4IZOA

Crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
376
Chain Sequence
SPILPGAWLGMVGGGQLGRMFCFAAQAMGYRVAVLDPDPTSPAGAVADKHLRAAYDDEAALAELAQLCDAVSTEVPAASLDFLAQSTFVAPAGRCVAIAQDRIAEKRFIAASGVPVAPHVVIESAAQLAALADADLAAVLPGILKTARKGQVRVATAQEARDAYGSLGGVPCVLEKRLPLKYEVSALIARGANGASAVFPLAQNTHHGGILSLSVVPAPAASDALVRDAQQAAARIADSLDYVGVLCVEFFVLEDGSLVANEMAPRPHNSGHYTVDACETSQFEQQVRAMTRLPLGSTRQHSPAAMLNVLGDVWFGEPVTPPWDQVAAMPTARLHLYGKEEARVGRKMGHVNFTAATLDEAVAGATACARLLRIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title Crystal structure of kinase Phosphoribosylaminoimidazole carboxylase, ATPase subunit from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Lyase
total genus 126
structure length 376
sequence length 389
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4izoA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4izoA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4izoA01
4XX0B 4O81A 1E4EA 4O7WA 4O2BF 3JZFA 1OBDA 3ORQA 4TV9F 4YJ2F 2YRWA 5LOVF 1C3OA 2VQDA 4O2AF 2DWCA 5C1PA 2YZMA 4O82A 5J2UF 4FU0A 3WNZA 2XCLA 4FFNA 2I80A 2J9GA 3U54A 2NU6B 3LWBA 4EA9A 3OUUA 1KUTA 1E4EB 1AUXA 4E4TA 2YZGA 5CB4F 3BSSA 2QF7A 3VMMA 3R5HA 5D8DA 2W6PA 5K2MA 5JQWA 4M9UA 1I7NA 4YBZB 5LA6F 1Z2OX 1Z2NX 4QSHA 2CZGA 3MJFA 3N6RA 1JKJB 3TIGA 1EZ1A 3TINA 1W93A 3VPBA 3LP8A 3I12A 3R23A 3WO1A 1KJJA 2R84A 2NU7B 2W70A 4DLKA 2R7NA 1JDBB 3GLKA 4MV7A 2FPIB 2GQSA 5I47A 4IZOA 3VPCA 4O4HF 5C8YF 2YYAA 2I8CA 4HNUA 1GSHA 1WR2A 1EHIA 4L1KA 4O7TA 4XYLB 3U9TA 2NU8B 2R7KA 4O7NA 2ZDHA 1JLLB 4O84A 4HNVA 4FE2A 1CE8A 4O7SA 2Z04A 1VKZA 2I87A 5IYZF 2GPSA 4RZQA 1A48A 3JZIA 3BSWA 4C5BA 2ZDQA 4M98A 4YAJB 1VBGA 4DIMA 2ZDGA 3K3PA 3HO8A 4GGMX 2V58A 2YWVA 3BFPA 4MV1A 1I7LA 4FFLA 2WYOA 4O7RA 5LYJF 2YS7A 1UC8A 3HBLA 4O4IF 2W6MA 5BPFA 4HQ6A 2C00A 5GONF 2GQRA 3UFXB 4XYMB 4EA7A 4O7VA 3RV3A 3U9SA 3ETHA 2HGSA 5BPHA 4I50F 3TW6A 1KC7A 3BG5A 5LP6F 3GIDA 2W6ZA 2V59A 1EUCB 2PVPA 5JVDF 3HB9A 2DLNA 4IIJF 4O7LA 3KREA 1CS0A 4O86A 4WD3A 5C1OA 4YJ3F 2YRXA 5KX5F 4TV8F 4EGQA 5EZYF 3G8DA 1B6RA 4FFPA 5HV6A 2VPQA 3U55A 3RUPA 1BNCA 4EABA 1OBGA 4ZI7F 2GPWA 1KBLA 3ETJA 1VBHA 3V4SA 1IOVA 4YAKB 2YW2A 3MWDA 4O4LF 5JH7F 3NUAA 4C5AA 3QFFA 3AW8A 5J2TF 1CQJB 2CNQA 1CQIB 4MV8A 3OUZA 1GLVA 4O7ZA 3Q2OA 1BXRA 1EYZA 2QK4A 4IHJF 3MWEA 5LXTF 4HNTA 2R82A 4YB8B 4EGJA 3R9RA 2R86A 1DV1A 3N8DA 3R5FA 4MV3A 3K5IA 2FPGB 1B6SA 2SCUB 2DIKA 3RV4A 1Z2PX 2GLTA 4NYEA 5HBRB 3JRXA 4MAMA 2CQYA 4ZOLF 1PK8A 2R7MA 3Q1KA 2W6QA 2PBZA 4M9CA 1KEEA 2P0AA 4EG0A 3K5HA 3KAJA 1ULZA 3G8CA 5CAEB 2IP4A 4EA8A 1KJ8A 2YZLA 1C30A 1W96A 4I55F 1KJ9A 4EAAA 2NUAB 5CA0F 2XD4A 2YL2A 5DMXA 4I4TF 2OLSA 3WO0A 3VA7A 4FFMA 1M0TA 2V5AA 2YZNA 4O83A 1AUVA 1GSAA 1DIKA 2R85A 2VR1A 2W6NA 2CNVA 5JQGF 3KAKA 2FPPB 2R7LA 3DF7A 1GGOA 5KKNB 2VHEA 4HR7A 3TIIA 2NU9B 5FNVF 2R6FA 2FP4B 4WBNF 5CA1F 2R87A 1T36A 3ORRA 2CNUA 4MV4A 2YS6A 1DV2A 4M99A 2X0SA 4Y8VB 1UC9A 4XZ3B 1M6VA 4ZHQF 3VOTA 1KJQA 1KJIA 1PX2A 4FGRA 4J6EA 3KALA 4FFRA 1M0WA 4FFOA 3JRWA 4IWXA 1JDEA 1IOWA 4MA0A 2HJWA 4MA5A 3RFCA 3AX6A 2DZDA 3BSYA 3V4ZA 2Z02A 1SCUB 2W71A 2W6OA 5H80A 4ZQIA 1EUDB 4O7YA 5JVLA 3VPDA 3SE7A 4TUYF 4C5CA 2FB9A 5BMVF 4O4JF 4MV9A 4IWYA 3TQTA 4ME6A 1GSOA 3E5NA 1A9XA 2PN1A 3R5XA 2NPOA 4MV6A
chains in the Genus database with same CATH superfamily
1ZL2A 2R68A 2Q0QA 3GARA 5KQMA 3T06B 2O3JA 4E33A 2MSNA 5COBA 3ZK8A 1XGKA 2GVDC 4I1PA 4YXWA 4WECA 1EBFA 1S01A 4NY1A 3UK2A 4QDOA 4RZSA 2B7LA 4HLDA 4FI3F 3RFVA 3GW8A 4QOFA 3JATA 1VG1A 4UUPA 1UQUA 4F50A 3QV1A 4I1RA 4A0HA 5EWJA 3THYB 3WG9A 1A5ZA 1Z2OX 3TRJA 3ZXIA 4NYMQ 1J2UA 3K1AA 4LYAA 3GJ8A 5T67A 1K3TA 4BV3A 4J9PA 2CGEA 1YIOA 3C6KA 2C7OA 1VIDA 5T4HA 1MDFA 3QELB 1VI2A 5K3SA 3WYFA 3C6XA 2X19A 3PTLA 1KWKA 4HJXA 4Q3OA 3J80A 1Q1BA 3NRJA 2FPMA 4DWOA 2W2LD 2YVAA 5DNUA 2GKGA 5BWMA 1TW2A 2G04A 1RC8A 5G0VA 1PWHA 4UMDA 2C1ZA 4AD8A 2J3HA 3P9QA 5FLYA 1ZJJA 2HPZA 4OOEA 3T7RA 1P7ZA 3F7TA 2FRDC 2PHZA 5EDWA 2VVTA 1G8MA 4I4LA 1IN8A 4EFKA 3D0QA 3ZZNA 5ERGB 4CW7A 1GDTA 2WYOA 1VJ5A 5HS6A 1JJAA 1SZDA 4CR6A 2OHJA 2OHVA 1E0AA 4NFSA 1G291 3W9SA 4UTVA 1XLVA 3D0OA 2B78A 2CLEB 5DBEX 2CDBA 1GTG1 2FLVA 1CDOA 3KK0A 4J1SA 1IQ0A 4O7LA 1N3YA 1FW8A 1FTGA 1Q1QA 4B6GA 4E1AA 3RSSA 3H2KA 2LP4Y 4REQA 2M9MA 4UVGA 4BGUA 4Z7QB 1X19A 5SZKB 3AHGA 1KBLA 2GTHA 3OOYA 1NP7A 1DAOA 2YN2A 4RB2C 5EIBC 3SR0A 5KKAA 1W76A 4A1FA 2EZ4A 2X2OA 3ROFA 1HG1A 2WUWE 4G9EA 1JYFA 4BMYA 3PDJA 5JO9A 4BNWA 3CRVA 2VI5A 3SQXA 4BWSC 2X8JB 3UVEA 2MTBA 5DYWA 4IIHA 4ZARA 1WSAA 3DDSA 3WA7A 1ST3A 4YXWD 4JBHA 2GXAA 2OXTA 3Q1KA 5EKTA 3NC0C 5ALUA 2P0AA 4BNYA 5CFNA 3QVUA 4GLFA 4MI1A 3RRZA 1XV5A 3AEXA 4G5RA 2FMIA 4P38A 3H7AA 4ZEVA 2XUOA 5IPFA 4PYQA 4FMDF 2PNJA 4M22A 1U81A 5EPEA 4PZCA 1C0KA 2ZRIA 3LBYA 2XOEA 4R98A 1UIRA 3BGVA 3LBHA 1OW3B 3ZGLA 5BURA 4LMRA 3NHSA 4KNWA 1N92A 2HDOA 2LGJA 2I6GA 3B48A 3ZG6A 3WIVA 1KOLA 1BS2A 1WU7A 1P19A 2TMDA 4UEQA 5DTIA 1JEJA 3LMLA 3SHFA 3AYHB 1V8ZA 2PBFA 4B3MH 3CUEF 4LJ6A 4CQMA 3E2MA 4WE3A 3ROMA 1QHIA 1DTWA 1JXQA 3W6UA 2FK2A 4MVCA 5I48A 4MR9A 5KOYA 5C44G 4LFBB 3NTLA 1GZ7A 2VHYA 4NICA 3IXLA 2IV3A 2J6CA 2A30A 1ISJA 4YRZA 1ADCA 4BCDA 2UXCH 3A58B 1GJRA 3DLAA 3KELA 