4J10A

The crystal structure of a secreted protein esxb (semet-labeled) from bacillus anthracis str. sterne
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
88
structure length
88
Chain Sequence
b'MAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECRETED PROTEIN ESXB
publication title The Crystal Structure of a Secreted Protein Esxb (Semet-Labeled) from Bacillus Anthracis Str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 38
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j10A00
4W4KA 2G38A 4J11A 3FX7A 4IYHA 4J7KA 4J10A 4J41A 2GTSA 4W4LA 4J42A 4IYIA 4KXRA 4J7JA
chains in the Genus database with same CATH superfamily
4KHPO 3W7SA 3FAVA 5IE9A 1VQ6V 4BW5A 2WAMA 1CXZB 2IJIA 1B3QA 1PD3A 2Y69C 3VQWA 1H8EG 3T1HO 3Q4HB 3G67A 4PDLA 1N8RW 2JJ2G 4DR3O 2QWNB 4QGPA 2RDCA 5LYJA 2HJFC 3T1HB 2HLDG 2X0LA 2UUCO 3AG3B 4JI5B 5KHJA 4DR3B 1YJWV 2W6JG 3JSNA 1K5SA 1SA0B 1B04A 3QO7A 3STLC 2QGNA 2ADPA 2GHYA 5J2TA 4NTXA 3SPIA 4MVOA 1AI6A 4GKJB 2CH7A 4JYCA 2ZNJA 1P84F 2C2AA 3BVOA 1QHTA 5ITZA 3JALB 1GM7A 5BY1A 1HNWB 2R70A 2QJ1A 5B1BC 1Z5WA 5E79Z 3C90A 1F23A 5LP6C 3CD6V 1MABG 1Q82W 1K9MW 1TVKA 3BAAA 3JCZA 4K8XA 3CCEV 2JIZG 1JQ0A 4MVRA 5IWAO 1XNRO 3K5OA 2B1GA 3BEHA 1X4TA 4O4IB 5FL7G 2F1MA 1AVMA 1M56C 3CB2A 4J10A 5IWAB 4BW9A 1XNRB 4K3AA 4GX2A 4DXWA 2VQEB 2PGGA 2UXXA 4JASA 3CJHB 1SZXA 4X66O 3CRCA 5JCOA 4X8AA 2WPDG 2QTOA 2GV9A 4X20A 2ZT9B 2E5LO 3K03A 4JI0O 1PM9A 1D2DA 1SETA 1DK1A 1K34A 2DYRC 3OEHG 4CH3A 4DK0A 2ZM6O 1NTMH 2VQFO 1K5QA 3E89A 4YJ2B 3C3TA 2HHHO 5KUMA 4UFZA 1FXKB 4I9QA 4MW3A 4XDJA 4H0LB 2R9RB 5HFMA 3SYAA 2VQFB 4FJCC 5IJ9A 2HHHB 1ROPA 1NR7A 3D36A 1T5EA 3L72H 5EC2C 4YHHB 1KP2A 3CWBH 1Y6XA 1QLNA 5BZBA 1D5AA 3J7AU 2Q4PA 1GN6A 1IBLO 2QWQB 2B5UA 3K3WA 2CUGA 1H2LA 2UXDB 4WFEA 2CDYA 4NXNO 3RYHB 4I0XB 4DK1A 4AQYB 1F51A 3O9OA 2NNUA 2PYLA 5JJJB 5LGNA 1IBLB 5BMVB 4JI4O 2ZCEA 4NXNB 5FNVA 2DJVA 3SPCA 1R6NA 3JD3A 1KMIZ 3RFRA 2W0XA 1JOYA 1SQPH 3UT5B 4JI4B 1URFA 2EILB 4I4TB 2FYUH 2GDSA 3UKMA 2ZR3A 3NR7A 3N2KB 1P7BA 4DV6O 4UCSA 1VQLV 3DGEA 4JI1B 1UJWB 4J7KA 4DR2B 1KD1W 1K73W 4X64B 5IYDO 4RUEA 3ZMZA 4JI3O 1WJZA 4FMTA 5H5NA 4KXRA 4E2LA 1SRYA 1N0JA 4FK5C 1J5EO 4DV6B 3MDSA 1M57C 4LF5O 3APQA 3T1CA 1OCOC 1V9PA 5GW7A 4JI3B 5JJNB 3RT3C 1ZUQA 4H33A 3Q4HA 4JAVA 4DV5O 1J5EB 3ZS8C 4CH6A 2IW5A 1V54C 3APOA 3D36C 1TAEA 1S0VA 4R7CA 1KP3A 4GX1A 1ZTEA 1NBMG 2JGUA 2Q7GA 3BFRA 1YJ9V 3P30A 4IHJB 3L71H 4X1YB 4DV5B 4ZHQB 1M4UA 3K58A 3PN1A 1D5NA 2JRIA 3CRQA 5LOVB 1V55B 1SA0A 5B1AB 4ICGA 1KYOF 2Q7HA 3B40A 3STZC 1XBLA 2AHZA 1Y67A 4DV1O 1PPJH 1G1XB 3RWRD 3CCRV 5KHIA 1Y4MA 5B3SB 3JD0A 5IY5C 1CPYA 4UCOA 3JALA 1XNQO 1EN5A 2YDEA 3OD4A 3CXHF 2QA4V 4NR1A 2YSUB 3G80A 4FM0A 4B3SO 1XNQB 1BMFG 3IAYA 2W6IG 2OYQA 3ABLB 3B4SA 2PI5A 4PA9A 5H2FZ 3CRAA 1RFYA 3JASA 2M7WA 2CGNA 3ICXA 5K1XA 4JI6B 3UQ8A 5LHHA 1NI8A 3ZJZA 