4IZOA

Crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
376
Chain Sequence
SPILPGAWLGMVGGGQLGRMFCFAAQAMGYRVAVLDPDPTSPAGAVADKHLRAAYDDEAALAELAQLCDAVSTEVPAASLDFLAQSTFVAPAGRCVAIAQDRIAEKRFIAASGVPVAPHVVIESAAQLAALADADLAAVLPGILKTARKGQVRVATAQEARDAYGSLGGVPCVLEKRLPLKYEVSALIARGANGASAVFPLAQNTHHGGILSLSVVPAPAASDALVRDAQQAAARIADSLDYVGVLCVEFFVLEDGSLVANEMAPRPHNSGHYTVDACETSQFEQQVRAMTRLPLGSTRQHSPAAMLNVLGDVWFGEPVTPPWDQVAAMPTARLHLYGKEEARVGRKMGHVNFTAATLDEAVAGATACARLLRIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title Crystal structure of kinase Phosphoribosylaminoimidazole carboxylase, ATPase subunit from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
total genus 126
structure length 376
sequence length 389
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4izoA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4izoA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4izoA01
5CAEB 3GIDA 4EA9A 2NU9B 3VMMA 4EGQA 4I50F 4FFOA 5CA0F 5CA1F 1I7LA 5C8YF 4YJ2F 3DF7A 3OUZA 2PVPA 4MA0A 4TV9F 2YZLA 3JRXA 1A9XA 1JKJB 4ME6A 2YZMA 4M9CA 3SE7A 3V4SA 2PBZA 4MV9A 4MA5A 4EG0A 1EHIA 5J2UF 5H80A 3U9TA 5LOVF 4O81A 1BXRA 4MV1A 2HJWA 4HNVA 5KKNB 3RV4A 1KUTA 1OBDA 4I55F 3R5HA 4YAJB 1JDEA 3U9SA 3LWBA 5JVDF 1EUDB 2R7NA 1B6SA 5JQWA 4DIMA 2YW2A 2V5AA 2ZDQA 3TIIA 1VBHA 5JQGF 5BPFA 3ORQA 2R6FA 5JVLA 1CE8A 4EA8A 2GQSA 3TQTA 2X0SA 2W71A 1PX2A 2QF7A 4MV7A 2FP4B 3JRWA 2DIKA 2P0AA 2R84A 5FNVF 3N8DA 4O86A 3R9RA 1AUVA 1WR2A 2YL2A 1GLVA 1Z2PX 4L1KA 2R86A 4GGMX 3V4ZA 2YS6A 1UC9A 4HNUA 4HR7A 3KAKA 2Z02A 2R7KA 1C30A 4FFPA 5LXTF 2YWVA 2W6NA 4O2AF 4DLKA 4O7WA 1JDBB 1DIKA 5LA6F 5HBRB 2FB9A 4WD3A 4ZHQF 2FPPB 2W6QA 5BPHA 5GONF 2W6ZA 1EUCB 2OLSA 4IWXA 2DLNA 4XZ3B 1CQJB 3K3PA 4IHJF 2CNQA 3NUAA 1UC8A 5LP6F 2ZDHA 4O84A 4Y8VB 1JLLB 3JZFA 3VPBA 4HQ6A 3VA7A 4IIJF 2NU6B 3R5XA 4E4TA 1ULZA 4C5CA 1Z2NX 2V59A 2FPIB 4FGRA 4QSHA 2NU8B 2GQRA 1BNCA 3R23A 5I47A 2GPWA 2VPQA 5IYZF 3KALA 1GSHA 5KX5F 3WNZA 1GSOA 1W96A 1GGOA 5CB4F 5J2TF 2W6MA 2NPOA 1KJIA 4M99A 4XYMB 3WO1A 2V58A 4ZOLF 2W6OA 2HGSA 3OUUA 4TV8F 2DZDA 2GLTA 4O7NA 3TW6A 4WBNF 4O4IF 1M6VA 4C5AA 3Q2OA 3MJFA 2CNVA 2SCUB 2WYOA 2YRWA 3ETJA 3AX6A 2GPSA 3I12A 5HV6A 3KAJA 3N6RA 2YYAA 1M0WA 3RFCA 4ZI7F 4XYLB 2NUAB 2IP4A 3BG5A 1CS0A 4O7LA 4FFNA 1EZ1A 4O7YA 1AUXA 1I7NA 3ETHA 2XD4A 5D8DA 2I8CA 5C1OA 1EYZA 3K5HA 4MV8A 4IZOA 5EZYF 3QFFA 1KJQA 1M0TA 2PN1A 2QK4A 4XX0B 2XCLA 2I87A 1VBGA 1CQIB 4MV6A 2DWCA 2VR1A 2VQDA 2YZGA 2R7LA 3MWDA 1W93A 4FFRA 3UFXB 1KJJA 2R82A 5LYJF 1Z2OX 4ZQIA 3VOTA 4O7TA 1B6RA 4M98A 3K5IA 4O7ZA 4FFLA 2W6PA 4EGJA 1PK8A 3ORRA 1KEEA 1KBLA 2W70A 1GSAA 5DMXA 3VPDA 4I4TF 3MWEA 4IWYA 2YRXA 4M9UA 5C1PA 4RZQA 3RV3A 2Z04A 3TIGA 4O7VA 3BSYA 4TUYF 4O7RA 4O82A 4MAMA 2J9GA 2R7MA 2CZGA 2CNUA 1DV2A 3WO0A 5JH7F 3G8CA 4C5BA 2YZNA 1KJ9A 4NYEA 3U54A 4EA7A 1VKZA 3VPCA 4O4JF 1IOVA 4EABA 3R5FA 3U55A 3HBLA 1DV1A 4O83A 1KC7A 2ZDGA 4J6EA 3GLKA 4YB8B 1KJ8A 3HB9A 1E4EB 1IOWA 4O7SA 3RUPA 2R85A 2I80A 5BMVF 3KREA 4YBZB 4FFMA 2CQYA 3BSWA 4MV4A 2YS7A 1SCUB 3LP8A 3JZIA 4FE2A 4FU0A 2NU7B 4EAAA 3E5NA 2R87A 3HO8A 4MV3A 3G8DA 4HNTA 4O2BF 2C00A 1E4EA 1OBGA 3BFPA 3AW8A 2FPGB 4O4HF 4YJ3F 1A48A 3Q1KA 3BSSA 1C3OA 5K2MA 4YAKB 4O4LF 1T36A 2VHEA 3TINA
chains in the Genus database with same CATH superfamily
3DT6A 3GIDA 1KEKA 4PX5A 4WLFA 4GKJB 2RGAA 1ZL2A 1KOJA 3FYUC 3INYA 3IHTA 3QVKA 1RTKA 3ZQ4A 5U9CA 3GZ4A 4ZEXA 1DO0A 2GCPA 5JCJD 3GIMA 4GAEA 1IRXA 4OLAA 4YAKA 4ALMA 3Q5DA 1KNXA 4IDPA 3CE9A 4X6LA 4DCTA 4BFUA 4BNUA 4W5NA 3WMEA 3SI7A 5M2QA 2JK0A 1OWOA 3TLCA 2RHOA 2YDYA 3KYBA 3V4LA 2PZFA 4A0RA 2HDOA 3GB9A 2ZSBA 2ZXFA 3GXBA 5L3SB 1IHXA 1C8LA 4MKRA 1UJ4A 1ZOOA 1CJTC 4BLRA 3QG1A 1IPHA 1CUIA 4OFBA 5BPFA 1HQCA 5IX8A 3RNLA 2D0PB 3KSAC 4B7AA 4JV5B 2PT5A 3UYKA 1U8CB 3TTSA 4ZODA 2O7QA 3M6UA 1N2EA 3V6JA 3EPIA 3RASA 5KJFA 3HSYA 4TX1A 4D3DA 1GR1A 4P38A 4KDCA 3SIWA 3LBIA 1K3TA 2YIJA 3L6CA 2I2BA 2WSLA 4BWYA 1YFJA 1U1EA 1J2YA 4Z99A 1Z6AA 5BN1A 1JA1A 5IFKA 4GXNA 1RK6A 5JS2A 4DADA 1YBAA 3ZLBA 2QLLA 3HACA 2OG2A 1E8MA 3CVVA 3O2JA 3B3QA 2H4HA 2PR2A 1RKUA 1RJQA 2YXBA 3U3ZA 5D6OA 1ORDA 4OGLA 5FI3A 3SWWA 4DCSA 2UUCH 5BSHA 3ET5A 2HRZA 4ED9A 1U90A 3M3HA 3HKCB 4FHFA 1NXXA 3GT7A 3GV0A 1OH7A 4RVSA 4QGFA 3R4VA 2HADA 1I01A 1TYDE 4WBNF 4JSTA 2HJRA 3VKGA 3L43A 1TYZA 2JK1A 3EXAA 3FR7A 1AN9A 5JS8A 2DWQA 2BGUA 3LUPA 3AXTA 3LUKA 1K0UA 3HJGA 2OORC 5CU7A 4Z0NA 3ZWDA 2DJIA 4LQCA 2GD6A 3FTDA 3SZLA 3LPNA 3FHLA 3T9DA 2BTQB 4HRAA 2YXPX 3GZNA 5C18A 2XNKA 4QUAA 4OHOA 2PTGA 1EA5A 3PJFA 1NC1A 1P1CA 3U4DA 1BRTA 2O48X 1UUFA 2BSAA 1Y6JA 1Z2AA 1QO7A 4TWJA 4TT8A 3HXMA 4YCAA 3L06A 4WTOA 1XWFA 2BEWA 3G6WA 3H5RA 3EEFA 2M98A 3ILHA 4QDZA 4IKPA 1TTQB 3T5HA 4CGYA 1GHTA 2AT1A 3KHUA 3RAPR 2CMKA 5I5TA 1G8GA 4KK4A 4KFTA 4DIKA 1F6BA 1UC5B 1JG1A 2QYZA 4YR7A 4RQAA 4W5QA 3DTYA 1QRTA 4NMXB 3WBFA 3J81A 3AFMA 1NXVA 1Y5RA 3CLRC 5CVUA 5D7BA 2WA2A 1WH2A 3VSCA 3THYA 2QRJA 1YUMA 2G4VA 4JLVA 2KLHA 2PV0A 5K8UA 3INNA 5AHXA 4UPEA 5F23A 2R85A 4R8LA 1PJSA 4FFWA 1MGPA 4BFZA 4R9UC 3A1VA 2Q2OA 3AL2A 4OU5A 1PR1A 1DXOA 1D1PA 4HAWA 1ECJA 3MIZA 2FWNA 4YIHA 1U98A 2AVNA 1YBVA 2NYUA 5HP4A 4Z9BA 2FCRA 