4J10A

The crystal structure of a secreted protein esxb (semet-labeled) from bacillus anthracis str. sterne
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
88
structure length
88
Chain Sequence
MAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Secreted Protein Esxb (Semet-Labeled) from Bacillus Anthracis Str. Sterne
rcsb
molecule keywords SECRETED PROTEIN ESXB
molecule tags Unknown function
source organism Bacillus anthracis
total genus 38
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j10A00
4KXRA 4W4KA 4J7JA 4IYIA 4J42A 4J10A 4W4LA 4J7KA 2G38A 4J41A 4J11A 3FX7A 2GTSA 4IYHA
chains in the Genus database with same CATH superfamily
1ZTEA 4O2AB 2QM7A 3AG2B 4DV5B 3AEIA 3L9DA 1CEZA 1UJWB 2ZR2A 4JI3B 5B1AC 4JI1B 3OMAB 4GKJB 3HKBA 4UB8Z 4FJCC 3JAKB 2QGNA 2PY5A 2IU3A 1NR1A 3ML0A 4JTCB 4IIJA 3IC9A 3HKEA 5J2TB 2EIMC 1GN4A 1GKFA 2HJDA 4YY3B 4LF6B 3QF7A 3JAMN 2AXTZ 4F6RB 2AHZA 5KMGA 2ITCC 4U3FH 3FB6C 4PDLA 2ZNJA 3F7VC 3MD0A 2Y4TA 3JCZA 1R6NA 3CWBH 3L75H 1IBLO 2KG7B 2QWOB 1VQ9V 2EZOA 3QG5A 2QSAA 1RFYA 1Y74A 3VOUA 2Y0IA 4OX9B 2UXBB 2C2AA 2RJZA 3E8HA 2E75B 4UCSA 2XTAA 2V7QG 3ASOC 2AW9A 3W7SA 1YI2V 1S76D 5J2UA 3H1IH 5K1XA 2Q73A 2RNBA 1Y76A 2ETNA 4MSWC 1HNXB 1ROPA 5CBGA 1AVMA 5C8YA 1Q43A 1BSMA 1D5NA 2JRIA 2OIEA 1KQSU 2VS0A 2HFEC 4X1IA 1RSOA 1Y4MA 4JYBA 2E5LO 4QIWF 3DXRB 5IE9A 4PA4A 1DF5A 4IL6Z 5IYBO 1NS1A 4KHPO 3U10A 1FJGB 1M5IA 5L3FA 3THOA 1KP2A 4R7CA 3IAYA 2JVDA 2HHHB 2ZIOA 2GSMB 1JOYA 4TT3G 4UV9A 3S3XA 3CJHB 3MDSA 4LF7O 3JATB 3RGBA 2YEVA 1JX9A 4CS2A 2B9ZA 1NTKH 1XOUA 1B06A 1ZSPA 4TOIA 1LUWA 5IYDO 2PZSA 3TXQA 2VWJA 1FFTB 1AJNA 2DOSA 3LSSA 4O4HB 4WBNA 1IBKO 3KZIZ 3B2EE 3CCLV 3JALB 1VQPV 4J9YB 3LUTB 4WCEV 1Q6IA 4O2BB 3OMIB 4CS3A 3UQ8A 4Z1VA 1VF6C 4FPPA 1J5EB 1XL6A 3JD3A 2HG5C 2NR5A 2OT5A 3HKDA 3ZN0A 5EBWC 3ZRXA 2ZQMA 4DV1O 2OTJV 3FB7C 2CGNA 2CDYA 4RWUA 2QKCA 3G67A 4JI7O 5LOVB 2K9PA 4E4EA 1BGYH 3APOA 4MTFA 2YIBA 1EN6A 4J42A 1V55B 4DR7B 1BZKA 1N0JA 4X66O 1KKCA 4L8JA 4NYKA 1FXKC 1BHAA 2YXHA 2DWDC 3WB0A 1P49A 4J7JA 1MNGA 1SA0A 4MT8A 4JI3O 1QVGU 1QBZA 4NR1A 5TISZ 5EIBD 4PELA 4JI1O 4GKJO 4FM2A 1LR1A 1QR9A 2A7WA 2LW7A 3B4SA 1IXMA 3G6EV 3CP1A 2XHBA 3W7UA 4HBNA 2WLLB 3FYEB 4RUFA 5KHGA 4CH4A 3IC7A 5B1NA 5CA3A 2Y69B 3B77A 4YXWG 3SJAC 5BMVB 1MZFA 4YY3O 1G1XB 1ENVA 1B04A 1SQPH 2W6IG 5LA6B 4LFBB 4CH3A 1YEWA 4QPJA 5CN0A 4AQYB 5KHJA 2KQXA 3VQXA 4LH6A 5B3SC 3CCVV 3FAVA 5KLVH 1VQ7V 3WG7C 1IXBA 1R6TA 4WFFA 1WP8A 5J2TA 4W4KA 4PV1B 3ETDA 1EZJA 1WN7A 3E83A 3LSQA 4X20A 4DV7B 4OX9O 2UXBO 4HNAB 1AJQA 1Z2GA 3I56V 3BRCA 2P7TC 4XBFA 5FNVB 4F6RA 4UVCA 2XOKG 1JR9A 1QLNA 4RQEA 4PDMA 1AILA 3OUFA 3UKMA 2RDCA 3UCSC 2R72A 4W4LA 1QR8A 1HNXO 1K5QA 3B8MA 1U96A 5H2FZ 1AP6A 4PI2A 2DYRB 4LWSB 3K79A 4FLYA 4DR5O 2P4VA 4FLWA 4NXNO 3ABKB 1Q3EA 2H3OA 2YS8A 3CMAV 1OCZB 4MTOA 1I0HA 2RMKB 3QO7A 1YHQV 5L3EA 2HHHO 3RWRD 3A0HZ 3ABMC 3ZBHA 4X1YA 1R1BA 3OM3B 2BTQB 2RN9A 4GLXA 1I94B 4BWAA 1F4NA 3HKBB 3ZMVA 3DSQA 4JI2B 2IBZH 1M56B 3J7AU 1THZA 3K59A 1PNLA 1K7DA 1F4MA 1HNZB 2XNDG 3E2EA 4N23A 2IJHA 5GW7A 1SQFA 1MABG 1PP9H 3DXRA 3N2GA 2ITDC 4PA3A 5L3BA 2XASA 3ZHSA 3R66A 3N2KA 4YIOA 1QLEC 3CRMA 1VQOV 3AK3A 3M7MX 3JATA 1MSWD 1J5EO 2QTSA 2NLJC 1OV9A 2IJKA 2EILB 2Q7HA 1K4CC 1Q82W 3SR2C 5L3GA 4O4HA 4B3SO 4WFBV 1IBMB 3MHHC 3OUSA 4FMTA 3SPCA 1GRJA 3W7TA 2BSKB 5IJ0B 3A2FA 3K3WA 4QPKA 4XDLA 5B1OA 4DR7O 3HB3B 5J2UB 4WFAV 2FTKA 3LNMB 4GYCB 1Y76B 3OFNG 2WAMA 2LJ2A 4FM0A 3QO8A 1EBOA 4UVBA 2FL4A 5C8YB 1VQMV 1P7BA 3IFXA 2OYQA 4PA9A 1TUBA 1QU7A 1SQVH 1DK1A 4J9ZB 3SPJA 1OCRC 3P3PA 4X1IB 3NR7A 1DGSA 5LOVA 1SZTA 5KAFZ 1FD9A 1GM8A 4K8XA 2IW5A 5DM6V 3I55V 3FFQA 2R9RB 1FPOA 1K73W 1KB9F 4DR6O 1PV0A 3EXAA 3JARA 4JZ2A 5EZYB 2RQ6A 4JI5O 1IVSA 4D6TH 2YEVB 2A0LA 3L70H 3ZMZA 3FX7A 4LFBO 1AI6A 1NH2B 2CH7A 2ATKC 4LCUC 2Q0OC 