4I5SA 4JTCB 3CC7V 4I55B 2WLHA 3HKEB 3DC5A 1VQNV 2WLIA 3OTOO 1M90W 1BQZA 3LNNA 1XQ8A 4FFBB 5LHGA 3UM7A 1GKFA 2P6JA 3K5NA 4DV3O 4E4EA 2YXHA 3OTOB 4LFBO 3UCSC 3CC2V 3AG3C 4OXSA 4LFAB 1H2MA 3E83A 4PI2A 5TISZ 4DV3B 3ABUA 3T4DA 4LFBB 1WNSA 3LSUA 3FYEB 1GH6A 1AP5A 2X6BA 2UUBO 2JEUA 4YJ2A 5CBHA 4MTXA 3K06A 1BHBA 1J95A 1FXKA 4DV4O 3QTCA 4JTAB 3NXSA 2RQ6A 3B09A 3K79A 3OMIB 1QQCA 2CK3G 4YIOA 2UUBB 1XOUA 1MA1A 3KKYA 4NB5A 2DW4A 3OAAG 5LXTB 2YIDA 1JFFB 3JCUZ 5E1AC 4DV4B 5EIBD 4DR7O 1OHHG 4F6RB 5J2TB 4PDMA 3P32A 1A32A 1SQBH 1K4DC 1SS3A 1K7DA 1HP8A 2CH7B 4YXWG 1S72V 4FIPC 4DR7B 2ARHA 2ZDIA 5FPOA 5LHIA 1M5IA 4TV8B 3RYHA 4I0XA 1X59A 4NYKA 1GN3A 4TT3G 1KC8W 5IYBO 1NZ6A 2ZE6A 5BMVA 1YIJV 2DQ3A 4DO2A 3SJCC 2YIBD 2F4VB 4EFEA 4MS2A 2DWDC 2AZ0A 5JJEB 4I50B 4NVPA 3HKCB 3BPZA 1PNKA 2PZSA 5LMUB 1YHQV 3HKBB 1WP8A 5EBMC 3UT5A 2KQXA 3EFFK 4I4TA 4X62B 2VWJA 1MZFA 3AG7A 1JPXA 2Q5ZA 3CPWU 3N2KA 1EFRG 3P3NA 4QE9A 2P90A 3G4SV 1IBMO 2BOCC 4QE7A 3VBBA 3AG2B 1N33O 3GVMA 4D6TH 2GUZB 4P9OA 2HP8A 1FXKC 4JV5B 4NTWA 2Q69A 3WB2A 4LBEC 3L70H 1FXHA 2AGAA 1IBMB 3H1HH 4H44B 4DW1A 3CRRA 4MVSA 3F7VC 1N33B 4CH5A 4WFHA 2AHYA 3ZEDA 2A3QA 4RQFA 4P30A 1FXVA 3LSSA 3JAWB 3LDCA 3BA8A 4IHJA 1LUWA 3DXRB 3N2GB 4X1YA 4A5UB 4ZHQA 3A0BZ 2R72A 5LOVA 1Q86W 2X7RB 4R8CA 1YF2A 3MHHC 2Q6AA 2DE0X 4UVBA 1OCCB 3VQVA 3K04A 2HVJC 3K57A 5D5PA 4WFBV 1S5LZ 2F43G 4DR6B 3FD9A 4C7UA 1I5YA 3T4ZA 3EHBB 3GB7C 4UV8A 2BOBC 1F4MA 3HB3B 3CC4V 2XASA 3ZRWB 1VF6A 3HKDB 3ZRXA 2V7QG 2EILC 1PNLA 1NTZH 5EZYB 1BE3H 4UVCA 2DOSA 4K35A 3JD1A 1HNZO 2LO1A 2QE7G 4DV7O 3TK1A 4OX9B 4B08A 4U7NA 2RMKB 3OGIB 4JI2O 3LDDA 1OJHA 1R73A 2AZ2A 1EZJA 1R3IC 1G8MA 4B3TB 3HR0A 3HKEA 3AK2A 2E76B 4TV9B 4F6EA 4JI2B 1H2KA 3E8HA 5JVDB 4FFBA 3SPHA 1FPOA 4PA3A 1GK9A 1P4RA 2PUSA 1XMOB 1QVFU 4LH6A 2FKXA 3A0HZ 2UXCO 3EXAA 1V55C 1E1QG 5B1AC 4G2KA 1AP6A 2CTRA 3LUTB 2UXCB 4JI5O 1AB3A 3H01A 2LFRA 2OIGA 3CE2A 3OT7A 5B3SC 1JCHA 3TJTA 1NQTA 1VQKV 3E86A 1VF6C 2ZE8A 4Z2WA 5LXTA 4GKJO 1AI7A 1JFFA 3OFNG 1L1FA 4F6RA 2BSKB 3TGUH 5A9GA 3ABLC 2L35A 3H1JH 3BY6A 1HNWO 2ZNIA 4RWUA 4TV8A 4ZBMA 3SR2C 1S5HC 2EINB 4PA7A 4BWAA 1ZL8B 1BT8A 4ZKIA 3ZHQA 2WLLB 3R66A 5KHGA 3OMNB 4I50A 4R6ZA 3S3XA 3ZHRA 3ASOB 1KUQA 3HKCA 1S77D 3HKBA 3KG2A 1IX9A 4QNHB 1VQPV 5IJ0A 3ZHUA 1L0LH 1FAFA 3RYCB 1IXMA 3JASB 1MSDA 4H13B 4CS2A 4GLXA 2VQEO 1VF7A 3SPGA 4LF9O 2ZINA 3BABA 4K0KO 3K9SA 1AJQA 2HR3A 3I55V 2WLIB 4DRXB 3CP1A 4RQEA 1P7GA 4UB8Z 4PA4A 1K4CC 2GUZA 2QKAA 5IYZB 5DM6V 4DUYO 4LF9B 2OCCB 4K0KB 2EX3A 2LQTA 1Y76B 2RNBA 1YITV 1BQ0A 3K0GA 4DUYB 2PI4A 5LBQA 1E1RG 1GM9A 1HW7A 3JAWA 3N2GA 3DXRA 1KBHA 2F66C 3G71V 3CCLV 3RYIB 1VEWA 2PF4E 1PP9H 4HAMA 4D7SA 4YHHO 5CBGA 4HBNA 4QPKA 2CE4A 1XREA 3OM3B 4MTFA 2QSAA 1WB8A 1GAXA 5CB4B 2Z5UA 4N21A 4EB6B 2UXDO 1HWYA 5JWPA 2YI8A 4OPHA 1CP9A 1K3EA 4AQYO 3ZRWA 3HKDA 3ASNB 4B3RB 1F7YA 5EZYA 4LF6B 