1G7SA 5CT9A 1FSZA 3LGXA 5JZVA 1J2TA 1EFDN 3PGJA 5KTYA 1X3LA 3RIGA 2JCBA 3EW9A 1PD0A 2J9FB 3W1BA 5J1SB 1GFZA 2Q2VA 1YKGA 3AF2A 3OUTA 3O94A 2XKBA 1Q2UA 3GPDG 1K2VN 5AI8A 3C1AA 2OL4A 3EEIA 4OYHA 5E95A 2HB6A 3BFVA 1VYHA 5DU2A 1EFCA 4BE9A 2EARA 2CMKA 2VP6A 2PEZA 2ZRHA 3ECCA 4C7XA 4MPTA 3NASA 1QRDA 4DXDA 3ZYZA 3PR5B 3TO5A 1RHUA 4NI5A 2ZJZA 2J9RA 3NMUF 4KI0A 1E0KA 2HHCA 3TLCA 3IAHA 2CFTA 1I2AA 4DMFA 1NX9A 2C0CA 1LSOA 1V3VA 1QO7A 5E9QA 3JQ9C 2GQSA 4DDUA 2X86A 4PAQA 1QWOA 3C15C 3WGHA 3QJ5A 1P4SA 4O7TA 5JUWA 3L8FA 5ENZA 2Z09A 3SCZA 4KVGA 1R0WA 1YI0A 5C7LO 4P93A 4KYVA 1H3FA 1MB4A 3HDVA 2WTXA 4N7BA 4R9RA 4Q4CA 4AI6A 1BMFA 3KFLA 2Y05A 5K45A 1J0CA 2R93A 1B3BA 5TQ0B 4BVKA 1YXMA 1T9DA 2PUAA 2ZT6A 4RADA 1TF7A 2OK8A 1RMQA 3GT4A 4L9SA 4WLFA 3ETHA 1E1RD 2VPZA 3MMSA 4EARA 1L3IA 1VGQA 3BD9A 4H17A 1P18A 3NHPA 4CQMD 2FMAA 5K09A 2VQ6A 4TKZA 2D4AA 3TWOA 3FOBA 4AO8A 3FPEA 3L0IB 1GZ4A 4KE8A 3HHEA 4EHDA 3WWDA 3HUEA 4GYKA 4DR4B 4L0CA 2FK8A 2Q1XA 2PS0A 3NBZC 5BRAA 1R66A 5ED0A 2FG7C 2VP4A 4DEXA 1IYZA 3GUYA 1RYBA 1W48A 3X2EA 1JRLA 4WESB 4GPD1 2UVQA 4AKEA 4ZT2A 2BUBA 4D46A 1P7VA 2HIAA 2H0QA 4ND2A 2KBFA 4J3NA 1RJ9A 3R24A 5E9WA 2HRCA 4MKXA 4E5DA 2VYFA 1RLIA 5EQDA 1L5QA 1ZC3A 1Q1NA 2DABA 1V95A 3N2EA 4Q48A 4DGSA 1FFSA 4DR6B 4TQUS 3GUHA 2ZITA 2IUEA 1JLSA 4G8DA 1FYEA 1UJMA 3HWRA 3OC6A 3ORFA 4F4ZA 1N2BA 1P80A 2IS6A 2C42A 5ADHA 2HMYB 4A8PA 1VQ1A 4C08A 4NBTA 3GJ0A 4OP2A 1GDDA 3Q5GA 4NCBA 1E62A 1A8UA 2C35B 2W83A 3TR5A 3D1JA 2XRZA 1W7AA 3AI7A 2YMMA 2FR1A 4Q16A 3RSQA 4A9AA 4TKVB 1XA0A 3PW0A 3GF4A 2D0DA 1AN9A 2Z3WA 2ZVDA 2ZI5A 3V1MA 1BHQ1 1IN6A 2I3DA 4ZN6A 2WSYB 3HUUA 1KYYA 1K8YB 4FGRA 1PR2A 3K70D 2PX4A 1ZH0A 1BMFD 2YZKA 4LYFA 4ASUA 2YBDA 5I7HA 4U8GA 2JRLA 4B6JA 1YJ5A 1KPIA 2BRUA 2E1PA 2ZRMA 4GWGA 5K3CA 5DM70 3P2MA 1FFEA 3FNFA 2WIBA 5D85A 3SXUB 3NATA 3N07A 3WL5A 4ZYVA 3K1TA 2VT6A 3NEJA 1V4BA 1C7QA 5JDIA 2Y77A 1IUNA 1MN6A 3O7MA 5C80A 3KQTA 4OHWA 5HFNA 3UJ9A 1T34A 5HMLA 4Q3NA 1TL7C 3M33A 5HIIA 1UZAA 2GPTA 5BMVA 2QE6A 3KEMA 1H9AA 4ICIA 3MW8A 4JP8A 1U7XA 4Q9HA 1F9AA 1UOPA 2IXAA 1TPZA 3OPVA 4B4DA 3TYXA 3C0KA 1H69A 1BGXT 4LY3A 5NULA 5K8VA 1VRCA 4JELA 4D2IA 1JHDA 3V4FA 1XRQA 4R6WA 5BQ5A 2IIQA 3A05A 4Y9RA 3KVVA 3E53A 3QY0A 4BJ6A 1KWGA 2VPPA 1RABA 3RVRA 4X24A 3LDGA 3EMKA 5ES4B 4IUBS 1RRMA 2PH5A 4MR7B 2IFTA 1JXLA 3OTHA 4EVSA 4ZA2A 4FS1A 1RBYA 1W4RA 1UXKA 1Y4SA 2WWVD 2ILVA 1YR2A 3SYMA 3BQ1A 1DGSA 1G64A 3DHNA 1M3SA 2E4VA 5I60A 4N82A 5J47A 1FNBA 1ZNZA 1FP7A 5C32A 3HU1A 5KFPA 2ZSEA 4JJIA 2J5KA 3WLAA 1IEXA 1XZIA 2G1AA 3AJAA 3ZWOA 3LS2A 4F2HA 4IDAA 3G6KA 4L51A 4X63A 1F8GA 2OT3B 5JR3A 2HJRA 3W8NA 2ASJA 1I80A 2XVAA 3HA5A 2RC6A 4YREA 1I2CA 2A9OA 3GBPA 3UUWA 1VXRA 4EUSA 2ODAA 1RQNA 4L2IA 2DLNA 1TPYA 4L4YA 2DFNA 1F2DA 1SUIA 3F6RA 4H35A 4RELA 2WVHA 2ZJOA 4D9MA 1PV4A 4OHVA 2EGGA 1CIJA 4ASUD 2BFFA 4J7XA 3U55A 4N1AA 1L1FA 3CRQA 4B33A 2FWIA 3Q12A 2FZLA 2FR8C 4YUWA 2EL9A 2RHTA 4BYGA 2GCEA 1CQIB 3MINA 1GUFA 4WIAA 4W4TA 2DECA 1EI9A 2JLWA 4H6XA 5L8VA 1EZ4A 2IY9A 3N8GA 3FFTA 1RHMA 4BO4A 3MERA 3H2GA 1IZ0A 3A1NA 1R37A 5JY1A 3J80W 5DRTA 3Q6MA 1OHHA 4HGNA 1GPAA 4IHKA 2XDYA 4HZGA 4KDRA 1FXWF 2QT9A 5EXTA 5GOZA 2C03A 1RYDA 4O1IA 4JEMA 4YP1A 4NBSA 1NJ1A 3FN4A 4XUCA 6ABPA 1EK0A 1IXSB 1QH0A 3FCXA 1N48A 3UJHA 5CDGA 1JBKA 5A5GA 1C5KA 3C3MA 3BSFA 3GQVA 3U44B 3CM0A 1JX4A 1XU7A 3RBVA 1C30B 3H40A 3ZZ1A 1M1NB 2MYUA 4N0QA 1CUFA 4MUBA 1W4CA 3CG0A 4R1QA 1GYRA 3FXAA 1JDJA 1LI7A 5B6JA 1MFZA 5JMWA 4FBLA 5L1IA 2DPIA 3OE1A 3OEWA 4D9JA 5AKJA 4HHEA 3EAGA 3QX8A 4UJ3A 5FUVA 4BKUA 2BFNA 3M1YA 1LGYA 3D6TB 3H87A 3CNBA 2X0EA 1DMSA 3AEQA 3CF6R 2PZBA 3HOXG 4UZEA 5F3WB 2WG2A 1G5HA 1U1EA 4IGAA 3WKEA 3PUKA 2WWWA 1DAHA 2HCJB 4K9MA 4P84A 1KRXA 5LQNA 2AJTA 2F43B 1XDWA 4M87A 2Q29A 4LFBH 2XKJE 3EAQA 4E5NA 1JEYB 3H84A 2YXDA 3FB4A 3TLZA 1WHTB 1PZMA 3DOJA 4MWCA 4J0EA 5DX8A 5FPYA 1UKAA 1XKQA 1UZUA 2BMEA 5GM2A 2NZJA 4H0NA 4DZTA 2IYZA 4EHBA 2C4NA 1DEKA 1DS6A 4PO3X 4HVLA 2QP9X 2QTBA 4CMBA 3LQ2A 3FVWA 5TV2A 1E92A 3M8KA 5JQWA 1K27A 5KG7A 4OJYA 2H65A 4Z4FA 4JXKA 2XYPA 3SS8A 1W36D 2C9YA 3E82A 2UVDA 1BZYA 3OFJA 2KPOA 4M0KA 4R2JA 2NU7B 3QNUA 3H2JA 1SC1A 2ZYRA 2XUAA 3TNJA 1MC4A 5KJ6A 1OHHD 4HLCA 5KG1A 1C9KA 2AJBA 4X7BA 4OB8A 4EGAA 4E32A 1NV8A 4MW2A 4DF3A 3H19A 1ZDMA 4Q1CA 3PE4A 3DDNA 1RRCA 4ZQFA 3RS9A 1KI4A 5HKBA 3VPAA 2IH4A 2J3MA 4XYBA 2FLPA 3NGXA 1DC5A 4URYR 5KFTA 1Y7PA 3QXHA 3H3XA 5LSAA 1OBCA 4PSAA 3BFJA 4C4XA 1AZSC 3ROGA 1VL8A 3THXB 4HNQA 1S9DA 5IX8A 3P97A 3DW3X 2CZCA 5MGNA 3LC0A 4RHFA 1JHQA 2GYWA 5LR6A 1YMVA 1Z74A 4J9RA 1OLXB 4AJ2A 1DRUA 1EJBA 2GCOA 4PXYA 5JPCA 4YHHH 4IDHA 1VM6A 4PONA 4HGPA 1QIMA 1NLUA 2YOGA 3M9WA 3GLRA 4DJAA 3TOVA 2CMGA 2Q49A 2PDAA 4MP3A 2J46A 3LRTA 1L5OA 3G2JA 4Y2YA 3PN1A 3U7FB 2JI7A 3R20A 2OHFA 1C7ZA 3M9MB 1XRRA 3IP3A 3S81A 4ABYA 4PE5B 2HLPA 1SBNE 3QV2A 1CYEA 4TS4A 4CUZA 3JWIA 2GCGA 1V9CA 2FKLA 2VH1A 4DR4H 3PJGA 3W2EA 3RABA 2FEPA 2ASLA 2OB2A 1CQPA 4ECYA 2VQSA 1R4MA 2HUNA 3WWOA 5JVDB 4G0UA 5JZMA 1SOUA 1JHRA 1XTUA 1OIVA 1PHRA 3ZY6A 3FHJA 3V8BA 1OJ7A 3SVLA 4MTDA 3GYGA 4YRGA 1YK0A 1P17A 2PSJA 5CA0F 4AY3A 4HN9A 2WBLC 1X1AA 5CTAA 1JPNA 3DF7A 1SG0A 2R48A 1KYVA 3LCJA 2JF0A 2H1LA 