4QNHB 2JS3A 3E22A 1VF6A 4YJ3A 1N34B 3CX5F 2IH1C 4Z1MG 4ZOLA 3RYIB 3PN1A 5LHHA 2QWNB 5DEDA 1AROP 4CBCA 1OCOB 1WA8A 5F2VO 1JVMA 5KHIA 3OEEG 3OMNB 4G2KA 5LL6Y 2UUAB 2UXDB 4DV7O 3RFRA 4YHHB 3AG4B 3JD2A 4BIUA 3SYQA 4MTXA 3TJTA 4J7ZA 4EFBA 3B8NA 1M93A 1VQ4V 2KKWA 5LGUA 3OR6C 3ZN1A 3AG3C 1GM9A 5J9PC 1MSDA 4LF4B 4WFGA 2WLNA 1NVPB 2OCCB 3GB7C 5AG2A 1S5HC 1V9PA 3BAAA 2CTWA 5C93A 4BIOA 4QE7A 4DO2A 4X64O 3BCCH 2AZ2A 4EB6A 2ZM6B 3AG2C 3RYFA 4CZZA 2BOBC 3T1HB 1SA0B 3ABLC 2ZXWC 3PJSK 4RUEA 2YC0A 1WP7A 1I94O 2W0FC 4B08A 4JI2O 3CCEV 2P06A 2WA4A 3SJBC 4DR1O 1HNZO 3CRCA 2P67A 2WLMA 5LGTA 2CAZC 2JEXA 1KMIZ 4LNUB 2CK3G 2QKSA 4FK5C 4B3MB 5CBHA 2ODMA 1E79G 5EIBC 4H33A 2BTQA 2XAFA 3OR7C 2JJ1G 3CS5A 1KU9A 3FAVB 1SQBH 2QM4A 1XDCA 5FPRA 1MA1A 2Q4PA 2PGGA 3OEHG 5CB4B 4JV5O 3SYCA 1W2BU 3D36A 4X20B 2DYSB 5LMUB 3QO5A 5LP6C 1JJOA 1B3QA 3OTOO 1S77D 3SGIA 1R6KA 5B1BC 1OJHA 4LR3A 4P2ZA 2E76B 1AR1B 1YITV 4B3RB 3T4ZA 2YIAA 5LGNA 3JCUZ 1N33B 2EIKC 1RM1C 2PYJA 1PD3A 1I5YA 2WA3A 2HJFC 1SQGA 1EN5A 4JGSA 2X6BA 4JAAA 1NJIW 1YJWV 5EC1C 3U0ZA 2ZCEA 1N4CA 1XUQA 5B1AB 4JYAB 1O9HA 2O57A 5LHGA 2HVKC 2BSKA 5IJ0A 5JWPA 1SETA 1HW7A 5A9GA 5JQGA 1TA8A 2D2CB 5A2QN 3X2QC 4EEQA 1Y66A 1L8DA 4DR3B 2QWPB 1FXVA 3RYHA 3JAWB 4FFKA 4ZBMA 4X1YB 5BR8B 2EINC 4WFHA 3OT7A 2EIMB 3CCRV 1TGOA 1XNRB 1YSCA 2YICA 4L87A 4KFMA 3SPHA 3STLC 1W0KG 3WU2Z 3FKSG 3K5NA 1KBHA 2EBOA 3ETEA 1YTFD 1YVWA 3N2GB 1JPXA 2PI4A 3T1YO 1Q8IA 4TV9A 1VQ8V 3N2KB 1V54B 2LW1A 4GX1A 3K57A 1SERA 2YIBD 1W59A 2EIJC 5EZYA 1QNMA 5CA1B 1GM7A 2GDSA 5E1AC 2QWRB 4YHHO 3ZJZA 4MVRA 4R6ZA 3M8AA 5KHHA 2ZINA 1K4DC 3ASOB 3W7WA 1HNWB 1WB8A 3APQA 4U7OA 4LF4O 2P6JA 2UXXA 5KA6A 1KECA 3ZHQA 3ZMSA 3RYIA 2ZR3A 1RP3B 2UUCB 2Z0AA 3FD9A 2LQTA 3D8CA 1H38A 3HR0A 4O4IA 2AZ0A 1GTOA 2P5OA 2F4VB 3T4DA 2L35A 3LSUA 3OGCC 4BR6A 2ZM6O 2A06H 5LMNB 3JSNA 1Q7YW 4NKGB 2N04A 4FZ1A 3K08A 3CMEV 2PI5A 1K34A 4KL1A 4DK1A 3T1HO 3TGUH 5KX5B 1TUBB 3F7YC 2ZDIA 5EC2C 1Z5WA 1AI5A 1YZBA 2YUAA 5D5QA 4GX2A 1AB3A 1H8EG 3IGAC 3I5DA 3E86A 1MZEA 2IM9A 4FVMA 1FKAO 3K5LA 5FLXN 5KUKA 1OCCC 3A0RA 2Y48A 3LDDA 3JARB 5K1PA 1B6QA 3CD6V 2W0XA 1I7FA 3H1HH 2Q68A 5GONB 4DV5O 4QE9A 5H9CA 4FIPC 2FKXA 2CH7B 2R9IA 4LC1A 1IZ3A 2WLKA 2MK3A 4AI8A 3E89A 3ZX6A 3E22B 4YJ3B 4PDVA 1RPRA 4IHJA 3CCQV 3ABTA 3L72H 4ZOLB 4TQFA 4MVQA 1L0LH 1WA8B 2N05A 2UXCB 1KD1W 1PM9A 4LNUA 4LF6O 5LMUO 2P90A 1VIBA 2VQEB 3CHXA 1XNQB 4NXMB 1NTZH 3CYOA 2R70A 1ZUQA 4B3RO 2QTOA 2QKAA 4K0KB 3BPZA 1XILA 1N33O 5JCOA 1Y6XA 4P30A 4LP8A 1FXKB 1Q5OA 2QWQB 1XL4A 4X8AA 3CRAA 5CB4A 1YXBA 3MHSC 1K97A 2FMLA 2IJIA 4EB6B 2RCVA 3AK2A 3CCJV 3VQYA 4JI0B 1VQLV 4E2LA 1UPGA 2YI9A 3RYFB 3ZMTA 3CCUV 1IDSA 1VQKV 2VRZA 4OPAA 4ZHQB 4UVAA 5JH7A 4DR3O 1N36B 2E3CA 5KA5A 3RVZA 3DC6A 1PNKA 4P9OA 1H8HG 1JJ2U 1AR5A 1VQNV 4DV3B 3HPLC 1FS0G 1X4TA 4FLXA 1XNRO 1SC5B 5E79Z 2ZE6A 1SESA 5B3SB 1PNMA 1D5AA 1FJGO 4FLUA 2BOCC 3WG7B 3VQWA 2AHYA 3K0GA 3H1LH 2HKOA 3JAWA 2VWKA 5H5NA 1NR7A 1SRYA 1QVFU 2M7WA 3WB1A 4UXNA 1DF4A 5FL7G 3GVMA 4DK0A 5LP6A 2QJ1A 4U7NA 2B5UA 3RVYA 5IT9N 3TXSA 1XMOB 4FFBA 4K3AA 4ICGA 1HNWO 4LFAB 4DUZB 2LO1A 3E8BA 3J80N 1SQXH 1AI7A 2DWEC 4ASUG 3AG1C 3SJQC 2YXYA 4DV0B 3CSXA 3G4SV 5CA1A 4I55A 2F95B 3LNNA 4G28B 4DR2B 1VEWA 2F43G 5LMNO 1HP8A 1M4UA 1E1RG 5BY1A 1CP9A 3MAQA 3ZMUA 2XT9A 4CC6A 5CBFA 3AG7A 4JF3A 4AILC 3ABMB 1H2KA 1G8MA 3ZHUA 3E35A 5JQGB 3O9OA 1Z5VA 2XUMA 5ITZB 4FLZA 3RYHB 3JD1A 4HYOA 2F93B 4TUYB 4I0XB 1M57C 1R3JC 4PJ0Z 3CCMV 5KX5A 4PHZA 1QLEB 4A5UB 2KSDA 2W6JG 2ZKOA 2ZE8A 1K9MW 4KXRA 2CTPA 3F5TA 4TV9B 2DQ3A 1BS3A 4MVZA 1UFIA 4NVPA 4LF5B 2UXCO 4UB6Z 1L0NH 3ASNB 1AJPA 4JI8B 4EKWA 5GONA 1YJNV 5D5PA 5GTHZ 2VQEO 1XNQO 4NXMO 4AQYO 4IT5A 3DC5A 5DN6G 4UCTA 4K0KO 3K0DA 4DRXB 2BE3A 3D3IA 1Y67A 1XEQA 1N32B 2DW4A 5IY5C 5JJJB 4N21A 5JVDB 4CH5A 1SF9A 4P9PA 1IX9A 2Q6AA 3B09A 4O4IB 