3X2QB 1MG1A 2BTQB 1SZTA 2AXTZ 1H2NA 2P7TC 2ATKC 3ZRSA 3M7MX 2IBZH 1BL8A 1FJGB 4P9PA 2D2CB 3AEIA 2A79B 1ZX3A 1KB9F 5B1NA 1TUEB 1DF4A 3AG2C 2YIAA 1Z2GA 4WBNB 3TXQA 2ZIOA 3ZBHA 1FD9A 2XTAA 4JI1O 5JCOC 4DR2O 4X64O 1P49A 3FB6C 4TV9A 2P4VA 4RAIA 5JVDA 1MOFA 2ZKOA 1RM1B 2JDIG 3ETGA 3KZIZ 3OEEG 4PELA 3C3SA 1EN4A 2F23A 3JAKB 2IU3A 1TA8A 4ZIBA 3CXCU 3AG1B 4IYIA 4XDKA 1XHZA 1TUBB 4AILC 2RJZA 4TQFA 1OCCC 3JYCA 2N05A 3SYOA 4J80A 3GWOA 4IIJA 3ZCCA 1VQ9V 2X6CA 1NJIW 1K92A 4FLZA 3M99B 3CMAV 3KCYA 1NH2D 2ZE7A 1AR5A 4B7EA 1RSOB 1SQGA 3JATB 2OTJV 3CCSV 4LNUA 2BSKA 2GSMB 1S5JA 4WCEV 4DR4O 4KP4A 1VP7A 2A7WA 2M6YA 2P4KA 5EC1C 3RVYA 1KECA 4LF7O 2PY5A 4CZZA 2A9HA 3LNMB 3T2MA 5GONB 4WFAV 4DR4B 1ZWIC 2EULA 4O2AB 5J9PC 4LF7B 2JGDB 1ZL8A 5CA1B 4I7ZB 2FL4A 2WLLA 1VIBA 4JI6O 1XL4A 1IVSA 1Q43A 1XEQA 3RYCA 4FLYA 3VQXA 3A0RA 1SF9A 1H2SB 2EIMB 3OE7G 1O9HA 3RGBA 2YXLA 1B6QA 3PJSK 1ENVA 4FLUA 5FPRA 4ASUG 4ABMA 4U3JB 4DRXA 2V1DA 3E35A 1VQ8V 1SQXH 3E22B 4LFAO 2QM8A 5IYZA 2EIJB 4O4LB 4GX5A 3ML0A 2OTLV 5KAIZ 4X88A 1Y76A 3U10A 3I56V 4NKGB 1JJ2U 5LL6Y 4LF4B 1RP3B 1YI2V 2DWEC 1AR1B 2RCVA 1K8AW 3G6EV 4XDLA 4PDVA 4DR5B 1NVPD 3RYIA 3ZHVA 3WG7B 4J42A 2GBOA 1VQMV 2JVDA 3OR7C 2QWOB 2ZE5A 4LC1A 5J2UB 3A2FA 1Q3EA 4IGGA 2EINC 2XAHA 5IYCO 2IJKA 1H2GA 5DN6G 5CB4A 4D7TA 4ZI7B 3K0DA 4JAUA 5KA5A 4EB6A 1YTFD 1XL6A 1QR8A 2PYJA 4HYOA 2LGQA 5CA0B 3ASOC 3MAQA 3CMEV 5A2QN 1PNMA 1FFXB 3QF7A 5B66Z 4R50A 3OUSA 3K5LA 2YI9A 3JARA 2F4VO 2HVKC 4BIOA 2BTQA 1DLBA 1N32B 1SQVH 2ILMA 5LMUO 1PV0A 1U96A 5EK0A 3ZHSA 1BS3A 3U0ZA 2Y4UA 3S3WA 4PJ0Z 4YY3B 1SQFA 4CBCA 4X62O 4DUZO 2UXBB 4LR3A 4BIZA 4MVQA 1ZAUA 4WBNA 2OCCC 2FB5A 2KG7B 3VQYA 1YCIA 2Q73A 1Y74B 4FLVA 5IJ0B 3CEIA 2QR4A 4DUZB 3ZHTA 2KKWA 4JV5O 3AG4B 4JYYA 2HFEC 3BA9A 4EEQA 3JAKA 2R9AA 4FLTA 1I94B 1NH2B 3O65A 2Y0PA 2P5OA 3ZN1A 1I0HA 1TUBA 3J81N 3SYPA 1AROP 1HDJA 1EBOA 1I5XA 5KHHA 1N4CA 1FFTB 2WLJA 3KCXA 2RN9A 1QCEA 4EKWA 2H94A 5CMUA 1YXBA 3FB5C 1KU9A 1AI5A 1QLEB 3B2EE 4Q6GA 3RW0A 3TXSA 1N36B 1IBKB 3CCVV 1RSOA 2CAZC 3ASNC 4GKKO 3JATA 2LP7A 4G28B 3FB8C 2ZDIC 1US6A 1ZLZA 3X2QC 4DR6O 4MW8A 2Q0OC 5KAFZ 1VQ7V 4GKKB 4X89A 1KKDA 4Z1VA 1N0NA 3BCCH 5GONA 1WB7A 3SDLA 4O2AA 2DN9A 2QEXV 2JGDA 4OX9O 1PKXA 3FYIB 1DGSA 2PTMA 5AG2A 1G6UA 5CA1A 5K1PA 1HR0B 3W7WA 4CC5A 5LGUA 3FKSG 5L3CA 4ZOLB 1RM1C 4QPJA 2QTSA 4MTGA 4IYHA 4UCRA 4KFMA 4TOIA 5C8YB 4B3TO 1K33A 1KKCA 2YXYA 4P2ZA 3AG1C 2O57A 5JQGB 2HG5C 2ZXWB 1MZEA 4RO2A 1ZSPA 4UVAA 4HZ3A 1FYJA 5IDJA 3SJAC 2IU0A 1NR1A 3M8AA 1XMOO 1QU7A 3E2EA 5BR8O 4U3JA 2EJ7A 5LMNO 5KX5B 3E22A 3DSQA 4F4LA 2OT5A 4MTOA 4OGQB 4O4LA 1W0JG 3CRMA 1OCZB 4Q20A 1XMQO 3JSLA 5BR8B 1OCRB 2XNDG 5CBFA 5LMNB 2LGWA 1Q81W 1IZ3A 2CTQA 1AR4A 1OV9A 3G6BA 1GN4A 1AJNA 1R3LC 2B1IA 5L3GA 1XMQB 2QKCA 4GT1A 1YVWA 4DR1B 4MVUA 3TETA 4IIJB 3J80N 3OTFA 1Q6UA 1WPBA 4JYAO 4TSFG 1NT2B 2QM7A 2OCHA 2NLJC 