2GASA 2NU9B 1LC3A 3KKKA 4JLUA 3DAYA 3DZIA 4BNDA 2J08A 3E70C 2AFRA 3ZS9A 2ARKA 4RMHA 3JV7A 2QXUA 1Y37A 4M99A 4DSZA 2NO7A 1WDWB 1KBOA 1XQVA 4F11A 3A3YA 4N5DA 3W2IA 2C5SA 3P1JA 2BEUB 3AZOA 3NGLA 3V1NA 3MXTA 4WDRA 3QVGA 4QGAA 1GTZA 5GY7A 1KBQA 2O2YA 3THOA 3WFZA 5BR8B 5AJHA 1EH5A 3FSRA 3ZU4A 3O8LA 3EXIB 4BV9A 3DQQA 1WUHS 1T4GA 3MJDA 2XQFA 3AQIA 2JKVA 4BWFB 1WUJS 1FQOA 3E0QA 4RSHA 3L49A 5D7NA 4NCJA 5H16A 5JQGB 1X8XA 3VNNA 3L8CA 4JYPA 2EKBA 5DLFA 3T9CA 1DQZA 1Q17A 4BN0A 1JU4A 2I5PO 4IJVA 5ER6A 3AHCA 1JE1A 1Z6GA 4M0EA 2KI5A 4AIIA 2FUG6 3GC6A 3ZWKA 3G5MA 4IS2A 2J5XA 4RZIA 1JB9A 4XGIA 3BT7A 4NK4A 3IH5A 1Q50A 1I3CA 4J03A 4LWZA 4F4XA 3MIZA 1V9LA 2NZYA 1S5PA 3NHYA 1KORA 1C3OB 3OQJA 3LCCA 2B63G 3HEBA 1M72A 2IV2X 4UBLA 7YASA 3PJDA 1IONA 1G6HA 3D6VA 4EJSA 5DYNA 4MVJM 3HY3A 3CTMA 2Y1EA 1NQVA 3RVQA 1NY5A 2BUAA 4K3VA 3PK0A 1PT5A 1OH7A 3TE7A 2WYUA 4UD2A 5KYWB 4CFYA 3RTGA 3VPCA 1Z3IX 3U6BA 4IJQA 3KB8A 2AW3A 4IOLA 4HUQB 3OLXA 1PQ4A 2IYUA 3V55A 2EWWA 1E3TA 4YUVA 3GK3A 4X20A 1OH5A 1NNI1 3AF5A 2IDMA 1XWWA 5DRYA 3EPLA 1JPVA 5IN4A 3VSEA 1OVGA 1KL7A 5BVHB 3RRXA 1KMIY 3HGTA 4BFUA 1GEEA 1MR3F 5BYAA 4LIPD 5EFZA 3F8SA 1B6TA 2VIIA 1HL3A 1U2TA 4TVOA 4NENB 2WWGA 4MW5A 1YR9A 1FFAA 5H8WA 2ZTHA 1FX0A 2Q3FA 3ZU3A 4R1UA 1FFBA 3WS7A 3IVGA 1P33A 4K86A 4FEYA 3E9ZA 1DELA 4KR2A 4OHUA 2IZ6A 5BOVA 4DG5A 1KO1A 121PA 4IOJA 4C3VA 2WJZB 3CUSA 4OHXA 2JAPA 1WQ3A 1Z4MA 1JDZA 1IN4A 1BD3A 3AI2A 1BYIA 3EA4A 4QEZA 3LZ6A 2HAEA 3UG6A 3K2EA 3MJHA 5DGTA 4E11A 3KR0A 2Q6VA 2ZSHA 2J7KA 3QI7A 4D8TA 1Y1KE 3EZ9A 2BAGA 1WL8A 3FPKA 4LJRA 1ESZA 3CONA 1XKTA 2ZBDA 1KY3A 3E9MA 1XYYA 4NYJR 4R2WA 1CZRA 2MU1A 1KYZA 1HF3A 3BJRA 2JEZA 5BVGB 5HE8A 3T3PB 3ET4A 2Y1OA 5HNKA 4P3KA 3VKUA 2WLTA 3RGWS 4UHFA 4W99A 4I5FA 2DAAA 1FF9A 3HXOA 3GLGE 1O95C 4UU8A 3JZ6A 5ILOA 4I1OA 3JWJA 5BSRA 4CG0A 4E5YA 1AKYA 2DQZA 2V6FA 3N5KA 4B73A 3L92A 2PH3A 4G85A 4OTZA 2KMLA 1GSAA 2XVXA 4X1YB 4NMXB 5THQA 1QO0A 1E2MA 4DDHA 1JHOA 1FSGA 4KRXA 3Q0IA 3LDHA 2H3EA 1G21B 2V0NA 2W2NA 3H8VA 3I04A 2JD2A 3B2QA 3LW8A 1DV2A 3DE6X 2JGDA 2X0SA 2ORVA 3FHOA 4MKZA 2P4HX 3BQNB 4HFRA 1MAHA 2BM1A 1DWPA 2CLDX 4LGYA 3K4PA 4F1WA 1Y8QA 3NEYA 2PX2A 1A4IA 1EJ2A 4RTNA 2AJ8A 4TL7A 2BT4A 4G63A 5KFQA 5LZ4A 3ESDA 4BQEA 1RADA 4UCVA 2OY0A 1W59A 2JCSA 2I76A 2R1VA 3HS3A 2I99A 4ZOEA 4O1MA 4V0MA 1ECCA 3KWFA 1XLWA 3L7LA 4QJ4A 1GO2A 3B1VA 3ADKA 5SICE 3W8DA 4TUYF 1EA5A 3C2QA 1US8A 2C98A 3KE9A 2V9WA 4QYXA 2Y0PA 2F3TA 3GLQA 1PFVA 2E82A 5IBQA 2RGUA 3SWWA 1XCJA 5JASA 4O7WA 3L4BA 4YCDA 3IGFA 5TNXA 3GJXB 3ER9A 1LEHA 2RGCA 2ZI4A 3UT5A 2JLRA 2UZ3A 5ECGC 1NVXQ 4EKDA 4E46A 3M4JA 2QQGA 2W2QA 5CGQB 1Y6ZA 1MRZA 4E7PA 2WM3A 4TTPA 3D7KA 2YXNA 4QJ5A 2YU9A 4Z1OA 1QVWA 1SAYA 4E2YA 3H9UA 5JS2A 3U7HB 1SJ9A 3PQ6A 1NN3A 2DP4E 3PQ5A 3EIFA 3ZDYB 4F4JA 3KL2A 1X80A 3BZBA 3H6HA 5D3MB 5KT7A 1IK6A 5HUQA 1OCEA 3IKLA 4P35A 1AS3A 2QI9F 5BWOA 3DGFC 4UM9B 1HOXA 5GJVC 3OKCA 4MV7A 3PR3A 3DE0X 3T7AA 2ADOA 2B2CA 3OIYA 1FDIA 2OV2A 4YJ2B 4KOAA 3T7JA 5ICCA 1N8NA 4JI8H 1LVHA 4UAGA 3CEHA 3F6YA 4RK6A 4HDRB 3FI9A 3C3CA 1STOA 2Z9CA 3MRVA 4L4SA 3BE4A 1NBWB 1O94A 4WADA 3W78A 3A6GA 3GFOA 4X54A 3JZIA 4CL0A 4LZOA 4W5QA 1OWNA 1XEAA 2Q8PA 4S12A 4DLLA 2X8BA 2QY6A 5KOJA 1WV1A 4ER5A 3BD6A 4N5HX 4QSMA 1OAKA 1VPVA 1QO0D 2WIFA 4LXXA 4TMXA 3PXCX 5EINA 1LVUA 4LX8A 3JD1A 3K7EA 3UWMA 2BP7B 2BFEA 1IM8A 1SXJA 4Y2GA 4P0PB 5D1HA 2CLKB 5EJ5A 2G8NA 1ZMTA 1M2VA 1F8XA 5SY6A 3ANLA 3WNVA 4ETNA 4B1FA 3CE9A 4RDIA 3V6HA 3LXMA 1Z5WA 5BQ3A 4Q0MA 1O2DA 4IG9A 4CLRB 3PC3A 3RVJA 1DTSA 5EUMA 3S1AB 1OTHA 4WCVA 2VOBA 4FYJA 1WY5A 4M53A 1B41A 4QEKA 4Q45A 3RHZA 2ST1A 3DPIA 5JSZB 1IJFA 4DSNA 2CFMA 4PLCA 3V4SA 3D6AA 4B2PA 2QPOA 5B2EA 1YMQA 2A9PA 4EEKA 3HL4A 1O8BA 4HVTA 5F9NA 4EW2A 3L7OA 3LQ1A 5EWLA 4JB0A 1ZUNB 4NZZA 3I4CA 2GN6A 4ZAWA 4YC7A 2PT9A 1OXBB 4K1XA 1NVFA 1MOZA 1XWIA 2ZIEA 3ZUPA 3F6CA 4II7A 1DBVO 3VC2A 3O4VA 2BM0A 3LV8A 4A82A 2HK6A 5J2TA 1Y3IA 3G2OA 4OEHA 4P86A 4ZZIA 2P6PA 2R8BA 2HRDA 1SC4A 1VL1A 3N76A 3CJQA 5FBZA 3M70A 4PZ9A 3PYMA 2D7JA 2A88A 2FSVC 2QAGB 3L6UA 1CCWA 3ISJA 1PUJA 1YZHA 1ICEA 2P5YA 1O08A 3M6FA 3LL7A 4YMTA 2IIVA 1E2BA 3IL2A 4IH9A 1T4CA 4XFDA 2O07A 4D97A 3DV2A 4ZCMA 3ADPA 1KP9A 3UC9A 5D5PA 1L8AA 3NYQA 4NV1A 2X8LA 3N2LA 3MAJA 2WNIA 2HQSA 1RYFA 3OIFA 3KZNA 4KFSA 1TUBB 4QRIA 1K8ZB 1M7BA 1Y0BA 3QOXA 2ZS7A 1KQGA 3K71B 2ET6A 1C9DB 2JH8A 3CB4A 1O94D 2QTRA 4TN5A 4BTLA 2I2CA 4Y67A 2O3SA 1ANKA 3VVBA 3V46A 4BU0A 5HIKA 1VPTA 1NUHA 1ZCFA 3MSCA 5C34B 2B61A 3ZH2A 5JS6A 2W11A 5EP4A 4J9KA 2EBUA 3AHFA 4KR6A 3JX9A 4XQEA 3ZDDA 4Y2HA 1Y1VG 4RK0A 1JMYA 4HDKB 2X0DA 4S1TA 4ZU6X 2W7OA 3JARA 5AWFC 4CCAA 4OREX 4EKEA 1RIIA 2IYFA 3C5CA 4QUIA 1SXJD 3JZFA 5COQA 3CX8A 5MFZA 3UK6A 1H66A 4YR0A 5BR8H 1PD1A 4AMGA 1Q7GA 5AHOA 1GQRA 4AUMA 4NEHB 4O82A 1AB5A 3KPYA 4RORA 2XA9A 2XKAA 5J4KA 3A25A 1J49A 4TXMA 1TC2A 4YMWA 1ZVKA 4AT1A 1IPFA 4J7UA 5DWVA 2VPTA 4XAQA 3IPXA 1U2GA 5JJIA 1J5EB 2WLSA 1SD2A 1U4OA 5I5WA 4XTCS 3QWUA 2RG1A 1GYFA 4NFHA 4ZHSA 3LVBA 1ZNQO 1QB8A 2I3BA 2ILTA 4DAEA 1J07A 1VE1A 4BVJA 1MRNA 4XLZA 2Y1KA 3GA7A 2PXCA 4V03A 3LUBA 1OT3A 4IUCS 3THWB 1QE5A 4M2LA 1N5DA 2JJ2A 1NI5A 2VT2A 1ZMOA 1FP2A 3OD1A 3FLBA 4PCAA 5EUQB 