4J80A 3CB2A 1NT2B 2A79B 2E5LB 1VF7A 1OCRB 3UT5B 1KC8W 2PF4E 1EM1A 4C7UA 2H94A 3K58A 4I50B 3K9SA 4I4TB 4O4LB 2A9HA 5CMUA 1MMMA 5LHIA 1N36O 5LXTB 4LF7B 4PDRA 1FXKA 3Q4HB 1GK9A 3ZRWA 3G6BA 4DV3O 1WB7A 4DV2B 4XDKA 1Q90D 2L6LA 1Q6UA 2JGUA 3K5OA 2XAGA 1I5XA 1IBKB 2ARHA 4BAYA 4X88A 3TCUA 3FYIB 1JQ0A 4CH6A 2UUBB 1K33A 2LGWA 4ZHQA 2YI8A 2YSUB 1F7YA 4X89A 4UCOA 4GCZA 1WPXA 4TV8A 2CE4A 5JJNB 4IYHA 4IHJB 1XMQB 4FLVA 4K8ZA 1XMOO 4UCUA 2Z3YA 2WSSG 1S3JA 1I08A 2MW2B 3L74H 3P3NA 4LFAO 3AG3B 3CRQA 4DUZO 3K03A 4JYCA 4X1KB 4CS4A 5BZBA 3T2MA 4JI7B 3J81N 3RT3C 5B66Z 4BIZA 2ZT9B 3NXSA 1S72V 4DV0O 4X9QA 4J11A 3SYAA 2P4KA 1XQ8A 3CC2V 1US6A 4I9WA 4X66B 3SYPA 3ZHVA 1E1QG 4NB5A 1G4YB 1MG1A 4U3JA 1WNSA 5HFMA 1KYOF 3RYCA 2LFRA 1YIJV 1SQQH 3OE7G 4RAIA 4JYYA 1WLEA 4Z2WA 3K5MA 2IU0A 1IBMO 3ABLB 2ZXWB 3BHPA 2E74B 1IURA 5B5EZ 4IYIA 2ZD9A 4I5SA 5LYJB 1NQTA 4QGPA 1COWG 2BCCH 3OW2U 4MTGA 2JGDB 4DUYB 2WLIB 1BL8A 5BXZA 3WB2A 1SZXA 5CA0A 5JH7B 4I7ZB 4B7KA 3VQVA 2B1GA 3B40A 3DGEA 3OD4A 4J10A 4UFZA 3QTCA 4TSFG 2FYUH 1NH2D 1H2LA 4JASA 1H2NA 3VBBA 5DECA 2CUGA 5LBQA 1WPBA 1V54C 4MVSA 3P32A 1NKDA 4O4JA 5ITZA 4TQDA 4D7SA 4KUMA 3FB5C 4LF5O 3GWKC 3KCXA 3H1JH 4DW1A 3FB8C 2FB5A 4TUYA 3EHBB 4I0XA 4JI8O 1GAXA 4H0LB 1U97A 5LP6B 2DQ0A 4MVMA 5B1BB 2WWWA 2UXNA 2F23A 1PKXA 4FFBB 3UO3A 1N34O 2YIDA 3A0BZ 2OIGA 1NVPD 2EIKB 1RM1B 3O65A 1R73A 4OXSA 2LP7A 1N32O 1RPOA 2GV9A 1BHBA 4JZGA 3KKYA 4FLTA 4DR5B 1XI1A 2UUAO 1P84F 4I55B 2UXDO 4NXNB 1BQ0A 4DV4B 1J95A 3K9AA 2OTLV 2PTMA 2N74A 1R3LC 1TAEA 3KG2A 3X2QB 4DRXA 2GTAA 4X62B 3TK1A 2LFSA 3SPIA 1QHTA 4MVOA 1G6UA 5IJ9A 1S5LZ 3BA8A 2EINB 2P22C 1ZX3A 1GMGA 5EBLC 1JFFB 5JVDA 4DV2O 4LF8B 4B7EA 1V55C 3L73H 1HR0B 2ADPA 4PA6A 1FFXB 4JI4B 3JASA 3UT5A 4F6EA 3TETA 4OPHA 1XHZA 4I50A 1S0VA 1W0JG 2UUBO 4I4TA 1VARA 4O4LA 5H6RA 2D3OW 1AI4A 1QQCA 1ZL8B 4ZI7A 1H2MA 5LXTA 1M1KW 3CC7V 4LBEC 3RBZA 4DR4B 2EJ7A 3T1CA 5KHKA 2EIJB 3Q4HA 2Y4UA 1T5EA 4LFCB 4UCVA 5H6QA 4X65B 4NTWA 2CTRA 1TVKA 3L71H 4WFEA 1KUQA 1XMQO 2AGAA 1URFA 2Q5ZA 1Q6HA 2ZE5A 4B3SB 2Y69C 1BCCH 4UV8A 1FAFA 3C90A 4B3MO 4ZKIA 4JTAB 3IJ4A 2QDOA 5IDJA 1K8AW 2DJVA 1ORQC 3U11A 3UM7A 3C3SA 4HAMA 2IJJA 3EFFK 4KP4A 1FYJA 3BABA 4AHCA 3HKCA 2KB1A 3CXHF 3STZC 3CPWU 4FZ0A 1NI8A 2UU9B 3ZHRA 1SS3A 4MW8A 2JJ2G 4X1KA 1SKVA 3OGIB 2GUZB 1Q81W 4ABMA 4DV6B 3C3TA 2WLHA 1H2GA 1F23A 2JDIG 4JTDB 4GX5A 1M9NA 4DUYO 3JD4A 2EULA 3OAAG 4DYLA 2OWOA 4DR6B 5IYZA 4JI5B 1OCCB 1P4RA 1KP3A 3ZRVA 2DYRC 1D2DA 4O2AA 4JAUA 3S3WA 4WF9V 1YDXA 3ZRWB 4LF9B 4I9QA 3ABKC 1LNQA 2Q9LA 1OCZC 1S5JA 4BW5A 5GTIZ 1YF2A 4JYAO 5KUMA 1TUEB 3CE2A 5LYJA 2Q69A 1FXHA 4Q6GA 3SPGA 1GO3F 5EYPB 3M99B 3JAKA 3JSLA 2HP8A 2NN4A 2JGDA 2WLIA 4NTYA 2QE7G 3ETQA 4JAVA 4ZIBA 1YCIA 2QEXV 5BR8O 1M56C 3E8GA 4TV8B 4JI6B 4PI0A 1L1FA 4PA7A 2Q0AA 2VQFB 1P7GA 1R3KC 4PD4F 4YJ2B 3D36C 2Q67A 1DLBA 2JS5A 2ZIMA 4OGQB 1OZ0A 2QA4V 2OCHA 2EX3A 2KG7A 1XBLA 1O9GA 2ZNIA 2ZE7A 2EZPA 2PYLA 5L3CA 4X64B 1CXZB 1X59A 4LH7A 3CC4V 2EILC 2H8PC 3SYOA 2F66C 4R8CA 4DV4O 2X0LA 5JJEB 2X7RB 4U3JB 1MOFA 2JK5C 1GH6A 1OHHG 4H37A 3CRRA 3RYCB 4GKKB 4UUJC 2GBOA 5HFLA 1PL0A 4B3TB 1VQ6V 2IH3C 2JIZG 3K06A 4X62O 3GWOA 2PUSA 3BA9A 1JCHA 4QJFB 5IYCO 3RN4A 5IWAB 2UUCO 4LF8O 3H1KH 2HEPA 4DR1B 4H44B 4JPRA 1HR0O 3RW0A 3QVNA 3AK1A 1K92A 2F4VO 4IIJB 1GN2A 3HKEB 5CA0B 4JI4O 1BE3H 4MS2A 1PPJH 3ZHTA 1XREA 2HR3A 2Q7EA 3E8FA 1ZAUA 4XDJA 1GN3A 2EJRA 1QCEA 3CJHA 3UO2A 5KMGB 4DR4O 2ADQB 1JMKC 2B1IA 1NZ6A 1JFFA 4LFCO 3DTUB 4X65O 2Q7GA 1M90W 2DE0X 4F4LA 4O4JB 1FFXA 3ZEDA 3ASNC 1Y74B 5EBMC 3H9VA 3ZRSA 4JV5B 1A32A 3LDCA 3D3QA 3JALA 4DW0A 2CTQA 3BEHA 3OTOB 4J41A 3BFRA 2GTSA 3JYCA 1ZL8A 2X6AA 1N8RW 4O2BA 4NTXA 4J7KA 2G38A 1F51A 3AG1B 2QR4A 3EVKA 3SDLA 1IBLB 3CCSV 2Z5UA 3KCYA 1OCOC 5L3DA 4GUNA 4H13B 2CGOA 2BTOA 1AP5A 4IGGA 3AG4C 4HZ3A 1NU1H 4D7TA 2UU9O 