2LJ2A 4NXMO 4AHCA 2LW7A 4KL1A 5J2UA 4FZ0A 4J7ZA 5H9CA 4KHPB 2XUMA 4L8JA 1Q8IA 2Q7EA 4JYAB 3RBZA 4ZI7A 2Q68A 2Y48A 4NXMB 2ZQMA 4LNUB 1QNMA 4TQDA 4HNAB 1WA8B 5CA0A 2YC0A 1SERA 3QO5A 1FFXA 1LNQA 2CTWA 1QBZA 3E8GA 2OIEA 1XI1A 4RUFA 2EIMC 3N27A 2IJHA 3RVZA 3FB7C 3U11A 4J9ZB 4W4LA 2UUCB 5LGTA 3F5WC 4G27B 2R9IA 3ZN0A 3FFQA 4O2BB 1O9GA 2EIJC 1QR9A 1G4YB 1THZA 4UB6Z 4NTYA 2KG7A 1Y74A 2Z0AA 2UU9O 1XUQA 5KUKA 3CCUV 5FLXN 4WF9V 4DV2O 3ABMB 2JS5A 2Q0AA 2UU9B 4UUJC 4MSWC 1VARA 4DV2B 2D3OW 4CH4A 2H3OA 3WG7C 4LWSB 3DC6A 3MD0A 2FMLA 3CYOA 5DEDA 3QO8A 4N23A 1M9NA 2UUAO 4H37A 2FTKA 4CS3A 3ETQA 1GO3F 3VOUA 3ABKB 1VMGA 4J11A 2UUAB 4B3MO 2BCCH 4JAAA 2ZR2A 1GM8A 3T1YO 4AI8A 4WFFA 2KB1A 4B3MB 5L3EA 3OUFA 5LA6B 4X66B 1R6KA 2YEVB 3ETDA 5C93A 1Z5VA 4JYBA 5KLVH 2E5LB 3T1YB 4B3RO 4JI0B 4LF6O 3L74H 1PL0A 3SJQC 1VF5B 1I7FA 1LUVA 2EIKB 3IFXA 2ZM6B 1NU1H 5B1OA 3ZMSA 3IJ4A 1FJGO 1BCCH 3ZX6A 2B9ZA 3CS5A 4X1KA 3JARB 2P22C 4MT8A 3D8CA 1WP7A 1W0KG 3RN4A 4ZOLA 1KQSU 1MNGA 2BE3A 3ZRVA 3UO2A 3AG4C 4W4KA 4X1IB 5KMGB 3THOA 5C8YA 1R3JC 4GCZA 3E8FA 5KA6A 5JQGA 4PV1B 4PD4F 2ZIMA 2IH3C 4XBFA 1YZBA 2XAQA 1AILA 2EJRA 4LF8O 3BHPA 3ETEA 2DYSB 2LW1A 5KX5A 4O4JB 2K9PA 2WLMA 2OWOA 4BIUA 5L3DA 2G38A 3R65A 5D5QA 1QLEC 2ITCC 4LF8B 1SC5B 4O4HB 2QWRB 1IXBA 1YDXA 4YJ3B 2NN4A 1NKDA 1N34O 4JI7O 2CGOA 1Q6IA 4GYCB 1BZKA 3RYFB 1RPRA 4LH7A 1VQ4V 1N34B 3H1IH 4JI7B 3B8MA 3IC7A 4MVZA 4JI8O 1W2BU 2YICA 4X65O 5JH7B 5IT9N 2EZPA 2ADQB 4LP8A 2X6AA 1AJPA 2H8PC 4GX0A 4DV0O 4JI8B 5EYPB 1R6TA 1M1KW 4I9WA 4X65B 1SKVA 2YIBA 4LF5B 3OMAB 2JS3A 4JZ2A 1BHAA 4HNAA 1WA8A 3K08A 2XT9A 4FLXA 5H6RA 1S3JA 4DV0B 1QVGU 2Y0IA 4X9QA 2ZXWC 2QKSA 3SGIA 4FZ1A 1MSWD 3DTUB 2Y69B 2W0FC 5GTHZ 2A0LA 1BGYH 1JR9A 2JJ1G 2K1EA 2Q9LA 4J41A 4IT5A 4O2BA 3FX7A 4MVMA 2ZD9A 1OCZC 1L0NH 1OCRC 4DV1B 1IDSA 2CTPA 3ZMTA 2WSSG 2XOKG 3WB1A 5GTIZ 1WAZA 2HKOA 4TUYB 3JAMN 1EZVH 4JTDB 3H1LH 1JVMA 1K97A 3B77A 5EIBC 4U7OA 1CEZA 5CA3A 2MW2B 2Y4TA 3K5MA 2WA3A 1Q5OA 5H6QA 3W7UA 2EBOA 4LF4O 2LFSA 4LFCO 5DECA 4FLWA 1F4NA 2HJDA 4UCTA 1GTOA 4LWSA 4B3SB 4O4IA 1ORQC 5BXZA 1GMGA 1SQQH 3OGCC 3ZMVA 1S76D 4LFCB 4DR5O 3BRCA 5B1BB 5LP6B 3CJHA 2QM4A 3QNEA 3F7YC 3LDEA 4JF3A 3FAVB 2XAGA 4L87A 4UV9A 2P67A 1FS0G 2E75B 4DYLA 3SYCA 1Q90D 4JZGA 5LA6A 1JMKC 2QWPB 1M56B 3L75H 2YEVA 3H9VA 2E74B 1R3KC 1EN6A 1FKAO 1JA8A 1MMMA 2A06H 3OR6C 3L9DA 5L3FA 5LYJB 4JGSA 3A8TA 1WN7A 1N32O 1E79G 2AW9A 2VWKA 1XDCA 2N04A 4IL6Z 1EM1A 4TWKA 5KHKA 1GN2A 4YY3O 2XAFA 4K8ZA 2F95B 3ABMC 2UXBO 5B5EZ 2Z3YA 4PA6A 3B8NA 2KSDA 1DTOA 2DYRB 4YIPA 2N74A 4X1IA 5KMGA 4FFKA 3WU2Z 3ZIAG 2VRZA 1W59A 4GZRB 3QG5A 4EFBA 1I08A 3IGAC 3SPJA 1L8DA 4DW0A 1YSCA 3CX5F 4PHZA 4FM2A 3D3QA 2UXNA 3QVNA 3CCMV 2WA4A 5ITZB 4CC6A 1NTKH 4UCUA 3D3IA 1I94O 4O4JA 4PI0A 2Q8VA 4BR6A 1WPXA 3ABKC 1UFIA 3OW2U 1TVKB 4FM1A 4O4HA 1JX9A 4YJ3A 2ODMA 5CN0A 1GRJA 1VQ5V 2IM9A 