5KFMA 2AJLI 4XYMA 4A3CG 1V7ZA 3MZ0A 5DLYA 1DXOA 2RB4A 3SQLA 1Y1TA 4DQVA 3CQZA 3WLHA 3ZX4A 1C9NA 2I78A 3HM9A 3NWPA 1PI3A 5B3KA 4B7CA 5A4DA 1EWVA 4BNMA 2W6MA 3OZIA 4BC1A 4YH1A 2SICE 4XUDA 2Q4BA 3SLKA 4KPGA 3T5TA 4QDTA 3ZTYA 1FFCA 1KYTA 4ND5A 4K5QA 2NWQA 1OA1A 4XH9B 4FXPA 1E7WA 2YY6A 3HB9A 2Q2OA 4BZXA 1EUQA 2J5BA 3S8EA 3WGYA 2V5UA 4RSGA 2R6GA 1YB4A 3KUCA 3NP7A 5HKKA 4IGIA 1E69A 4IFTA 5DGAA 4QW9A 2CT8A 4OM7A 4BP3A 1ZGZA 1JFSA 4LRXA 1R8QA 4G84A 2YXEA 3PHBE 2GMWA 4OGWA 4H77A 2QRGA 3H17A 4MV8A 2OCXA 1U7ZA 3C4QA 1F0NA 5KFNA 3L8GA 1D9XA 2QV0A 4XPIA 3VH2A 5IT9A 3G6WA 2DWPA 3WGKA 4W9RA 1X92A 1RJWA 1ZAYA 1NRIA 1QQAA 1E5VA 5KG3A 3E58A 1PFWA 4HK4A 3SBEA 4ZOLF 1FRZA 1RWQA 3QFHA 3A9TA 5KX5B 2EW2A 5ECYA 4MUIA 1A5BB 3KZ1E 4R2HA 2FQ1A 4J1NA 4IHJA 2V7TA 3EC1A 3O2NA 4C21A 4D9GA 5DLPA 5C81A 4EYHB 2HPHA 3NCTA 3HDHA 3P9SA 4JY7A 1ONSA 1Q7EA 2HG8A 3AM4A 1TLFA 1MG0A 1T0IA 2IEBA 5HZKA 3RUEA 1AGYA 4K6HA 3U49A 3MSXA 2L0XA 5LPNA 2AXPA 3LVFO 3SM3A 1G8JA 4R6XA 1L5YA 3L01A 3OZTA 1YFLA 1R15A 1MGPA 1RTTA 4TTJA 3IQIX 1A95A 1LNZA 1J2RA 1BMDA 3BD7A 3RJTA 3OOEA 1HQDA 2JJ2D 1Y7TA 4X3PA 3MN1A 4HXGA 2QUJA 3NYWA 4WFIA 2VS1A 3R0ZA 3BGOS 2O2SA 1I2BA 4KKXB 2VNKA 5JDCA 2Z83A 1JQDA 4JVNA 1LPNA 2YWXA 1R4AA 2DZDA 3WB1A 3QPUA 1FEZA 1V5FA 3ZZMA 3JQ8B 3VHXA 5JNVA 2QAIA 4I9FA 3GCZA 1GG9A 2PUGA 2WSLA 5EWFA 5DWDA 4YRLA 2XJ9A 4BFVA 3EOAI 5I7FA 3WDLA 3BRWA 3V9AA 2FPPA 3KG2A 4N5IX 2WZBA 4ROTA 3YASA 2ZWMA 3AUFA 1GUDA 4JJGA 4M6WB 4N3AA 1U02A 2YWEA 2XRYA 1SHKA 2DX7A 3HYNA 5JIBA 1A9OA 5HKKD 3J7TA 1BMTA 4KZKA 4BVEA 3GAAA 3C48A 4ZZ2A 1P2SA 1H1LB 4MUEA 3HCAA 3BF8A 2WJPA 2R8GA 4JBIA 1VRWA 2IEDA 3EXG2 4GMHA 5FOXA 2EBHX 2BEWA 4JC5A 1IBKB 1CK4A 1NXOA 3NBYC 5J5CA 1HM5A 4N47A 1Z5PA 2RHBA 4FDMA 3UK0A 2EGHA 3TLGB 2R3SA 3DEFA 1CJVC 1J23A 3VPBA 3BQMB 1NE7A 3TH5A 5KTKA 1JP7A 1UEJA 3QVTA 1HZJA 5EXDA 3PC2A 4H7JA 2H6EA 2SKDA 7MDHA 3X1ZA 4YAOA 2PS9A 1HL7A 4KXQA 3LYHA 1ENZA 4QA9A 3PL1A 4DV6H 1T9GR 5B1YA 1L5RA 4RL4A 3NBZB 3IVRA 1VMIA 1YF3A 2XT9A 3INNA 4UOEA 3I05A 2D5CA 1KAGA 3ZN2A 4D8VA 4JX9A 3H5RA 4ZXFA 4QUHA 2PA0A 4FFLA 4A2CA 3VISA 2BMAA 4CKYA 1FQWA 5CLIA 1G17A 4HQKA 1BFKA 1HX7A 1Q1EA 4G86A 3HY6A 3LP6A 1H93A 3Q87B 2AMFA 1AKMA 3JQRA 4U2DA 1RWBA 5HR5A 3DUFB 4JC4A 2JCVA 5BW6B 1CUYA 2E3JA 4WD3A 4EYQA 2OA0A 1AQLA 3H9QA 3O4FA 1JECA 4B4UA 4LSAA 5T41A 3DTNA 2ERXA 2PH7A 3MFHA 3TZLA 4FJ1A 3A7EA 4GXTA 3O4IA 4DA8A 2XX3A 4UDYX 3HCBA 2E85A 1TK9A 3WGIA 4KP7A 3ONNA 2JI4A 5BW8A 1P8AA 2QBYB 3PC6A 4O4IB 2JASA 1CQJB 3U1BA 2FSSA 4NPAA 1G3QA 3VR6A 3R9KA 1GD1O 3KVNA 3HJBA 3H5NA 4MVJH 2A3RA 1UANA 2V4QA 4MVJI 3UANA 2B69A 3PNBA 2HKIA 2O5VA 4WKBA 2G0NA 3LK7A 4Z0NA 1KQFA 4B85A 4EUNA 3AVTA 1UKYA 4QICA 1YIAA 4GLJA 4GC7A 2FCAA 5ERYA 2GPJA 3B9RA 4JT2A 3FJ1A 5H9VA 1YS4A 2IYOA 3PI6A 1EA7A 1BSVA 1M2WA 3HP1A 2OCBA 4ARUA 3LGSA 3W5AA 2D1SA 1UMDB 1OFHA 3JR3A 3SIWA 3RKUA 5LLDA 4ZALA 4AMBA 4PPNA 3P32A 1TVCA 3G7SA 3HI6A 3PW7A 4BIIA 4NJOA 4BRZA 4DIDA 4F0JA 3CNEA 3X1JA 3NJRA 3I61A 4PNPA 4Y8VB 1AHIA 3K2BA 2ZAYA 2VK2A 4P36A 1CUBA 2Q3CA 2XB9A 3KTAA 4HNHA 4BNZA 1OTYA 4JJ7A 4U7GA 2XNKA 3BAZA 2R8JA 2NO1A 2UKDA 4O59O 2O4CA 3O8OA 3MFQA 3LYAA 1L8OA 5LLSA 3A27A 1IUOA 5J63A 2VKTA 3U40A 4G4SO 2YIVX 1RJRA 3IELA 3DOCA 2BJHA 3VTAA 3CRZA 3H1PA 4FLMA 3JQ7B 4DW8A 4YRPA 2C2RA 1UC5B 4G1EB 3GLIE 1ZSYA 5TE9A 3VX3A 2ZCUA 2I1QA 5BOSB 3SI8A 2WZQA 2XF8A 2LBPA 3WLLA 1NJ5A 1F3LA 1CQZA 4E03A 4C4OA 1N6LA 4AY5A 3ZY5A 3WBJA 5KT6A 2JK0A 3TB4A 3RLIA 1YFJA 1VG0B 2DJIA 4YHHB 2JJQA 5T7BA 1NBME 1QLWA 2PGJA 4OFWA 1PVDA 4G4JA 2CNOA 4UQPA 4DIBA 2YWFA 2ZWOA 1IE3A 3GLHA 9LDTA 5C7YA 4Z9AA 3CLSC 3KXDA 5HG0A 1ZD4A 1YZYA 1E3QA 4IH1A 4Q8FA 3LBFA 1QGYA 5BR7A 1WH2A 1WMSA 2YXLA 3HKBA 3BMNB 4HP8A 3VR6D 1UEIA 2ISQA 2OCLA 2P9HA 4A3IG 4M60A 4YRMA 2EP7A 3JQAB 4XWTA 3ZHSA 4L8FA 2PD4A 1GKUB 5AVQA 1IWBB 1SIUA 5ITZB 5KFRA 1LRJA 1J5EH 4F96A 4PRKA 1WF3A 2EV9A 5LOVB 4ETMA 4U9IS 1AK9A 2HLNA 2XCPA 5L95A 2X4IA 3WAJA 1P4JA 1IMOA 2BR3A 3QVJA 1M2NA 2MSWA 4K2AA 1E7SA 3D2BA 1TIBA 3LSYA 3OQ6A 5KFLA 1WG8A 3WKCA 3RUHA 2QSJA 4E22A 5JHHB 2P69A 2QTZA 3PXUA 4P53A 4V3CA 1N36H 4R1MA 3HMKA 1C1XB 1XDBA 1U0TA 4RZ2A 1CR1A 3KPJA 4DRYA 2SKCA 2PLWA 3DZFA 3L82B 1W49A 3DBLB 4W63A 3PNMA 5JNTA 3ZW7A 3QOFA 5ELLA 3LTEA 3CLRD 3HKZE 3WGJA 2VK4A 3TBFA 5KCMA 3GUVA 1VA4A 2E18A 4D5EA 1CVLA 1ZH6A 1P3DA 3VGPA 1B33N 1QK5A 5KNCA 3REFA 3QWFA 2BW0A 4QFMA 2I1VB 1DEOA 3LXXA 4YIKA 5DOVA 2FUKA 2ZKIA 2FZKA 5IYDG 2ZYDA 3BILA 5AIBA 4BPBA 2QYTA 1NBHA 1NAIA 2GBLC 3RBXA 5CP8A 1JR3A 4F38A 1NW5A 2BBWA 3KBBA 4J9VA 5AW0A 3FYHA 1DSSG 2VTVA 2XODA 4M49A 1MNAA 4MW0A 4P54A 4GO1A 2QX4A 3BMQB 3OFKA 1QOQB 3K9FC 4PG6A 1DX6A 2A7XA 1YE8A 4Y1RA 5D6NA 3R5FA 4IYRA 4I9GA 3NWOA 5IRCD 2H1IA 2V0CA 1JAIA 5LQAA 1WTCA 4F7WA 2GK3A 4R05A 1PK8A 4C2BA 1FMTA 4IX9A 3RB0A 4UBKA 3OURA 5C4IA 2DJ5A 3VR4A 3VYRB 1RK6A 1OZGA 1QZUA 1X0VA 4B44A 2G5GX 5GZ1A 2FP4A 3Q3HA 3A6KA 4O4LB 4JAVC 1KAQA 3DV0A 3A0UA 5IHXA 3BTOA 1OFTA 2ENUA 3WQSB 4M21A 5DH9A 1EEXB 1Y33E 1HT1E 3HRKA 3KYCB 1U6KA 5KREA 1G8KA 2VF8A 4I4CA 1XCMA 1OT5A 4CM8A 3EYWA 1RKBA 3AEUB 1BS9A 2UUAH 1L5VA 5AVUA 3OP4A 4MYDA 1KS2A 4NE2A 2PUWA 1SHJA 4UHEA 3A14A 3MA0A 3PUXA 5K0CA 3R6WA 1T13A 