A 4QDTA 1RAHA 4JXUA 3VRHA 2YCLA 3MRVA 3SD7A 3NYRA 5K8UA 1YNSA 4X54A 3NG1A 1E1NA 3I2YX 5JEEA 1FP1D 3RFUA 4U7WA 3HLTA 4G1FA 2H59A 2ZYVX 3NKFA 2NGRA 5B2FA 4HDSB 2CYCA 4MV9A 4RXMA 2WD9A 4GLLA 4YRTA 1G3UA 5FTLA 2QTAA 5JXHA 3OP1A 2CLEB 1K6XA 1RE0A 2CV0A 2PSSA 1UDRA 1QUEA 2QXUA 3NBQA 2IXGA 3IJRA 2HW8A 1QRRA 3U09A 3NR2A 1P9OA 1HR0B 1ZK3A 2ATVA 2EDAA 5DOZA 2C3OA 1LPAB 5I9LA 5E8RA 3DCJA 4K9NA 4DR7H 3REFA 1LDMA 4LX0A 4J6EA 3ZJYA 1ISHA 1CIPA 4B3DA 1DPFA 5BVGA 4ZWNA 4AUMA 3IMEA 3UHPA 1K97A 2I29A 5FEMA 4MUMA 5JD6A 1FTGA 5JUMA 3R6TA 2V55B 5BYBA 1V5WA 3ZIDA 4DYDA 4A3EG 4RTPA 2JVKA 2X1LA 1N2JA 1RXIA 4YAKA 2MYUA 1DIHA 3ZWYA 3U44A 2AH5A 4C05A 4FGRA 1B3RA 4FHFA 4G09A 2F1KA 4N12A 3OZDA 4AC9A 3ZY3A 3URMA 3WWPA 5KKCA 3HXMA 3NUQA 3TW8B 2HMTA 3HKBA 2XB2A 5FOSA 2X0SA 1I0LA 3MT8A 2HTEA 4LZOA 4MLDA 4UCVA 3ECSA 5FRDA 2WHPA 1XTPA 2YV3A 3CT6A 1Q0RA 3DNFA 3AHHA 3RFXA 4RENA 1SCNE 2WD8A 1SIUA 4EL0A 1V51A 4IDQA 1EESA 4QTYA 3LW8A 4BLRA 4KAFA 2Q29A 4Q82A 4WIAA 3WGOA 4KHPB 1GTVA 2HWXA 2GM3A 4MUKA 1E0AA 4XZ3B 1XZDA 1G2WA 2C7OA 4KMSA 2PVSA 4UCQA 5AKZA 2C3YA 4A3GG 5FKJA 3H84A 2C7GA 1XD2B 1W8DA 4FDLA 3K9WA 3ZV6A 1P0MA 3HR7A 3L0BA 4H3HB 2IS2A 2XWQA 4HNAA 1CR0A 1NQUA 2EGHA 1Z18A 4DCOA 2C59A 4LDRA 2VHEA 2DH5A 4P8RA 1JTVA 2Q8NA 2ZRFA 3BTVA 3PRJA 3I4LA 1DC3A 4LSXA 3QUTA 1HNNA 1CZNA 1NUSA 5CRIA 1Y8RA 3MJCA 1TQDA 1UZAA 1IOWA 3JQ7B 3KC2A 3S8YA 1TECE 1HLPA 4IEFB 1XAGA 4NEGA 2XCAA 4NYIR 4XIJA 4YAIA 3VX4A 2ODTX 1D0SA 3H0KA 2Z4TA 3RVDA 4NH0A 4WXEA 4RQBA 4ZU1X 1Z2OX 3N86A 2UXCH 3UMYA 1T2DA 2NVUA 3FLMA 5FBWB 4M38A 3V2UA 3GIJA 1GZVA 2BOVA 2Q9BA 3I39X 3QF4B 3S5JA 3G59A 2QIPA 3PW5A 1CC1S 1GU1A 5LLSA 3O0TA 3RB4A 1Q6ZA 2FF5A 2REQA 2G5TA 4N8DA 4I5IA 3UFBA 5FPHA 3ZQKA 1EJ0A 4CKCB 3UJHA 3SHVA 2C31A 5INTA 3DBIA 1YGPA 3WGHA 1MV8A 4TXNA 4OB6A 2MJLA 1HSZA 1EFAA 3T3OA 1MDFA 4FDUA 3AESB 1NFFA 1I9CA 1N5OX 4BMCA 5LQDA 4RQUA 3GN2A 2VIIA 1G9XA 4D44A 1JPNA 2IEDA 3FUUA 1BKYA 3AQIA 4E09A 1YA4A 5BWNA 2NSLA 4DLPA 2D6FA 5CB4A 1F5SA 3KB6A 4MYHA 2OQ2A 4DV5B 1IFXA 2P5UA 3ORYA 1X80B 2RHHA 2FMFA 3FB4A 4CI9A 4EGJA 4YJHB 3ZX4A 1MAAA 5AM5A 1JNYA 3C7AA 3IAFA 3PXBA 4Z4QA 4WPGA 3K53A 1MOZA 3DH0A 4A3MG 2YC2C 4B7CA 3GEPA 