4IZXA

Macrolepiota procera ricin b-like lectin (mpl) in complex with lactose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
TQVSSGQTYKITNVKAGTVIDLSGEDNKSIIGYPYHSGKNQQWTFNWTGKAWTLRSASSGSYLGIEGTPADGTRLVAVNDPFEWHIWRDEANENAFRIFVPFTNYNLDLSGYGDTTPGTPVQLWWTWEGLHQTWTIDRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Macrolepiota procera ricin B-like lectin (MPL) in complex with lactose
rcsb
molecule keywords Ricin B-like lectin
molecule tags Sugar binding protein
source organism Macrolepiota procera
total genus 37
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4izxA00
4P0KA 1G9AA 2MIBA 3IAGC 2Y9XE 1EVTA 5B2HA 3T8SA 4P0LA 4AN6A 1IT0A 2IHOA 4IYBA 5BXRA 4DCKC 1ISXA 1T4QA 3LLPA 4ISQA 3RMYA 1BARA 5EC5A 3N7LA 1FV2A 3WINA 3BAUA 2D22A 3O4CA 4LO1A 1FGAA 3FFZA 1G82A 3AH1A 2X2SA 3AZWA 4Z8SB 3D7WB 3CA0A 4OWLA 3FJBA 4GAIA 4QBCA 1MD6A 3FJEA 3FJKA 2Y9FA 1VCLA 3CA6A 1T9FA 4JKXB 3MALA 4LO8B 4I7IA 1Q03A 5HPZA 2HZ9A 2Z48A 3ZXGA 5JLVA 2VXTI 3V0BB 2M49A 1ISVA 2Z49A 1ILR1 5DZUA 1AF9A 2FO1A 2ZQOA 3O44A 3O3QA 2MC2A 4II0A 4IONA 5D63A 4Q9GA 1WD3A 5FZYA 3ZX7A 1IRPA 3MPPG 3FJIA 4IZEA 1HKNA 1FQ9A 1AVUA 1R8OA 2Y9WC 1DFQA 4WBCA 4OUJA 3R4UA 1S0GA 4I4XA 3WO4A 4ZGRB 3BRFA 1BLDA 1JQZA 5BQUC 1AVWB 1OQLB 4G9MA 1V6VA 3BA5A 4QO3A 2HW9A 1Z2VA 3P6JA 3BAOA 4ENDA 1DFCA 4I37A 2X2TA 3PUBA 3Q7WA 5G00A 4QD2B 4QALA 5E24E 1YBIA 3LTQA 4EKXB 4D0TA 1II4A 1SR4C 1DIWA 3ZC8A 2NP0A 3TC2A 3BRDA 2AXMA 3BAGA 1Q04A 1F31A 2NZ9A 1WBAA 4KC3A 2AFGA 2NYYA 1KNMA 2ZR1B 3FJ8A 4IY8A 5FZUA 2VSEA 1G9BA 1BA7A 2FFVA 4IQPA 3WINC 1YF8B 3HBWA 4LO1C 3CU1B 4ISRA 3HOMA 1NZKA 3H6QA 2FDBM 1A8DA 2BFHA 3POKA 3I29B 4I96A 2K43A 3RMXA 4JP0A 1FV3A 1S0FA 2RSTA 4R6UB 5JMCA 3FJCA 3H6RB 4P6AA 3S8KA 1AVAC 1P63A 2D7RA 2VUAA 3BAVA 2D20A 3CRHA 2QYIB 3FJHA 3K1XA 1TWEA 4YOLA 5BXSA 3UD9A 4P0JA 4QKSA 1DQOA 1AFCA 4LO3A 3P53A 3Q7YA 3RSJA 1I1EA 4ZLBB 4X38A 3H6SE 1BLAA 3FJ9A 5DUYA 2Q3NB 4ZBVB 1FMZA 4D0ZA 1JLYA 1TWMA 4EFQA 21BIA 7I1BA 1ISWA 2D1ZA 4Q9PA 1PWAA 1S0BA 5F8YA 4J2XA 4LO2A 4DEPA 3FJAA 31BIA 3PG0A 3V79C 4L4HA 3N0KA 4J2SA 3A07A 4KBBA 3CA1A 3EF2A 3H6RA 3E8LC 4I1BA 2ERMA 4G1RA 3O4OA 4A7KA 2F2FA 3OBRA 2D44A 4KEIA 3JUTA 3BRGC 4GAFA 1JLXA 1N4KA 1S0LA 4IY9A 3BADA 1RZOB 4CJMA 3F62B 2R9KB 3BAQA 3VT2A 2LIEA 2YUGA 5BXTA 2QN4A 1L2HA 1HCEA 1ISYA 3UJ0A 1JT4A 4H04A 4OWKA 1FMMS 4J2KA 3RTJB 1CE7B 1BFFA 1DZDA 2Q9XA 1J0SA 3AH2A 1K5VA 3BX1C 1PZZA 4ZOTA 1V6XA 2WRYA 3UD8A 3CAHA 1PUUB 1TP0A 3HALA 4X39A 4XFTA 4GP3A 2NM1A 4IHZA 4G6JA 1W3GA 4I8MA 1V6WA 5BP5A 1FWVA 1ONKB 1PC8B 4I3NA 4GP0A 4HR6C 1BASA 3CRIA 5FNXA 1IILA 4TLPA 4QD2C 4USOA 3N7KA 2L5XA 2P23A 3WMVA 3WMUA 5GAQA 2K8RA 4A7YA 2DREA 2HWAA 4G9NA 1G9DA 3BTAA 3QYDA 1TTUA 4H9WA 1DQGA 2ZQNA 4QKRA 3AKFA 5F8WA 4PC4A 3W9TA 2DRZA 3VSZA 4EEEB 4I4YA 1ABRB 3PMEA 1D0HA 3CRGA 4I4PA 2NTDA 1PUMB 4JPZA 3O4DA 4EB2B 1WBCA 3NBDA 1UPSA 5EHAA 3AKIA 4JRAA 3WO3A 4ZKTB 3WA1A 4A7ZA 4LO2C 2D7IA 2LIQA 3BAHA 2F8XC 4IZXA 1XG6A 3ILAA 3BA4A 1HWPB 1HIBA 1R8NA 2GO2A 2RG9B 3O4BA 3SNVA 3UD7A 41BIA 4F34A 3VT1A 5BOWA 2AAIB 1TOOA 1BFGA 3BA7A 2VLCA 3IM7A 5D62A 4LO0A 4LO7C 1W3FA 1Z0HA 3FJJA 3O5WB 4LO7B 1JTCA 5BQUA 3OGFA 1EV2A 4G6MA 4I4QA 1YXWA 2NVHA 1HCDA 3A21A 1WD4A 1XZZA 4I4RA 1E0OA 1EYLA 2KI4A 3A23A 4I1EA 4I4SA 3VSFA 2E4MA 3HN1A 4L4IA 4OWJA 4JQ0A 4FVVA 2IWTB 1G9CA 3FUOA 3PHZA 2D43A 2K4AB 3I2AA 3Q7XA 4XKIA 3WO2A 1AVXB 4AN7B 4ZFWB 3AKGA 5BP5C 4XFUA 3FUQA 3OGGA 5FZZA 1ISZA 1HWOB 1W3AA 1TFMB 4X37A 4ZFUB 3AJ6A 4GOVA 4FGFA 4X3AA 2ET2A 3HSMA 1IRAX 1RG8A 1IHKA 1GGPB 2VU9A 1ITBA 4JAWA 4QC4A 3IM6A 4F83A 4ZA3B 3AH4A 4J23B 1JT5A 3ZC9A 2KH2A 3VUOA 2FGFA 3I2XA 1JT3A 3FJFA 2DRYA 1Z4SA 2VXRA 2J3PA 5DVHA 1S0DA 2WBCA 1DZCA 3CA5A 3O4AA 5F8SA 1NUNA 1SZ6B 2ESUA 2HWMA 3QR5A 3N7JA 3UJ4A 1QXMA 1JY0A 8I1BA 3VWCA 3OJMA 3FGMA 4OEEA 2KKIA 1TIEA 1V6UA 3V0AB 1JT7A 2MLLB 2VSAA 3BB2A 2KLLA 3JRRA 1M16A 3RTIB 4KEJA 1I1BA 1AXMA 