1Y66A 4PDRA 1H8HG 4OPAA 4GUNA 2V4DA 2IJJA 1OZ0A 3AK3A 1N36O 3RYFA 2GTAA 1Q7YW 1IBKO 1PL4A 1TGOA 2IH1C 3SYQA 3L73H 2YUAA 2EZOA 3JD2A 5F2VO 5JH7A 1LR1A 1VQOV 2L6LA 2EIKC 3AK1A 1M93A 4FVMA 2ITDC 2WLNA 4X20B 2Q67A 1UPGA 2JEXA 4QJFB 5EYPA 4BAYA 2HEPA 1JJOA 5EBWC 3W7XA 1RPOA 5EBLC 1B06A 3JD4A 2XAJA 3E8BA 3WB0A 3UO3A 1YJNV 4Z1MG 2F93B 3CSXA 2JK5C 3WFVA 3F5TA 2VS0A 1HR0O 1M57B 1Q6HA 1XHXA 2E3CA 3HPLC 3ZMUA 1BSMA 1OCOB 2ETNA 1H38A 3LSQA 4X1KB 2GTSA 5IJ9B 3K59A 2DYSC 1V54B 5HFLA 1HNXO 1COWG 4J9YB 3K9AA 1XILA 3H1KH 4FPPA 4QIWF 3EVKA 2DMXA 3W7TA 4UXNA 2XHBA 1DF5A 3ABTA 4J7JA 3MHSC 1AI4A 4LCUC 1HNXB 1R1BA 4TUYA 2YS8A 3TCUA 2MK3A 3GWKC 1U97A 3IC9A 2BTOA 4CS4A 1WLEA 1NS1A 4KUMA 3CHXA 5L3BA 3I5DA 1NVPB 1SESA 3P3PA 4WFGA 1IURA 3CCQV 5FNVB 1HNZB 2NR5A 5IY5B 2QDOA 4DV7B 4DR1O 4B7KA 2P06A 4I55A 2WWWA 4UCVA 2WLKA 4JPRA 3CCJV 5LP6A 3SJBC 1YEWA 1YTFB 2DQ0A 4U3FH
chains in the Genus database with same CATH topology
4W4KA 2G38A 4J11A 3FX7A 4IYHA 4J7KA 4J10A 4J41A 2GTSA 4W4LA 4J42A 4IYIA 4KXRA 4J7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4K A;  2G38 A;  4J11 A;  3FX7 A;  4IYH A;  4J7K A;  4J10 A;  4J41 A;  2GTS A;  4W4L A;  4J42 A;  4IYI A;  4KXR A;  4J7J A; 
#chains in the Genus database with same CATH topology
 4KHP O;  3W7S A;  3FAV A;  5IE9 A;  1VQ6 V;  4BW5 A;  2WAM A;  1CXZ B;  2IJI A;  1B3Q A;  1PD3 A;  2Y69 C;  3VQW A;  1H8E G;  3T1H O;  3Q4H B;  3G67 A;  4PDL A;  1N8R W;  2JJ2 G;  4DR3 O;  2QWN B;  4QGP A;  2RDC A;  5LYJ A;  2HJF C;  3T1H B;  2HLD G;  2X0L A;  2UUC O;  3AG3 B;  4JI5 B;  5KHJ A;  4DR3 B;  1YJW V;  2W6J G;  3JSN A;  1K5S A;  1SA0 B;  1B04 A;  3QO7 A;  3STL C;  2QGN A;  2ADP A;  2GHY A;  5J2T A;  4NTX A;  3SPI A;  4MVO A;  1AI6 A;  4GKJ B;  2CH7 A;  4JYC A;  2ZNJ A;  1P84 F;  2C2A A;  3BVO A;  1QHT A;  5ITZ A;  3JAL B;  1GM7 A;  5BY1 A;  1HNW B;  2R70 A;  2QJ1 A;  5B1B C;  1Z5W A;  5E79 Z;  3C90 A;  1F23 A;  5LP6 C;  3CD6 V;  1MAB G;  1Q82 W;  1K9M W;  1TVK A;  3BAA A;  3JCZ A;  4K8X A;  3CCE V;  2JIZ G;  1JQ0 A;  4MVR A;  5IWA O;  1XNR O;  3K5O A;  2B1G A;  3BEH A;  1X4T A;  4O4I B;  5FL7 G;  2F1M A;  1AVM A;  1M56 C;  3CB2 A;  4J10 A;  5IWA B;  4BW9 A;  1XNR B;  4K3A A;  4GX2 A;  4DXW A;  2VQE B;  2PGG A;  2UXX A;  4JAS A;  3CJH B;  1SZX A;  4X66 O;  3CRC A;  5JCO A;  4X8A A;  2WPD G;  2QTO A;  2GV9 A;  4X20 A;  2ZT9 B;  2E5L O;  3K03 A;  4JI0 O;  1PM9 A;  1D2D A;  1SET A;  1DK1 A;  1K34 A;  2DYR C;  3OEH G;  4CH3 A;  4DK0 A;  2ZM6 O;  1NTM H;  2VQF O;  1K5Q A;  3E89 A;  4YJ2 B;  3C3T A;  2HHH O;  5KUM A;  4UFZ A;  1FXK B;  4I9Q A;  4MW3 A;  4XDJ A;  4H0L B;  2R9R B;  5HFM A;  3SYA A;  2VQF B;  4FJC C;  5IJ9 A;  2HHH B;  1ROP A;  1NR7 A;  3D36 A;  1T5E A;  3L72 H;  5EC2 C;  4YHH B;  1KP2 A;  3CWB H;  1Y6X A;  1QLN A;  5BZB A;  1D5A A;  3J7A U;  2Q4P