4YIPA 1K5SA 3BY6A 1RSOB 1GN6A 3N27A 3ZCCA 4DV6O 1XHXA 2XAHA 2HVJC 3G80A 2ILMA 2HLDG 1ZWIC 3K04A 1BQZA 4RQFA 2ZDIC 2K1EA 2OCCC 3CEIA 1BT8A 4GT1A 5IJ9B 4LF9O 1M57B 4CC5A 2R9AA 2Q8VA 4EFEA 2GUZA 2WPDG 2QM8A 3JASB 4WBNB 4R50A 1WAZA 3R65A 4KHPB 1HDJA 3T1YB 2X6CA 4JI0O 1R3IC 1VF5B 1JA8A 2WLLA 4DXWA 2WLJA 1BMFG 4ZI7B 2DMXA 1N0NA 1NBMG 5BMVA 2YDEA 4MW3A 4G27B 1NTMH 5LA6A 4JI6O 3P30A 3LDEA 1WJZA 3BVOA 1TVKB 1ZLZA 3HKDB 3SJCC 3G71V 2VQFO 3JD0A 1EN4A 5EK0A 4Q20A 4TWKA 5EYPA 1YTFB 3F5WC 3CXCU 1H2SB 3ICXA 5FPOA 1DTOA 2DN9A 4GZRB 2M6YA 4GX0A 5IY5B 1LUVA 1EFRG 2LGQA 2A3QA 4HNAA 5JCOC 2GHYA 4MVUA 1YJ9V 5FNVA 1PL4A 2XAQA 1VP7A 3HKCB 3ZIAG 4RO2A 4DV1B 4K35A 4GKKO 5KAIZ 4YJ2A 2DYSC 4B3TO 2XAJA 1HWYA 4FM1A 3QNEA 2V4DA 3A8TA 2YXLA 4UCRA 2V1DA 3WFVA 2NNUA 1VQ5V 5IWAO 2JEUA 4LWSA 1Q86W 3ZS8C 3ETGA 1AR4A 3ABUA 2Y0PA 1KKDA 1K3EA 3OTFA 1VMGA 4DR2O 3W7XA 5IYZB 1CPYA 3H01A 1EZVH 4BW9A 2F1MA
chains in the Genus database with same CATH topology
4KXRA 4W4KA 4J7JA 4IYIA 4J42A 4J10A 4W4LA 4J7KA 2G38A 4J41A 4J11A 3FX7A 2GTSA 4IYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXR A;  4W4K A;  4J7J A;  4IYI A;  4J42 A;  4J10 A;  4W4L A;  4J7K A;  2G38 A;  4J41 A;  4J11 A;  3FX7 A;  2GTS A;  4IYH A; 
#chains in the Genus database with same CATH topology
 1ZTE A;  4O2A B;  2QM7 A;  3AG2 B;  4DV5 B;  3AEI A;  3L9D A;  1CEZ A;  1UJW B;  2ZR2 A;  4JI3 B;  5B1A C;  4JI1 B;  3OMA B;  4GKJ B;  3HKB A;  4UB8 Z;  4FJC C;  3JAK B;  2QGN A;  2PY5 A;  2IU3 A;  1NR1 A;  3ML0 A;  4JTC B;  4IIJ A;  3IC9 A;  3HKE A;  5J2T B;  2EIM C;  1GN4 A;  1GKF A;  2HJD A;  4YY3 B;  4LF6 B;  3QF7 A;  3JAM N;  2AXT Z;  4F6R B;  2AHZ A;  5KMG A;  2ITC C;  4U3F H;  3FB6 C;  4PDL A;  2ZNJ A;  3F7V C;  3MD0 A;  2Y4T A;  3JCZ A;  1R6N A;  3CWB H;  3L75 H;  1IBL O;  2KG7 B;  2QWO B;  1VQ9 V;  2EZO A;  3QG5 A;  2QSA A;  1RFY A;  1Y74 A;  3VOU A;  2Y0I A;  4OX9 B;  2UXB B;  2C2A A;  2RJZ A;  3E8H A;  2E75 B;  4UCS A;  2XTA A;  2V7Q G;  3ASO C;  2AW9 A;  3W7S A;  1YI2 V;  1S76 D;  5J2U A;  3H1I H;  5K1X A;  2Q73 A;  2RNB A;  1Y76 A;  2ETN A;  4MSW C;  1HNX B;  1ROP A;  5CBG A;  1AVM A;  5C8Y A;  1Q43 A;  1BSM A;  1D5N A;  2JRI A;  2OIE A;  1KQS U;  2VS0 A;  2HFE C;  4X1I A;  1RSO A;  1Y4M A;  4JYB A;  2E5L O;  4QIW F;  3DXR B;  5IE9 A;  4PA4 A;  1DF5 A;  4IL6 Z;  5IYB O;  1NS1 A;  4KHP O;  3U10 A;  1FJG B;  1M5I A;  5L3F A;  3THO A;  1KP2 A;  4R7C A;  3IAY A;  2JVD A;  2HHH B;  2ZIO A;  2GSM B;  1JOY A;  4TT3 G;  4UV9 A;  3S3X A;  3CJH B;  3MDS A;  4LF7 O;  3JAT B;  3RGB A;  2YEV A;  1JX9 A;  4CS2 A;  2B9Z A;  1NTK H;  1XOU A;  1B06 A;  1ZSP A;  4TOI A;  1LUW A;  5IYD O;  2PZS A;  3TXQ A;  2VWJ A;  1FFT B;  1AJN A;  2DOS A;  3LSS A;  4O4H B;  4WBN A;  1IBK O;  3KZI Z;  3B2E E;  3CCL V;  3JAL B;  1VQP V;  4J9Y B;  3LUT B;  4WCE V;  1Q6I A;  4O2B B;  3OMI B;  4CS3 A;  3UQ8 A;  4Z1V A;  1VF6 C;  4FPP A;  1J5E B;  1XL6 A;  3JD3 A;  2HG5 C;  2NR5 A;  2OT5 A;  3HKD A;  3ZN0 A;  5EBW C;  3ZRX A;  2ZQM A;  4DV1 O;  2OTJ V;  3FB7 C;  2CGN A;  2CDY A;  4RWU A;  2QKC A;  3G67 A;  4JI7 O;  5LOV B;  2K9P A;  4E4E A;  1BGY H;  3APO A;  4MTF A;  2YIB A;  1EN6 A;  4J42 A;  1V55 B;  4DR7 B;  1BZK A;  1N0J A;  4X66 O;  1KKC A;  4L8J A;  4NYK A;  1FXK C;  1BHA A;  2YXH A;  2DWD C;  3WB0 A;  1P49 A;  4J7J A;  1MNG A;  1SA0 A;  4MT8 A;  4JI3 O;  1QVG U;  1QBZ A;  4NR1 A;  5TIS Z;  5EIB D;  4PEL A;  4JI1 O;  4GKJ O;  4FM2 A;  1LR1 A;  1QR9 A;  2A7W A;  2LW7 A;  3B4S A;  1IXM A;  3G6E V;  3CP1 A;  2XHB A;  3W7U A;  4HBN A;  2WLL B;  3FYE B;  4RUF A;  5KHG A;  4CH4 A;  3IC7 A;  5B1N A;  5CA3 A;  2Y69 B;  3B77 A;  4YXW G;  3SJA C;  5BMV B;  1MZF A;  4YY3 O;  1G1X B;  1ENV A;  1B04 A;  1SQP H;  2W6I G;  5LA6 B;  4LFB B;  4CH3 A;  1YEW