4GOYA 4Z9WB 9ILBA 4EFRA 3NBCA 4JKQA 4LO0C 4I6IA 5DSSB 1BFCA 4LO3C 5EG6C 1FWUA 3OJ2A 4OW4A 1DLLA 2Y9GA 1S0EA 3A22A 3UDAA 3NBEA 4DENA 2D23A 4I4OA 3R4SA 1DJSB 4I0YA 3V0BA 1EPWA 2BEBA 3HMYA 2E4MC 3CA4A 4ZFYB 1XHBA 1MC9A 3P6IA 4OEGA 2GZBA 2KI6B 5D61A 1BFBA 3ZXDA 6I1BA 1IOBA 3N7MA 3OBTA 1Q1UA 1YTOA 3V0AA 1RMLA 3KMVA 2AQZA 4OEFA 3AJ5A 3OJVA 4KEKA 2I1BA 3AZVA 1S0CA 3C9ZA 3IIRA 2F2FC 3VEQA 4HJJA 1CVSA 1FN0A 4EFPA 1HWNB 3CA3A 4J2YA 5BXPA 4QBVA 4XFSA 4USPA 1QQKA 2DS0A 1YYNA 4I2SA 4D8HA 3IM5A 3F1RA 1K5UA 3S8JA 3NBNA 1M2TB 4HA2A 4I4VA 3CQAA 4I4UA 1QQLA 3FJDA 2RQ9A 2XOAA 2FFUA 1IJTA 2P39A 3O49A 3B9UA 3VT0A 2BEAA 1XYFA 5F90A 4Q91A 1SR4A 3NJ5A 3AKHA 5FNWA 1RY7A 5I1BA 5BVPI 2UUSA 1HWMB 2D24A
chains in the Genus database with same CATH superfamily
4P0KA 1G9AA 2MIBA 3IAGC 2Y9XE 1EVTA 5B2HA 3T8SA 4P0LA 4AN6A 1IT0A 2IHOA 4IYBA 5BXRA 4DCKC 1ISXA 1T4QA 3LLPA 4ISQA 3RMYA 1BARA 5EC5A 3N7LA 1FV2A 3WINA 3BAUA 2D22A 3O4CA 4LO1A 1FGAA 3FFZA 4MZGB 1G82A 3AH1A 2X2SA 3AZWA 4Z8SB 3D7WB 3CA0A 4OWLA 3FJBA 4GAIA 4QBCA 1MD6A 3FJEA 3FJKA 2Y9FA 1VCLA 3CA6A 1T9FA 4JKXB 3MALA 4LO8B 4I7IA 1Q03A 5HPZA 2HZ9A 2Z48A 3ZXGA 5JLVA 2VXTI 3V0BB 2M49A 1ISVA 2Z49A 1ILR1 5DZUA 1AF9A 2FO1A 2ZQOA 3O44A 3O3QA 2MC2A 4II0A 4IONA 5D63A 4Q9GA 1WD3A 5FZYA 3ZX7A 1IRPA 3MPPG 3FJIA 4IZEA 1HKNA 1FQ9A 1AVUA 1R8OA 2Y9WC 1DFQA 4WBCA 4OUJA 3R4UA 1S0GA 4I4XA 3WO4A 4ZGRB 3BRFA 1BLDA 1JQZA 5BQUC 1AVWB 1OQLB 4G9MA 1V6VA 3BA5A 4QO3A 2HW9A 1Z2VA 3P6JA 3BAOA 4ENDA 1DFCA 4I37A 2X2TA 3PUBA 3Q7WA 5G00A 4QD2B 4QALA 5E24E 1YBIA 3LTQA 4EKXB 4D0TA 1II4A 2NS2A 1SR4C 1DIWA 3ZC8A 2NP0A 3TC2A 3BRDA 2AXMA 3BAGA 1Q04A 1F31A 2NZ9A 1WBAA 4KC3A 2AFGA 2NYYA 1KNMA 2ZR1B 3FJ8A 4IY8A 5FZUA 2VSEA 1G9BA 1BA7A 2FFVA 4IQPA 3WINC 1YF8B 3HBWA 4LO1C 3CU1B 4ISRA 3HOMA 1NZKA 3H6QA 2FDBM 1A8DA 2BFHA 3POKA 3I29B 4I96A 2K43A 3RMXA 4JP0A 1FV3A 1S0FA 2RSTA 4R6UB 5JMCA 3FJCA 3H6RB 4P6AA 3S8KA 1AVAC 1P63A 2D7RA 2VUAA 3BAVA 2D20A 3CRHA 2QYIB 3FJHA 3K1XA 1TWEA 4YOLA 5BXSA 3UD9A 4P0JA 4QKSA 1DQOA 1AFCA 4LO3A 3P53A 3Q7YA 3RSJA 1I1EA 4H75A 4ZLBB 4X38A 3H6SE 1BLAA 3FJ9A 5DUYA 2Q3NB 4ZBVB 1FMZA 4D0ZA 1JLYA 1TWMA 4EFQA 21BIA 7I1BA 1ISWA 2D1ZA 4Q9PA 1PWAA 1S0BA 5F8YA 4J2XA 4LO2A 4DEPA 3FJAA 31BIA 3PG0A 3V79C 4L4HA 3N0KA 4J2SA 3A07A 4KBBA 3CA1A 3EF2A 3H6RA 3E8LC 4I1BA 2ERMA 4G1RA 3O4OA 4A7KA 2F2FA 3OBRA 2D44A 4KEIA 3JUTA 3BRGC 4GAFA 1JLXA 1N4KA 1S0LA 4IY9A 3BADA 1RZOB 4CJMA 3F62B 2R9KB 3BAQA 3VT2A 2LIEA 2YUGA 5BXTA 2QN4A 1L2HA 1HCEA 1ISYA 3UJ0A 1JT4A 4H04A 4OWKA 1FMMS 4J2KA 3RTJB 1CE7B 1BFFA 1DZDA 2Q9XA 1J0SA 3AH2A 1K5VA 3BX1C 1PZZA 4ZOTA 1V6XA 2WRYA 3UD8A 3CAHA 1PUUB 1TP0A 3HALA 4X39A 4XFTA 4GP3A 2NM1A 4IHZA 4G6JA 1W3GA 4I8MA 1V6WA 5BP5A 1FWVA 1ONKB 1PC8B 4I3NA 4GP0A 4HR6C 1BASA 3CRIA 5FNXA 1IILA 4TLPA 4QD2C 4USOA 3N7KA 2L5XA 2P23A 3WMVA 3WMUA 5GAQA 2K8RA 4A7YA 2DREA 2HWAA 4G9NA 1G9DA 4MZHA 3BTAA 3QYDA 1TTUA 4H9WA 1DQGA 2ZQNA 4QKRA 3AKFA 5F8WA 4PC4A 3W9TA 2DRZA 3VSZA 4EEEB 4I4YA 1ABRB 3PMEA 1D0HA 3CRGA 4I4PA 2NTDA 1PUMB 4JPZA 3O4DA 4EB2B 1WBCA 3NBDA 1UPSA 5EHAA 3AKIA 4JRAA 3WO3A 4ZKTB 3WA1A 4A7ZA 4LO2C 2D7IA 2LIQA 3BAHA 2F8XC 4IZXA 1XG6A 3ILAA 3BA4A 1HWPB 1HIBA 1R8NA 2GO2A 2RG9B 3O4BA 4UY4A 3SNVA 3UD7A 41BIA 4F34A 3VT1A 5BOWA 2AAIB 1TOOA 1BFGA 3BA7A 2VLCA 3IM7A 5D62A 4LO0A 4LO7C 1W3FA 1Z0HA 3FJJA 3O5WB 4LO7B 1JTCA 5BQUA 3OGFA 1EV2A 4G6MA 4I4QA 1YXWA 2NVHA 1HCDA 3A21A 1WD4A 1XZZA 4I4RA 1E0OA 1EYLA 2KI4A 3A23A 4I1EA 4I4SA 3VSFA 2E4MA 3HN1A 4L4IA 4OWJA 4JQ0A 4FVVA 2IWTB 1G9CA 3FUOA 3PHZA 2D43A 2K4AB 3I2AA 3Q7XA 4XKIA 3WO2A 1AVXB 4AN7B 4ZFWB 3AKGA 5BP5C 4XFUA 3FUQA 3OGGA 5FZZA 1ISZA 1HWOB 1W3AA 1TFMB 4X37A 4ZFUB 3AJ6A 4GOVA 4FGFA 4X3AA 2ET2A 3HSMA 1IRAX 1RG8A 1IHKA 1GGPB 2VU9A 1ITBA 4JAWA 4QC4A 4MZFB 3IM6A 4F83A 4ZA3B 3AH4A 4J23B 1JT5A 3ZC9A 2KH2A 3VUOA 2FGFA 3I2XA 1JT3A 3FJFA 2DRYA 1Z4SA 2VXRA 2J3PA 5DVHA 1S0DA 2WBCA 1DZCA 