4YP5A 3D54D 3X1KA 4MW5A 5KJ6A 4LV6A 3ITKA 3G8CA 1FW8A 2YMQA 1E2KA 3USCS 3QUAA 4I5FA 5TQ0A 3KV3O 2JAUA 3PC7A 2IE8A 3IQIX 4DLAA 4PX5A 1RYHA 5JRZA 2ODBA 1U2ZA 4EVSA 3K2IA 2GN6A 3L2OB 4QDZA 2FPIB 1W4ZA 4Q1DA 3DMYA 1TQHA 3LXRA 2Z09A 2EU8A 2QTBA 1LK7A 3BMNB 2V03A 1Z0KA 4G0WA 2QW1A 3ZR4B 1QRUA 1LGYA 3OUTA 4MW7A 2OC9A 2RDIA 2R1ZA 4BNJA 2VWPA 4TMVA 1J49A 4M4SA 1CRZA 1DOHA 4TV8A 1S0MA 3QI2A 1UIMA 2QV7A 1HYQA 5JYBA 1E2EA 1I3MA 3K4QA 4YASA 4G81A 2X8JA 2BKLA 3H0EA 3TQOA 1X87A 4ZAWA 1Z13A 3HU1A 1WD5A 4JXKA 2COIA 3TB4A 2Q7OE 4CG2A 3H05A 4GEKA 2BP7A 4U0JA 4FEYA 5LQKA 2OFWA 3KYDA 4O82A 2V7EA 4KAXA 1J8VA 4G5YA 2D1QA 3B6ZA 3GL9A 1HV8A 1LDNA 2QQEA 1FRVA 1J9ZA 3HJGA 5C7YA 2I6GA 3KKKA 4BATA 5EXDA 2PSDA 1A82A 4XGKA 1RYMA 2F00A 2ZUSA 1HPLA 1OX4B 4IXTA 1ZGCA 4M7PA 1U31A 3RH0A 1KC3A 1B2LA 3AI2A 5IZ4A 2RHOA 1T36A 5FJJA 2FPMA 4CCSA 2WVHA 4AF6A 2QM7A 1ADCA 4H6XA 3K2QA 4YAJB 3T1QA 3S5UA 3NKLA 2F3PA 3QEBZ 4HFRA 1E1YA 4RDHA 1JEDA 4OP2A 5KCMA 1N3IA 3LUJA 2X6TA 2JC3A 4QEZA 4TV8F 3UZUA 3CH6A 4ADSG 1JLSA 4J2TA 4YAEA 2K7FA 4DV1H 1XCPA 2YIJA 4OJMX 1L0BA 3IHKA 2OZVA 4C7BA 1KTVA 2DBVO 1W1WA 1KYIA 3VI3B 4B4OA 2X7HA 4U7GA 2NU8B 2RGNA 2X2OA 1JFFA 2BMWA 3BRCA 1CJVC 3FFTA 3UO8B 1BO6A 1KETA 3RF6A 1SXJB 5IXJA 5CA0A 5GQSA 5GGXA 1NUUA 2M05A 4YIHA 1XTRA 3CVZA 1JHUA 2BM8A 3QNMA 1KU6A 3BJZA 3JS5A 3CNHA 1VGVA 1BN7A 4CQMA 4Y1EA 5I9TA 1HDRA 1RC1A 5E6UA 2WTAA 4NECA 1YA6A 2CBGA 5MFPA 4F4ZA 3Q6MA 1JDZA 2NUBA 3GP5A 5ED4A 1VP9A 1NR7A 3O8QB 4XIFA 1NVGA 1GY8A 2DFNA 4EG4A 1Z62A 1A9TA 4NXNH 2BKXA 3N3AC 5EXXA 2YXBA 5AOBA 3ANLA 1QU2A 4DL3A 5MGNA 5BUSA 4DJ5X 5IASA 3GJYA 3HBNA 3FOFC 1XOIA 3CE6A 4MXDA 1CD5A 3AJ9A 3IEMA 4C0KA 2XYQA 3KEMA 1UMBB 2B7CA 3NORA 5JCJA 3DULA 3O6VA 2BE7A 3JSXA 4NU0A 2RHWA 5E1DA 3PFCA 4HGQA 1YBMA 3EIXA 2UUBB 3ONEA 1NMQA 1UKEA 3A58B 2Y05A 1M1NB 2INGX 4N03A 3EF3A 5F98A 1PNOA 4MTEA 1V4VA 2X1VA 3WWEA 5DTMA 3RHTA 3VO2A 5DHTA 1CSEE 2R5FA 4L7VA 2QWXA 4WHMA 1E3TA 2B1GA 2YV1A 2YJGA 5AVOA 3WB9A 4OB8A 4TL6A 5CA0F 2P9HA 3WMRA 1J0AA 5I01A 3ND8A 4R2JA 1XVUA 4QTZA 1XXHB 2R8GA 1NMEA 4MQEA 4ENVA 1CFZA 1OB5A 4KGXA 5FNVA 1SXJD 3HOXG 1RAEA 3QV2A 3CJQA 2NZ8A 3LQ2A 4O7TA 3Q1KA 1OCEA 3HJFA 5FUWA 1