4D1YA 1S2NA 2QTCA 3I8XA 1UP6A 3GJZA 4XCXA 5HQ3A 5B7NA 3FMFA 4KLAA 3C97A 2HIAA 4EUSA 4WSOA 2M6KA 2BBWA 1TM1E 1MJ5A 2G9VA 1IZ0A 5L3RA 1DHRA 1EM6A 1XPJA 2A5DA 1YB5A 4RK7A 1N3IA 3GPBA 3QBVA 4WXHA 3GLHB 4H6PA 4JJKA 4R01A 4Q6BA 4FNAA 3C7TA 2ZJ8A 1PBNA 5CIQA 4KIFA 4KGZA 2JCYA 2NV2B 2EWVA 2GN8A 3V1KA 4AX8A 2Z8YM 4BZXA 3LWNA 3BFJA 5DVZA 4L3OA 4DLUA 4U2KA 3JY6A 1P39A 1H3EA 4U4AA 2YWBA 4Y1GA 1UPAA 2BM0A 3S8YA 2KMLA 1GTMA 2Z6VA 3MNFA 5GGXA 2XWQA 5FPSA 1EUQA 5L3SA 5MGNA 2QJRA 1XK6A 5CDSA 2VP5A 2CZQA 2F9MA 3ZHUA 2GVDC 1KO4A 1RXWA 1Z5UA 4L02A 1HSOA 3HDQA 3H5TA 3Q8WA 3HNPA 1WZ2A 1K86A 5K4HA 2Q1TA 2WAAA 1O95A 2BDUA 4FDTA 2FB9A 4DC9A 3PC8C 1YHNA 1UXOA 4WY2A 2VHQA 1E9AA 3ASZA 3C0KA 1H66A 3QXSA 4OQPA 2FPXA 3NHSA 1QPGA 1AHNA 3O90A 4HNQA 1G21E 1M8FA 2HW8A 4PRLA 2GFQA 2PIAA 2YVUA 1WRVA 2WDZA 2KE5A 1ZQ7A 2P2LA 3L7MA 5KFPA 4OJTA 3VYSB 4Q8FA 1DC6A 3SZOA 4XGKA 2XTJA 1PZEA 3M5CA 4DLXA 5JXIA 5D5QA 1OH8A 2N1MA 2ZYHA 3CWQA 5HJEA 4X7RA 1QTNA 5IU6A 1GPUA 3U4HA 4MVJH 2NLOA 3HKCA 3H11B 2ASJA 4EG8A 4ETMA 3HKBA 3WGKA 1U8YA 5THQA 2AXNA 4JEMA 4FFBA 1Y5NA 1K7FB 5TQJA 3T1YB 3JSAA 4EQ6B 4XUCA 3FDZB 2NQ8A 1DX6A 4UEWA 2HA6A 4RFSA 4NICA 4JOCA 4JYBA 1NY6A 4WJLA 1GEEA 2F3UA 3N8HA 4OMFG 1OYWA 1ENOA 4TUYA 3CO5A 4QL3A 2H29A 3DYIA 2OC4A 3QTBA 1SQGA 3LSYA 1XLUA 2FX3A 2BTQA 1RKBA 2GSWA 4JP5A 1M2OB 4AMBA 4P3XA 1EVJA 1PR5A 4M87A 2G71A 2Q5IA 3S3TA 3KVYA 1I2AA 3ANXA 3OT4A 1GITA 2IU4A 1YDWA 2OQRA 4LVOA 5TQVA 2JJ2A 4EFLA 4PTZA 2O2XA 1CF9A 4RL4A 3V48A 2J0VA 1I6KA 5HR5A 4ARZB 5EHIA 2NVYA 2CXXA 2ZI4A 2ZJAA 3S27A 4YV1A 3K1ZA 1YE8A 2VQ6A 4X8MA 2XVYA 4BFXA 3NDJA 7GPBA 2IHNA 3QZUA 2HLNA 2HT6A 1XRMA 4OQDA 3VAYA 1IPEA 3Q7SA 4ECRA 4RU1A 2AQHA 3WS7A 3ZHVA 1P4RA 3MTQA 3AONB 3AM5A 3DFZA 2HREA 1GVHA 1U80A 3UAVA 1IUOA 3E7DA 4D41A 1PS0A 1KSHA 5KFNA 4D9BA 2J85A 3EXG1 3RUHA 4C4SA 2CC2A 1DB3A 2I2DA 4K9NA 3JQ6A 3O4JA 2LVBA 1D5CA 1DU4A 2AMYA 3ZJ4A 4ICIA 2JIQA 1GVNB 5JEEA 3MVEA 4DLVA 4KMMA 4DIMA 3PD7A 3UUEA 3GLHA 4QUJA 4YO7A 5C32A 4ENVA 4Z4IA 1GYRA 2QN8A 5C81A 2QV7A 4CMDA 5MN6A 4FCVA 1B8OA 1T1GA 3VR6A 4ZT7A 1KP9A 3HB1A 1UAYA 5DN6D 2DBZA 3HJNA 5KHAA 3N8DA 1QHXA 1FP6A 1N48A 3C6QA 1W4LA 3Q7PA 3RB0A 4BX8A 2HOQA 5ECDA 2QVCA 4U6QA 1HV8A 1I6LA 10MHA 2RDMA 4FYWA 1K83A 3ETNA 4GOKA 4R2KA 3ONFA 1M2WA 3VHRA 1R16A 5FBVB 3DWGA 1KYWA 3E2PA 5JZOA 5BPHA 1UBOS 1DLIA 2JKVA 4YRNA 1OYVA 4QIWE 2ILTA 5DM60 2IELA 1S02A 1TQ4A 1MP0A 1HKUA 2J41A 1Z4KA 2QKYA 1NONA 3UUFA 2WQ7A 4HYQA 2B1QA 3ZQUA 3TFQA 1MQAA 3OF2A 3R0VA 3AXSA 2BQ3A 1P2SA 3KTFA 2JS7A 3O1LA 5FJ8G 4GMKA 2HBZA 5DEOA 1I94B 3IHKA 2ZIXB 1JHDA 1CS0B 5DBFA 4DBLE 4A9AA 5KFQA 3V42A 1ELOA 1E79D 1N2HA 4LCJA 3DXYA 2HZ7A 2G7ZA 2IVZA 3FI0A 2JJYA 3PHCA 4Y2TA 4PRYA 4K8RB 3PVXA 2VA9A 3SYTA 3V80A 5K09A 1XTPA 3NHWA 1O96B 3E03A 5HF6A 2VK8A 4WV3A 4EK9A 1BJRE 1S3FA 3DVSX 3HXPA 1ESZA 3CVXA 3RK0A 4BPBA 2JCBA 1FSSA 3IIKA 4AQYB 2VYQA 1QIGA 1L4UA 2ZAMA 5G0UA 3H11A 3K2EA 2CKMA 3SFZA 2UVQA 1A98A 4QQKA 5KTYA 5EWEA 2HNKA 2PD6A 4JB2A 1P61B 1V37A 1XIVA 4AJ9A 4AW9A 3F47A 1T4MA 2FK7A 3H9GA 4B7CA 4MUXA 2Q4TA 3VR5D 3FDZA 4B3TB 4KRGA 1CY8A 2YVKA 5H16A 4NEGA 1IBKB 2H9AA 4KCGA 3EQ2A 4CMKA 5FDFA 4EZIA 1KE2A 5BQXA 2JHGA 1EFDN 4TYWA 5IJXA 3AFOA 1QIEA 4LH6A 3OCWA 5DTMA 2VH1A 3DZJA 3UMJA 1I3MA 3DVRX 1JQBA 1K7XB 4NC9A 2WFMA 1UT8A 4TMFA 1IUKA 1J24A 3ELUA 2AWOA 1FA9A 1ZGAA 4Z4GA 3P0HA 4H18A 1XZAA 4BRWA 4UU1A 4MUKA 4DV0B 4JYPA 1T13A 5JCPA 1E4EB 3IKLA 4YNBA 1KJNA 4DNQA 3DC7A 4FOLA 4PIVA 2PL3A 2PAFA 1RAEA 1K8ZB 1F2DA 3FWHA 5AOVA 1IHUA 4NDZA 4AJOA 1P6XA 2VQEB 3EZ9A 1DAEA 4HPXB 1G4AE 5HUJA 3OKPA 1U8TA 4ARZA 1WHSA 3I4FA 1LDNA 5KFOA 3WR5A 4UEJA 2GZAA 3NU1A 5G53C 3I1YA 3QVXA 5DK6A 2XMSA 4LXHA 4JLJA 2TS1A 3SXUA 3B5EA 1UK8A 2PXHA 3U2QA 1QQ5A 3JZMA 1C8BA 3K9QO 2CN1A 4Q15A 3GOQA 5H8WA 1FYDA 4YAGA 3DLCA 4OJYA 3MIIA 4J0GA 1E2LA 1FTWA 1PT7A 2B4AA 2ZSFA 2J7PA 3I5AA 2BGMA 4IIXA 4OQMA 4JXXA 2XEXA 4WERA 2CWWA 4B3MB 4MIEA 3IR5A 4OHUA 4UXHA 1A9PA 1WMEA 3UAZA 3OURA 3GLSA 5EIFA 2IYLD 1Z68A 4I1IA 1LQUA 5K03A 1TFUA 1CQWA 4ZRMA 4R3NA 4RXTA 4WK2B 4BMVA 4YT2A 2VTEA 1H9CA 4BV3A 4I3GA 3LQSA 3IAEA 3T9CA 4F2DA 4X24A 3EIWA 4DQKA 5SY4A 1OI2A 2ZWIA 1U8UA 1QP7A 3STYA 3C3YA 1UDWA 4I9HA 3EF3A 1NG9A 3OHSX 2HLPA 4XJSA 4F9FA 1LBIA 3D6JA 2Q2WA 3N2GB 5CTAA 1WR8A 5IDYA 3C4QA 1E62A 5JMOA 1FTSA 1MC8A 3KP1A 3A31A 3TTWA 1SULA 4QBHA 4CF6A 1YDFA 3QVOA 5B5SA 4QE3A 2AOXA 1DG1G 4DA6A 3ICQB 3MT8A 3NHRA 3V1NA 5AXDA 1CVIA 4EVIA 5EQTA 2C4NA 1AS0A 5C53B 3F97A 4MUBA 1M34B 1Y5LA 4QECA 3OHBA 1YC5A 3HRHA 3PFNA 2WSMA 2XDAA 1HNNA 4BMXA 1KRXA 3AVYA 3FFAA 4OJKA 1GGOA 2GN2A 1SG9A 4KPUA 1OR8A 3OIUA 2XMGA 5KNBD 3U1BA 2ZJYA 3M7IA 4LSGA 1F6WA 1DIAA 2X76A 2QQEA 3FCXA 5E9JA 2VDJA 1SUPA 1MB4A 4FYHA 1U99A 1H4SA 2FR8C 5ERYA 3LKVA 3SX0A 3I4MG 1QBGA 3WHPA 1JTFA 2JGLA 4KAFA 3U16A 3AR7A 4DRYA 3ACCA 2C7QA 2ZIXA 1CS0A 3ZEIA 3L82B 4M60A 3QZ7A 2FK8A 5KBYA 1SUFA 4Y6SA 4UOZA 5F21A 2O8FA 3Q7QA 1YZFA 4ED0A 2WYUA 4AN4A 3BQ1A 2R8ZA 2VPTA 4LHYA 1F6DA 4UNIA 4KLNA 4TVIA 4BVBA 3MPUA 1XL1A 4F5YA 3JQGB 1OWTA 1KARA 2YNMD 2Q2TA 2ZAOA 4M98A 1HDGO 2B0JA 3WV4A 4RK1A 4L28A 1H4QA 1A5ZA 4DIUA 4HDQB 2G08A 1YI8A 4GX1A 3TNFA 2ZK7A 1I0LA 2JD2A 2CV0A 5L1LA 3A4LA 