3CA5A 3O4AA 5F8SA 1NUNA 1SZ6B 2ESUA 2HWMA 3QR5A 3N7JA 3UJ4A 1QXMA 1JY0A 8I1BA 3VWCA 3OJMA 3FGMA 4OEEA 2KKIA 1TIEA 1V6UA 3V0AB 1JT7A 2MLLB 2VSAA 3BB2A 2KLLA 3JRRA 1M16A 3RTIB 4KEJA 1I1BA 1AXMA 4GOYA 4Z9WB 9ILBA 4EFRA 3NBCA 4JKQA 4LO0C 4I6IA 5DSSB 1BFCA 4LO3C 5EG6C 1FWUA 3OJ2A 4OW4A 1DLLA 2Y9GA 1S0EA 3A22A 3UDAA 3NBEA 4DENA 2D23A 4I4OA 3R4SA 1DJSB 4I0YA 3V0BA 1EPWA 2BEBA 3HMYA 2E4MC 3CA4A 4ZFYB 1XHBA 1MC9A 3P6IA 4OEGA 2GZBA 2KI6B 5D61A 1BFBA 3ZXDA 6I1BA 1IOBA 3N7MA 3OBTA 1Q1UA 1YTOA 3V0AA 1RMLA 3KMVA 2AQZA 4OEFA 3AJ5A 3OJVA 4KEKA 2I1BA 3AZVA 1S0CA 3C9ZA 3IIRA 2F2FC 3VEQA 4HJJA 1CVSA 1FN0A 4EFPA 1HWNB 3CA3A 4J2YA 5BXPA 4QBVA 4XFSA 4USPA 1QQKA 2DS0A 1YYNA 4I2SA 4D8HA 3IM5A 3F1RA 1K5UA 3S8JA 3NBNA 1M2TB 4HA2A 4I4VA 3CQAA 4I4UA 1QQLA 3FJDA 2RQ9A 2XOAA 2FFUA 1IJTA 2P39A 3O49A 3B9UA 3VT0A 2BEAA 1XYFA 5F90A 4Q91A 1SR4A 3NJ5A 3AKHA 5FNWA 1RY7A 5I1BA 5BVPI 2UUSA 1HWMB 2D24A
chains in the Genus database with same CATH topology
4P0KA 1G9AA 2MIBA 3IAGC 2Y9XE 1EVTA 5B2HA 3T8SA 4P0LA 4AN6A 1IT0A 2IHOA 4IYBA 5BXRA 4DCKC 1ISXA 1T4QA 3LLPA 4ISQA 3RMYA 1BARA 5EC5A 3N7LA 1FV2A 3WINA 3BAUA 2D22A 3O4CA 4LO1A 1FGAA 3FFZA 4MZGB 1G82A 3AH1A 2X2SA 3AZWA 4Z8SB 3D7WB 3CA0A 4OWLA 3FJBA 4GAIA 4QBCA 1MD6A 3FJEA 3FJKA 2Y9FA 1VCLA 3CA6A 1T9FA 4JKXB 3MALA 4LO8B 4I7IA 1Q03A 5HPZA 2HZ9A 2Z48A 3ZXGA 5JLVA 2VXTI 3V0BB 2M49A 1ISVA 2Z49A 1ILR1 5DZUA 1AF9A 2FO1A 2ZQOA 3O44A 3O3QA 2MC2A 4II0A 4IONA 5D63A 4Q9GA 1WD3A 5FZYA 3ZX7A 1IRPA 3MPPG 3FJIA 4IZEA 1HKNA 1FQ9A 1AVUA 1R8OA 2Y9WC 1DFQA 4WBCA 4OUJA 3R4UA 1S0GA 4I4XA 3WO4A 4ZGRB 3BRFA 1BLDA 1JQZA 5BQUC 1AVWB 1OQLB 4G9MA 1V6VA 3BA5A 4QO3A 2HW9A 1Z2VA 3P6JA 3BAOA 4ENDA 1DFCA 4I37A 2X2TA 3PUBA 3Q7WA 5G00A 4QD2B 4QALA 5E24E 1YBIA 3LTQA 4EKXB 4D0TA 1II4A 2NS2A 1SR4C 1DIWA 3ZC8A 2NP0A 3TC2A 3BRDA 2AXMA 3BAGA 1Q04A 1F31A 2NZ9A 1WBAA 4KC3A 2AFGA 2NYYA 1KNMA 2ZR1B 3FJ8A 4IY8A 5FZUA 2VSEA 1G9BA 1BA7A 2FFVA 4IQPA 3WINC 1YF8B 3HBWA 4LO1C 3CU1B 4ISRA 3HOMA 1NZKA 3H6QA 2FDBM 1A8DA 2BFHA 3POKA 3I29B 4I96A 2K43A 3RMXA 4JP0A 1FV3A 1S0FA 2RSTA 4R6UB 5JMCA 3FJCA 3H6RB 4P6AA 3S8KA 1AVAC 1P63A 2D7RA 2VUAA 3BAVA 2D20A 3CRHA 2QYIB 3FJHA 3K1XA 1TWEA 4YOLA 5BXSA 3UD9A 4P0JA 4QKSA 1DQOA 1AFCA 4LO3A 3P53A 3Q7YA 3RSJA 1I1EA 4H75A 4ZLBB 4X38A 3H6SE 1BLAA 3FJ9A 5DUYA 2Q3NB 4ZBVB 1FMZA 4D0ZA 1JLYA 1TWMA 4EFQA 21BIA 7I1BA 1ISWA 2D1ZA 4Q9PA 1PWAA 1S0BA 5F8YA 4J2XA 4LO2A 4DEPA 3FJAA 31BIA 3PG0A 3V79C 4L4HA 3N0KA 4J2SA 3A07A 4KBBA 3CA1A 3EF2A 3H6RA 3E8LC 4I1BA 2ERMA 4G1RA 3O4OA 4A7KA 2F2FA 3OBRA 2D44A 4KEIA 3JUTA 3BRGC 4GAFA 1JLXA 1N4KA 1S0LA 4IY9A 3BADA 1RZOB 4CJMA 3F62B 2R9KB 3BAQA 3VT2A 2LIEA 2YUGA 5BXTA 2QN4A 1L2HA 1HCEA 1ISYA 3UJ0A 1JT4A 4H04A 4OWKA 1FMMS 4J2KA 3RTJB 1CE7B 1BFFA 1DZDA 2Q9XA 1J0SA 3AH2A 1K5VA 3BX1C 1PZZA 4ZOTA 1V6XA 2WRYA 3UD8A 3CAHA 1PUUB 1TP0A 3HALA 4X39A 4XFTA 4GP3A 2NM1A 4IHZA 4G6JA 1W3GA 4I8MA 1V6WA 5BP5A 1FWVA 1ONKB 1PC8B 4I3NA 4GP0A 4HR6C 1BASA 3CRIA 5FNXA 1IILA 4TLPA 4QD2C 4USOA 3N7KA 2L5XA 2P23A 3WMVA 3WMUA 5GAQA 2K8RA 4A7YA 2DREA 2HWAA 4G9NA 1G9DA 4MZHA 3BTAA 3QYDA 1TTUA 4H9WA 1DQGA 2ZQNA 4QKRA 3AKFA 5F8WA 4PC4A 3W9TA 2DRZA 3VSZA 4EEEB 4I4YA 1ABRB 3PMEA 1D0HA 3CRGA 4I4PA 2NTDA 1PUMB 4JPZA 3O4DA 4EB2B 1WBCA 3NBDA 1UPSA 5EHAA 3AKIA 4JRAA 3WO3A 4ZKTB 3WA1A 4A7ZA 4LO2C 2D7IA 2LIQA 3BAHA 2F8XC 4IZXA 1XG6A 3ILAA 3BA4A 1HWPB 1HIBA 1R8NA 2GO2A 2RG9B 3O4BA 4UY4A 3SNVA 3UD7A 41BIA 4F34A 3VT1A 5BOWA 2AAIB 1TOOA 1BFGA 3BA7A 2VLCA 3IM7A 5D62A 4LO0A 4LO7C 1W3FA 1Z0HA 3FJJA 3O5WB 4LO7B 1JTCA 5BQUA 3OGFA 1EV2A 4G6MA 4I4QA 1YXWA 2NVHA 1HCDA 3A21A 1WD4A 1XZZA 4I4RA 1E0OA 1EYLA 2KI4A 3A23A 4I1EA 4I4SA 3VSFA 2E4MA 3HN1A 4L4IA 4OWJA 4JQ0A 4FVVA 2IWTB 1G9CA 3FUOA 3PHZA 2D43A 2K4AB 3I2AA 3Q7XA 4XKIA 3WO2A 1AVXB 4AN7B 4ZFWB 3AKGA 5BP5C 4XFUA 3FUQA 3OGGA 5FZZA 1ISZA 1HWOB 1W3AA 1TFMB 4X37A 4ZFUB 3AJ6A 4GOVA 4FGFA 4X3AA 