4PG8A 5EJIA 1PEKE 2MINB 1RPNA 4JHLA 2MSDB 4AJIA 1LQTA 5DHSA 4TPKA 5FNVA 4PGFA 4PR0A 1BXGA 3AL0C 3LX8A 5KDOA 1QHXA 2CNLA 1SUEA 3RW9A 2FW8A 2JIDA 4KDEA 3LZCA 2JLXA 4MTEA 4TKLA 3IA2A 1SXQA 4FMCB 2OGTA 5IT9W 1NLFA 1T9BA 1XD2B 2XQVA 4ZPJA 3L9WA 4LOKA 3W6PA 4NARA 4TLMB 2TECE 1D0SA 3M3HA 1NOJA 2YIDA 2QM3A 3GIIA 2XRFA 4QPCA 1NVMB 5EVJA 2GSDA 3A28A 4DAOA 1C8LA 3NVAA 4K6KA 2D3WA 5KNCD 1E4EB 5BSEA 4JWTA 4DLZA 1AUXA 4ND4A 4DKXA 2PSHA 3GLFA 1QH9A 4MTLA 2PXAA 4HQOA 1KBZA 4RAZA 1SELA 1BHSA 1IEVA 1JR3D 4EI9A 4TQGA 3CEPB 4G5FA 1OASA 4EB6B 5KFDA 1W8IA 3CTPA 3R40A 2ATEA 4Z9FA 4CMGA 2HOQA 1CUCA 4FN5A 2IPOA 4RK5A 4HS9A 3U13A 3WGTA 2E6UX 5I8WA 4RH1A 3BPSA 1FSFA 2P4QA 1Z5GA 4ECUA 2P8SA 3CVWA 1S8NA 1IBKH 1B42A 5DVZA 3K6SA 3FYDA 3RG8A 4EYOA 1KEVA 1SY7A 4NDNE 4DSOA 4A7PA 1SPBS 2HWYA 1A9RA 4MITA 4KIJA 4GVPA 3EIUA 1TYDE 2GEDA 1PR5A 1NONA 3VR4D 3BKWA 3Q2KA 4UM7A 3B1XA 4CMEC 4U5XA 5CB8A 2O2JA 3FBWA 1GUZA 3GLUA 3RVSA 5L51A 2W5UA 5T8KA 3G02A 2ZRFA 4QVKA 4Q19A 1NG9A 4P7GA 1I3LA 1NXSA 1D0IA 2O2DA 2Q21A 2VF7A 1GV1A 2IYVA 3DQPA 1UZNA 4XDHA 4EY8A 2PU7A 4RD1A 1WLYA 3WGOA 1NXVA 1L5HA 1PR3A 1TJ5A 1E63A 2PMZA 4OIFA 1A7KA 2YJ6A 2O5RA 1YQ9A 4OK5A 2CWWA 4RGYA 4MPDA 1NJ6A 1G16A 4TQ9A 2AA3A 2V9CA 3LT1A 3H0GG 5FUXA 2J32A 2IUTA 1BG6A 4P4SB 2ZRKA 4F60A 1IG0A 4CCWA 3H2BA 1PR0A 1P1FA 1DB3A 4DCVA 1K7FB 2QD1A 1N5IA 1U0FA 3DGEC 4AN1A 1AV7A 1K2WA 5FTKA 3HJGA 3A9WA 1LWOA 1IZZA 1GPDG 3N8NA 1HQKA 1PDOA 3EN0A 4QJFA 3IVCA 3KSBC 4MUFA 1GQFA 2J3QA 2VHXA 4JI7H 4BVFA 4P80A 1M33A 1Z13A 4ED3A 4ZJYA 2CW8A 1NXXA 3R5JA 2FUG1 2D1TA 3DTFA 4AO6A 3EE6A 2CBXA 3RUFA 4QUJA 5IAOA 2ZSJA 4UDNA 4YV7A 4WI1A 2C5HA 4NKRA 4N4AA 1XTTA 4NE9A 5CD1A 5JAMA 3E05A 2QV7A 5LYYA 5DGIA 3HBMA 3NAZA 1S2LA 4W7SA 2ZK7A 4G4IA 4D3DA 1HE4A 5DX0A 2Y27A 4JXUA 4S05A 4HTAA 3MCZA 4MDFA 4CHIA 2J9ZB 1U1FA 3GOQA 3OPXA 3ZE7A 3SQWA 4XOIA 1BKDR 1USKA 2XQJA 2ISSD 4LXTA 5FV7A 1MZBA 3CB2A 2OE2A 1CUIA 2FZWA 4LA4A 1MH9A 2LR0A 4LOIA 1AUVA 3T7CA 4H08A 2H7YA 1RP7A 2EDCA 5H4GA 1R50A 4Y2RA 3VZBA 2LKCA 3R0VA 2VUUA 4JLJA 1R6DA 3CS3A 1PW7A 4JI8B 2HT1A 3MWGA 5KS2A 1P4AA 4NEQA 5SZIA 3QW2A 4D45A 3UN1A 1QJ4A 4UPEA 4FSHA 1SUAA 3ED1A 2FF7A 4DQNA 3A4YA 4B74A 2PY6A 4OK3A 5EY5B 4H1HA 3S6JA 3JZDA 1Z7GA 4ED9A 3GA5A 2A58A 4E2WA 2B1QA 2Q5OA 4EUHA 1ODLA 4TSFA 3P71T 4JSRA 3QU7A 4POOA 1Z0SA 5J58A 5FPRA 2KJQA 4ZYZA 2UVPB 4X97A 1S0MA 4NJMA 5LC1A 4JI4B 3HSYA 1GQOA 2QE7A 4ZZ1A 3G7NA 1ZK3A 4R3NA 2HEIA 3DLPX 2VDWA 2P2ZA 4C3ZA 1H65A 4RUKA 3N75A 3AFOA 2QRJA 4WCDA 1UBEA 1S7GA 4KH1A 4L9WA 3S5UA 1V51A 3JAKB 3IAUA 3OTGA 4RHTA 2JLAA 2QSYA 3DBHB 1TK2A 2ACVA 3PWZA 2HHHB 2WJGA 3FPFA 2NSLA 2AJDA 1CDZA 2RHGB 2WWYA 3IMFA 4EMUA 1EUDA 1R18A 3NOXA 3WO1A 1R27A 1C9YA 1LS6A 1MENA 2YWHA 2Y1FA 2AE1A 3TZQA 4CF3A 3BWYA 4B34A 1U7OA 1FDWA 3SD7A 3AR9A 3ECSA 3OBIA 1KT8A 4HG2A 4ERXA 2IPNA 3ZYCA 2F90A 4OXKA 4RA6B 3F3MA 3SC3A 2C2HA 2VWGA 3RUDA 3TSWA 2A5GA 3UAYA 4DABA 1Q74A 4IIXA 4FEGA 5T6MA 1U8YA 2XJ4A 2NU6A 3EXFB 1KI6B 4QXQA 3Q3IA 2VP2A 2IVFA 5REQA 1RXUA 2YQ4A 2JLSA 1XLTC 1YCFA 1PTKA 1T0JB 4PGAA 2AEFA 4B4KA 3IAAA 1Z6XA 2BH2A 4L9AA 4LZNA 2QYZA 3TOSA 3L8EA 5TRTA 3O83A 2Q4OA 2I9KA 1SB9A 1IHDA 3V6LA 4TVBA 4EMTA 3NXSA 4E2ZA 1RI2A 3LFUA 2F4NA 5MGBA 1B1AA 2I29A 4AF7A 2H54A 4A0QA 2NV2B 4GVXA 3ND6A 5K4AA 3EMDA 4TSFD 3WB0A 3ETJA 3DE2X 2XPCA 4KRFA 4DLWA 5A3RA 2YKGA 1JEEA 3BB1A 3PUZA 3H8JA 2B9EA 1YFZA 3RRYA 2OBLA 3KLNA 2QE7D 1UOEA 4IPTA 2ZIZA 4QGGA 1HV8A 3NCHA 3RUCA 4QC2A 4ECWA 1OUMA 4ZI7A 4ALNA 3L0PA 2RCYA 3WLFA 3DAGA 2REQA 1CQXA 5BUZA 2Q7OE 1T9AA 4JNCA 3RS0A 1IVSA 1VMKA 2MMCA 2Q1UA 4AICA 1K0FA 4HPJB 5CEFA 3CX4A 1P44A 1DKQA 4CKWA 2B2XA 1T3SA 1SVWA 2C2MA 2GZHA 4Z8XA 2G9QA 4FK8A 3TD6A 2BKVA 4JQYA 3MD9A 1JDBC 5F2OA 2NMVA 1CW2B 1XTPA 4FW9A 3RR5A 2FDCA 1EVLA 2ODNA 2WW8A 2POCA 3IDFA 2CL6X 3R77A 5FBKA 2I6XA 4FCTA 1T3GA 1QAMA 3STHA 3FGPA 3HB7A 5G3ZA 6LDHA 1U7PA 4P1ZA 2WIAA 5EZ6B 2I7XA 2JEIA 3X2SA 4PYLA 1EFTA 5FA8A 3W3AH 2XI4A 2PX8A 3Q3CA 1ZHHA 2WZDA 2AB0A 1N6OA 2O7VA 2M32A 2ZU0C 1I7QB 4F5YA 4PAOA 3SS7X 4MRSA 3H05A 2FLNA 1ECBA 1Y3DE 1OSNA 4R54A 4UAJA 3PCXA 1UC4B 5KYXB 2OAEA 3BWDD 3AOGA 2DHQA 1AA9A 3WLRA 2ZJ8A 3NFRA 3BGDA 3GXOA 3GFSA 2Y4RA 3PTZA 1JEDA 2O7QA 4DAAA 4HGZA 1PUXA 1SBTA 3RJMA 4PRZA 2AKYA 4MS3A 2Q4DA 3BWBA 5E7MA 1Z5VA 1L3CA 5IF3A 2XKKA 4MQFB 2PN1A 3EUFA 1J56A 4AKHA 3BWXA 3KJIA 3PEEA 5FOSA 1J99A 4RMNA 2N1MA 3HVHA 2J8ZA 1G98A 4PHTA 4CQJA 3RVNA 2ZYWX 3CO0S 1GITA 1KQNA 2ICAA 4GKAA 5EERA 1Z38A 1GL3A 4WZ6A 3CN9A 2HIVA 2AYXA 3ZGZA 2JH3A 2ZJ0A 3VKFA 2PYZA 2ZJAA 4RNOA 5AVOA 3VMMA 2BHNA 4GLOA 4EEYA 5FTMA 3U48A 3LUPA 2CCJA 4IR9A 3E1KA 3IEIA 4ZT3A 3PGA1 4EG3A 1G5PA 1NQAO 4O3FA 4YCSA 1UDWA 3TTVA 3KVRA 2O2CA 2WDZA 2LCQA 1EK1A 1YGYA 3ROQA 3AOEA 1EP2B 3WLSA 3NWBA 2DHDA 1EUZA 4YAJA 2Y1GA 2FSIA 2X5XA 3R3SA 4MRMB 2XVZA 2IEGA 2VHUA 5CIQA 1KZ6A 4BX9A 2J0UB 4UATA 4BLUA 2EZUA 4MEBA 5FLXA 2WNSA 3E3OA 1DOHA 1NDQA 2B8WA 5EUBA 3ORHA 2IY7A 2LDXA 1LTQA 5F64A 3T3OA 1BEZA 2BM9A 3UB2A 5AK3A 3BIXA 4BO8A 5KFXA 4BQNA 3R3VA 4OSEA 3I6YA 4UCXA 5LUBA 2WEKA 3G49A 1UDRA 5B1SA 2XCQA 1XQ1A 2GK7A 5I9IA 4J29A 2E4WA 4MJ3A 1DARA 2FWRA 4TVKA 5JVDF 1RVV1 3I2YX 2EZTA 3REGA 4MJ7A 1E98A 1BJRE 2H00A 4BCCA 1KU6A 1YDHA 1BCSA 4LC0A 2FLKA 2HWUA 3KQOA 1C9EA 4LI3X 2HZBA 1XEXA 3BCRA 2D0IA 4EFMA 1J5XA 3OQVA 2H57A 1ZOPA 2Q3HA 4G3IA 1GAJA 4HATA 3HZHA 3D6HA 3HJHA 1V1MA 2BBTA 3RSLA 2VP5A 3AKDA 1GFIA 3TK1A 3PNKA 4DBLC 3GL9A 1X1DA 3FVQA 2NM0A 4B0OA 4YAFA 2CYCA 3STYA 4TV8B 1E2QA 3HGMA 3IX7A 4LHZA 4FC7A 4UE2A 4DM4A 1Y6FA 1JT2A 3QFSA 4U2GA 2PWAA 5TR9A 4N40A 2WMNB 5DYYA 1WXWA 3VBCA 3Q8XB 1AKQA 4EI2A 1YD7A 4C01A 3Q8MA 1T9ZA 5JQGF 4I1VA 3SE0A 3OWOA 3KKPA 4DL9A 5KKNB 3AHDA 1D8TA 4AZ3B 1J2JA 1EK5A 5D01A 5J59A 3ED5A 4R8UB 4MW1A 4WHXA 2HDNB 2R87A 3D6MA 1P74A 1NF8A 5E3JA 1VBKA 2Q0SA 2QENA 1E6CA 2BZ1A 3EXEA 4Z0PA 4F06A 4DV6B 5DI3A 1X1SA 1CP2A 3NOVA 2XECA 3VOTA 4GX0A 1UPUA 3MTDA 1NHGA 4KLCA 4FGJA 1NURA 3S2GA 1NPTO 4RGVA 4JV0A 2Z4TA 4RD0A 3NJ4A 3N2GA 1AUOA 5C51B 4DV7B 4JUCA 1TQ6A 4GRIA 2J9XB 2UXDB 3UH1A 4AJEA 1ZVVA 2WF7A 4H4CA 2C78A 3RT9A 5BWUA 2BUCA 1K4YA 4JQCA 4D02A 3VHLB 5L1LA 3OJWA 2V45A 1HZZA 1IEQA 1ZXLA 3K1YA 4CTOA 1YTLA 3NIBA 2CJXA 5ALOA 2AD5A 4II3A 2RGGA 3KHGA 5JROA 4BQRA 4MK4A 4FHZA 3R9IA 2HU2A 3AJDA 4PFKA 4JI4H 4WV3A 1JKJA 1ISMA 3IEVA 4P08A 1M76A 3A2LA 5JD5A 5FTWA 4Q1EA 1CKOA 1DJOA 2R1UA 3TE6A 5HVNA 3Q0TA 3OLYA 1XVUA 1PR4A 1ZVQA 2DKNA 2NV0A 4ZMSA 3RE1A 4RVSA 4NS4A 4PNZA 4GOKA 3HUDA 2QLLA 4NCXA 1X1RA 3UWPA 4MGHA 1MQAA 2ECFA 1T5LA 4HNGA 2H4ZA 5AW3A 1N2CB 4WOBA 4KO4S 4KXLA 2HHHH 1JSZA 4OH1A 4L1KA 2VOEA 1T8WA 4MS1B 4YMUA 3QUQA 3NGMA 3HCEA 2WNHA 1XMIA 4MYRA 3Q41A 4N3CA 1NZJA 2GBIA 4R7RA 1MD9A 3U5ZB 3VNUA 3M6XA 4URWR 1W581 4Q4AA 1SK9A 3RWOA 3SNKA 1IQUA 3IMKA 1HO3A 5IW8A 2XGJA 1KDRA 5FFFA 2HRBA 4PLYA 3VAAA 2RDJA 4YN3A 1RC1A 1YB7A 4L3VA 4LQCA 2FWAA 3C7TA 3QLUA 1BJKA 5C8VA 3PFBA 2Q3MA 4Q3LA 3Q6IA 2QD3A 4LZLA 4TYMA 3HCWA 3W8EA 3F5DA 2F8SA 4FWIB 1N0VC 4IINA 3AXSA 3PGMA 3KYDA 1ZHOA 3U60B 3GN1A 1BH2A 1JA0A 1HQCA 3GLSA 4Q12A 5JRZA 1OBGA 2QTCA 4TLCA 3TAUA 4BIMA 4YT8A 4CEJB 2PCLA 3FCSB 5E7QA 4G5OA 2W6JA 1RS0A 1M1UA 4WZAA 1UNNC 5KFCA 5I5SA 1OXTA 4RB3C 2XAAA 4EW6A 1CY1A 3WLEA 2B35A 5KIAA 4HGOA 1PFKA 4GPZA 2Q4EA 1GILA 1LC0A 2RH8A 2GF2A 2DT5A 4MLDA 3R6TA 2Y6VA 1S8OA 3OLZA 3LX6A 3G2HA 5TPWB 2HFJA 1NBEA 2Q28A 1JI3A 4J2OA 5D86A 2GN9A 3MT8A 1E9VA 1SQ5A 4CL8A 2HV8A 3MR6A 2VZ9A 3JD2A 1UWLA 2G07A 1RYEA 2C2ZA 3TMYA 3K09C 4M0JA 4MYUA 1W96A 3RRFA 5DXJA 1SBCA 5DHUA 1WMDA 4CKBB 2WYWA 1TVKB 4H3SA 4QVIA 1A9PA 1GYPA 2OPHA 3KQNA 2C82A 1WBBA 3QQPA 5KOHB 1H4SA 1JJ7A 4ZK6A 2ZR0A 3UXYA 2IH5A 3OIWA 4BLWA 2EHDA 1CY6A 4GPIB 1WXXA 5FA6A 2ZR8A 1RCFA 1U4NA 1ZGHA 1E89A 3TRIA 4EQZA 5CE8A 3HKCB 4EW1A 5DT9A 4QAQA 3Q9SA 2PLNA 4WX2B 1SKQA 5EYPB 3GRVA 1MX9A 2H8GA 5EC8A 3ANSA 2A0KA 3BKXA 5J5AA 1MX1A 5KFUA 1U6JA 1K7XB 4OXXA 2XGSA 1XB2A 5TMBA 2GD2A 1DKNA 4H2DA 4D7AA 4BWYA 5CFZA 4JLNA 1QTIA 4JGIA 1UAAA 3E61A 3V8NA 3ZE1B 4QQKA 3W5UA 2YQ5A 3VO1A 3N8KA 5FWXA 3G2LA 3K0SA 2P1ZA 3IULA 1QX3A 2DBVO 3HVRA 2VP9A 4NU8X 1N36B 2B2NA 3ROPA 1S0OA 1KPGA 3RC1A 2CFIA 2QX8A 3D2AA 4ZVMA 4QT0A 4YGXB 1VIYA 4ECXA 1M2EA 3HJFA 4CM7A 1YIDA 1PZHA 3IA7A 4YJ2F 5EZ5A 3C5EA 4ZYWA 1NFQA 5KNDH 1ISRA 1E9EA 5TLSA 3C7CB 1WSBA 1QQ5A 4EA9A 4JITA 4DLVA 1P8JA 1Z06A 3LUKA 1SG6A 1Z0ZA 4LNUB 4BY7G 3NC0B 2V8OA 3ZHCA 2X9QA 4B83A 3X1YA 5HZHA 1HC7A 2W6JD 1HNXH 3IEMA 3FVVA 2HQ1A 3Q1LA 1EWTA 4L7VA 1P7PA 1Y8CA 2O5CA 2J7PA 3WOVA 3NAQA 3OIVA 1ICIA 3NANA 4HWRA 1ZMRA 2QRMA 1ENPA 3R41A 5F73A 5A5DA 4OKNA 2I8CA 1KO5A 3HBFA 5KAMA 4UTNA 4CKCA 1YU9A 1CIVA 2IYRA 3HDYA 4BUJA 4QDUA 3EGEA 3HE3A 3H6KA 4B76A 5DP1A 1E6KA 4EG6A 2C5AA 4MVJF 2ZJ7A 3AFHA 4BZWA 1FIUA 3ENZA 3HCOA 4RCYA 4K9OA 3U81A 3A6FA 3R0IA 2PTGA 3W5VA 5L3SA 4N12A 2G8LA 4TZ6A 3EGDB 8ADHA 1DO2A 1FJ2A 2WILA 3QFCA 1ECJA 3ZK9A 1TUGA 2X5RA 4YRTA 1XAHA 1CZKA 3DDHA 2CJWA 2Q5QA 4DDVA 4LXYA 4KVFA 2UUAB 3NVMB 4GZ3A 3FR7A 1ZN9A 3DF9A 1PJ8A 4PC2A 4BY9E 5HOQA 2DBYA 2GBFA 3G23A 4EG1A 2BFDB 2CN1A 2YRXA 4XJSA 5LB4A 3H0KA 4RMJA 3GY0A 1B6RA 4IDBA 1K7SN 4C6TB 3TZHA 3B7PA 1NRWA 4UTOA 5K6RA 3X2FA 1PJRA 1UM9A 1RWMA 2YMQA 3GVXA 1D7AA 3S8YA 1M2GA 4YT2A 1G6KA 3OUZA 4ZTZB 3RBAA 3T5HA 3VR0A 2PRIA 5BYJA 3KYBA 2DFVA 3AIMA 2AZTA 1BJTA 4GI3A 3U4CA 1ZU4A 4ZRNA 4JJZA 3EWAA 2O3RA 3IE1A 2X14A 2V9ZA 3NU1A 2IW1A 4UHHA 4EPXA 3RT7A 1UXOA 1ZD1A 2Y9PB 2ZE6A 5IM4F 1A7JA 2WF5A 1XI2A 5TQ2B 2FN8A 1KO4A 1P2FA 4Z3KA 1V7PC 4PZ6A 2V1UA 2YOHA 3MBIA 5IVPA 2OZLA 1U0LA 5K0SA 3I8SA 5EE9A 5M3BA 5F9HA 1UBRS 3DMNA 4DRXB 1KMCA 3AEKA 3TRHA 2O05A 1X1EA 5DMXA 1E3DA 1WZ2A 1N1EA 1OGIA 1L4BA 1HSOA 1GU1A 1RHRA 3FG9A 4QXAA 5HUJA 2J7PD 5FUMA 1TQDA 2XOKA 1E1CA 1ZCAA 1NQ5A 3VZSA 2AWOA 5AP9A 5IYCG 1KI8A 3IHLA 1ZJ5A 3DFIA 2HR1A 1UH5A 4P83A 2CY0A 2JA7A 3UJCA 1H05A 4WL0A 3UV7A 3TUIC 3EVZA 1Q0LA 5DE3A 1YB1A 2ZS9A 5LP6C 5FPPA 2QDKA 3H11B 4JB2A 4NPHA 3K16A 3OQBA 2M6RA 1WZUA 4K28A 1K86A 3RJ9A 3KALA 1R16A 2F1KA 3DEJA 1JQJC 2QRKA 5K2OA 2A14A 2UVVA 3VPFA 1Z0FA 4MRAA 4U7FA 3AR7A 3ZWQA 4J3JA 4CEIA 3EWIA 1KMMA 1V16B 3MS4A 3VYUB 5LDGA 3FE2A 1UR5A 3Q3VA 5FHRA 2VP3A 5C5DA 1KEKA 4GE3A 3GVIA 1JX6A 2WV7A 2CNBA 4GR5A 1QFXA 2O1XA 5KUTA 2G9RA 2NQTA 4LPKA 5B6IA 3QTTA 2EX1A 3DULA 2ZBQA 2JAOA 1E8NA 3P20A 4MO9A 3TSAA 3UQ8A 2Q1SA 1MB2A 3KLOA 1XZKA 1G21E 3B6MA 4CM3A 2WFLA 4DV7H 2COEA 1X7WA 1X8LA 1Z35A 2G70A 4Q4HA 1F2TA 2QSZA 2UXDH 1T5HX 