1OJLA 2R8EA 3MB5A 4RM2A 2ZBQA 4RWEA 3HLKA 4NFLA 2PNFA 2CNUA 2P79A 3FWPA 3B20A 4G41A 3E4DA 4DYVA 3OESA 2A1HA 2WFZA 3L9XA 4HS9A 1FRVA 3TOVA 3C3JA 5JAUA 1F4VA 3BE4A 1KH1A 2V4RA 1IZ7A 4UDYX 5E95A 3QFSA 1GZUA 1PNTA 4H9GA 3IVXA 2I6TA 1Q0SA 4MWBA 1YB7A 1CJKC 3MTEA 1YCFA 1ZK1A 1KAQA 4OIMA 1KBZA 3S5UA 3UG7A 4TTRA 5KS8A 1SUWA 1JA9A 2VYND 4JJ6A 4ITVA 1E4EA 5KHOC 4OGWA 1SB8A 3HC7A 3DS8A 2ACWA 1JDZA 3WLQA 4JIMA 3DZHA 1H2YA 4DV3B 1V48A 3L49A 2FTKE 1AOXA 1EX7A 4JNKA 1IK4A 2UYHA 1ND5A 2VK4A 3VNSA 5JZVA 3FPFA 2E0IA 4S1WA 4XASA 3S8EA 1B14A 2OP1A 2D8MA 4BNDA 3F9IA 4M1OA 4F6LA 4B17A 1JI0A 3UQZA 3V8RA 4Q66C 4QGSA 5FTMA 1MB3A 3WJ7A 3W2IA 1Y80A 3KQWA 4IOJA 2NT4A 3CG4A 2C5EA 1GTRA 2C5FA 1E64A 3HU5A 3R44A 1ZC4A 4ATNA 1BS2A 2WD7B 1NRWA 1HDZA 1VHQA 2Z8XA 4K9KA 5DT2A 4L50A 3VDRA 3HVHA 4CODB 3ICEA 3NDPA 4P4LA 4OQYA 5E1MA 1JDVA 3T3DA 2H4YA 1YV9A 2QRMA 1MABB 1XZCA 3NTOA 4IXDA 3OLXA 1M33A 5FORA 1CS4C 3L7IA 4HEQA 4WESB 3R20A 2FXIA 4FKBA 4EF4A 3JATB 1PJRA 2B6NA 4HH4A 2IXBA 4BX2A 2XRFA 1U2GC 1H2EA 2XR1A 1F2UA 4LRTB 4J7CA 3DB2A 3IODA 2MSLA 3KQHA 2ZWMA 2ECOA 2EP8A 3E6AA 2B8TA 4JP2A 4W9RA 4KIJA 1YIOA 3IQXA 1N2CB 3OTQA 2BGIA 1T15A 1Y3DE 1UCFA 1XQVA 3N2GA 1WZEA 1EVEA 1GQYA 2I1WA 4Y8VB 4LSXA 3SICE 3KPJA 2P30A 4M9QA 1ZHOA 3EG5A 3MT0A 4PWQA 3FCOA 2G77B 3ZHXA 4ECYA 3GJ6A 5HKBA 2GPWA 2Q9BA 2WILA 5CXUA 4MP8A 3LYLA 4BU0A 4U1RA 1C3JA 1OYOA 2O2ZA 1GRNA 4HAZA 1AXEA 3HUUA 3UY4A 2RHTA 1M34A 5BR4A 3EUFA 2RDIA 3PO2G 4BC0A 2MT9A 1IZ8A 1L5VA 4PZPA 1BN6A 5ES4B 4YMLA 2RHGB 5BRJA 3EGWA 4Y1RB 2FW7A 2GFIA 2K4MA 2PE5A 4X7PA 3GA7A 4MUMA 2X1MA 2D5AA 3EQ7A 2RAFA 4RKWA 2N46A 5DO9A 2VDLB 2EC5A 4UBKA 2KSWA 3K1AB 4C14A 4E6NA 1C8VB 4QEDA 2JA5A 1JS1X 1N5LA 2WE6A 3G13A 5ALPA 2Y99A 4A0GA 3M83A 1TPZA 3EZYA 1AU9A 2P6NA 1PFWA 3ND7A 3FMVA 1XMOB 4RA6A 1KP2A 3AHCA 5BOVA 2I3BA 2OHJA 2YXEA 3EGOA 4K88A 3NIDB 1T8PA 1T26A 1QGUA 3JW8A 4QZVA 3H9CA 4RWZA 1S5PA 1OLUB 2CVHA 4KUEA 3HH8A 1JHVA 4QGHA 1Z35A 2WHRA 2ZW9A 1XWIA 2GD2A 3LUBA 4EPYA 3TAUA 5B2EA 2C4MA 3RG8A 3WOHA 4CR8A 1JLSA 1ZJ5A 1Z25A 1YKFA 3KJFA 2EATA 4DV1H 5JRZA 4Y2RA 4YHHH 2I7XA 1PYDA 1SZDA 4CG3A 2ZIAA 1EFCA 4KIUA 4ZYYA 4B4DA 3P2EA 4PDBA 4BO3A 4IDBA 4NBUA 4QARA 1J07A 4Q4JB 1XPOA 4PONA 2EFDB 2BGKA 2C59A 1G9TA 3L77A 5IC4A 4HFRA 1UM9A 4F3NA 1PFYA 1HDIA 4ACBA 3RYHB 4DQUA 3MRTA 5KQLA 3HEMA 4NNOA 1ATIA 1T2VA 3BHJA 3D4NA 3L92A 5KSWB 2Z56A 3CZMA 3GB8B 3WL6A 1PQWA 3URKA 1UIRA 1TPYA 4H7HA 5HOEA 1SOAA 4FZ5A 5LUAA 1ISIA 3TINA 2QX6A 1OWLA 3DHVA 3E53A 5J5CA 1ODKA 4C0HA 4KMSA 1PKEA 1E1LA 2JJ8A 3OZWA 3DHNA 2DFLA 1BJTA 1ZD9A 4Q4CA 3OJCA 1SC1A 4G36A 4MTCA 1I50A 5JAZA 2HJ9A 1LY1A 2PD4A 1DEOA 4G0QA 3WIUA 4CT5A 2PX2A 3IEIA 4ZYWA 2WP0A 3CX3A 3X44A 2E82A 1LTKA 3ADDA 1NF9A 2A86A 3N59A 1U0FA 2VF5X 2R4UA 2JLZA 5KHLB 5FEUA 3E8XA 2WKRA 3VOSA 2OFFA 1L3BA 1I3CA 4LE1A 3EWSA 1KR2A 4NZMA 5JYEA 4BJ5A 4B4WA 4KLRA 4R1UA 2P6OA 3KXKA 2F59A 3F8NA 2WD7A 5FNVF 4Q7QA 1BVYF 3DBVO 4MVWA 3NNNA 3WIOA 2FX2A 4R40A 4MDYA 2FU5C 4ZZ0A 4EF5A 2WWIA 4L08A 1NYTA 3VVMA 5CB4B 4J0FA 3QLTA 3ZGLA 4O5OA 3ECCA 2BKUA 1J97A 3IQIX 2O2IA 5DH9A 5BV0A 1T2NA 3N3AC 1LWNA 1MABA 3BACA 4EHHA 5NLLA 3P2OA 3M1AA 5T7BA 1VE7A 4ZGWA 2CJPA 2W6NA 2C4UA 3BWDD 4WESA 4R9SA 3IPCA 3RHTA 5KTMA 3JATA 3U1TA 2JBWA 4GM0A 2H65A 5D85A 3HU1A 2Q21A 1K66A 2BEUB 3KL4A 1GFWA 4KBGA 1V25A 3KZNA 2BHSA 4G4SP 4NJMB 4A15A 2PJDA 2J3MA 4DSNA 3I9FA 5C7IO 1DDGA 3BKWA 2X4LA 2P7HA 3JYHA 2V7UA 1N2CA 4IJWA 4BYMA 3I2HA 1F1BA 1IEWA 3CW2A 1MENA 4JC4A 4S05A 3FMPB 3JWGA 3F73A 1ET0A 3U81A 1Q0ZA 3QM1A 3PDWA 5DNVA 3ER9A 4GXRA 1C4KA 4NY1A 2Z3WA 2VPZA 3L18A 1L5NA 2ZTVA 2X41A 3GGCA 1F7UA 3KCNA 2CNBA 3M3DA 4Y1FA 3U4GA 3WIDA 1VDZA 1BAPA 1R0YA 1QRRA 2R44A 2YWHA 1QU2A 1HOXA 2PUGA 3G0HA 4YRTA 3RFCA 3ZDQA 4DCOA 5CFOA 3LLCA 3BXHA 4C06A 3TM4A 1CY4A 1W0KD 4OLHA 3L05A 1XDBA 4U6SA 1EIWA 5JCOC 2HKIA 5FWYB 2XT0A 2RJ3A 2EYQA 5AKXA 1JMKC 4Y1RA 3A11A 5CPBA 1YDEA 5LYJF 3CZRA 3U7RA 1L3CA 4UHDA 1P19A 4OL9A 1YVEI 2BZGA 4G86A 2QRLA 1IHDA 2CNNA 1JUDA 3ASUA 2FLNA 4LJ8A 3U4MA 3OKCA 3HEAA 4B3RB 1H2ZA 3GILA 2ZRDA 3NWEA 1KK1A 2A5FA 2FMFA 1VPEA 4N0MA 4BGVA 2CZGA 5JCZA 1M2NA 1P0FA 2IDMA 5BORA 4KQCA 3ABZA 5FV7A 4LGYA 1OLUA 3ZHTA 5JI2E 2ISQA 3EIXA 1SHJA 4ZIRB 3KTAB 3QP9A 2Z83A 4JI2B 1YCHA 4LF6H 2ZRAA 4DV7B 2RI0A 4B3CA 4R1SA 4D4GA 4KSBA 1TEXA 1WE2A 1H2AS 1SBIA 5IJZA 821PA 1P7PA 4L16A 4FU0A 3G0IA 3L4JA 1IJBA 5HGJA 3KV1A 4WFJA 4FBMA 4QGAA 4Q4JA 4EARA 2ZTLA 2R4TA 2V7QD 2J0SA 1ZH2A 1CUFA 2PRYA 2H3HA 3PGMA 5EKDA 2ZU0C 1KU0A 4PG6A 4B8ZA 5CA1F 2P3SA 4Y2SA 1TKBA 4NRDA 4Z4HA 2J9FB 2XAAA 2QJFA 1N78A 2PBZA 1KQPA 1FP4B 4KTVE 5F5NA 3BWCA 3U3RA 4ZXPA 2OEPA 1FNBA 3VZQA 1CY1A 4G5GA 5FA6A 1X8LA 5C1IA 4K0KB 1GKUB 1MVOA 1U2DA 4AIRA 3C3XA 4JB8A 5IZ4A 3TY9A 4LHVA 5H02A 5FBKA 1OY1A 2Y27A 5C8VA 1QH9A 3R6GA 1BCSA 2PCJA 2ZBVA 5AO9A 1EDEA 1GQFA 4DMCA 1QF6A 1AURA 4RV4A 4YRBA 5DYIA 1X9HA 2J32A 2C8KA 4NESA 4BVJA 2YC4C 3IPYA 4V03A 1PS8A 4DV6B 2A9VA 3OE4A 5LLTA 4ECTA 3PKZA 1XUOA 3OTGA 1W52X 4BAZA 2AB0A 3K6JA 1K2WA 4I9GA 1CKOA 2AJTA 2R6ZA 2XKKA 5AQ1A 2ODEA 1KETA 1XVUA 3K0AA 4XB2A 4HY3A 1A82A 1E79A 3MMXA 3HCRA 3JWIA 1RM3A 2C4VA 5CB4A 2MJLA 1WB4A 1Z6XA 2AU0A 2B83A 2DBYA 3VPBA 3OTOH 