2ET2A 3HSMA 1IRAX 1RG8A 1IHKA 1GGPB 2VU9A 1ITBA 4JAWA 4QC4A 4MZFB 3IM6A 4F83A 4ZA3B 3AH4A 4J23B 1JT5A 3ZC9A 2KH2A 3VUOA 2FGFA 3I2XA 1JT3A 3FJFA 2DRYA 1Z4SA 2VXRA 2J3PA 5DVHA 1S0DA 2WBCA 1DZCA 3CA5A 3O4AA 5F8SA 1NUNA 1SZ6B 2ESUA 2HWMA 3QR5A 3N7JA 3UJ4A 1QXMA 1JY0A 8I1BA 3VWCA 3OJMA 3FGMA 4OEEA 2KKIA 1TIEA 1V6UA 3V0AB 1JT7A 2MLLB 2VSAA 3BB2A 2KLLA 3JRRA 1M16A 3RTIB 4KEJA 1I1BA 1AXMA 4GOYA 4Z9WB 9ILBA 4EFRA 3NBCA 4JKQA 4LO0C 4I6IA 5DSSB 1BFCA 4LO3C 5EG6C 1FWUA 3OJ2A 4OW4A 1DLLA 2Y9GA 1S0EA 3A22A 3UDAA 3NBEA 4DENA 2D23A 4I4OA 3R4SA 1DJSB 4I0YA 3V0BA 1EPWA 2BEBA 3HMYA 2E4MC 3CA4A 4ZFYB 1XHBA 1MC9A 3P6IA 4OEGA 2GZBA 2KI6B 5D61A 1BFBA 3ZXDA 6I1BA 1IOBA 3N7MA 3OBTA 1Q1UA 1YTOA 3V0AA 1RMLA 3KMVA 2AQZA 4OEFA 3AJ5A 3OJVA 4KEKA 2I1BA 3AZVA 1S0CA 3C9ZA 3IIRA 2F2FC 3VEQA 4HJJA 1CVSA 1FN0A 4EFPA 1HWNB 3CA3A 4J2YA 5BXPA 4QBVA 4XFSA 4USPA 1QQKA 2DS0A 1YYNA 4I2SA 4D8HA 3IM5A 3F1RA 1K5UA 3S8JA 3NBNA 1M2TB 4HA2A 4I4VA 3CQAA 4I4UA 1QQLA 3FJDA 2RQ9A 2XOAA 2FFUA 1IJTA 2P39A 3O49A 3B9UA 3VT0A 2BEAA 1XYFA 5F90A 4Q91A 1SR4A 3NJ5A 3AKHA 5FNWA 1RY7A 5I1BA 5BVPI 2UUSA 1HWMB 2D24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0K A;  1G9A A;  2MIB A;  3IAG C;  2Y9X E;  1EVT A;  5B2H A;  3T8S A;  4P0L A;  4AN6 A;  1IT0 A;  2IHO A;  4IYB A;  5BXR A;  4DCK C;  1ISX A;  1T4Q A;  3LLP A;  4ISQ A;  3RMY A;  1BAR A;  5EC5 A;  3N7L A;  1FV2 A;  3WIN A;  3BAU A;  2D22 A;  3O4C A;  4LO1 A;  1FGA A;  3FFZ A;  1G82 A;  3AH1 A;  2X2S A;  3AZW A;  4Z8S B;  3D7W B;  3CA0 A;  4OWL A;  3FJB A;  4GAI A;  4QBC A;  1MD6 A;  3FJE A;  3FJK A;  2Y9F A;  1VCL A;  3CA6 A;  1T9F A;  4JKX B;  3MAL A;  4LO8 B;  4I7I A;  1Q03 A;  5HPZ A;  2HZ9 A;  2Z48 A;  3ZXG A;  5JLV A;  2VXT I;  3V0B B;  2M49 A;  1ISV A;  2Z49 A;  1ILR 1;  5DZU A;  1AF9 A;  2FO1 A;  2ZQO A;  3O44 A;  3O3Q A;  2MC2 A;  4II0 A;  4ION A;  5D63 A;  4Q9G A;  1WD3 A;  5FZY A;  3ZX7 A;  1IRP A;  3MPP G;  3FJI A;  4IZE A;  1HKN A;  1FQ9 A;  1AVU A;  1R8O A;  2Y9W C;  1DFQ A;  4WBC A;  4OUJ A;  3R4U A;  1S0G A;  4I4X A;  3WO4 A;  4ZGR B;  3BRF A;  1BLD A;  1JQZ A;  5BQU C;  1AVW B;  1OQL B;  4G9M A;  1V6V A;  3BA5 A;  4QO3 A;  2HW9 A;  1Z2V A;  3P6J A;  3BAO A;  4END A;  1DFC A;  4I37 A;  2X2T A;  3PUB A;  3Q7W A;  5G00 A;  4QD2 B;  4QAL A;  5E24 E;  1YBI A;  3LTQ A;  4EKX B;  4D0T A;  1II4 A;  1SR4 C;  1DIW A;  3ZC8 A;  2NP0 A;  3TC2 A;  3BRD A;  2AXM A;  3BAG A;  1Q04 A;  1F31 A;  2NZ9 A;  1WBA A;  4KC3 A;  2AFG A;  2NYY A;  1KNM A;  2ZR1 B;  3FJ8 A;  4IY8 A;  5FZU A;  2VSE A;  1G9B A;  1BA7 A;  2FFV A;  4IQP A;  3WIN C;  1YF8 B;  3HBW A;  4LO1 C;  3CU1 B;  4ISR A;  3HOM A;  1NZK A;  3H6Q A;  2FDB M;  1A8D A;  2BFH A;  3POK A;  3I29 B;  4I96 A;  2K43 A;  3RMX A;  4JP0 A;  1FV3 A;  1S0F A;  2RST A;  4R6U B;  5JMC A;  3FJC A;  3H6R B;  4P6A A;  3S8K A;  1AVA C;  1P63 A;  2D7R A;  2VUA A;  3BAV A;  2D20 A;  3CRH A;  2QYI B;  3FJH A;  3K1X A;  1TWE A;  4YOL A;  5BXS A;  3UD9 A;  4P0J A;  4QKS A;  1DQO A;  1AFC A;  4LO3 A;  3P53 A;  3Q7Y A;  3RSJ A;  1I1E A;  4ZLB B;  4X38 A;  3H6S E;  1BLA A;  3FJ9 A;  5DUY A;  2Q3N B;  4ZBV B;  1FMZ A;  4D0Z A;  1JLY A;  1TWM A;  4EFQ A;  21BI A;  7I1B A;  1ISW A;  2D1Z A;  4Q9P A;  1PWA A;  1S0B A;  5F8Y A;  4J2X A;  4LO2 A;  4DEP A;  3FJA A;  31BI A;  3PG0 A;  3V79 C;  4L4H A;  3N0K A;  4J2S A;  3A07 A;  4KBB A;  3CA1 A;  3EF2 A;  3H6R A;  3E8L C;  4I1B A;  2ERM A;  4G1R A;  3O4O A;  4A7K A;  2F2F A;  3OBR A;  2D44 A;  4KEI A;  3JUT A;  3BRG C;  4GAF A;  1JLX A;  1N4K A;  1S0L A;  4IY9 A;  3BAD A;  1RZO B;  4CJM A;  3F62 B;  2R9K B;  3BAQ A;  3VT2 A;  2LIE A;  2YUG A;  5BXT A;  2QN4 A;  1L2H A;  1HCE A;  1ISY A;  3UJ0 A;  1JT4 A;  4H04 A;  4OWK A;  1FMM S;  4J2K A;  3RTJ B;  1CE7 B;  1BFF A;  1DZD A;  2Q9X A;  1J0S A;  3AH2 A;  1K5V A;  3BX1 C;  1PZZ A;  4ZOT