A;  4QPJ A;  5CN0 A;  4AQY B;  5KHJ A;  2KQX A;  3VQX A;  4LH6 A;  5B3S C;  3CCV V;  3FAV A;  5KLV H;  1VQ7 V;  3WG7 C;  1IXB A;  1R6T A;  4WFF A;  1WP8 A;  5J2T A;  4W4K A;  4PV1 B;  3ETD A;  1EZJ A;  1WN7 A;  3E83 A;  3LSQ A;  4X20 A;  4DV7 B;  4OX9 O;  2UXB O;  4HNA B;  1AJQ A;  1Z2G A;  3I56 V;  3BRC A;  2P7T C;  4XBF A;  5FNV B;  4F6R A;  4UVC A;  2XOK G;  1JR9 A;  1QLN A;  4RQE A;  4PDM A;  1AIL A;  3OUF A;  3UKM A;  2RDC A;  3UCS C;  2R72 A;  4W4L A;  1QR8 A;  1HNX O;  1K5Q A;  3B8M A;  1U96 A;  5H2F Z;  1AP6 A;  4PI2 A;  2DYR B;  4LWS B;  3K79 A;  4FLY A;  4DR5 O;  2P4V A;  4FLW A;  4NXN O;  3ABK B;  1Q3E A;  2H3O A;  2YS8 A;  3CMA V;  1OCZ B;  4MTO A;  1I0H A;  2RMK B;  3QO7 A;  1YHQ V;  5L3E A;  2HHH O;  3RWR D;  3A0H Z;  3ABM C;  3ZBH A;  4X1Y A;  1R1B A;  3OM3 B;  2BTQ B;  2RN9 A;  4GLX A;  1I94 B;  4BWA A;  1F4N A;  3HKB B;  3ZMV A;  3DSQ A;  4JI2 B;  2IBZ H;  1M56 B;  3J7A U;  1THZ A;  3K59 A;  1PNL A;  1K7D A;  1F4M A;  1HNZ B;  2XND G;  3E2E A;  4N23 A;  2IJH A;  5GW7 A;  1SQF A;  1MAB G;  1PP9 H;  3DXR A;  3N2G A;  2ITD C;  4PA3 A;  5L3B A;  2XAS A;  3ZHS A;  3R66 A;  3N2K A;  4YIO A;  1QLE C;  3CRM A;  1VQO V;  3AK3 A;  3M7M X;  3JAT A;  1MSW D;  1J5E O;  2QTS A;  2NLJ C;  1OV9 A;  2IJK A;  2EIL B;  2Q7H A;  1K4C C;  1Q82 W;  3SR2 C;  5L3G A;  4O4H A;  4B3S O;  4WFB V;  1IBM B;  3MHH C;  3OUS A;  4FMT A;  3SPC A;  1GRJ A;  3W7T A;  2BSK B;  5IJ0 B;  3A2F A;  3K3W A;  4QPK A;  4XDL A;  5B1O A;  4DR7 O;  3HB3 B;  5J2U B;  4WFA V;  2FTK A;  3LNM B;  4GYC B;  1Y76 B;  3OFN G;  2WAM A;  2LJ2 A;  4FM0 A;  3QO8 A;  1EBO A;  4UVB A;  2FL4 A;  5C8Y B;  1VQM V;  1P7B A;  3IFX A;  2OYQ A;  4PA9 A;  1TUB A;  1QU7 A;  1SQV H;  1DK1 A;  4J9Z B;  3SPJ A;  1OCR C;  3P3P A;  4X1I B;  3NR7 A;  1DGS A;  5LOV A;  1SZT A;  5KAF Z;  1FD9 A;  1GM8 A;  4K8X A;  2IW5 A;  5DM6 V;  3I55 V;  3FFQ A;  2R9R B;  1FPO A;  1K73 W;  1KB9 F;  4DR6 O;  1PV0 A;  3EXA A;  3JAR A;  4JZ2 A;  5EZY B;  2RQ6 A;  4JI5 O;  1IVS A;  4D6T H;  2YEV B;  2A0L A;  3L70 H;  3ZMZ A;  3FX7 A;  4LFB O;  1AI6 A;  1NH2 B;  2CH7 A;  2ATK C;  4LCU C;  2Q0O C;  4QNH B;  2JS3 A;  3E22 A;  1VF6 A;  4YJ3 A;  1N34 B;  3CX5 F;  2IH1 C;  4Z1M G;  4ZOL A;  3RYI B;  3PN1 A;  5LHH A;  2QWN B;  5DED A;  1ARO P;  4CBC A;  1OCO B;  1WA8 A;  5F2V O;  1JVM A;  5KHI A;  3OEE G;  3OMN B;  4G2K A;  5LL6 Y;  2UUA B;  2UXD B;  4DV7 O;  3RFR A;  4YHH B;  3AG4 B;  3JD2 A;  4BIU A;  3SYQ A;  4MTX A;  3TJT A;  4J7Z A;  4EFB A;  3B8N A;  1M93 A;  1VQ4 V;  2KKW A;  5LGU A;  3OR6 C;  3ZN1 A;  3AG3 C;  1GM9 A;  5J9P C;  1MSD A;  4LF4 B;  4WFG A;  2WLN A;  1NVP B;  2OCC B;  3GB7 C;  5AG2 A;  1S5H C;  1V9P A;  3BAA A;  2CTW A;  5C93 A;  4BIO A;  4QE7 A;  4DO2 A;  4X64 O;  3BCC H;  2AZ2 A;  4EB6 A;  2ZM6 B;  3AG2 C;  3RYF A;  4CZZ A;  2BOB C;  3T1H B;  1SA0 B;  3ABL C;  2ZXW C;  3PJS K;  4RUE A;  2YC0 A;  1WP7 A;  1I94 O;  2W0F C;  4B08 A;  4JI2 O;  3CCE V;  2P06 A;  2WA4 A;  3SJB C;  4DR1 O;  1HNZ O;  3CRC A;  2P67 A;  2WLM A;  5LGT A;  2CAZ C;  2JEX A;  1KMI Z;  4LNU B;  2CK3 G;  2QKS A;  4FK5 C;  4B3M B;  5CBH A;  2ODM A;  1E79 G;  5EIB C;  4H33 A;  2BTQ A;  2XAF A;  3OR7 C;  2JJ1 G;  3CS5 A;  1KU9 A;  3FAV B;  1SQB H;  2QM4 A;  1XDC A;  5FPR A;  1MA1 A;  2Q4P A;  2PGG A;  3OEH G;  5CB4 B;  4JV5 O;  3SYC A;  1W2B U;  3D36 A;  4X20 B;  2DYS B;  5LMU B;  3QO5 A;  5LP6 C;  1JJO A;  1B3Q A;  3OTO O;  1S77 D;  3SGI A;  1R6K A;  5B1B C;  1OJH A;  4LR3 A;  4P2Z A;  2E76 B;  1AR1 B;  1YIT V;  4B3R B;  3T4Z A;  2YIA A;  5LGN A;  3JCU Z;  1N33 B;  2EIK C;  1RM1 C;  2PYJ A;  1PD3 A;  1I5Y A;  2WA3 A;  2HJF C;  1SQG A;  1EN5 A;  4JGS A;  2X6B A;  4JAA A;  1NJI W;  1YJW V;  5EC1 C;  3U0Z A;  2ZCE A;  1N4C A;  1XUQ A;  5B1A B;  4JYA B;  1O9H A;  2O57 A;  5LHG A;  2HVK C;  2BSK A;  5IJ0 A;  5JWP A;  1SET A;  1HW7 A;  5A9G A;  5JQG A;  1TA8 A;  2D2C B;  5A2Q N;  3X2Q C;  4EEQ A;  1Y66 A;  1L8D A;  4DR3 B;  2QWP B;  1FXV A;  3RYH A;  3JAW B;  4FFK A;  4ZBM A;  4X1Y B;  5BR8 B;  2EIN C;  4WFH A;  3OT7 A;  2EIM B;  3CCR V;  1TGO A;  1XNR B;  1YSC A;  2YIC A;  4L87 A;  4KFM A;  3SPH A;  3STL C;  1W0K G;  3WU2 Z;  3FKS G;  3K5N A;  1KBH A;  2EBO A;  3ETE A;  1YTF D;  1YVW A;  3N2G B;  1JPX A;  2PI4 A;  3T1Y O;  1Q8I A;  4TV9 A;  1VQ8 V;  3N2K B;  1V54 B;  2LW1 A;  4GX1 A;  3K57 A;  1SER A;  2YIB D;  1W59 A;  2EIJ C;  5EZY A;  1QNM A;  5CA1 B;  1GM7 A;  2GDS A;  5E1A C;  2QWR B;  4YHH O;  3ZJZ A;  4MVR A;  4R6Z A;  3M8A A;  5KHH A;  2ZIN A;  1K4D C;  3ASO B;  3W7W A;  1HNW B;  1WB8 A;  3APQ A;  4U7O A;  4LF4 O;  2P6J A;  2UXX A;  5KA6 A;  1KEC A;  3ZHQ A;  3ZMS A;  3RYI A;  2ZR3 A;  1RP3 B;  2UUC B;  2Z0A A;  3FD9 A;  2LQT A;  3D8C A;  1H38 A;  3HR0 A;  4O4I A;  2AZ0 A;  1GTO A;  2P5O A;  2F4V B;  3T4D A;  2L35 A;  3LSU A;  3OGC C;  4BR6 A;  2ZM6 O;  2A06 H;  5LMN B;  3JSN A;  1Q7Y W;  4NKG B;  2N04 A;  4FZ1 A;  3K08 A;  3CME V;  2PI5 A;  1K34 A;  4KL1 A;  4DK1 A;  3T1H O;  3TGU H;  5KX5 B;  1TUB B;  3F7Y C;  2ZDI A;  5EC2 C;  1Z5W A;  1AI5 A;  1YZB A;  2YUA A;  5D5Q A;  4GX2 A;  1AB3 A;  1H8E G;  3IGA C;  3I5D A;  3E86 A;  1MZE A;  2IM9 A;  4FVM A;  1FKA O;  3K5L A;  5FLX N;  5KUK A;  1OCC C;  3A0R A;  2Y48 A;  3LDD A;  3JAR B;  5K1P A;  1B6Q A;  3CD6 V;  2W0X A;  1I7F A;  3H1H H;  2Q68 A;  5GON B;  4DV5 O;  4QE9 A;  5H9C A;  4FIP C;  2FKX A;  2CH7 B;  2R9I A;  4LC1 A;  1IZ3 A;  2WLK A;  2MK3 A;  4AI8 A;  3E89 A;  3ZX6 A;  3E22 B;  4YJ3 B;  4PDV A;  1RPR A;  4IHJ A;  3CCQ V;  3ABT A;  3L72 H;  4ZOL B;  4TQF A;  4MVQ A;  1L0L H;  1WA8 B;  2N05 A;  2UXC B;  1KD1 W;  1PM9 A;  4LNU A;  4LF6 O;  5LMU O;  2P90 A;  1VIB A;  2VQE B;  3CHX A;  1XNQ B;  4NXM B;  1NTZ H;  3CYO A;  2R70 A;  1ZUQ A;  4B3R O;  2QTO A;  2QKA A;  4K0K B;  3BPZ A;  1XIL A;  1N33 O;  5JCO A;  1Y6X A;  4P30 A;  4LP8 A;  1FXK B;  1Q5O A;  2QWQ B;  1XL4 A;  4X8A A;  3CRA A;  5CB4 A;  1YXB A;  3MHS C;  1K97 A;  2FML A;  2IJI A;  4EB6 B;  2RCV A;  3AK2 A;  3CCJ V;  3VQY A;  4JI0 B;  1VQL V;  4E2L A;  1UPG A;  2YI9 A;  3RYF B;  3ZMT A;  3CCU V;  1IDS A;  1VQK V;  2VRZ A;  4OPA A;  4ZHQ B;  4UVA A;  5JH7 A;  4DR3 O;  1N36 B;  2E3C A;  5KA5 A;  3RVZ A;  3DC6 A;  1PNK A;  4P9O A;  1H8H G;  1JJ2 U;  1AR5 A;  1VQN V;  4DV3 B;  3HPL C;  1FS0 G;  1X4T A;  4FLX A;  1XNR O;  1SC5 B;  5E79 Z;  2ZE6 A;  1SES A;  5B3S B;  1PNM A;  1D5A A;  1FJG O;  4FLU A;  2BOC C;  3WG7 B;  3VQW A;  2AHY A;  3K0G A;  3H1L H;  2HKO A;  3JAW A;  2VWK A;  5H5N A;  1NR7 A;  1SRY A;  1QVF U;  2M7W A;  3WB1 A;  4UXN A;  1DF4 A;  5FL7 G;  3GVM A;  4DK0 A;  5LP6 A;  2QJ1 A;  4U7N A;  2B5U A;  3RVY A;  5IT9 N;  3TXS A;  1XMO B;  4FFB A;  4K3A A;  4ICG A;  1HNW O;  4LFA B;  4DUZ B;  2LO1 A;  3E8B A;  3J80 N;  1SQX H;  1AI7 A;  2DWE C;  4ASU G;  3AG1 C;  3SJQ C;  2YXY A;  4DV0 B;  3CSX A;  3G4S V;  5CA1 A;  4I55 A;  2F95 B;  3LNN A;  4G28 B;  4DR2 B;  1VEW A;  2F43 G;  5LMN O;  1HP8 A;  1M4U A;  1E1R G;  5BY1 A;  1CP9 A;  3MAQ A;  3ZMU A;  2XT9 A;  4CC6 A;  5CBF A;  3AG7 A;  4JF3 A;  4AIL C;  3ABM B;  1H2K A;  1G8M A;  3ZHU A;  3E35 A;  5JQG B;  3O9O A;  1Z5V A;  2XUM A;  5ITZ B;  4FLZ A;  3RYH B;  3JD1 A;  4HYO A;  2F93 B;  4TUY B;  4I0X B;  1M57 C;  1R3J C;  4PJ0 Z;  3CCM V;  5KX5 A;  4PHZ A;  1QLE B;  4A5U B;  2KSD A;  2W6J G;  2ZKO A;  2ZE8 A;  1K9M W;  4KXR A;  2CTP A;  3F5T A;  4TV9 B;  2DQ3 A;  1BS3 A;  4MVZ A;  1UFI A;  4NVP A;  4LF5 B;  2UXC O;  4UB6 Z;  1L0N H;  3ASN B;  1AJP A;  4JI8 B;  4EKW A;  5GON A;  1YJN V;  5D5P A;  