5CX1A 1B8UA 4QBKA 1ZL0A 2HXYA 3JAMA 4HD8A 2VG8A 2WB1A 2JGJA 1SM4A 2UYYA 2PX6A 1COWA 3M9XA 4PLTA 2O0HA 4JI7B 3D5QA 3N44B 4KJZA 2NZUG 3OT1A 3CMMA 3BA1A 1TTQB 4Q1DA 3N28A 5TS3A 2G7MC 1HURA 3EPHA 2QVBA 4PNEA 2XUQA 1XLUA 2P5TB 4PXSA 4JUAA 1Z5OA 2GAOA 4BATA 1UK9A 4TMTA 4FONA 1AQIA 1XVVA 3OF2A 2NYAA 1TJYA 5C1BA 1N1GA 1R00A 3O82A 3DAOA 5CXQA 2EFGA 1LSUA 3BIJA 4I4NA 3CNQS 1Z6ZA 2Q46A 3I3OA 2ZDHA 2FXVA 3ASUA 3BRWD 3V34A 4W6ZA 3TKLA 9ATCA 2ZZKA 3GJSA 2WT9A 3JPWA 4QU8A 1JFVA 3T7TA 5CVJA 3IODA 3DD5A 2IRWA 2W2KA 3FTEA 1SULA 3BTVA 4BMZA 3NV7A 1MB9A 1SCDA 4EY3A 2PKWA 3QYPA 4P5EA 3QVSA 5EGNA 4ZREA 2XOKD 4AIRA 4EY4A 4X45A 3OEEA 5A2QA 1HR0H 3OZXA 4QYTA 4F4CA 2HVRA 1PGQA 3MHPA 3QMWA 3ZLJA 2H5LA 4TRJA 4Y18A 1WCYA 4GMGA 4YAKA 2JLCA 1G4HA 1DNPA 4UKDA 1R6UA 1J8VA 5BORA 3G2IA 2COJA 5KX5F 4HNRA 1S3FA 4EW3A 4BFLA 2E5FA 3HCCA 2F9FA 3VC3A 4Q21A 5IEJA 2AX4A 2V7XA 3H2HA 3ZXYA 4C03A 5B3JC 2ZRBA 4M0LA 3T4EA 3DTVB 3G6XA 5IJ0A 2ES4A 3B5JA 3PDIA 3QEBZ 2PBLA 3ZCRA 4XVQA 3OMWA 3VU8A 3L7IA 2G06A 3U3JA 1M2OA 1KH1A 5JZSA 1SFRA 5EP3A 3O74A 1NTRA 1EXMA 3GFVA 1XRMA 3PQDA 4J4BA 2Q2UA 3TPZA 2PVSA 1B3RA 3QBDA 5G02A 2RHDA 4FM9A 1ZR4A 5IAEA 1JTVA 1KEUA 4ZCLA 1IY2A 1COWD 5IH7A 2OHHA 4MVJE 3F78A 2FUEA 5F23A 2I22A 3IUMA 5AW5A 4ND1A 4NPCA 4Q7EA 5DW3A 4R9NA 2R85A 4XIJA 1G1AA 4DPLA 3E7PA 3PC4A 4LE1A 3FX2A 4IIUA 5I5TA 3U3KA 3TQCA 2B4AA 4B84A 2CNUA 4IXMA 1ZJZA 1DQNA 4MW6A 4PN7A 2VDRB 4D0SA 2J6HA 1SUSA 3UHPA 2BMDA 1N5OX 3ZC3A 4JBNA 4UNRA 3N53A 4NH0A 1KH3A 3SEQA 1ZIYA 4FFRA 4WZBA 4UBMA 4RTRA 4OG2A 1FLAA 2X1VA 2WP8J 3KM0A 3UW1A 5HCIA 1BD4A 1HKHA 2CHUA 3TIXB 3UQZA 1R4NB 1C3EA 3VFDA 4ZI3A 2H4XA 3U4MA 1TD9A 4KR9A 3OLQA 1WSDA 2PGNA 4CVNA 3GEIA 2C8VA 4LCBA 4ME6A 1RMTA 3OEED 1PL7A 3IP1A 4B80A 1ZC4A 4AG6A 4DHEA 1FFDA 1A5AB 5CVUA 3B1FA 4K9LA 1G6Q1 2RFLA 1GA6A 3UJPA 1V47A 3BAFA 1Q0RA 2XUIA 3CZAA 4IHAA 3D3EA 4H1TA 3WGMA 3I01M 3D7LA 1WJGA 4RY2A 1NYLA 4YRJA 3FFAA 1G5FA 4LOLA 5AOAA 5GJCA 1JWAB 3OZEA 1L5MA 1YZKA 1IZ9A 3LNCA 2V3CC 3W1GA 2W9CA 4IIYA 4XE5A 1GZ6A 2ZYGA 5CCDA 1XPJA 2QNIA 3B5IA 2FPWA 4G1MB 2PT7A 4WMLA 2JLVA 1P5FA 3UO8B 3UJDA 4LZWA 3FJOA 4YDRA 4G23A 2XF2A 3ERCA 4RLFA 4E1VA 3GMDA 2Y1XA 2ZJYA 1RQPA 4HYQA 2JIQA 1RYZA 3LFTA 3CIFA 3KPWA 4JLSA 4IZOA 1U63A 1TJNA 2GBGA 1CZLA 1X9HA 2QJWA 5BV2P 5HS4A 4R8KA 5TJ9A 1LPAB 4PHGA 2HXSA 3AF3A 1UT5A 3HKEB 4FHCA 3ILVA 3KNZA 2DFDA 1RYRA 3EXAA 3BSWA 2EOAA 4C5BA 2EBFX 4NBNA 4OHPA 3CX3A 5D1NA 4X61A 3UWKA 1XR3A 2OGUA 4H7FA 4UVEA 1HLGA 4RK1A 4TQRA 2C31A 3A9RA 1FU4A 4U02A 2ZIGA 4O4IF 3DBRA 3R7SA 2WC1A 1EUCA 2OQVA 4TT3A 2H2IA 4K8RB 4CLEA 3TQRA 4IJ6A 9LDBA 1P2TA 1GQ2A 1GV0A 5I45A 3QMVA 3ANXA 2O23A 5L9AA 2YN0A 1A3CA 4Q0YA 1UK7A 1Z4PX 1YRYE 1USIA 2YFYA 1KDVA 5KFYA 1QIDA 1P9LA 1V5WA 3UAZA 4KBYA 5SYAA 2BDEA 5FF9A 1YWGO 3CVZA 2CL7X 3KOMA 2F8MA 4LCJA 4YWHA 5F2NA 2D74A 1NFRA 3Q7SA 2YDYA 1X7ZB 1VCOA 1EVZA 1Y6QA 2GS9A 3G2NA 4CHTA 4JJAA 1YJQA 2QJFA 4OYRA 3V8RA 2Q1WA 3MWEA 1VS0A 3SJBA 4PW0A 3LC7O 1N2IA 4U5QA 3PX7A 4I4TB 3WZMA 2AQ4A 3NHFA 1BKYA 1QU3A 3JSNA 1E2PA 2EL7A 1YZFA 2NUAA 4OU4A 3MVEA 1QYRA 3HM2A 2PZGA 1KO8A 3SK0A 4GWKA 5J9FA 3ID6C 1XJ5A 4U7JA 3NVKI 3MB8A 2NLOA 1SKAA 1TT5A 3RYHB 3WICA 1QH8B 3WLNA 3HLTA 2YL2A 2JA5G 3DYVA 5IASA 4BO7A 3D3WA 3OLCX 3SHWA 2WYHA 3EY4A 3TSYA 1UWKA 3P4UA 1X1BA 4KQ6A 3FFWA 2VHEA 2RF4A 3L4KA 1ZKDA 3E6AA 3I9NA 5JYBA 3V9PA 2DFPA 3QYJA 1UDXA 1ULHA 1HE3A 3RYIB 3GTJA 2QG9A 3BERA 1NW9B 3C1UA 3T7DA 4J0QA 3RVDA 3Q7QA 3JD4A 3JW8A 3VKHA 3ZLBA 1WCV1 1KH2A 1MX3A 3FDSA 3FBGA 2NQ8A 2CLSA 1SCIA 4ZAFA 1P1BA 5C5CA 4BJ1A 4F9EA 1Y4UA 3KLBA 1NFFA 4M9QA 1Q21A 1QC5A 3QBTA 4GYYA 2OM2A 3TVDA 2E89A 4AURA 4QXMA 5AK6A 1W4BA 3D6JA 2N42A 5KYVA 1F20A 1O96B 1Z4IA 4TT3D 1BTOA 4M55A 4CKEB 1Y48E 3DM9B 2OORA 2O8BA 2HC9A 4HADA 2G1KA 1V7CA 3OT5A 4HB0A 1PR1A 3EZLA 3GMSA 3SKXA 2XT6A 5GZ6A 1U2EA 3K20A 4KUEA 3KJFA 4Q1AA 5LOVF 1YOBA 1E4FT 4EVRA 5FLMG 4XWYA 4H3KB 3RNLA 3E35A 5L4NA 1N0HA 3C5VA 2MMGA 4X1OA 3F3SA 2IS2A 2IUUA 4DA0A 1E32A 2NZWA 3BHMA 2CVOA 2ZYSA 2HADA 3L3BA 5TDHA 3X1MA 4RK4A 1B93A 2VRBA 1NC3A 4ECRA 4HNSA 4X65H 2FWBA 3LULA 3ZJ5A 4MR8B 2PS3A 4AMUA 1V71A 3DDOA 4MDYA 3TY8A 4RU1A 2XE8A 2OMKA 3MR5A 1FB5A 4POAA 3NIGB 3RC9A 4ECZA 3PX3A 1L3BA 4PTLA 3BTUA 5CG1A 4RTPA 5GZ3A 2G76A 2ZRGA 3NW9A 2IX9A 5AK5A 4BQIA 4WLNA 1D7OA 3LIIA 4RLQA 2B30A 4IDQA 2YMLA 3CEBA 1UQRA 3WK5A 2RHCA 1ZQ7A 1Z75A 4AJNA 1QHSA 1Z2DA 1U1DA 1ZI9A 4KK4A 5G40A 1MOQA 1K6MA 4QZVA 3HB4X 2CEAA 1QO9A 2QRVB 5EXEA 4KXYA 4OQXA 1ECGA 2NYVA 4RTSA 5INTA 2PJDA 2XUFA 4DV5H 4MCAA 3GRCA 3AFIA 1Z4KA 5GJBA 1NXPA 3DTYA 1NVWQ 3R9XB 1VA5A 10MHA 3EUEA 2E4YA 5D7BA 3J7AK 1U80A 4Q43A 5K9ZA 4CF6A 1R9TA 3O3OB 3BACA 1SKUA 2ZUTA 3UUGA 2I6UA 4WNAB 1MTOA 3W5JA 2GVZC 4BKQA 2P2YA 1Y3CE 4EQ6A 3JAWB 2YZ7A 5KTSA 2P9CA 1Q83A 3LA6A 3LDUA 1MJGM 4RL6A 2A0XA 3H1BA 1AGRA 3MWDA 3B85A 5AXDA 1YOVB 4O4LF 1YVDA 4JNKA 4ZWNA 8OHMA 5DWQA 2H17A 1VMAA 2KSQA 2BLLA 4YCCA 4FYXA 2GJ4A 5AYVA 1HQYE 3IBTA 3RIYA 1EYZA 1E6UA 1XL1A 3DH0A 3G0HA 1O4WA 2DYKA 3CIOA 2VK8A 3FZNA 4X1IB 2G0TA 1I3MA 3VVMA 4IXDA 4KE9A 1Z47A 2IXFA 1ESMA 4XX1A 1Q0PA 1ZD3A 4LMPA 3GLTA 4YDSA 2ADFA 3FNQA 3DT9A 3F9RA 3SGIA 2WT4A 3ETGA 3OZSA 3OWHA 2IP4A 