A;  1GN6 A;  1IBL O;  2QWQ B;  2B5U A;  3K3W A;  2CUG A;  1H2L A;  2UXD B;  4WFE A;  2CDY A;  4NXN O;  3RYH B;  4I0X B;  4DK1 A;  4AQY B;  1F51 A;  3O9O A;  2NNU A;  2PYL A;  5JJJ B;  5LGN A;  1IBL B;  5BMV B;  4JI4 O;  2ZCE A;  4NXN B;  5FNV A;  2DJV A;  3SPC A;  1R6N A;  3JD3 A;  1KMI Z;  3RFR A;  2W0X A;  1JOY A;  1SQP H;  3UT5 B;  4JI4 B;  1URF A;  2EIL B;  4I4T B;  2FYU H;  2GDS A;  3UKM A;  2ZR3 A;  3NR7 A;  3N2K B;  1P7B A;  4DV6 O;  4UCS A;  1VQL V;  3DGE A;  4JI1 B;  1UJW B;  4J7K A;  4DR2 B;  1KD1 W;  1K73 W;  4X64 B;  5IYD O;  4RUE A;  3ZMZ A;  4JI3 O;  1WJZ A;  4FMT A;  5H5N A;  4KXR A;  4E2L A;  1SRY A;  1N0J A;  4FK5 C;  1J5E O;  4DV6 B;  3MDS A;  1M57 C;  4LF5 O;  3APQ A;  3T1C A;  1OCO C;  1V9P A;  5GW7 A;  4JI3 B;  5JJN B;  3RT3 C;  1ZUQ A;  4H33 A;  3Q4H A;  4JAV A;  4DV5 O;  1J5E B;  3ZS8 C;  4CH6 A;  2IW5 A;  1V54 C;  3APO A;  3D36 C;  1TAE A;  1S0V A;  4R7C A;  1KP3 A;  4GX1 A;  1ZTE A;  1NBM G;  2JGU A;  2Q7G A;  3BFR A;  1YJ9 V;  3P30 A;  4IHJ B;  3L71 H;  4X1Y B;  4DV5 B;  4ZHQ B;  1M4U A;  3K58 A;  3PN1 A;  1D5N A;  2JRI A;  3CRQ A;  5LOV B;  1V55 B;  1SA0 A;  5B1A B;  4ICG A;  1KYO F;  2Q7H A;  3B40 A;  3STZ C;  1XBL A;  2AHZ A;  1Y67 A;  4DV1 O;  1PPJ H;  1G1X B;  3RWR D;  3CCR V;  5KHI A;  1Y4M A;  5B3S B;  3JD0 A;  5IY5 C;  1CPY A;  4UCO A;  3JAL A;  1XNQ O;  1EN5 A;  2YDE A;  3OD4 A;  3CXH F;  2QA4 V;  4NR1 A;  2YSU B;  3G80 A;  4FM0 A;  4B3S O;  1XNQ B;  1BMF G;  3IAY A;  2W6I G;  2OYQ A;  3ABL B;  3B4S A;  2PI5 A;  4PA9 A;  5H2F Z;  3CRA A;  1RFY A;  3JAS A;  2M7W A;  2CGN A;  3ICX A;  5K1X A;  4JI6 B;  3UQ8 A;  5LHH A;  1NI8 A;  3ZJZ A;  4I5S A;  4JTC B;  3CC7 V;  4I55 B;  2WLH A;  3HKE B;  3DC5 A;  1VQN V;  2WLI A;  3OTO O;  1M90 W;  1BQZ A;  3LNN A;  1XQ8 A;  4FFB B;  5LHG A;  3UM7 A;  1GKF A;  2P6J A;  3K5N A;  4DV3 O;  4E4E A;  2YXH A;  3OTO B;  4LFB O;  3UCS C;  3CC2 V;  3AG3 C;  4OXS A;  4LFA B;  1H2M A;  3E83 A;  4PI2 A;  5TIS Z;  4DV3 B;  3ABU A;  3T4D A;  4LFB B;  1WNS A;  3LSU A;  3FYE B;  1GH6 A;  1AP5 A;  2X6B A;  2UUB O;  2JEU A;  4YJ2 A;  5CBH A;  4MTX A;  3K06 A;  1BHB A;  1J95 A;  1FXK A;  4DV4 O;  3QTC A;  4JTA B;  3NXS A;  2RQ6 A;  3B09 A;  3K79 A;  3OMI B;  1QQC A;  2CK3 G;  4YIO A;  2UUB B;  1XOU A;  1MA1 A;  3KKY A;  4NB5 A;  2DW4 A;  3OAA G;  5LXT B;  2YID A;  1JFF B;  3JCU Z;  5E1A C;  4DV4 B;  5EIB D;  4DR7 O;  1OHH G;  4F6R B;  5J2T B;  4PDM A;  3P32 A;  1A32 A;  1SQB H;  1K4D C;  1SS3 A;  1K7D A;  1HP8 A;  2CH7 B;  4YXW G;  1S72 V;  4FIP C;  4DR7 B;  2ARH A;  2ZDI A;  5FPO A;  5LHI A;  1M5I A;  4TV8 B;  3RYH A;  4I0X A;  1X59 A;  4NYK A;  1GN3 A;  4TT3 G;  1KC8 W;  5IYB O;  1NZ6 A;  2ZE6 A;  5BMV A;  1YIJ V;  2DQ3 A;  4DO2 A;  3SJC C;  2YIB D;  2F4V B;  4EFE A;  4MS2 A;  2DWD C;  2AZ0 A;  5JJE B;  