5GTH Z;  2VQE O;  1XNQ O;  4NXM O;  4AQY O;  4IT5 A;  3DC5 A;  5DN6 G;  4UCT A;  4K0K O;  3K0D A;  4DRX B;  2BE3 A;  3D3I A;  1Y67 A;  1XEQ A;  1N32 B;  2DW4 A;  5IY5 C;  5JJJ B;  4N21 A;  5JVD B;  4CH5 A;  1SF9 A;  4P9P A;  1IX9 A;  2Q6A A;  3B09 A;  4O4I B;  4J80 A;  3CB2 A;  1NT2 B;  2A79 B;  2E5L B;  1VF7 A;  1OCR B;  3UT5 B;  1KC8 W;  2PF4 E;  1EM1 A;  4C7U A;  2H94 A;  3K58 A;  4I50 B;  3K9S A;  4I4T B;  4O4L B;  2A9H A;  5CMU A;  1MMM A;  5LHI A;  1N36 O;  5LXT B;  4LF7 B;  4PDR A;  1FXK A;  3Q4H B;  1GK9 A;  3ZRW A;  3G6B A;  4DV3 O;  1WB7 A;  4DV2 B;  4XDK A;  1Q90 D;  2L6L A;  1Q6U A;  2JGU A;  3K5O A;  2XAG A;  1I5X A;  1IBK B;  2ARH A;  4BAY A;  4X88 A;  3TCU A;  3FYI B;  1JQ0 A;  4CH6 A;  2UUB B;  1K33 A;  2LGW A;  4ZHQ A;  2YI8 A;  2YSU B;  1F7Y A;  4X89 A;  4UCO A;  4GCZ A;  1WPX A;  4TV8 A;  2CE4 A;  5JJN B;  4IYH A;  4IHJ B;  1XMQ B;  4FLV A;  4K8Z A;  1XMO O;  4UCU A;  2Z3Y A;  2WSS G;  1S3J A;  1I08 A;  2MW2 B;  3L74 H;  3P3N A;  4LFA O;  3AG3 B;  3CRQ A;  4DUZ O;  3K03 A;  4JYC A;  4X1K B;  4CS4 A;  5BZB A;  3T2M A;  4JI7 B;  3J81 N;  3RT3 C;  5B66 Z;  4BIZ A;  2ZT9 B;  3NXS A;  1S72 V;  4DV0 O;  4X9Q A;  4J11 A;  3SYA A;  2P4K A;  1XQ8 A;  3CC2 V;  1US6 A;  4I9W A;  4X66 B;  3SYP A;  3ZHV A;  1E1Q G;  4NB5 A;  1G4Y B;  1MG1 A;  4U3J A;  1WNS A;  5HFM A;  1KYO F;  3RYC A;  2LFR A;  1YIJ V;  1SQQ H;  3OE7 G;  4RAI A;  4JYY A;  1WLE A;  4Z2W A;  3K5M A;  2IU0 A;  1IBM O;  3ABL B;  2ZXW B;  3BHP A;  2E74 B;  1IUR A;  5B5E Z;  4IYI A;  2ZD9 A;  4I5S A;  5LYJ B;  1NQT A;  4QGP A;  1COW G;  2BCC H;  3OW2 U;  4MTG A;  2JGD B;  4DUY B;  2WLI B;  1BL8 A;  5BXZ A;  3WB2 A;  1SZX A;  5CA0 A;  5JH7 B;  4I7Z B;  4B7K A;  3VQV A;  2B1G A;  3B40 A;  3DGE A;  3OD4 A;  4J10 A;  4UFZ A;  3QTC A;  4TSF G;  2FYU H;  1NH2 D;  1H2L A;  4JAS A;  1H2N A;  3VBB A;  5DEC A;  2CUG A;  5LBQ A;  1WPB A;  1V54 C;  4MVS A;  3P32 A;  1NKD A;  4O4J A;  5ITZ A;  4TQD A;  4D7S A;  4KUM A;  3FB5 C;  4LF5 O;  3GWK C;  3KCX A;  3H1J H;  4DW1 A;  3FB8 C;  2FB5 A;  4TUY A;  3EHB B;  4I0X A;  4JI8 O;  1GAX A;  4H0L B;  1U97 A;  5LP6 B;  2DQ0 A;  4MVM A;  5B1B B;  2WWW A;  2UXN A;  2F23 A;  1PKX A;  4FFB B;  3UO3 A;  1N34 O;  2YID A;  3A0B Z;  2OIG A;  1NVP D;  2EIK B;  1RM1 B;  3O65 A;  1R73 A;  4OXS A;  2LP7 A;  1N32 O;  1RPO A;  2GV9 A;  1BHB A;  4JZG A;  3KKY A;  4FLT A;  4DR5 B;  1XI1 A;  2UUA O;  1P84 F;  4I55 B;  2UXD O;  4NXN B;  1BQ0 A;  4DV4 B;  1J95 A;  3K9A A;  2OTL V;  2PTM A;  2N74 A;  1R3L C;  1TAE A;  3KG2 A;  3X2Q B;  4DRX A;  2GTA A;  4X62 B;  3TK1 A;  2LFS A;  3SPI A;  1QHT A;  4MVO A;  1G6U A;  5IJ9 A;  1S5L Z;  3BA8 A;  2EIN B;  2P22 C;  1ZX3 A;  1GMG A;  5EBL C;  1JFF B;  5JVD A;  4DV2 O;  4LF8 B;  4B7E A;  1V55 C;  3L73 H;  1HR0 B;  2ADP A;  4PA6 A;  1FFX B;  4JI4 B;  3JAS A;  3UT5 A;  4F6E A;  3TET A;  4OPH A;  1XHZ A;  4I50 A;  1S0V A;  1W0J G;  2UUB O;  4I4T A;  1VAR A;  4O4L A;  5H6R A;  2D3O W;  1AI4 A;  1QQC A;  1ZL8 B;  4ZI7 A;  1H2M A;  5LXT A;  1M1K W;  3CC7 V;  4LBE C;  3RBZ A;  4DR4 B;  2EJ7 A;  3T1C A;  5KHK A;  2EIJ B;  3Q4H A;  2Y4U A;  1T5E A;  4LFC B;  4UCV A;  5H6Q A;  4X65 B;  4NTW A;  2CTR A;  1TVK A;  3L71 H;  4WFE A;  1KUQ A;  1XMQ O;  2AGA A;  1URF A;  2Q5Z A;  1Q6H A;  2ZE5 A;  4B3S B;  2Y69 C;  1BCC H;  4UV8 A;  1FAF A;  3C90 A;  4B3M O;  4ZKI A;  4JTA B;  3IJ4 A;  2QDO A;  5IDJ A;  1K8A W;  2DJV A;  1ORQ C;  3U11 A;  3UM7 A;  3C3S A;  4HAM A;  2IJJ A;  3EFF K;  4KP4 A;  1FYJ A;  3BAB A;  4AHC A;  3HKC A;  2KB1 A;  3CXH F;  3STZ C;  3CPW U;  4FZ0 A;  1NI8 A;  2UU9 B;  3ZHR A;  1SS3 A;  4MW8 A;  2JJ2 G;  4X1K A;  1SKV A;  3OGI B;  2GUZ B;  1Q81 W;  4ABM A;  4DV6 B;  3C3T A;  2WLH A;  1H2G A;  1F23 A;  2JDI G;  4JTD