2FF7A 2JI7A 5ED4A 1E1KA 1REQB 4ZO7A 4X91A 3I04M 1UPBA 4URXR 3F71A 3R23A 3WOVA 1XNJA 1AK1A 1SIWA 1D8AA 1NVVQ 5LFAA 4R2JA 1B73A 2DQZA 5DG9A 1G7RA 2ZXEA 2BEUA 1P6UA 3NFYA 4B34A 2XXAA 3DD5A 3SVTA 4NJMA 2XGPA 3Q6NA 2H1IA 1OFIA 1Z4IA 3AOGA 3DPSA 2PU7A 4IDQA 1C5KA 2P0EA 3VR5A 4UE3S 4JI0H 3RKRA 4DE5A 3T5CA 4UHKA 1SH7A 4JLNA 4K9OA 4QD3A 2YJ3A 1KP3A 4RPHA 1JZSA 2CLDX 3O21A 3BHIA 2WRZA 4JASB 4LZJA 4JLSA 3I2IA 2QXTA 5M5BA 1DBWA 3VMFA 4CEHB 3SBDA 1XAJA 3QYFA 3PC3A 1Z6TA 3U60B 5IVIA 1VL1A 1G42A 4OM7A 4FHZA 4XRRA 2BMEA 4FJ2A 2Q41A 5FWYA 1P62B 4C0SA 4KI7A 1U0BB 3QQPA 4CTMA 5A2GA 5ALHA 3BICA 2NP6A 4EL0A 1DSSG 1ZU4A 3KB1A 3FGOA 3K4HA 1XMPA 4WI1A 3G8CA 2CMDA 5FX2A 3WLPA 3LCJA 5I01A 3E05A 4HGQA 1CJUC 4AL4A 3V3KA 3GX1A 4N18A 4A3KG 2CMHA 1W4AA 1RHJA 1T1RA 4GQIA 4Q01A 1FJGB 3KREA 1HYHA 2H17A 1SOWA 3VZRA 4PEVA 3RVPA 1M2VB 4HBZA 3C8DA 5J4HA 3W8NA 1L7OA 3NP7A 3KELA 2JAQA 2ZJTA 3W5OA 3HA2A 3F6CA 4G5RA 2C9MA 4KQKA 3H19A 1HKHA 5EKSA 5BR8H 1VG8A 3IL2A 1ULBA 4PFKA 4MB0A 2DCUA 3PF8A 4QWWA 1WABA 3UB2A 1I6UA 4NYMQ 3QEKA 3W1BA 5CA0F 1Z73A 5IULC 4PYRA 1QU3A 3WLOA 1W7AA 4XB6B 1K8XB 1HYEA 4V0LA 4X66B 3NPAA 4M6WB 1OA1A 4X20B 3EISA 1GDDA 2PJRA 3RYFB 1C9KA 4HDCA 2A9KA 5E8JA 4DGSA 3GAMA 1AMNA 2I99A 2R8OA 4URYR 2BJHA 2C2YA 1F7VA 4KXXA 2P11A 5FQOA 4G67A 3I2YX 1O6GA 3N0TA 4ZQFA 3E7FA 8OHMA 3WGUA 4I1OA 4YAJB 4MHTA 5NULA 1EJ0A 3JARB 4LE0A 2HF9A 5ALRA 5CFRA 2VAMA 3CUVA 5CDFA 4CT0A 2YW2A 1R8XA 2PEYA 2P41A 3QY9A 2YICA 2UZ1A 3AGPA 2GQSA 1PZNA 2IZ7A 5BSVA 1VIDA 4HXYA 1FVFA 3C7DB 3MUOA 1BU5A 2AJCA 3MFIA 3P96A 4Z4FA 3V33A 5KFIA 4ZMSA 2BRUA 4MGHA 1JEEA 3VDQA 2RK6A 1BFDA 4FXOA 1RI1A 3C74A 2BTOA 3O4VA 1P17A 3K0FA 4ABYA 1W4RA 4ZC8A 3MT7A 1OLXB 5KNBA 3PQ7A 3HR7A 4Q37A 3Q85A 2R7KA 5EI5A 1I4DD 1QAQA 4MEJA 3BD7A 2ZRBA 4GRAA 5FLXA 1JJ7A 1CZUA 1P5RA 3DFKA 3KEOA 1Z7EA 4IYJA 3ENNA 4G84A 5BW8A 5DU2A 4LBVA 3KJGA 4TTAA 3UF0A 5JU6A 2GN9A 3ZVKA 1JZQA 2EBUA 5BSKA 4Y2HA 4BAUA 2GEVA 4PGGA 3WGOA 3DDCA 5CLHA 4OK6A 2RAUA 1WL8A 4L0QA 1VAJA 3I4LA 2FFHA 4H7JA 3H1PA 1JHRA 2O5RA 4PSUA 3ZTTA 3DTFA 3SVLA 2RHMA 3RYIB 3HJBA 4ZJYA 4ZOLF 4Q4HB 4PLZA 1ZH4A 2YNMA 2ZCJA 4G8DA 3R0XA 1WB9A 3Q40A 3S2SA 1TFRA 4O3QA 3M49A 5KU1A 2VJCA 3MTDA 3ZY2A 2YDXA 3EOBI 1T91A 3KE8A 3JR3A 3ADCA 1Q2XA 2HDKA 1D6JA 1E6MA 4IEEA 5ALYA 1E89A 5AW0A 3IKTA 1VE3A 1RI4A 1F1JA 3NWBA 4GKJH 5KFUA 3LS2A 2FA9A 3BXZA 2EX0A 3B9RA 2P75A 4JROA 3ICWA 5BQ3A 1PU2A 3T5JA 4QFDA 2NO4A 2R3SA 3UQYS 4EJSC 1H8EA 4DNFA 1EGVB 1P1HA 3Q72A 5I9LA 4PCLA 3ELWA 4EEKA 1ZRHA 2BBOA 1PSDA 5CW1A 3O31A 5AK3A 1FYFA 1HZZA 3NBZC 4CLXA 2H52A 3SHFA 4D5EA 1KRHA 1R6DA 4MUFA 3S1SA 1ZN8A 4OXKA 3QW4B 5LDHA 3NTXA 3QZ8A 4Y6RA 5JTTA 2VYNA 3URMA 4MZXA 4CR7A 2WR8A 3BSYA 4OGKA 2QG4A 2HIGA 5CR5A 2M6SA 5EDWA 2BF7A 5SV2A 5H83A 4RIGA 2IRWA 2VAWA 5B3AA 3PUVA 1N2OA 1WZIA 5CYFA 2ZULA 1DKPA 4KV7A 4O2LA 3JSLA 4JV5H 4IQ0A 2BUCA 4J90A 1FW6A 1XYGA 4DC0A 1UMDB 1L7AA 4ZN6A 4LC9A 4IQGA 4RUAA 4I1UA 4BLWA 1IM5A 4X1OA 3VNUA 3KDSE 2B69A 2OM2A 4I1PA 5I5SA 3BRWA 1N0VC 3VU0A 2FH5B 2B25A 2O59A 4HEA1 2GEFA 1EE9A 1T3HA 1X70A 2ZSIA 2O8CB 2CVPA 2HWXA 3MAAC 4GXTA 3KR1A 5K0EA 1KYQA 2BEVB 4TS4A 5ALZA 1FXWF 1M2VA 3LW7A 1Y3BE 3LWDA 3F5DA 2IYFA 4S1PA 4N47A 3K8OE 3DV2A 4OX9H 4YR0A 4BVFA 4M9CA 3RJ5A 1CR1A 3RG2A 4G1CA 4B84A 2EJBA 5HXAA 1FKAH 4E09A 3GRAA 1MTZA 2B9VA 2EQAA 4U5QA 3GRYA 2FKAA 1T0JB 2ZYWX 4QHTA 2PYIA 1FLDA 4X20A 2B5OA 4JCOA 1WZUA 3IUYA 5HHTA 4AJ2A 3RYFA 2ZS9A 3H75A 3NMUF 2WV7A 1YOBA 3T1HB 2OXCA 4NMMA 1L8AA 3G2OA 4AS3A 5FP0A 4I5GA 1J7KA 4JJZA 1XJ0A 1VSTA 3JARA 1T5BA 5H1YA 3U17A 1A8SA 1S2OA 3RROA 1BX1A 1YA4A 4JAVC 2PX5A 3IELA 1QFJA 4D99A 2UUAB 1AUVA 3IVMA 3L1HA 3AY0A 2FN4A 2B7LA 2RD2A 1QRUA 3IG0A 1WW8A 2VP2A 2XVAA 4I9FA 5EIXA 4Q3CA 3QWFA 5KFJA 4DCMA 2NYAA 1IQRA 1II9A 1RSZA 3RVLA 3IDAA 1PFKA 5TRTA 2LDXA 5T8KC 1QIMA 3DYVA 1KVSA 4M0KA 3D2AA 4KO3S 1Z28A 1OLXA 3OEED 1W8DA 4UCFA 2WSIA 3AVOA 3DYBA 1O0BA 1E4GT 5JFTA 4JJEA 1CNEA 5B2FA 1E1CB 2V4MA 4UCXA 4EFEA 5K05A 3NTQA 3MGBA 3CCCA 4FT4A 3EXEB 1J8MF 3KKOA 2BYTA 4O3NA 3RHFA 1RQ2A 3DGEC 2JLYA 2JI9A 1NXSA 4BNLA 1A3GA 4I14A 1CJVC 4MDHA 4H15A 2PGJA 4JWKA 1SXIA 3MJEA 2BAGA 1S0NA 2IYPA 1T6ZA 4RAOA 3CKKA 3B85A 3RTDA 1WB6A 4OI2A 4JLWA 2VAVA 1A9OA 3IUQA 2P90A 5C8ZA 3GZTB 2D1FA 3RYIA 1FDVA 4Q4HA 4GYYA 1IN4A 5DI3B 1YF3A 3AEXA 1UJ5A 3QBJA 1ZC3A 2JB9A 4PV7A 1UH5A 5F9LA 3F67A 1TI7A 1XQWA 9MHTA 1AN0A 1IZ9A 4WA8A 4S24A 1G66A 2CXNA 4LAFA 5AOBA 4E30A 3FBGA 3RYCB 4D3XA 2VSFA 2OD9A 1KJJA 1V2HE 3WGTA 3CVYA 2I7DA 1FTYA 3CPEA 5D1NA 4XVRA 1U3FA 2QD5A 2VJNA 3CVOA 3R40A 4WE3A 1ZD5A 4WA7A 2Y1OA 3I9LA 5L6MB 4Q48A 1L8XA 2DPMA 2XCQA 4L8VA 4I4TF 2RI1A 4KN6A 3MCWA 2PZKA 3VR6H 2WWTA 3Q8QB 2R93A 3T7AA 1EK0A 2A94A 2FWIA 5KAMA 5ECYA 2JBAB 2AN3A 4LMBA 1FQKA 1N2ZA 1V26A 2Z98A 1WV0A 1G3QA 4H6XA 1Q6ZA 1LBTA 3EWIA 1G5IA 5K1ZA 1D07A 3E2IA 2ZDGA 5L51A 4UM7A 3LOUA 4TV9B 2WAQA 3SR0A 1HNXB 1X86B 3D31A 4N6NA 1P33A 3KYJB 1ZVQA 1DKLA 1ZCAA 4DQLA 4N7MA 5CCDA 1JJVA 4U9UA 2XYPA 2OBNA 3OEHD 4Q3OA 2CXUA 1GCAA 4X64B 3VJLA 3R76A 2HA0A 1LRJA 1IY8A 2CYBA 4UD2A 2HU5A 3OD1A 2ZUBA 4QQNA 4OKNA 3CE6A 2YJ6A 1PT8A 1Q0UA 1NJSA 3WGJA 2QTGA 4CETA 4GEKA 1T6XA 3PX3A 4G2NA 3Q0EA 4E4YA 