4I50 B;  4NVP A;  3HKC B;  3BPZ A;  1PNK A;  2PZS A;  5LMU B;  1YHQ V;  3HKB B;  1WP8 A;  5EBM C;  3UT5 A;  2KQX A;  3EFF K;  4I4T A;  4X62 B;  2VWJ A;  1MZF A;  3AG7 A;  1JPX A;  2Q5Z A;  3CPW U;  3N2K A;  1EFR G;  3P3N A;  4QE9 A;  2P90 A;  3G4S V;  1IBM O;  2BOC C;  4QE7 A;  3VBB A;  3AG2 B;  1N33 O;  3GVM A;  4D6T H;  2GUZ B;  4P9O A;  2HP8 A;  1FXK C;  4JV5 B;  4NTW A;  2Q69 A;  3WB2 A;  4LBE C;  3L70 H;  1FXH A;  2AGA A;  1IBM B;  3H1H H;  4H44 B;  4DW1 A;  3CRR A;  4MVS A;  3F7V C;  1N33 B;  4CH5 A;  4WFH A;  2AHY A;  3ZED A;  2A3Q A;  4RQF A;  4P30 A;  1FXV A;  3LSS A;  3JAW B;  3LDC A;  3BA8 A;  4IHJ A;  1LUW A;  3DXR B;  3N2G B;  4X1Y A;  4A5U B;  4ZHQ A;  3A0B Z;  2R72 A;  5LOV A;  1Q86 W;  2X7R B;  4R8C A;  1YF2 A;  3MHH C;  2Q6A A;  2DE0 X;  4UVB A;  1OCC B;  3VQV A;  3K04 A;  2HVJ C;  3K57 A;  5D5P A;  4WFB V;  1S5L Z;  2F43 G;  4DR6 B;  3FD9 A;  4C7U A;  1I5Y A;  3T4Z A;  3EHB B;  3GB7 C;  4UV8 A;  2BOB C;  1F4M A;  3HB3 B;  3CC4 V;  2XAS A;  3ZRW B;  1VF6 A;  3HKD B;  3ZRX A;  2V7Q G;  2EIL C;  1PNL A;  1NTZ H;  5EZY B;  1BE3 H;  4UVC A;  2DOS A;  4K35 A;  3JD1 A;  1HNZ O;  2LO1 A;  2QE7 G;  4DV7 O;  3TK1 A;  4OX9 B;  4B08 A;  4U7N A;  2RMK B;  3OGI B;  4JI2 O;  3LDD A;  1OJH A;  1R73 A;  2AZ2 A;  1EZJ A;  1R3I C;  1G8M A;  4B3T B;  3HR0 A;  3HKE A;  3AK2 A;  2E76 B;  4TV9 B;  4F6E A;  4JI2 B;  1H2K A;  3E8H A;  5JVD B;  4FFB A;  3SPH A;  1FPO A;  4PA3 A;  1GK9 A;  1P4R A;  2PUS A;  1XMO B;  1QVF U;  4LH6 A;  2FKX A;  3A0H Z;  2UXC O;  3EXA A;  1V55 C;  1E1Q G;  5B1A C;  4G2K A;  1AP6 A;  2CTR A;  3LUT B;  2UXC B;  4JI5 O;  1AB3 A;  3H01 A;  2LFR A;  2OIG A;  3CE2 A;  3OT7 A;  5B3S C;  1JCH A;  3TJT A;  1NQT A;  1VQK V;  3E86 A;  1VF6 C;  2ZE8 A;  4Z2W A;  5LXT A;  4GKJ O;  1AI7 A;  1JFF A;  3OFN G;  1L1F A;  4F6R A;  2BSK B;  3TGU H;  5A9G A;  3ABL C;  2L35 A;  3H1J H;  3BY6 A;  1HNW O;  2ZNI A;  4RWU A;  4TV8 A;  4ZBM A;  3SR2 C;  1S5H C;  2EIN B;  4PA7 A;  4BWA A;  1ZL8 B;  1BT8 A;  4ZKI A;  3ZHQ A;  2WLL B;  3R66 A;  5KHG A;  3OMN B;  4I50 A;  4R6Z A;  3S3X A;  3ZHR A;  3ASO B;  1KUQ A;  3HKC A;  1S77 D;  3HKB A;  3KG2 A;  1IX9 A;  4QNH B;  1VQP V;  5IJ0 A;  3ZHU A;  1L0L H;  1FAF A;  3RYC B;  1IXM A;  3JAS B;  1MSD A;  4H13 B;  4CS2 A;  4GLX A;  2VQE O;  1VF7 A;  3SPG A;  4LF9 O;  2ZIN A;  3BAB A;  4K0K O;  3K9S A;  1AJQ A;  2HR3 A;  3I55 V;  2WLI B;  4DRX B;  3CP1 A;  4RQE A;  1P7G A;  4UB8 Z;  4PA4 A;  1K4C C;  2GUZ A;  2QKA A;  5IYZ B;  5DM6 V;  4DUY O;  4LF9 B;  2OCC B;  4K0K B;  2EX3 A;  2LQT A;  1Y76 B;  2RNB A;  1YIT V;  1BQ0 A;  3K0G A;  4DUY B;  2PI4 A;  5LBQ A;  1E1R G;  1GM9 A;  1HW7 A;  3JAW A;  3N2G A;  3DXR A;  1KBH A;  2F66 C;  3G71 V;  3CCL V;  3RYI B;  1VEW A;  2PF4 E;  1PP9 H;  4HAM A;  4D7S A;  4YHH O;  5CBG A;  4HBN