A;  1V6X A;  2WRY A;  3UD8 A;  3CAH A;  1PUU B;  1TP0 A;  3HAL A;  4X39 A;  4XFT A;  4GP3 A;  2NM1 A;  4IHZ A;  4G6J A;  1W3G A;  4I8M A;  1V6W A;  5BP5 A;  1FWV A;  1ONK B;  1PC8 B;  4I3N A;  4GP0 A;  4HR6 C;  1BAS A;  3CRI A;  5FNX A;  1IIL A;  4TLP A;  4QD2 C;  4USO A;  3N7K A;  2L5X A;  2P23 A;  3WMV A;  3WMU A;  5GAQ A;  2K8R A;  4A7Y A;  2DRE A;  2HWA A;  4G9N A;  1G9D A;  3BTA A;  3QYD A;  1TTU A;  4H9W A;  1DQG A;  2ZQN A;  4QKR A;  3AKF A;  5F8W A;  4PC4 A;  3W9T A;  2DRZ A;  3VSZ A;  4EEE B;  4I4Y A;  1ABR B;  3PME A;  1D0H A;  3CRG A;  4I4P A;  2NTD A;  1PUM B;  4JPZ A;  3O4D A;  4EB2 B;  1WBC A;  3NBD A;  1UPS A;  5EHA A;  3AKI A;  4JRA A;  3WO3 A;  4ZKT B;  3WA1 A;  4A7Z A;  4LO2 C;  2D7I A;  2LIQ A;  3BAH A;  2F8X C;  4IZX A;  1XG6 A;  3ILA A;  3BA4 A;  1HWP B;  1HIB A;  1R8N A;  2GO2 A;  2RG9 B;  3O4B A;  3SNV A;  3UD7 A;  41BI A;  4F34 A;  3VT1 A;  5BOW A;  2AAI B;  1TOO A;  1BFG A;  3BA7 A;  2VLC A;  3IM7 A;  5D62 A;  4LO0 A;  4LO7 C;  1W3F A;  1Z0H A;  3FJJ A;  3O5W B;  4LO7 B;  1JTC A;  5BQU A;  3OGF A;  1EV2 A;  4G6M A;  4I4Q A;  1YXW A;  2NVH A;  1HCD A;  3A21 A;  1WD4 A;  1XZZ A;  4I4R A;  1E0O A;  1EYL A;  2KI4 A;  3A23 A;  4I1E A;  4I4S A;  3VSF A;  2E4M A;  3HN1 A;  4L4I A;  4OWJ A;  4JQ0 A;  4FVV A;  2IWT B;  1G9C A;  3FUO A;  3PHZ A;  2D43 A;  2K4A B;  3I2A A;  3Q7X A;  4XKI A;  3WO2 A;  1AVX B;  4AN7 B;  4ZFW B;  3AKG A;  5BP5 C;  4XFU A;  3FUQ A;  3OGG A;  5FZZ A;  1ISZ A;  1HWO B;  1W3A A;  1TFM B;  4X37 A;  4ZFU B;  3AJ6 A;  4GOV A;  4FGF A;  4X3A A;  2ET2 A;  3HSM A;  1IRA X;  1RG8 A;  1IHK A;  1GGP B;  2VU9 A;  1ITB A;  4JAW A;  4QC4 A;  3IM6 A;  4F83 A;  4ZA3 B;  3AH4 A;  4J23 B;  1JT5 A;  3ZC9 A;  2KH2 A;  3VUO A;  2FGF A;  3I2X A;  1JT3 A;  3FJF A;  2DRY A;  1Z4S A;  2VXR A;  2J3P A;  5DVH A;  1S0D A;  2WBC A;  1DZC A;  3CA5 A;  3O4A A;  5F8S A;  1NUN A;  1SZ6 B;  2ESU A;  2HWM A;  3QR5 A;  3N7J A;  3UJ4 A;  1QXM A;  1JY0 A;  8I1B A;  3VWC A;  3OJM A;  3FGM A;  4OEE A;  2KKI A;  1TIE A;  1V6U A;  3V0A B;  1JT7 A;  2MLL B;  2VSA A;  3BB2 A;  2KLL A;  3JRR A;  1M16 A;  3RTI B;  4KEJ A;  1I1B A;  1AXM A;  4GOY A;  4Z9W B;  9ILB A;  4EFR A;  3NBC A;  4JKQ A;  4LO0 C;  4I6I A;  5DSS B;  1BFC A;  4LO3 C;  5EG6 C;  1FWU A;  3OJ2 A;  4OW4 A;  1DLL A;  2Y9G A;  1S0E A;  3A22 A;  3UDA A;  3NBE A;  4DEN A;  2D23 A;  4I4O A;  3R4S A;  1DJS B;  4I0Y A;  3V0B A;  1EPW A;  2BEB A;  3HMY A;  2E4M C;  3CA4 A;  4ZFY B;  1XHB A;  1MC9 A;  3P6I A;  4OEG A;  2GZB A;  2KI6 B;  5D61 A;  1BFB A;  3ZXD A;  6I1B A;  1IOB A;  3N7M A;  3OBT A;  1Q1U A;  1YTO A;  3V0A A;  1RML A;  3KMV A;  2AQZ A;  4OEF A;  3AJ5 A;  3OJV A;  4KEK A;  2I1B A;  3AZV A;  1S0C A;  3C9Z A;  3IIR A;  2F2F C;  3VEQ A;  4HJJ A;  1CVS A;  1FN0 A;  4EFP A;  1HWN B;  3CA3 A;  4J2Y A;  5BXP A;  4QBV A;  4XFS A;  4USP A;  1QQK A;  2DS0 A;  1YYN A;  4I2S A;  4D8H A;  3IM5 A;  3F1R A;  1K5U A;  3S8J A;  3NBN A;  1M2T B;  4HA2 A;  4I4V A;  3CQA A;  4I4U A;  1QQL A;  3FJD A;  2RQ9 A;  2XOA A;  2FFU A;  1IJT A;  2P39 A;  3O49 A;  3B9U A;  3VT0 A;  2BEA A;  1XYF A;  5F90 A;  4Q91 A;  1SR4 A;  3NJ5 A;  3AKH A;  5FNW A;  1RY7 A;  5I1B A;  5BVP I;  2UUS A;  1HWM B;  2D24 A; 
#chains in the Genus database with same CATH topology