1UFOA 1VPDA 2P67A 3FE2A 3A58B 4L85A 1LZKA 3W77A 1NVMB 4QPZA 3H2KA 2B21A 3SIPA 4GX2A 2O8CA 4ED8A 1XOIA 3FNIA 3ZZ1A 2C2RA 4E11A 3NHUA 3C3AA 4LDNA 1UFRA 1ZN9A 1WF3A 4RGBA 4F86A 3FB1A 1JHPA 1L4EA 4M1MA 5GV7A 3K8YA 4JN6B 1ZISA 5E1BA 5HKLA 4JX9A 4Q82A 1R66A 1N5RA 2ZI9A 4LK3A 1NRXA 3QEBZ 5TPZD 5DG7A 5JJKA 2UYGA 4GE3A 3HDHA 4URFA 1MDBA 5JHHB 1WDTA 1PR6A 3SJZA 4FS1A 3GUYA 2EVWX 4G8JA 4MV7A 3VXKA 2RG1A 1D6SA 3O8DA 3OZRA 3ZTWA 2WKPA 1JE0A 1AB5A 1BKDR 4JUDX 4YRQA 3P52A 5KVQA 5TVGA 3QLUA 2OWOA 1FUEA 2QDXA 4MLZA 1YR1A 1XCBA 4GUAA 4UHHA 1P9WA 4PAWA 5E6SB 3ZEAA 3KU1A 4KXNA 1GQQA 3HRKA 3ETCA 1TYCA 1RJDA 3IOEA 4L6IA 4G1VA 4CQNA 3KOWA 5FYQA 4TN5A 4YQFA 2YMLA 2IPMA 3UMFA 1EZ4A 1RWKA 4HN9A 2FSVA 3I1JA 2HO5A 4W8OA 3L84A 2ZBEA 4EQ6A 1YQ9A 2IITA 1MNAA 5LDDC 4IGKA 3MGCA 1KDRA 5KX5F 5FR1A 3EW7A 2XYHA 1G8PA 4ECSA 3SNOA 2OK7A 1F8XA 5J2TF 3CSUA 2H4FA 4RSGA 3V7NA 3T3GA 2ZRCA 3KQKA 3GY0A 2MSNA 2R8PA 4HH3C 2QRZA 4IIBA 2H57A 4NEHB 3B7WA 2WF6A 1E1CA 1M2OA 4TN1A 2OV1A 1XQ9A 2A7QA 3EXEA 3O5AA 4ND6A 4M38A 5DLEA 1IJKA 3T5DA 3Q3VA 1R5OA 4YREA 3AB8A 1L7MA 4CLHA 2DKNA 4BLUA 4ON9A 4DL5A 1NZFA 5JJCA 1LQ2A 1GAWA 4AF8A 2VAPA 2UDPA 1FE8A 2ZPTX 5E4FA 5ICGA 1UPTA 4EVQA 4ZXFA 3ZIAD 2HHJA 1KO8A 3D43A 1BS1A 5IVKA 2DAAA 3MJ4A 4OHCA 3TI7A 2BKXA 4IV8A 3EFHA 1JXQA 3EIQA 3NT2A 5DI3A 2Y0BA 4UU7A 4H1UA 5HZKA 2QI9C 4X9XA 3LYAA 5BYBA 3IXQA 3JYOA 1I2LA 2CKZB 2PQ6A 4PX2A 3ZU6A 5DGAA 2Z5FA 3OICA 4Q0MA 3LDGA 3W5VA 1F2VA 2BGRA 4P0QB 4B3SB 3EEYA 2J07A 4UZFA 5EE5B 3R3SA 1RJWA 1ENYA 2PLFA 3RYCA 3ISJA 3A25A 2NV6A 3RTBA 2DWUA 4LG1A 2ORED 1UPCA 3H8VA 1SKMA 4XDGA 2V7QA 4ZVMA 3TKAA 5JDIA 4BO2A 3FMAA 2PWYA 4WKGA 1H0SA 5DW3A 3LULA 1TWAA 2FMIA 2J3EA 1WUJS 5G40A 1HWYA 3AEYA 2MYTA 3AFNA 1FDIA 4DAAA 3HN7A 1F8FA 2BZSA 4YV7A 2IHZA 4E5SA 1KK3A 2JBAA 6ABPA 2M6LA 3W6ZA 4H27A 3WL8A 4J9MA 2I4MA 2BMJA 5FYDA 4UVGA 5JXHA 5LZ4A 1IVYA 3AOEC 3PXUA 3VNBA 2ADMA 4TV9A 4K86A 4Q9NA 2Q27A 1XPRA 3PD0A 1W76A 4MVJP 3EUEA 4C76A 2HPHA 4O4LF 3O4RA 3CLTC 4UC0A 4QOGA 4ZEOA 2HQ1A 3LT4A 1QYDA 5CG1A 1QX4A 2H11A 3DZGA 1P6QA 1INLA 1UFVA 3O3OB 1XC7A 3O9ZA 4CR6A 1V8OA 4D9NA 2B0CA 5KFDA 1I7SB 2FMTA 2YZMA 1N4AA 1T10A 1HYGA 2P4HX 3IJ5A 3DAAA 5J4YA 4TXNA 4PY2A 3KB8A 5LR6A 4N8SA 1R7RA 4IG4A 4L0MA 4O81A 5BWRA 2P9ZA 4ESHA 3UZUA 3OMXA 4LBYA 5CBPB 3KB6A 1GCUA 2FQXA 3HPRA 3W1EA 5D3KA 5E3HA 4V0MA 1M72A 1QJCA 4K9SA 5KOYA 1CC1S 3I6IA 5DMHA 1VMIA 5DYNA 4LOKA 1SEPA 3FKIG 5D00A 3VU3A 3GJRA 2BGJA 2YQ5A 4XKJA 3C45A 3GGPA 5HF5A 3ZE7A 1IM8A 4RTRA 1CBUA 1HFKA 4WPGA 4MW2A 5HCUA 4IRCA 4HEA6 2BR0A 4JOBA 3KOMA 3SK0A 1NDUA 2I6XA 1JIIA 3D0OA 1KOLA 2CFOA 1H2BA 1RWBA 3BMOB 2NZUG 3NUGA 4UKDA 5E9AA 2QJWA 2MHCA 4MCIA 4AQYH 2R86A 2JH3A 3P9ZA 3EIEA 3H18A 4OSEA 5FV4A 1OZHA 2P4SA 3ZOKA 2EKPA 3RSFA 4F3CA 5AR1A 1NTRA 3IBCA 4OBWA 4X6YA 2YWVA 5CT5A 4BNMA 4DCNA 2HJHA 1ZGHA 1UBLS 3T5MA 4JMLA 4HH1A 1U2QA 4B3TH 1O96A 4FJ0A 5TPWB 1QVRA 1P7WA 2F55A 1O77A 5E6SA 5F9MA 5FR2A 1KT8A 3IB6A 1JFTA 4OP3A 2EHDA 1WXDA 1FLAA 3BJEA 1YZGA 5JBQA 1NQ5A 3TKYA 4E31A 4MWTA 4UCQA 4H7PA 4WLEA 2GQRA 5L4SA 3FGPA 1XA4A 3ZLVA 4DIOA 2I71A 3KALA 1IRIA 1ZW1A 2BFFB 1GSOA 1B7GO 1W96A 3QXJA 1ZKMA 4PZUA 1TT7A 4PHGA 3DLTA 2C4TA 4ND4A 2IZ5A 2Y1KA 1O1YA 2FMXA 1HNWH 3P20A 1M1UA 1MF7A 1JIKA 4LW8A 1OX6A 3P9QA 3HDJA 3X3HA 4QU0A 4MS3B 7ABPA 4D8YA 2H48A 4QJ4A 5JCJA 2IDZA 3A3OA 4CQJA 1KZYC 3DEHA 1L7XA 2NM0A 3L4EA 2VQEH 4OB6A 2ACVA 4EY8A 3ZDAA 4RM3A 2H0RA 2O7RA 3L41A 2CEKA 4DV5B 3DOIA 3AFIA 3O82A 2F1OA 3K09C 3U26A 3KQOA 2OO3A 4OLJA 3ZV6A 2QTFA 3F90A 1HE4A 5D1OB 3PUXA 3BFVA 2DLDA 1ZRNA 4ZARA 1JSLA 4NYIR 2JGJA 3TQRA 4A91A 3I2JA 2B63G 1SY7A 1DPFA 3EIFA 4BQIA 1IN8A 1S8OA 5IP9G 1NYLA 1X7YB 1JQ3A 1JRLA 1T29A 4BWGA 2P0YA 3MOGA 3AIOA 4M0UA 2I76A 4JJAA 2GJKA 4IICA 3R0IA 4B3MH 4RD4A 3HUFA 4CRWB 1EX1A 1G291 1QLWA 3I62A 3GF4A 3E23A 1U3VA 1KZ4A 4EZEA 3AUAA 3WNDA 4M53A 3HDYA 5JYDA 4M0LA 2AFHE 4E4RA 1AQ6A 5BR1A 1EESA 4H4DA 2YHBA 3ZS8A 4EABA 4M2LA 1CKNB 3NPMA 3RARA 3NAMA 3GAAA 1TC2A 4Q47A 1H5UA 4AY3A 1T1JA 2BLLA 1X80B 4JL5A 4XCQA 4KODA 3E7WA 2HUNA 5K3WA 2NG1A 1OOEA 4OOEA 4P4TA 3L2OB 1OV6A 1W47A 1GTJ1 1P7YA 2PYDA 2XT9A 1DKOA 1OBGA 3UHPA 3J7AK 3CLSC 1P0QA 3AKCA 1GTG1 1TM4E 3ID6C 4PZLA 4I6JA 1EXVA 3FYCA 3TLBA 5L3QB 1RZ3A 5AKZA 5CIYA 1F60A 2AK2A 5IVDA 2YXLA 3OOEA 4OB7A 3R7FA 3AUUA 3EBOA 1WEKA 3SM3A 5KYKA 2EZTA 3I58A 1QFYA 1GRVA 2JIMA 2RGXA 2O0KA 3MWYW 4XM0A 4HMPA 1ARZA 1NFFA 4OU4A 3TIVA 4C05A 5KJEA 5BQFA 4NMWA 1RI5A 1UMCB 2HQOA 4BGDA 2WVJA 1NQOA 5DP2A 2O5EA 4J9NA 2Y0SA 3QYPA 1P2TA 4R98A 3R0QA 3T3OA 3UGTA 2V4UA 1XJ5A 2I65A 3BB3A 5SYAA 4RTJA 2QORA 4MS4B 3T35A 4HL6A 5CBPA 4KFRA 3EVGA 4EQ5A 3IILA 1AA6A 4HAYA 2XGSA 4MWGA 3VZCA 1D7AA 5DLYA 3IV9A 2C82A 3G2IA 1VYTA 4P7BA 1RPZA 3NHZA 1TO2E 3PFGA 5LCXA 4BBJA 4CE6A 1GLVA 4CZ2A 1SUAA 5KYXB 1XMIA 1YQTA 5L95A 3I0NA 4E21A 4JIGA 2BFWA 4WOPA 3U7EB 2GFHA 3ND9A 3BMOA 4MGYR 2CL5A 3D8NA 3AB7A 4MYRA 3Q0TA 2OV3A 3N2LA 4IWXA 3G0GA 1WV1A 1E4FT 4FBGA 1E1QD 5HIKA 1ULZA 3DBOB 4JENA 5JAQA 4KVGA 1AC5A 3E35A 1E6LA 3JQGA 3Q12A 1TADA 5EJGA 3PN1A 5TPWA 2DX7A 4I6GA 4I2NA 2V1UA 4RZ3A 1F48A 4M99A 2PPVA 4D4KA 1GGMA 4DCUA 2GCNA 4EW3A 4FB5A 4GOJA 2QI9F 2AH5A 4LY0A 2WU4A 