B;  4GX5 A;  1M9N A;  4DUY O;  3JD4 A;  2EUL A;  3OAA G;  4DYL A;  2OWO A;  4DR6 B;  5IYZ A;  4JI5 B;  1OCC B;  1P4R A;  1KP3 A;  3ZRV A;  2DYR C;  1D2D A;  4O2A A;  4JAU A;  3S3W A;  4WF9 V;  1YDX A;  3ZRW B;  4LF9 B;  4I9Q A;  3ABK C;  1LNQ A;  2Q9L A;  1OCZ C;  1S5J A;  4BW5 A;  5GTI Z;  1YF2 A;  4JYA O;  5KUM A;  1TUE B;  3CE2 A;  5LYJ A;  2Q69 A;  1FXH A;  4Q6G A;  3SPG A;  1GO3 F;  5EYP B;  3M99 B;  3JAK A;  3JSL A;  2HP8 A;  2NN4 A;  2JGD A;  2WLI A;  4NTY A;  2QE7 G;  3ETQ A;  4JAV A;  4ZIB A;  1YCI A;  2QEX V;  5BR8 O;  1M56 C;  3E8G A;  4TV8 B;  4JI6 B;  4PI0 A;  1L1F A;  4PA7 A;  2Q0A A;  2VQF B;  1P7G A;  1R3K C;  4PD4 F;  4YJ2 B;  3D36 C;  2Q67 A;  1DLB A;  2JS5 A;  2ZIM A;  4OGQ B;  1OZ0 A;  2QA4 V;  2OCH A;  2EX3 A;  2KG7 A;  1XBL A;  1O9G A;  2ZNI A;  2ZE7 A;  2EZP A;  2PYL A;  5L3C A;  4X64 B;  1CXZ B;  1X59 A;  4LH7 A;  3CC4 V;  2EIL C;  2H8P C;  3SYO A;  2F66 C;  4R8C A;  4DV4 O;  2X0L A;  5JJE B;  2X7R B;  4U3J B;  1MOF A;  2JK5 C;  1GH6 A;  1OHH G;  4H37 A;  3CRR A;  3RYC B;  4GKK B;  4UUJ C;  2GBO A;  5HFL A;  1PL0 A;  4B3T B;  1VQ6 V;  2IH3 C;  2JIZ G;  3K06 A;  4X62 O;  3GWO A;  2PUS A;  3BA9 A;  1JCH A;  4QJF B;  5IYC O;  3RN4 A;  5IWA B;  2UUC O;  4LF8 O;  3H1K H;  2HEP A;  4DR1 B;  4H44 B;  4JPR A;  1HR0 O;  3RW0 A;  3QVN A;  3AK1 A;  1K92 A;  2F4V O;  4IIJ B;  1GN2 A;  3HKE B;  5CA0 B;  4JI4 O;  1BE3 H;  4MS2 A;  1PPJ H;  3ZHT A;  1XRE A;  2HR3 A;  2Q7E A;  3E8F A;  1ZAU A;  4XDJ A;  1GN3 A;  2EJR A;  1QCE A;  3CJH A;  3UO2 A;  5KMG B;  4DR4 O;  2ADQ B;  1JMK C;  2B1I A;  1NZ6 A;  1JFF A;  4LFC O;  3DTU B;  4X65 O;  2Q7G A;  1M90 W;  2DE0 X;  4F4L A;  4O4J B;  1FFX A;  3ZED A;  3ASN C;  1Y74 B;  5EBM C;  3H9V A;  3ZRS A;  4JV5 B;  1A32 A;  3LDC A;  3D3Q A;  3JAL A;  4DW0 A;  2CTQ A;  3BEH A;  3OTO B;  4J41 A;  3BFR A;  2GTS A;  3JYC A;  1ZL8 A;  2X6A A;  1N8R W;  4O2B A;  4NTX A;  4J7K A;  2G38 A;  1F51 A;  3AG1 B;  2QR4 A;  3EVK A;  3SDL A;  1IBL B;  3CCS V;  2Z5U A;  3KCY A;  1OCO C;  5L3D A;  4GUN A;  4H13 B;  2CGO A;  2BTO A;  1AP5 A;  4IGG A;  3AG4 C;  4HZ3 A;  1NU1 H;  4D7T A;  2UU9 O;  4YIP A;  1K5S A;  3BY6 A;  1RSO B;  1GN6 A;  3N27 A;  3ZCC A;  4DV6 O;  1XHX A;  2XAH A;  2HVJ C;  3G80 A;  2ILM A;  2HLD G;  1ZWI C;  3K04 A;  1BQZ A;  4RQF A;  2ZDI C;  2K1E A;  2OCC C;  3CEI A;  1BT8 A;  4GT1 A;  5IJ9 B;  4LF9 O;  1M57 B;  4CC5 A;  2R9A A;  2Q8V A;  4EFE A;  2GUZ A;  2WPD G;  2QM8 A;  3JAS B;  4WBN B;  4R50 A;  1WAZ A;  3R65 A;  4KHP B;  1HDJ A;  3T1Y B;  2X6C A;  4JI0 O;  1R3I C;  1VF5 B;  1JA8 A;  2WLL A;  4DXW A;  2WLJ A;  1BMF G;  4ZI7 B;  2DMX A;  1N0N A;  1NBM G;  5BMV A;  2YDE A;  4MW3 A;  4G27 B;  1NTM H;  5LA6 A;  4JI6 O;  3P30 A;  3LDE A;  1WJZ A;  3BVO A;  1TVK B;  1ZLZ A;  3HKD B;  3SJC C;  3G71 V;  2VQF O;  3JD0 A;  1EN4 A;  5EK0 A;  4Q20 A;  4TWK A;  5EYP A;  1YTF B;  3F5W C;  3CXC U;  1H2S B;  3ICX A;  5FPO A;  1DTO A;  2DN9 A;  4GZR B;  2M6Y A;  4GX0 A;  5IY5 B;  1LUV A;  1EFR G;  2LGQ A;  2A3Q A;  4HNA A;  5JCO C;  2GHY A;  4MVU A;  1YJ9 V;  5FNV A;  1PL4 A;  2XAQ A;  1VP7 A;  3HKC B;  3ZIA G;  4RO2 A;  4DV1 B;  4K35 A;  4GKK O;  5KAI Z;  4YJ2 A;  2DYS C;  4B3T O;  2XAJ A;  1HWY A;  4FM1 A;  3QNE A;  2V4D A;  3A8T A;  2YXL A;  4UCR A;  2V1D A;  3WFV A;  2NNU A;  1VQ5 V;  5IWA O;  2JEU A;  4LWS A;  1Q86 W;  3ZS8 C;  3ETG A;  1AR4 A;  3ABU A;  2Y0P A;  1KKD A;  1K3E A;  3OTF A;  1VMG A;  4DR2 O;  3W7X A;  5IYZ B;  1CPY A;  3H01 A;  1EZV H;  4BW9 A;  2F1M A; 
#chains in the Genus database with same CATH homology
 4KXR A;  4W4K A;  4J7J A;  4IYI A;  4J42 A;  4J10 A;  4W4L A;  4J7K A;  2G38 A;  4J41 A;  4J11 A;  3FX7 A;  2GTS A;  4IYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...