 4P0K A;  1G9A A;  2MIB A;  3IAG C;  2Y9X E;  1EVT A;  5B2H A;  3T8S A;  4P0L A;  4AN6 A;  1IT0 A;  2IHO A;  4IYB A;  5BXR A;  4DCK C;  1ISX A;  1T4Q A;  3LLP A;  4ISQ A;  3RMY A;  1BAR A;  5EC5 A;  3N7L A;  1FV2 A;  3WIN A;  3BAU A;  2D22 A;  3O4C A;  4LO1 A;  1FGA A;  3FFZ A;  4MZG B;  1G82 A;  3AH1 A;  2X2S A;  3AZW A;  4Z8S B;  3D7W B;  3CA0 A;  4OWL A;  3FJB A;  4GAI A;  4QBC A;  1MD6 A;  3FJE A;  3FJK A;  2Y9F A;  1VCL A;  3CA6 A;  1T9F A;  4JKX B;  3MAL A;  4LO8 B;  4I7I A;  1Q03 A;  5HPZ A;  2HZ9 A;  2Z48 A;  3ZXG A;  5JLV A;  2VXT I;  3V0B B;  2M49 A;  1ISV A;  2Z49 A;  1ILR 1;  5DZU A;  1AF9 A;  2FO1 A;  2ZQO A;  3O44 A;  3O3Q A;  2MC2 A;  4II0 A;  4ION A;  5D63 A;  4Q9G A;  1WD3 A;  5FZY A;  3ZX7 A;  1IRP A;  3MPP G;  3FJI A;  4IZE A;  1HKN A;  1FQ9 A;  1AVU A;  1R8O A;  2Y9W C;  1DFQ A;  4WBC A;  4OUJ A;  3R4U A;  1S0G A;  4I4X A;  3WO4 A;  4ZGR B;  3BRF A;  1BLD A;  1JQZ A;  5BQU C;  1AVW B;  1OQL B;  4G9M A;  1V6V A;  3BA5 A;  4QO3 A;  2HW9 A;  1Z2V A;  3P6J A;  3BAO A;  4END A;  1DFC A;  4I37 A;  2X2T A;  3PUB A;  3Q7W A;  5G00 A;  4QD2 B;  4QAL A;  5E24 E;  1YBI A;  3LTQ A;  4EKX B;  4D0T A;  1II4 A;  2NS2 A;  1SR4 C;  1DIW A;  3ZC8 A;  2NP0 A;  3TC2 A;  3BRD A;  2AXM A;  3BAG A;  1Q04 A;  1F31 A;  2NZ9 A;  1WBA A;  4KC3 A;  2AFG A;  2NYY A;  1KNM A;  2ZR1 B;  3FJ8 A;  4IY8 A;  5FZU A;  2VSE A;  1G9B A;  1BA7 A;  2FFV A;  4IQP A;  3WIN C;  1YF8 B;  3HBW A;  4LO1 C;  3CU1 B;  4ISR A;  3HOM A;  1NZK A;  3H6Q A;  2FDB M;  1A8D A;  2BFH A;  3POK A;  3I29 B;  4I96 A;  2K43 A;  3RMX A;  4JP0 A;  1FV3 A;  1S0F A;  2RST A;  4R6U B;  5JMC A;  3FJC A;  3H6R B;  4P6A A;  3S8K A;  1AVA C;  1P63 A;  2D7R A;  2VUA A;  3BAV A;  2D20 A;  3CRH A;  2QYI B;  3FJH A;  3K1X A;  1TWE A;  4YOL A;  5BXS A;  3UD9 A;  4P0J A;  4QKS A;  1DQO A;  1AFC A;  4LO3 A;  3P53 A;  3Q7Y A;  3RSJ A;  1I1E A;  4H75 A;  4ZLB B;  4X38 A;  3H6S E;  1BLA A;  3FJ9 A;  5DUY A;  2Q3N B;  4ZBV B;  1FMZ A;  4D0Z A;  1JLY A;  1TWM A;  4EFQ A;  21BI A;  7I1B A;  1ISW A;  2D1Z A;  4Q9P A;  1PWA A;  1S0B A;  5F8Y A;  4J2X A;  4LO2 A;  4DEP A;  3FJA A;  31BI A;  3PG0 A;  3V79 C;  4L4H A;  3N0K A;  4J2S A;  3A07 A;  4KBB A;  3CA1 A;  3EF2 A;  3H6R A;  3E8L C;  4I1B A;  2ERM A;  4G1R A;  3O4O A;  4A7K A;  2F2F A;  3OBR A;  2D44 A;  4KEI A;  3JUT A;  3BRG C;  4GAF A;  1JLX A;  1N4K A;  1S0L A;  4IY9 A;  3BAD A;  1RZO B;  4CJM A;  3F62 B;  2R9K B;  3BAQ A;  3VT2 A;  2LIE A;  2YUG A;  5BXT A;  2QN4 A;  1L2H A;  1HCE A;  1ISY A;  3UJ0 A;  1JT4 A;  4H04 A;  4OWK A;  1FMM S;  4J2K A;  3RTJ B;  1CE7 B;  1BFF A;  1DZD A;  2Q9X A;  1J0S A;  3AH2 A;  1K5V A;  3BX1 C;  1PZZ A;  4ZOT A;  1V6X A;  2WRY A;  3UD8 A;  3CAH A;  1PUU B;  1TP0 A;  3HAL A;  4X39 A;  4XFT A;  4GP3 A;  2NM1 A;  4IHZ A;  4G6J A;  1W3G A;  4I8M A;  1V6W A;  5BP5 A;  1FWV A;  1ONK B;  1PC8 B;  4I3N A;  4GP0 A;  4HR6 C;  1BAS A;  3CRI A;  5FNX A;  1IIL A;  4TLP A;  4QD2 C;  4USO A;  3N7K A;  2L5X A;  2P23 A;  3WMV A;  3WMU A;  5GAQ A;  2K8R A;  4A7Y A;  2DRE A;  2HWA A;  4G9N A;  1G9D A;  4MZH A;  3BTA A;  3QYD A;  1TTU A;  4H9W A;  1DQG A;  2ZQN A;  4QKR A;  3AKF A;  5F8W A;  4PC4 A;  3W9T A;  2DRZ A;  3VSZ A;  4EEE B;  4I4Y A;  1ABR B;  3PME A;  1D0H A;  3CRG A;  4I4P A;  2NTD A;  1PUM B;  4JPZ A;  3O4D A;  4EB2 B;  1WBC A;  3NBD A;  1UPS A;  5EHA A;  3AKI A;  4JRA A;  3WO3 A;  4ZKT B;  3WA1 A;  4A7Z A;  4LO2 C;  2D7I A;  2LIQ A;  3BAH A;  2F8X C;  4IZX A;  1XG6 A;  3ILA A;  3BA4 A;  1HWP B;  1HIB A;  1R8N A;  2GO2 A;  2RG9 B;  3O4B A;  4UY4 A;  3SNV A;  3UD7 A;  41BI A;  4F34 A;  3VT1 A;  5BOW A;  2AAI B;  1TOO A;  1BFG A;  3BA7 A;  2VLC A;  3IM7 A;  5D62 A;  4LO0 A;  4LO7 C;  1W3F A;  1Z0H A;  3FJJ A;  3O5W B;  4LO7 B;  1JTC A;  5BQU A;  3OGF A;  1EV2 A;  4G6M A;  4I4Q A;  1YXW A;  2NVH A;  1HCD A;  3A21 A;  1WD4 A;  1XZZ A;  4I4R A;  1E0O A;  1EYL A;  2KI4 A;  3A23 A;  4I1E A;  4I4S A;  3VSF A;  2E4M A;  3HN1 A;  4L4I A;  4OWJ A;  4JQ0 A;  4FVV A;  2IWT B;  1G9C A;  3FUO A;  3PHZ A;  2D43 A;  2K4A B;  3I2A A;  3Q7X A;  4XKI A;  3WO2 A;  1AVX B;  4AN7 B;  4ZFW B;  3AKG A;  5BP5 C;  4XFU A;  3FUQ A;  3OGG A;  5FZZ A;  1ISZ A;  1HWO B;  1W3A A;  1TFM B;  4X37 A;  4ZFU B;  3AJ6 A;  4GOV A;  4FGF A;  4X3A A;  2ET2 A;  3HSM A;  1IRA X;  1RG8 A;  1IHK A;  1GGP B;  2VU9 A;  1ITB A;  4JAW