1E7RA 2CXRA 4HZUB 1Q11A 5B58T 6GPBA 2IHVA 3MJFA 3DOOA 2E7ZA 1SRQA 3EFOB 3U56A 1M73E 4EKDA 4DVJA 1W49A 3TLGB 4YMWA 1PJ3A 4B2YA 5HKKD 4LHXA 4O1IA 2C04A 3VR2D 4KAXA 2J3JA 4MS3A 1KJQA 2IHTA 1X77A 4Z0PA 4ERXA 3K9FC 4FGUA 4HQNA 2FSUA 3SQWA 4NK4A 4ZVQA 2OMEA 1Q50A 3C1OA 2VQDA 1R9JA 5TXGA 5I9SA 1CQXA 1NNEA 1RC1A 2R7LA 3LECA 4K6KA 4FFRA 4QBFA 2QMZA 1RJEA 5FHRA 4LX8A 2XDQB 1TNDA 3KCQA 4Z8XA 1GKIA 3W3AD 5JNVA 5D1OA 3IEPA 2H8KA 3AI3A 4CF7A 1BJKA 1PEAA 1NPYA 3TIGA 3N28A 4XARA 3QF4B 3AVUA 1MAVA 3P9CA 1H3FA 1JFFB 2G5PA 4B6EA 3HFJA 4V2IA 1RHRA 2ENUA 3DUWA 3GEPA 4D9MA 1UBJS 1ZO8A 3U4QB 3HOUG 3ZK8A 1TF7A 1QC5B 3U55A 4CT4B 3A1CA 2EV9A 5FI0B 2NNWB 4BO1A 3T38A 3JTMA 4G3XA 1BC5A 1XXLA 1R10A 1NSYA 3DZBA 2FFRA 3NAGA 4Z9FA 1LNSA 4OATA 4C1BA 4UUAA 2DHDA 1UKCA 5EUQB 2EZ8A 1FXUA 3MILA 1U2RA 2WWGA 2ZI6A 3ABOB 5H3LA 2NTJA 4HNTA 1BDIA 3LQ2A 2Q3DA 2VF4X 2YV2A 3DHWC 1C50A 2O14A 4CMEA 2FG6C 4CKCB 2Q46A 4IGEA 1X80A 1G5RA 3F6PA 4W63A 3GJXC 1ZJYA 3L8MA 3QYAA 4IR9A 2OQVA 5JS1A 3LLUA 4Q1VA 3TVTA 3HABA 5EL0A 3DLBA 3BB4A 3TOXA 4R7GA 3CCFA 1VGRA 1OA0A 5ENVA 1UOPA 3FXAA 2WG0A 5I9IA 1SVUA 4U2CA 1XDWA 1WS6A 5BSUA 2CFCA 3L6RA 3K9HA 1P1JA 2RKWA 4HDNB 4MVJF 1ZCZA 4PFQA 5L3QA 4PHCA 1KDVA 1N7IA 3FHOA 5CX4A 4AC9A 4CI0B 3VC7A 1RRPA 2R48A 1Z06A 5AJVB 1PFGA 4K5QA 4RHCA 4EHFA 2PSFA 4Y8VA 1EWYA 2V5AA 2VDWB 4GPD1 1G21B 3EDOA 1A9RA 3AR2A 3ECSA 3ZBUA 5B1YA 3FWZA 3NOOA 4D9HA 1BGXT 3KJHA 3ZGYA 2OZEA 3OEEA 2EFYA 2E4WA 1LNZA 2Q4BA 4XVQA 3OTHA 4EFBA 3PK0A 1TEHA 1TK3A 1O3YA 3RO7A 3VNAA 3UV3A 3JSXA 3FNEA 1AT1A 2HTFA 1GPMA 3P9NA 3UHFA 2RGYA 5C3MA 2Z5VA 3LE8A 4WGFA 1E3WB 3BIJA 4HR7A 1D0IA 3THXB 4FNGA 4NENB 4E51A 3CG0A 3R6DA 1JDBB 1RVDA 1FJ2A 1XMOH 3D3WB 4HLQB 4Q1BA 1IULA 1J5PA 3AO0B 4MYHA 5KYXA 1Z2CA 2HK6A 3N05A 4K6CA 3K1AA 3FJ1A 4F9EA 1SXJE 2ZQ5A 1VIMA 1PNVA 4B4UA 3QX9A 4AMVA 4Z53A 3TZQA 1JGTA 4IUBS 3ACDA 3JZAA 3ENKA 5IC5A 4GD3Q 5LPNA 3OM1A 1J8FA 5GONB 4ZREA 3EEOA 3OUUA 1F5NA 3H9JA 3TGLA 2FETA 3ETJA 1E5DA 4QXQA 5KFYA 3KQSA 2NACA 4KTTE 5KWVA 4A3DG 4WNYA 4F50A 1AS3A 3TZBA 5ARBA 4J94A 4YQZA 3MT9A 3CEHA 1IXYA 2W9XA 4FFNA 2D2EA 2B5VA 3ETHA 4EELA 3HP4A 1TOAA 3W5HA 1NFRA 3EFOA 3QFFA 1ULHA 5DISC 2HO4A 4BLOA 1SUCA 2UVPB 3SKXA 3A9VA 2VSOA 3KKLA 2HQRA 3ML1A 3RYHA 5D86A 4MGZR 1WKCA 4G9EA 1QIHA 3TGWA 2XUGA 2O8NA 5DN6A 3OEHA 1OTHA 4BASA 4JB0A 5DFAA 1DAOA 2G7MC 2D1RA 1XTTA 5DQIA 2F3RA 4OD0A 4RESA 1ZVVA 4O4HB 3VX3A 1PFUA 4MAMA 2Q1UA 5HM8A 3L8GA 1A2OA 2JAPA 2PT7A 4AS1A 1WB5A 4ZVRA 3D5TA 4L5IA 4DL2A 1YL7A 1W1WA 5DQHA 1WUTA 4B9EA 1NW9B 4W9NA 1EAMA 4Y2PA 3KVVA 1NP7A 2EW2A 2J3KA 1O9GA 4X3CA 3H0GA 2RE8A 3QF4A 2W2LD 1JFFA 4RGQA 2WPNA 1U0EA 4RSHA 3TFOA 2LWIA 3DMHA 1K68A 2G9NA 4GR9A 5A03A 1XVTA 3U4QA 2NU7B 3TQOA 2GNAA 4E6PA 3AF1A 3WMXA 3DCYA 4NTZA 3KUCA 2JFFA 5A4JA 1X1CA 221PA 4ADSG 3OECA 1HNZB 4HXFB 4B5LA 3TQSA 4X8OA 1R9TA 5EJ9A 2W90A 4M1EA 5GM1A 5KCMA 4D56A 3QSYA 2E87A 2YOFA 2EBHX 1R0WA 2WKWA 2QGZA 2FJPA 3A9RA 1T9HA 4QFMA 1G6OA 2PJZA 4LV5B 2F3SA 1BH2A 2ZXUA 2PVPA 1GG5A 3VISA 2AG6A 1WAMA 4CKCA 4BKPA 1SBHA 5H9VA 3H2ZA 2NO9A 3A4TA 4EJ0A 3VR5H 3OZGA 1A76A 3DTVD 3C3DA 5AK6A 1RS0A 3PLRA 3UYYA 2PX8A 1GA1A 2F17A 3HZHA 2YIDA 2ZJ6A 3C6XA 2JDID 3T3PB 4PBCA 1XSEA 2WFAA 4JVOA 6LDHA 1N0HA 4JI6B 2RB4A 4IJKA 4P3YA 2C28A 5TMDA 3P0EA 4E70A 4D8VA 3RFTA 5LP6B 4GDMA 721PA 4CMBA 1FDTA 2OR3A 2EP7A 1IIBA 3CIFA 3EMBA 4FSXA 4RVNA 2VDWA 3PWKA 1G21A 3FUUA 1HE8B 4M86A 1ZCJA 2QYSA 1F14A 4QU8A 5FOWA 2WG2A 4NABA 4L1KA 4GGMX 2BCEA 4BBSG 5A7FA 4AKEA 1IBCA 2NO7A 4CDMA 1JAYA 4L5JA 4ZQBA 1QO0D 1IONA 2QZ9A 4ZHQF 2W6QA 2WT8A 5E4JA 1F5SA 4O25A 3LKBA 1Y4ZA 2YJNA 5AI4A 4BHTA 2DEUA 2VDVE 4B3RH 4K03A 1JYFA 3CKYA 4OFXA 2NP7A 1E3WA 2AQKA 3U3KA 1FPMA 3RBVA 1H4TA 3THXA 1VHDA 4NENA 4Y7DA 2QXYA 2HHFB 3F5QA 1VZ2A 3ZIAA 4MQ5A 3X2EA 1Q84A 4AAYA 4U2BA 4BFYA 3PXCX 3P9XA 2NAFA 1MOZA 2WTNA 4DV7H 2JAHA 1SIOA 5D1PA 3F6EX 3NGLA 1JIUA 1RW4A 2QYHA 2OXIA 4P33A 4B5KA 3ETLA 4F4UA 3AI2A 2R8RA 1EDDA 1RT9A 5EJ5A 1XNQB 1LPAB 3N07A 5JROA 1RXUA 4CM1A 3C2QA 2QN6A 4KDRA 3L1JA 1T3TA 1EFRD 3L0PA 2DECA 4CM4B 1L5FA 5I5EA 3KXLA 2BFCB 3F2IA 4BNJA 2HI0A 5IUJC 5IEJA 3JQEA 3WP1B 3AILA 5I7RA 4ZIRA 1LPMA 5AHOA 3KTAA 4DA0A 4E2WA 4EI8A 3FPHA 3ZOZA 4ZTZB 4WCFB 3LUCA 3UA3A 3N70A 3DEAA 3PLNA 4GLFA 2VYCA 4C6RA 4KRFA 1NMSA 1JSRA 1PP4A 3C3MA 3A70A 1X7WB 3P9SA 2ZJFA 3BL6A 4J9PA 2NVOA 5AVTA 4KHPB 5AW3A 1Z5PA 1GGVA 2AJBA 1VRWA 4K0KH 2XF2A 1E1NA 1SXJD 2UVPA 2ZEJA 4NS1A 3FYHA 4XIYA 2PFKA 2KLBA 5A0VA 4JA2A 2H5EA 4UUGA 1O6FA 2FMUA 3AT1A 5D3QA 3RJZA 5SY6A 5H59A 4BB6A 3CX4A 2BDTA 5IT4A 2J9FA 2C20A 4ZCRA 2IXDA 3O8RA 2OB1A 4E5VA 4CUJA 1FP4A 4YB8B 1KYIA 5KNBH 4K9QA 3HI6A 2FE3A 3M34A 4O4HA 5JAOA 2B7BA 2WAMA 3ED1A 4DV6H 1ST2A 1PWXA 2RBEA 3I8SA 3RANA 2LRHA 4C4RA 4QWCA 4RHUA 2C94A 1XF1A 3GGDA 3FFXA 4GWGA 1QFZA 4WZZA 4XIJA 3IQZA 2C7RA 5IN4A 4BN4A 1X1EA 2VT2A 5LKAA 2NU7A 3SLGA 5BMVB 2EYUA 1DPGA 1CVLA 2CDNA 2P5SA 4PZYA 5AI6A 2JD0A 3ZI0A 2XKAA 4J03A 8ABPA 1U8AA 2J5KA 4O2BB 1EVKA 3BWVA 2WBLC 4B40A 3TQ1A 2VT3A 1M2EA 2ZAGA 5ADWA 2X5RA 4B1FA 1J0XO 2DB3A 5THXA 2F1HA 2XE7A 4Q1DA 5AK0A 2DFKB 1NHWA 4P92A 2LKCA 1EK2A 2R7NA 1DBQA 2IYTA 3AIKA 2CXSA 4R1TA 3QHQA 3L6OO 4QFBA 