3T5KA 2IYEA 3VU9B 1LVGA 2EQAA 3TKAA 2IJGX 4L0MA 5BN3A 1JLMA 3NRBA 1FVHA 3NI2A 1T1SA 3K8QA 2KM1A 2HMVA 4I4TF 3EPRA 4NF2A 4RA9A 3SZUA 3HQ4O 2HDWA 4AUKA 2QW1A 4HF7A 5DHAA 3F2VA 1S2GA 4UCOA 4IQ4A 2OP1A 2VSNA 2FOXA 3IQZA 5LXTB 4FMCF 3D8SA 1F8FA 4DNQA 4GT1A 4FZRA 4I55A 1CSEE 1FDVA 1OXXK 1X94A 4H7IA 2ZAGA 1TEHA 1YZVA 2CKDA 3AF4A 3P9YA 5JSUA 3ZGNA 5BWBA 2VDVE 1AXEA 3OESA 4LGCA 5KC9A 4GX1A 3I2HA 1HBJA 5CT6A 1HDGO 4FHGA 1J9EA 2I2BA 2ONKA 2HA5A 2Z6AA 1FBNA 3UNXA 1PGOA 2A84A 3V1KA 5JC8A 2IYNA 3C39A 1RACA 1AA6A 5GQSA 2DGDA 1XVLA 5F1PA 3FYTA 3K70C 2OOSA 3DZBA 1ZJ6A 3DOFA 4A8JA 4FHEA 5K5EA 2D3TA 5JVLA 1B8OA 1Z0UA 3CF4G 3L1UA 5G41A 4Q66C 4CCSA 2WMYA 3FUTA 1ENOA 3K9BA 2QTLA 1O9GA 4MQLA 2XY4A 4R2IA 1ORIA 3PGKA 8MHTA 2ACWA 1NMZA 1B15A 4EAQA 2KYRA 3VNVA 3QG5A 1Z68A 4DMRA 5KZMB 4D42A 5JRDS 1WPGA 2WJIA 3A9VA 3IT0A 4TT8A 1WSWA 4HTFB 3H97A 3SIXA 2F8TA 1KE2A 3TF5A 1W5AA 3C6ZA 3D1LA 2YZGA 1J20A 3HC7A 2VUIB 3MR2A 1JVNA 2OESA 2CMFA 4HQLA 1WHSB 1HETA 1DZ3A 3EZ2A 2DCUA 1QGUA 1JIKA 5I5XA 3UB3A 4PLPA 2YMPA 2E87A 5L7YA 3D3JA 3QYAA 4C0LA 5U4XA 1SHZA 1LDYA 2HF7A 2XTAA 4ZMBA 3LDFA 1HG0A 5GP1A 1NT4A 3FTNA 4IXTA 2PKEA 3KEQA 3WDSA 2GJ9A 4CV3A 1S7CA 1KDYA 4YMLA 3ECAA 1E9FA 1SCAA 2VUSA 1F0YA 1N3BA 2JEFA 4IFEA 5IZCA 3BA6A 1GSHA 2CB9A 4HDMA 5J2UB 3OQHA 1PJCA 1H5QA 3NNSA 3LY5A 5E1BA 4TYNA 3IDQA 1U90A 2Z04A 1KIFA 1PL0A 1T2AA 4YRAA 3QQ5A 1P6UA 4PLWA 5E6RA 3R2JA 3IOEA 5DTEA 3IUPA 3HN6A 4HBGA 1TFRA 3KPVA 3TW8A 3N70A 2FSHA 2I65A 2EX0A 4RVOA 5LL6P 3UFXB 4OGGA 1Z26A 3NBFA 1RVDA 1DJPA 1U4SA 2ZJBA 4GR4A 4C89A 2HRRA 4QBTA 2C5GA 1S68A 3SC2B 1DXHA 4LJ7A 2Y68A 5CYFA 1OB5A 4RXTA 1D03A 5JRJA 3MM4A 3GDEA 1WB5A 2J6TA 3IIJA 5BSKA 2HJSA 4FFPA 4JK3A 2A4KA 5EIHA 4LYYA 4JA0A 4BNKA 3HTXA 2GESA 4K7JA 1GZVA 1Z34A 5SZHB 3CKKA 4HDAA 1Y8ZA 4CGZA 2CFOA 5AXBA 1T4BA 4P3OA 2IT1A 1SEPA 1RTKA 5JMPA 3B6ZA 3M4YA 2BRUC 1DC6A 3PS9A 1QVAA 1VDZA 3DZKA 2GRJA 3ZGVA 3PO2G 3S2ZA 3OSUA 4NMLA 1XZPA 1I9GA 4I9HA 4AJHA 1JLHA 1T4MA 4U4AA 1M2HA 1GQSA 1AQJA 3HOVG 5K0LA 4DANA 3EZGA 2X5KO 5B57C 3E22A 4BLRA 3T1TA 4JGBA 3OQOA 5T4BA 3ML1A 1DEAA 5L6LB 2GD0A 3R3YA 3DMGA 5JDIC 1IH8A 3IURA 2FRXA 2Z56A 1Z08A 1Q12A 3KKZA 3SFZA 1RW4A 4D3YA 1HNXB 3I4FA 1USWA 5F1YA 3WQRA 2V65A 3DR5A 4DSUA 1EHYA 2C4WA 2RIPA 3UA4A 2IOYA 2M6LA 1IFXA 5HKLA 2QVCA 3NHAA 4OXQA 1UPAA 1P62B 1YJAA 1HFKA 2EBWA 3P0HA 5H82A 4IG4A 5LWHA 4YFVA 3TIVA 1ZETA 1FC0A 5A6SA 2H29A 3I62A 1ZZGA 1RWPA 4IUDS 1FLNA 3IT3A 1Q1AA 4ZPXA 2O2IA 2R6HA 3C6BA 3ABZA 1SVMA 3NONA 4TXJA 1AT1A 4IVPA 2ZSFA 5CDFE 4FGWA 3I9OA 3U6KA 3Q7RA 3QH4A 2R92A 1JDEA 4MHSA 2OM6A 4NJEB 4IQGA 3PXXA 4QBHA 4GXRA 1DWUA 2H4HA 3CH4B 4UREA 1TYEB 3GNQA 3O8DA 1J25A 3PIRA 4JODA 5ENVA 3EZYA 1EKVA 1NIJA 1S3GA 4DIEA 3KOWA 2PSEA 2X3UA 3MJCA 4XX0B 2YUTA 4QGHA 3QNWA 4D8WA 3IPRA 1AO3A 4L5BA 2JI8A 1PYGA 4CE5A 2VATA 3QNMA 2YWJA 3HDGA 4KV7A 4KI7A 5C4GB 3C41J 1O6GA 3AY0A 2ATLA 3LVQE 1LSJA 3F4LA 3TFWA 3NBMA 4G8BA 4LHEA 4FSXA 3AG5A 4KITB 2QJTA 3H04A 4UTXA 3AF1A 4I4IA 3L0OA 1UP6A 3H8WA 2IBSA 3MEQA 2HBRA 1OMOA 3KR2A 4ZYUA 4LZZA 2FDXA 3PFCA 5H0IA 1GPJA 1FFXB 1XQ9A 1MQ9A 3NXKA 3C8UA 4WCFA 1VLMA 5ICEA 5IU6A 5LZ5A 2PCJA 5DXAA 2R84A 1LPPA 3GLKA 5IKOA 4PXAA 1QM5A 4P22A 5I6DA 1W36C 2NVBA 1FP4B 3LZDA 1RYMA 4HDSB 5F77A 2YJ3A 1H2AS 2A67A 4L5YA 4C0WA 3WJ2A 1H23A 5IP9G 3ENNA 3PRJA 1KVRA 3WADA 3L46A 2M05A 1I0LA 2B8TA 3WBBA 3NM6B 4O84A 3MTGA 3GG9A 1I01A 4ZXPA 2Y6UA 2GZ3A 4QPDA 1LPBB 3UHOA 3AKCA 3TKYA 4BFSA 4JL8A 5ARBA 1GA1A 1X9IA 2FN3A 3CEAA 4PEVA 1ULUA 3GGSA 3IV7A 1NMQA 3I58A 3F97A 1AMOA 2IA5A 3LD9A 5DBHX 1L7RA 3IDOA 3WZLA 2XXAB 1EK6A 3CGWA 5H1YA 2W37A 1S9HA 1YACA 5IYZA 1FP1D 4UQLA 2BI7A 2UVUA 3W04A 1PBNA 3PXDA 3O4RA 4UEOA 2FUNB 3G13A 4P58A 1PFGA 4MVJG 1OIXA 3GGGA 1YJBA 5EIWA 4P4UA 4NYMR 3O92A 3EVCA 5GONA 4IFIA 2VAXA 2ZROA 2CVZA 2YV2A 5E9AA 1SEVA 2HUPA 3JQBA 5DCWA 4S24A 1NI4A 1GNVA 1X7DA 1B8VA 2DPLA 5CR5A 4W1PA 3EF0A 1EXDA 3FDIA 4X5OA 3R3ZA 1ZGBA 1N2EA 4LWQA 3A1VA 4H7EA 2BJWA 2ZYHA 4NQZA 1U0NA 2GB4A 2VDMB 1ZOIA 3I6BA 4UUQA 1M1XB 1KO7A 1U0EA 1XMXA 2OKGA 2AOUA 1WKCA 3LWDA 3JRXA 3NM4A 3C14C 4BO5A 1NY6A 4RZ3A 4MUYA 1V9SA 4D4IA 4W5HA 3EZ7A 1SIOA 1JTFA 3C24A 1OKKA 2HNKA 4OLFA 1XFAA 5IMSA 1JVBA 4RPHA 5A4KA 1NM5A 3KAQA 3UEOA 1NIPA 4BJ3A 5BNWA 2P2DA 5CGZA 4DT1B 1Y42X 3GVCA 2GN0A 2RH5A 4A5OA 2V5AA 5AVZA 2QTVA 4Q9JA 4F04A 3QBEA 3W2TA 2UXBB 1N0UA 1AX9A 5FOVA 1BRMA 1FSSA 1QBKC 2XMDA 1JA1A 4XA8A 2PS1A 2AKAB 3HFGA 3PUVA 2GYVA 3FUXA 1N7HA 5KWEA 3ICCA 5F5NA 4R9VA 3VNAA 4RY9A 5KFJA 1H5NA 2JD0A 3U4QA 2HLDA 4Q24A 2GOYA 3ESBA 2OO3A 2EWMA 4GL2A 3KSMA 4FR5A 4TWAA 3THSA 5CIYA 3DC2A 4L3WA 4MVXA 1T4DA 4UFPA 4MPJA 2L18A 3HJUA 3L7DA 3A1UA 4QIHA 2X6QA 1ZXXA 2CFSA 3D8TA 1H0RA 5IUJC 5KMGA 5I9SA 2BYTA 1DXQA 2WTUA 1KGDA 5JWHA 3EXHA 4RABA 4E5SA 1T9HA 3ZWNA 1EBUA 2DSNA 1GVHA 4QQFA 4A6DA 5HDQA 1HR0B 4UE6A 3S2UA 4E09A 2NPOA 1BWSA 1EHCA 2ZBVA 4DC0A 1PNOA 3FDZB 4M54A 3WIUA 4NOMA 2YXBA 3M5WA 2VRCA 2BOVA 3L7MA 2QWXA 4E5VA 5HKOA 4R7ZA 3FZQA 3VSCA 1T6XA 1JNYA 4ECTA 1E2FA 4WBXC 3WBKA 1WIWA 4FFSA 3EG9B 3ZW8A 1R0SA 3U54A 1I2DA 3LWBA 5FR9A 2P0YA 3CF2A 5A3QA 3MTIA 3HJAA 1W35A 2WAAA 2WICA 3BEOA 3OFNA 1A4UA 2VDLB 3KOYA 1PE0A 2A1UB 2D8AA