A;  4QC4 A;  4MZF B;  3IM6 A;  4F83 A;  4ZA3 B;  3AH4 A;  4J23 B;  1JT5 A;  3ZC9 A;  2KH2 A;  3VUO A;  2FGF A;  3I2X A;  1JT3 A;  3FJF A;  2DRY A;  1Z4S A;  2VXR A;  2J3P A;  5DVH A;  1S0D A;  2WBC A;  1DZC A;  3CA5 A;  3O4A A;  5F8S A;  1NUN A;  1SZ6 B;  2ESU A;  2HWM A;  3QR5 A;  3N7J A;  3UJ4 A;  1QXM A;  1JY0 A;  8I1B A;  3VWC A;  3OJM A;  3FGM A;  4OEE A;  2KKI A;  1TIE A;  1V6U A;  3V0A B;  1JT7 A;  2MLL B;  2VSA A;  3BB2 A;  2KLL A;  3JRR A;  1M16 A;  3RTI B;  4KEJ A;  1I1B A;  1AXM A;  4GOY A;  4Z9W B;  9ILB A;  4EFR A;  3NBC A;  4JKQ A;  4LO0 C;  4I6I A;  5DSS B;  1BFC A;  4LO3 C;  5EG6 C;  1FWU A;  3OJ2 A;  4OW4 A;  1DLL A;  2Y9G A;  1S0E A;  3A22 A;  3UDA A;  3NBE A;  4DEN A;  2D23 A;  4I4O A;  3R4S A;  1DJS B;  4I0Y A;  3V0B A;  1EPW A;  2BEB A;  3HMY A;  2E4M C;  3CA4 A;  4ZFY B;  1XHB A;  1MC9 A;  3P6I A;  4OEG A;  2GZB A;  2KI6 B;  5D61 A;  1BFB A;  3ZXD A;  6I1B A;  1IOB A;  3N7M A;  3OBT A;  1Q1U A;  1YTO A;  3V0A A;  1RML A;  3KMV A;  2AQZ A;  4OEF A;  3AJ5 A;  3OJV A;  4KEK A;  2I1B A;  3AZV A;  1S0C A;  3C9Z A;  3IIR A;  2F2F C;  3VEQ A;  4HJJ A;  1CVS A;  1FN0 A;  4EFP A;  1HWN B;  3CA3 A;  4J2Y A;  5BXP A;  4QBV A;  4XFS A;  4USP A;  1QQK A;  2DS0 A;  1YYN A;  4I2S A;  4D8H A;  3IM5 A;  3F1R A;  1K5U A;  3S8J A;  3NBN A;  1M2T B;  4HA2 A;  4I4V A;  3CQA A;  4I4U A;  1QQL A;  3FJD A;  2RQ9 A;  2XOA A;  2FFU A;  1IJT A;  2P39 A;  3O49 A;  3B9U A;  3VT0 A;  2BEA A;  1XYF A;  5F90 A;  4Q91 A;  1SR4 A;  3NJ5 A;  3AKH A;  5FNW A;  1RY7 A;  5I1B A;  5BVP I;  2UUS A;  1HWM B;  2D24 A; 
#chains in the Genus database with same CATH homology
 4P0K A;  1G9A A;  2MIB A;  3IAG C;  2Y9X E;  1EVT A;  5B2H A;  3T8S A;  4P0L A;  4AN6 A;  1IT0 A;  2IHO A;  4IYB A;  5BXR A;  4DCK C;  1ISX A;  1T4Q A;  3LLP A;  4ISQ A;  3RMY A;  1BAR A;  5EC5 A;  3N7L A;  1FV2 A;  3WIN A;  3BAU A;  2D22 A;  3O4C A;  4LO1 A;  1FGA A;  3FFZ A;  4MZG B;  1G82 A;  3AH1 A;  2X2S A;  3AZW A;  4Z8S B;  3D7W B;  3CA0 A;  4OWL A;  3FJB A;  4GAI A;  4QBC A;  1MD6 A;  3FJE A;  3FJK A;  2Y9F A;  1VCL A;  3CA6 A;  1T9F A;  4JKX B;  3MAL A;  4LO8 B;  4I7I A;  1Q03 A;  5HPZ A;  2HZ9 A;  2Z48 A;  3ZXG A;  5JLV A;  2VXT I;  3V0B B;  2M49 A;  1ISV A;  2Z49 A;  1ILR 1;  5DZU A;  1AF9 A;  2FO1 A;  2ZQO A;  3O44 A;  3O3Q A;  2MC2 A;  4II0 A;  4ION A;  5D63 A;  4Q9G A;  1WD3 A;  5FZY A;  3ZX7 A;  1IRP A;  3MPP G;  3FJI A;  4IZE A;  1HKN A;  1FQ9 A;  1AVU A;  1R8O A;  2Y9W C;  1DFQ A;  4WBC A;  4OUJ A;  3R4U A;  1S0G A;  4I4X A;  3WO4 A;  4ZGR B;  3BRF A;  1BLD A;  1JQZ A;  5BQU C;  1AVW B;  1OQL B;  4G9M A;  1V6V A;  3BA5 A;  4QO3 A;  2HW9 A;  1Z2V A;  3P6J A;  3BAO A;  4END A;  1DFC A;  4I37 A;  2X2T A;  3PUB A;  3Q7W A;  5G00 A;  4QD2 B;  4QAL A;  5E24 E;  1YBI A;  3LTQ A;  4EKX B;  4D0T A;  1II4 A;  2NS2 A;  1SR4 C;  1DIW A;  3ZC8 A;  2NP0 A;  3TC2 A;  3BRD A;  2AXM A;  3BAG A;  1Q04 A;  1F31 A;  2NZ9 A;  1WBA A;  4KC3 A;  2AFG A;  2NYY A;  1KNM A;  2ZR1 B;  3FJ8 A;  4IY8 A;  5FZU A;  2VSE A;  1G9B A;  1BA7 A;  2FFV A;  4IQP A;  3WIN C;  1YF8 B;  3HBW A;  4LO1 C;  3CU1 B;  4ISR A;  3HOM A;  1NZK A;  3H6Q A;  2FDB M;  1A8D A;  2BFH A;  3POK A;  3I29 B;  4I96 A;  2K43 A;  3RMX A;  4JP0 A;  1FV3 A;  1S0F A;  2RST A;  4R6U B;  5JMC A;  3FJC A;  3H6R B;  4P6A A;  3S8K A;  1AVA C;  1P63 A;  2D7R A;  2VUA A;  3BAV A;  2D20 A;  3CRH A;  2QYI B;  3FJH A;  3K1X A;  1TWE A;  4YOL A;  5BXS A;  3UD9 A;  4P0J A;  4QKS A;  1DQO A;  1AFC A;  4LO3 A;  3P53 A;  3Q7Y A;  3RSJ A;  1I1E A;  4H75 A;  4ZLB B;  4X38 A;  3H6S E;  1BLA A;  3FJ9 A;  5DUY A;  2Q3N B;  4ZBV B;  1FMZ A;  4D0Z A;  1JLY A;  1TWM A;  4EFQ A;  21BI A;  7I1B A;  1ISW A;  2D1Z A;  4Q9P A;  1PWA A;  1S0B A;  5F8Y A;  4J2X A;  4LO2 A;  4DEP A;  3FJA A;  31BI A;  3PG0 A;  3V79 C;  4L4H A;  