1U9YA 1REQA 1Q14A 1XCJA 2FG7C 3BHNA 3GHHA 5AESA 4FCWA 4W7IA 1L4YA 4QIWA 2VAXA 1SGWA 1ZU5A 4RJTA 3DCNA 1QIFA 3R8FA 1ADGA 4OHBA 1H0KA 1USWA 5AJYA 4AP6A 5GJBA 3STTA 1YACA 4M0DA 2LXNA 4QDTA 2UYQA 4XDYA 3U62A 2H2FA 4ARAA 1FQWA 5LP6A 1MVNA 4CJXA 3W90A 1RLOA 3AYHB 3A14A 2A5GA 1U9IA 3OCZA 5H81A 4J0DA 2YN2A 1KYVA 2FPUA 3DL7A 3QOFA 2WP8J 5HJ5A 1I0ZA 1IUPA 2NOAA 4FYYA 1CT9A 2WWYA 5KYNA 6ADHA 2D1YA 4Q9HA 4OAQA 4J7UA 2HMUA 3P2KA 3TTVA 3W1GA 1LBQA 4CEHA 2EEPA 5A4DA 1KY5A 3MJSA 1U7ZA 2CDBA 4IMRA 3EEBA 4IIYA 3IB3A 4LWZA 1OFGA 1I4WA 1LBSA 2O8VA 4PPFA 1VKRA 2H16A 3EVFA 4I5EA 5HW0A 2QYOA 5DHFA 2Q6TA 5JIBA 1P3JA 1FU4A 4FDMA 3IP9A 3VJKA 5DGTA 1JQAA 3A28A 3ER8A 2HHFA 1GL6A 1V9SA 1FJGH 1LV7A 4DT1B 2I2WA 3A1FA 5KYUB 1ZNYA 3TPFA 2FFJA 5LZ9A 4GNRA 5JO0A 1ZK3A 4C7KA 5EKUA 4QYWA 1LZLA 4B74A 4C0JA 3PEEA 1A50B 1L5ZA 4TTJA 1M2GA 4X3OA 4M83A 5FBLB 3WLKX 3P9KA 2PZMA 4DA7A 1CZRA 4Z6KA 4XWKA 1J49A 3WRWA 4C4TA 1Z6ZA 1VBGA 3RUDA 1MPTA 2H2HA 2PBLA 4X66H 3QKWA 4BGUA 1A7AA 1KK0A 1Y9JA 1M2HA 3UT6A 3ZHZA 3KYHC 4AY5A 1RWOA 1AIPA 2ZM5A 1DTSA 2PUDA 1S0OA 4UBOA 3P97A 1QH0A 4ETIA 4EECA 3T9BA 1C29B 4QM7A 2Y1XA 4YJDA 3ESCA 4Z3OA 5JXJA 1X7WA 2OLEA 4PYLA 3JRNA 3IUEA 1CUGA 2O20A 2EG9A 2W7OA 5DLQC 4ZTBA 3TL3A 3F6SA 2A1UB 4IBOA 4M6WA 3KFVA 1CTQA 1R0KA 1R4NB 5I6DA 5AXBA 1UBSB 3O1IC 2E6KA 4YROA 3WVNA 1IC6A 2OK8A 1USUA 5EJ4A 1AF4A 1NU6A 1PHRA 2X15A 3T06B 5ULLA 1XZFA 3TIFA 4KZPA 3E9EA 4YAJA 4C22A 4KPFC 4EAAA 4KB5A 1B8PA 3FCSB 5AVQA 4YB8A 1J0BA 2RKBA 3WIVA 4NATA 1VI2A 1ISSA 4BMOB 1OXXK 3O2SB 4C0XA 3FYDA 4OUDB 5CAEB 2WK1A 2RH4A 1Z6QA 4LF4B 2X8JB 2VNKA 3X0DA 1YJBA 5CCEA 3RWBA 2EW1A 1TZKA 1XGKA 1I33A 2E18A 2C1XA 3WZMA 3VVCA 3ZW8A 4TGLA 2YZLA 3ZVLA 4TVKA 5CM0A 4O8CA 2WTFA 4U7CA 4YUXA 2M9MA 2OGWA 2LBPA 2OO5A 2IA5A 3RPEA 3COWA 1BWRA 4HVTA 3C7AA 2IH5A 4I55F 3RAXA 1ZVJA 3BQ0A 5JVDF 2VUGA 2ZRIA 2R66A 4CDNA 9LDBA 3FNQA 2F3PA 2Z1NA 4DM4A 3WADA 2ALZA 3TX2A 3D4LA 1Q6YA 4PHHA 4I3FA 3L8HA 4PCAA 2PTHA 4HWOA 4UUNA 1E1QA 1MIOB 3T99A 1CJMA 3HI4A 3NYIA 2HDNB 5IT9A 2I2FA 4ZANA 5AW4A 2DBQA 4P3KA 1L5LA 2BR5A 5G2OA 5A5VA 3HO1A 4YFYA 1KXZA 5DT9A 3WHIA 3BT7A 1RQ7A 2JFNA 2YL2A 4HDRB 2ODAA 5H68A 5HFNA 5AKHA 2JLBA 3CF4G 4ZU6X 5AKJA 2ZUTA 2FMHA 2Q7XA 1TYAE 4X95A 3L4BA 5B6IA 4GWLA 3PRJA 3AKEA 1G8SA 3PUZA 1JU3A 3SLKA 1WCV1 3AY7A 1EBBA 4KO4S 3RD5A 3OQBA 3ETGA 4K9LA 4D92A 4FVTA 1IM2A 4XDZA 4TWIA 3ZXXA 5E38A 3J81k 3VR2A 2VKTA 3GC6A 3AERB 1HG0A 5G02A 3S81A 1D9ZA 1J0DA 1USIA 3VBCA 1Q7BA 3HY4A 5ESRA 4YDSA 2D62A 3M4YA 5E6RB 1NVKA 3NFRA 3J80A 2GX6A 2W5UA 3N1UA 2W8ZA 4JSYA 4UCWA 2X3FA 3W3AA 3BSFA 4BVGA 3A7DA 4WZAE 1IEVA 4Y2QA 3N58A 3CS3A 4BKRA 3ZE6A 2PKXA 2ZRMA 1QPZA 4M0CA 1TZCA 3X1YA 4JZKA 3OZTA 1ISPA 3SF8B 1RACA 1BA2A 1YGPA 2E6UX 1PBTA 3U3OA 4DT1A 2O7NA 2XWJI 1JPNA 4INOA 5KQPA 3EC2A 3AHIA 4UU0A 1WCWA 1UMDA 5JTUA 3MF4A 1Q21A 3EPLA 4NOMA 1GSIA 3MCVA 3WJ1A 4P7JA 1YWGO 4JEHA 2R6R1 2Q6KA 1TUGA 4NU8X 3VM6A 4YIKA 1GKKA 4IQ4A 2VWHA 1HQDA 1G20E 2WTEA 3IALA 3PUYA 3VPXA 4K46A 4K8OA 2UXCB 3AJEA 2BEVA 1H4VB 2VUTA 4DS3A 3WZLA 1X7HA 1V7PC 3T1HH 4ASUD 4UMDA 2QTAA 4UBMA 4FEEA 1FPQA 4RAQA 2A9RA 1FTGA 3NORA 1YB6A 3DTVB 2P6PA 3CN9A 1KF0A 4M54A 3HLYA 3H05A 1JXAA 4MRPA 4J9UE 2D7DA 2GI4A 5B1DA 2Y1EA 3DEKA 3TTTA 1FYXA 4KXFB 4O2RA 4Y6QA 3CNLA 2I80A 4Q8EA 1NMZA 4PPGA 1NLFA 2UUAH 4RD1A 3HVJA 3N53A 5GINE 4RDCA 1R4NA 5DE3A 1N33B 2XNDD 3HO8A 1XALA 1I14A 1N9GB 2EHJA 3T1YH 5REQB 3VR3D 3BS4A 1RP7A 3WDMA 1X7XB 4YCNA 1DO8A 2KHZA 3SDSA 2WIJA 4LRUA 4KXLA 4EI9A 4JI8B 5G0VA 1FJHA 5SZHB 3R24A 4DB2A 4B2PA 3DKRA 3EF0A 1RRKA 3TLYA 1SCNE 4MV9A 4OMUA 4OUDA 5CAEA 2JLVA 5EMLA 3BJIC 4Y30A 5LOVF 1W0KA 2C1ZA 4EYKA 4JZYA 1ZIYA 4CG1A 3TH5A 1FSZA 5HFJA 4X3PA 1N6RA 3TD2A 2B94A 4PZAA 6REQB 4CDGA 1DCKA 1VLJA 2G9RA 4A3LG 1B0PA 3GFRA 1BOFA 4IXNA 3T7JA 3W79A 1H22A 1ORVA 3BERA 2QTWB 4L22A 3N41B 2PGOA 5KYYB 1J25A 1XP8A 4RE6A 3WK6A 4QYSA 4RCVA 4KN8A 4Y18A 2UZ4A 4B3BA 1J7JA 1MO4A 4LMRA 1R8SA 3EVZA 1DG3A 3NW9A 3PJRA 4HT3B 1IY0A 3JQ7B 1UBEA 3TRIA 3ZY3A 2BV3A 2X19A 2IKSA 3WZ2A 1SG6A 3NT4A 3LLVA 5INTA 3JASB 4LY9A 1Y34E 2E37A 3N43B 3DF9A 1MFPA 2IUYA 5EHNA 5BQOA 4J0EA 5K01A 4UREA 2PGNA 1FL9A 1QDUA 2JGNA 3OFSA 2OLSA 4XZ3B 2DABA 2Y8EA 5GTDA 5K45A 4P3OA 3L8YA 4TT3D 5F76A 4MNTA 4QBIA 3IUPA 2O7SA 1JSCA 4RFVA 3M1LA 3AR4A 5I47A 1GV1A 3BTVA 4J9VA 3COVA 1EHCA 2EL7A 1NL3A 2WOJA 2XWBF 4IJ6A 1H1DA 2BI8A 5D3MB 1KJIA 3PENA 1RABA 1SXJB 1UK7A 5FO0A 1NVUQ 3OQVA 1BXZA 3USES 1HNXH 3M9OB 1OREA 3S2FA 4Q7JB 1PNQA 4E07A 1CRPA 4ZWNA 4MW4A 3AERA 3HB7A 1IPFA 3G9XA 1V47A 1H6BA 1F4LA 4QPNA 4JXJA 3F8SA 3KR2A 3FG9A 1KZHA 4X64H 1P7ZA 4GF5A 3EVDA 1L2TA 1TM2A 1C0LA 1EFPB 2W58A 2CL0X 2ZGIA 4N40A 1RBMA 2R6DA 3LH5A 3LVRE 4HPJB 1O95C 3THRA 1X39A 3VU9B 3RI3A 4PTYA 4FCTA 5AVSA 4FMDB 4MK4A 2LW7A 4YR3A 1KVTA 3NIWA 4ROSA 2VHYA 4OFWA 2WUFA 4DLPA 5DTJA 2R2AA 4PNZA 2ZIUB 1V2GA 1KI4A 2W2LA 5HS6A 1TIPA 3Q8PB 4ERNA 2L0XA 1GL3A 3L0CA 3CR7A 2OL4A 3GJ8A 5BVGB 4R9VA 1KAOA 4MCHA 4Z4QA 3ABQB 1VCNA 4UHFA 1G8KA 4U39A 1JR4A 1PJ4A 3JWPA 4NCKA 5EZYB 4GKAA 4QUGA 4HFMA 5FHQA 3CRQA 2B7CA 4E5MA 5ILOA 3KV3O 1U1GA 2EJUA 4WFIA 2MINB 3IE1A 4G1BA 3GRFA 1TU3A 3DAYA 1I94H 3S44A 4RKYA 2HFJA 2Y0CA 3HBLA 2OKGA 4BNIA 3VBEA 2XJ9A 1R37A 4CMJA 4KYVA 1YB4A 2NZXA 3GDOA 4TQRA 2V6GA 3TAHA 4PSDA 1KPGA 2IIPA 2WF8A 3DTVA 4LSWA 4REMA 2R87A 4YP5A 2ZB4A 1AV7A 2H92A 2QTHA 2P2SA 2JDIA 3NRJA 3BCUA 3STXA 3NYWA 1QHGA 5GOTA 2QYTA 4MI6A 3KPYA 4LCEA 3LAWA 4P98A 3DQQA 4ZJPA 1F9EA 4DWOA 2ZRJA 1JPJA 3ET4A 3F7OA 3D8SA 3DE4X 4PW0A 5REQA 4TRRA 4PS0A 3WYBA 4DCJA 3HO6A 1IBKH 4D2IA 5G4KB 1X7XA 1UC4B 4CU2A 4IXMA 5TMEA 2IOYA 4ZZ2A 3NQ41 1L7QA 2CGEA 4ZVLA 3PJDA 3DQPA 2I78A 4DR6B 5TC4A 1ES9A 2VA2A 2YY6A 2QR5A 4EW2A 1QRSA 3IT3A 4U00A 4XD7D 4PG7A 4HPWA 5CVEA 5KFSA 1SWWA 4PYQA 1SHTX 1F51E 5KWIA 2N0SA 5CFQA 5FUWA 4Y2UA 1QPBA 3BREA 4DV0H 3KLOA 1HLGA 4I5DA 3HE3A 4WX2B 3HOWG 5CLQA 6REQA 1BRMA 1HRDA 1TJYA 1LJUA 2OAQ1 4NQZA 3RE1A 1WSBA 1Z18A 4GE0A 1FK8A 2VP4A 3QPUA 3ICCA 2W37A 3O94A 3JD2A 4V0RA 2HFKA 1W36D 1M3SA 5KYYA 2CFTA 4LOLA 2ESRA 1C14A 2IUEA 4IZIA 1J8VA 4YJHB 2CXHA 1H2XA 4I99A 3IUMA 4Z54A 4O4IB 2CLLB 1ZQ9A 3JQ7A 1CUEA 3OU6A 1G2OA 3O26A 3T5KA 3ED5A 4J16A 4GZ5A 3NUAA 1P16A 1EFRA 3KO8A 2JASA 2FX5A 4ZO6A 1K4KA 2O2DA 4L9SA 4JI3B 3AY3A 4N3GA 2WHYA 2P69A 4OJQA 1ZUNB 2DOKA 5TMBA 1CE8B 3B5JA 2C07A 3B2EA 2MSKA 2F1RA 4XFKA 3QE9Y 4AYXA 3PHIA 3IKMB 4XZ3A 4LI3X 3QKIA 4PPQA 2H5LA 3EZ2A 3Q0IA 3RGGA 4XM2A 3OD5A 4MH0R 1ESDA 4IIEA 4CMIB 2JFZA 4X65B 3B9BA 4Q3EA 5EAIA 3A6JA 2FGJA 4U8GA 1RRVA 1NDHA 3UHJA 4HUJA 1PF7E 4NFHA 1QOZA 3V55A 3LQFA 4HB0A 4YXWD 1PW7A 1KE1A 4DDTA 1FSFA 1VMAA 2HSEA 1IMJA 1PL7A 1QYXA 5D84A 1FMFA 3K1TA 1R0LA 5ESWA 4FEGA 5CNKA 4YACA 2BQUA 1FEZA 1R5NA 3HSSA 1G7SA 3MWLA 3VTAA 1SVOA 2PNJA 1EFPA 2DKFA 1R0XA 4N8DA 1YBMA 2ZRNA 5L7WA 2VDKB 1JEDA 3U4IA 1YVRA 4ZU1X 3ERCA 3VU9A 3EE6A 3S2UA 4R84A 4RJJA 5BRAA 1DDOA 1KHTA 3UK6A 4ZGGA 2VOJA 3K0CC 4OX9Y 4F97A 1KWKA 2REOA 1WSDA 4M21A 5B1EA 4O7VA 3ADPA 3RUCA 1R18A 3KKEA 1RAHA 2IU0A 4NJOA 4RHEA 5BVGA 1UJCA 2FZGA 3PNVA 2O2EA 4IDOA 3VPCA 4UUOA 3I2GA 4OHXA 1EQAA 3PD1A 4HVAA 4UZEA 2N1BA 4KX5A 1OH6A 3WLFA 5T6MA 4AG3A 2ZBFA 2YUTA 1B16A 3FPSA 3D9QX 2DGDA 4CTJA 2PWPA 4NBRA 5I60A 4TXJA 1MOSA 1X1TA 2AUNA 1G16A 1WQ4A 1ZNQO 3F4LA 5JH7B 4EGCB 1U1FA 5IAJA 3SQLA 6Q21A 1YQUA 1NUUA 2R5WA 1TWFA 3BSSA 3JALB 4O4JB 3MJCA 4HB2A 1QNLA 4WHXA 2PX4A 4XQ9A 3AY6A 3D7KA 3Q9SA 4UFZA 3FUTA 1OWNA 3B89A 1WCIB 3ZG6A 2X6QA 1NATA 1M6YA 3WFIA 3H9BA 5E3JA 4M9ZA 3IYLW 3MWGA 4WKBA 2X22A 1OVMA 2NVWA 3MRSA 1A8PA 2CDCA 4DARA 4ZDWA 4M76B 2HGWA 5AXAA 4UPVA 1FBNA 2WSSD 1ONPA 5C7LO 3ZWXA 2COGA 3T4PA 5JQWA 5CHEA 1TJ3A 3RSSA 5FWAA 2ZCVA 5H4GA 3ICOA 1RI3A 2HMYB 4C0WA 3OOJA 2OHXA 1MN6A 4EA8A 3ND8A 4IDHA 2WE7A 3P5BA 4DV5H 1U0JA 2BFFA 4XVCA 5KG0A 2VCEA 2EQ5A 5LJIA 1G8AA 3TTUA 1VG1A 3G68A 1A95A 4ZCPA 4EI2A 3OH8A 3ZJ5A 4WKOA 3DW1X 1XG5A 1CY2A 1WCMG 3QGMA 3OETA 1SHZA 1X3SA 1T9DA 3Q3JB 3KXYT 4DEVA 3LZCA 2DY0A 3NP9A 3KJNA 5LQSA 1RJGA 4DV3H 3LQYA 2Z02A 1JKMA 3SY8A 1SCIA 1P4GA 1E9SA 2B34A 1E2MA 4AMYA 2QTLA 4EIWA 3OWHA 4IXTA 1GAXA 1AN7A 1P80A 3N8NA 3UG6A 3A9CA 1NURA 5BWMA 4L0CA 1KQGA 2PZGA 2BN4A 2Q5FA 4YJHA 1B26A 2QL9A 1J1IA 2NYVA 4AG5A 5A4AA 1EFUA 4RABA 4RYLA 2CHFA 4O4IA 1Z5OA 5F1KA 4LHZA 1ZAKA 3M4JA 5JALA 3TXYA 2FUG6 3EPPA 3MWJA 2V97A 5LB2A 4LFCB 4LJKA 3TEFA 1SCBA 4E2FA 2QX4A 1OWPA 5B30A 1X7YA 1I3LA 1ZUIA 1FYEA 4UHCA 1ZUNA 5JT1A 3R5KA 2R96A 3DMYA 1UDAA 5DF1A 2WD9A 4A3BG 2WYVA 3GK3A 3ZX5A 1C30B 2JI6A 5KB3A 1Y3HA 2DSNA 2V6JA 5E1OA 3FVQA 1MT0A 2RC5A 4IMJB 3IVGA 3V2IA 1JHOA 3BDIA 5B7PA 2X4DA 5JSQA 2GCIA 1CKNA 1QQ7A 2GRUA 2FGKA 4BLSA 3QFTA 3ROFA 1GPH1 2FDCA 1LGYA 1R3DA 3BZWA 3QY0A 3ECAA 3MAGA 4M0MA 3H8JA 3UHOA 3JXEA 4O7ZA 3HVRA 3FFBA 4ZRNA 1ZJWA 4BX9A 1NBWB 2XAUA 4KNWA 1LPSA 3PL1A 3PITA 1Q5PA 5DRYA 3CJTA 1JMYA 3VRHA 3B7GA 4TUYF 4I1VA 1VE6A 5JS7A 3NKLA 3PVCA 2AYYA 3GRRA 1J0CA 3TSCA 4L73A 4WLOA 2D8AA 1YQGA 1P8LA 3VSBA 4Q4DA 3UWKA 4JJ4A 4BQFA 4IV0A 2EJ2A 1SM4A 1DINA 3UK1A 3SPXA 3FVTA 4BBPA 2VP9A 5KFCA 3IBSA 3I72A 1QVAA 4NYJR 2W2KB 1XHLA 4HWPA 1UMCA 4GZLA 1OFTA 1OBOA 2XB6A 5C4XG 2WEKA 3A3KA 4MS4A 1USGA 2Y67A 4C0KA 3D7RA 2X8BA 4PQFA 1ENZA 4QA9A 4XWOA 2K6GA 3P2IA 1N5OX 3E5HA 1MXFA 2B35A 3PPXA 5JH7A 3EIHA 3X1WA 1KO7A 2QUHA 4Y2XA 3LNCA 4GX5A 3SE7A 4EYSA 1SIBE 2CFIA 1RXYA 5CDYA 3R9KA 2VPIA 5CGQB 2NO0A 4JELA 3I37X 3KQPA 1BMTA 2HGZA 5AK5A 2EDAA 4UHEA 1ZLYA 1WCIA 4KR9A 3R5HA 4BO5A 2H31A 3OE7D 3DEIA 2YQZA 2DTXA 2FJZA 2JCGA 2G1JA 1L5GB 4PC2A 4A0HA 1NJ2A 4R1LA 2B2XA 3KD2A 5JD3A 2DHQA 1KOFA 1NN1A 4F85A 4Z3KA 2XHEA 2ROQA 2VRBA 1SBQA 3U9LA 2WU0A 3PI6A 1T5TA 5HK8A 1ZEMA 3QKSB 1NW4A 4W6QA 4MICA 3RF7A 5F98A 2R9VA 5MN5A 3DMTA 3FVRA 4PHTA 2VJAA 1FVIA 4V24A 3HCOA 1KJWA 2C88A 4K9RA 4HZUA 3B1KA 1B04A 4ER7A 5CT4A 3RTGA 4TLCA 5KT2A 2HVRA 1A04A 1V95A 5FL3A 4KW7A 3MHPA 3AKDA 4WEOA 1C1XB 3AEQB 2QSZA 2W22A 1KMCA 2VHTA 3TLGA 4JUBA 4ITUA 1D1TA 1P0CA 1AGXA 4CCSA 2BC9A 2MWMA 3BK7A 3W2EA 4D4IA 1C1DB 3DMGA 2WDTA 2LGJA 3HYNA 1R0SA 3RFXA 2HZBA 1MFZA 3RU3A 2NU6B 3RBXA 1OFUX 1UEIA 2RFLA 3OCYA 4DG9A 5G1PA 2R1VB 4TLBA 4A26A 1NW3A 1GRCA 2PL1A 3HZOA 4FMCB 3ZNQA 3T0FA 3I5MA 4JQZA 2XDQA 2CBGA 1ZNXA 1PT6A 4Q3LA 3D7NA 2BLNA 1BIFA 2R47A 2D1TA 3DAHA 2I8AA 4NBTA 4ZOAA 3NLLA 4GT1A 5CXSA 3OG9A 3B12A 4NCNA 1KZGB 4QEZA 5I7UA 3L8DA 5WRFA 3G9ZA 1E2FA 4INJA 2ZRKA 2BF4A 4WZAB 2C2ZA 2H4JA 4KXYA