3N0K A;  4J2S A;  3A07 A;  4KBB A;  3CA1 A;  3EF2 A;  3H6R A;  3E8L C;  4I1B A;  2ERM A;  4G1R A;  3O4O A;  4A7K A;  2F2F A;  3OBR A;  2D44 A;  4KEI A;  3JUT A;  3BRG C;  4GAF A;  1JLX A;  1N4K A;  1S0L A;  4IY9 A;  3BAD A;  1RZO B;  4CJM A;  3F62 B;  2R9K B;  3BAQ A;  3VT2 A;  2LIE A;  2YUG A;  5BXT A;  2QN4 A;  1L2H A;  1HCE A;  1ISY A;  3UJ0 A;  1JT4 A;  4H04 A;  4OWK A;  1FMM S;  4J2K A;  3RTJ B;  1CE7 B;  1BFF A;  1DZD A;  2Q9X A;  1J0S A;  3AH2 A;  1K5V A;  3BX1 C;  1PZZ A;  4ZOT A;  1V6X A;  2WRY A;  3UD8 A;  3CAH A;  1PUU B;  1TP0 A;  3HAL A;  4X39 A;  4XFT A;  4GP3 A;  2NM1 A;  4IHZ A;  4G6J A;  1W3G A;  4I8M A;  1V6W A;  5BP5 A;  1FWV A;  1ONK B;  1PC8 B;  4I3N A;  4GP0 A;  4HR6 C;  1BAS A;  3CRI A;  5FNX A;  1IIL A;  4TLP A;  4QD2 C;  4USO A;  3N7K A;  2L5X A;  2P23 A;  3WMV A;  3WMU A;  5GAQ A;  2K8R A;  4A7Y A;  2DRE A;  2HWA A;  4G9N A;  1G9D A;  4MZH A;  3BTA A;  3QYD A;  1TTU A;  4H9W A;  1DQG A;  2ZQN A;  4QKR A;  3AKF A;  5F8W A;  4PC4 A;  3W9T A;  2DRZ A;  3VSZ A;  4EEE B;  4I4Y A;  1ABR B;  3PME A;  1D0H A;  3CRG A;  4I4P A;  2NTD A;  1PUM B;  4JPZ A;  3O4D A;  4EB2 B;  1WBC A;  3NBD A;  1UPS A;  5EHA A;  3AKI A;  4JRA A;  3WO3 A;  4ZKT B;  3WA1 A;  4A7Z A;  4LO2 C;  2D7I A;  2LIQ A;  3BAH A;  2F8X C;  4IZX A;  1XG6 A;  3ILA A;  3BA4 A;  1HWP B;  1HIB A;  1R8N A;  2GO2 A;  2RG9 B;  3O4B A;  4UY4 A;  3SNV A;  3UD7 A;  41BI A;  4F34 A;  3VT1 A;  5BOW A;  2AAI B;  1TOO A;  1BFG A;  3BA7 A;  2VLC A;  3IM7 A;  5D62 A;  4LO0 A;  4LO7 C;  1W3F A;  1Z0H A;  3FJJ A;  3O5W B;  4LO7 B;  1JTC A;  5BQU A;  3OGF A;  1EV2 A;  4G6M A;  4I4Q A;  1YXW A;  2NVH A;  1HCD A;  3A21 A;  1WD4 A;  1XZZ A;  4I4R A;  1E0O A;  1EYL A;  2KI4 A;  3A23 A;  4I1E A;  4I4S A;  3VSF A;  2E4M A;  3HN1 A;  4L4I A;  4OWJ A;  4JQ0 A;  4FVV A;  2IWT B;  1G9C A;  3FUO A;  3PHZ A;  2D43 A;  2K4A B;  3I2A A;  3Q7X A;  4XKI A;  3WO2 A;  1AVX B;  4AN7 B;  4ZFW B;  3AKG A;  5BP5 C;  4XFU A;  3FUQ A;  3OGG A;  5FZZ A;  1ISZ A;  1HWO B;  1W3A A;  1TFM B;  4X37 A;  4ZFU B;  3AJ6 A;  4GOV A;  4FGF A;  4X3A A;  2ET2 A;  3HSM A;  1IRA X;  1RG8 A;  1IHK A;  1GGP B;  2VU9 A;  1ITB A;  4JAW A;  4QC4 A;  4MZF B;  3IM6 A;  4F83 A;  4ZA3 B;  3AH4 A;  4J23 B;  1JT5 A;  3ZC9 A;  2KH2 A;  3VUO A;  2FGF A;  3I2X A;  1JT3 A;  3FJF A;  2DRY A;  1Z4S A;  2VXR A;  2J3P A;  5DVH A;  1S0D A;  2WBC A;  1DZC A;  3CA5 A;  3O4A A;  5F8S A;  1NUN A;  1SZ6 B;  2ESU A;  2HWM A;  3QR5 A;  3N7J A;  3UJ4 A;  1QXM A;  1JY0 A;  8I1B A;  3VWC A;  3OJM A;  3FGM A;  4OEE A;  2KKI A;  1TIE A;  1V6U A;  3V0A B;  1JT7 A;  2MLL B;  2VSA A;  3BB2 A;  2KLL A;  3JRR A;  1M16 A;  3RTI B;  4KEJ A;  1I1B A;  1AXM A;  4GOY A;  4Z9W B;  9ILB A;  4EFR A;  3NBC A;  4JKQ A;  4LO0 C;  4I6I A;  5DSS B;  1BFC A;  4LO3 C;  5EG6 C;  1FWU A;  3OJ2 A;  4OW4 A;  1DLL A;  2Y9G A;  1S0E A;  3A22 A;  3UDA A;  3NBE A;  4DEN A;  2D23 A;  4I4O A;  3R4S A;  1DJS B;  4I0Y A;  3V0B A;  1EPW A;  2BEB A;  3HMY A;  2E4M C;  3CA4 A;  4ZFY B;  1XHB A;  1MC9 A;  3P6I A;  4OEG A;  2GZB A;  2KI6 B;  5D61 A;  1BFB A;  3ZXD A;  6I1B A;  1IOB A;  3N7M A;  3OBT A;  1Q1U A;  1YTO A;  3V0A A;  1RML A;  3KMV A;  2AQZ A;  4OEF A;  3AJ5 A;  3OJV A;  4KEK A;  2I1B A;  3AZV A;  1S0C A;  3C9Z A;  3IIR A;  2F2F C;  3VEQ A;  4HJJ A;  1CVS A;  1FN0 A;  4EFP A;  1HWN B;  3CA3 A;  4J2Y A;  5BXP A;  4QBV A;  4XFS A;  4USP A;  1QQK A;  2DS0 A;  1YYN A;  4I2S A;  4D8H A;  3IM5 A;  3F1R A;  1K5U A;  3S8J A;  3NBN A;  1M2T B;  4HA2 A;  4I4V A;  3CQA A;  4I4U A;  1QQL A;  3FJD A;  2RQ9 A;  2XOA A;  2FFU A;  1IJT A;  2P39 A;  3O49 A;  3B9U A;  3VT0 A;  2BEA A;  1XYF A;  5F90 A;  4Q91 A;  1SR4 A;  3NJ5 A;  3AKH A;  5FNW A;  1RY7 A;  5I1B A;  5BVP I;  2UUS A;  1HWM B;  2D24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...