A;  4QPK A;  2CE4 A;  1XRE A;  3OM3 B;  4MTF A;  2QSA A;  1WB8 A;  1GAX A;  5CB4 B;  2Z5U A;  4N21 A;  4EB6 B;  2UXD O;  1HWY A;  5JWP A;  2YI8 A;  4OPH A;  1CP9 A;  1K3E A;  4AQY O;  3ZRW A;  3HKD A;  3ASN B;  4B3R B;  1F7Y A;  5EZY A;  4LF6 B;  3X2Q B;  1MG1 A;  2BTQ B;  1SZT A;  2AXT Z;  1H2N A;  2P7T C;  2ATK C;  3ZRS A;  3M7M X;  2IBZ H;  1BL8 A;  1FJG B;  4P9P A;  2D2C B;  3AEI A;  2A79 B;  1ZX3 A;  1KB9 F;  5B1N A;  1TUE B;  1DF4 A;  3AG2 C;  2YIA A;  1Z2G A;  4WBN B;  3TXQ A;  2ZIO A;  3ZBH A;  1FD9 A;  2XTA A;  4JI1 O;  5JCO C;  4DR2 O;  4X64 O;  1P49 A;  3FB6 C;  4TV9 A;  2P4V A;  4RAI A;  5JVD A;  1MOF A;  2ZKO A;  1RM1 B;  2JDI G;  3ETG A;  3KZI Z;  3OEE G;  4PEL A;  3C3S A;  1EN4 A;  2F23 A;  3JAK B;  2IU3 A;  1TA8 A;  4ZIB A;  3CXC U;  3AG1 B;  4IYI A;  4XDK A;  1XHZ A;  1TUB B;  4AIL C;  2RJZ A;  4TQF A;  1OCC C;  3JYC A;  2N05 A;  3SYO A;  4J80 A;  3GWO A;  4IIJ A;  3ZCC A;  1VQ9 V;  2X6C A;  1NJI W;  1K92 A;  4FLZ A;  3M99 B;  3CMA V;  3KCY A;  1NH2 D;  2ZE7 A;  1AR5 A;  4B7E A;  1RSO B;  1SQG A;  3JAT B;  2OTJ V;  3CCS V;  4LNU A;  2BSK A;  2GSM B;  1S5J A;  4WCE V;  4DR4 O;  4KP4 A;  1VP7 A;  2A7W A;  2M6Y A;  2P4K A;  5EC1 C;  3RVY A;  1KEC A;  4LF7 O;  2PY5 A;  4CZZ A;  2A9H A;  3LNM B;  3T2M A;  5GON B;  4WFA V;  4DR4 B;  1ZWI C;  2EUL A;  4O2A B;  5J9P C;  4LF7 B;  2JGD B;  1ZL8 A;  5CA1 B;  4I7Z B;  2FL4 A;  2WLL A;  1VIB A;  4JI6 O;  1XL4 A;  1IVS A;  1Q43 A;  1XEQ A;  3RYC A;  4FLY A;  3VQX A;  3A0R A;  1SF9 A;  1H2S B;  2EIM B;  3OE7 G;  1O9H A;  3RGB A;  2YXL A;  1B6Q A;  3PJS K;  1ENV A;  4FLU A;  5FPR A;  4ASU G;  4ABM A;  4U3J B;  4DRX A;  2V1D A;  3E35 A;  1VQ8 V;  1SQX H;  3E22 B;  4LFA O;  2QM8 A;  5IYZ A;  2EIJ B;  4O4L B;  4GX5 A;  3ML0 A;  2OTL V;  5KAI Z;  4X88 A;  1Y76 A;  3U10 A;  3I56 V;  4NKG B;  1JJ2 U;  5LL6 Y;  4LF4 B;  1RP3 B;  1YI2 V;  2DWE C;  1AR1 B;  2RCV A;  1K8A W;  3G6E V;  4XDL A;  4PDV A;  4DR5 B;  1NVP D;  3RYI A;  3ZHV A;  3WG7 B;  4J42 A;  2GBO A;  1VQM V;  2JVD A;  3OR7 C;  2QWO B;  2ZE5 A;  4LC1 A;  5J2U B;  3A2F A;  1Q3E A;  4IGG A;  2EIN C;  2XAH A;  5IYC O;  2IJK A;  1H2G A;  5DN6 G;  5CB4 A;  4D7T A;  4ZI7 B;  3K0D A;  4JAU A;  5KA5 A;  4EB6 A;  1YTF D;  1XL6 A;  1QR8 A;  2PYJ A;  4HYO A;  2LGQ A;  5CA0 B;  3ASO C;  3MAQ A;  3CME V;  5A2Q N;  1PNM A;  1FFX B;  3QF7 A;  5B66 Z;  4R50 A;  3OUS A;  3K5L A;  2YI9 A;  3JAR A;  2F4V O;  2HVK C;  4BIO A;  2BTQ A;  1DLB A;  1N32 B;  1SQV H;  2ILM A;  5LMU O;  1PV0 A;  1U96 A;  5EK0 A;  3ZHS A;  1BS3 A;  3U0Z A;  2Y4U A;  3S3W A;  4PJ0 Z;  4YY3 B;  1SQF A;  4CBC A;  4X62 O;  4DUZ O;  2UXB B;  4LR3 A;  4BIZ A;  4MVQ A;  1ZAU A;  4WBN A;  2OCC C;  2FB5 A;  2KG7 B;  3VQY A;  1YCI A;  2Q73 A;  1Y74 B;  4FLV A;  5IJ0 B;  3CEI A;  2QR4 A;  4DUZ B;  3ZHT A;  2KKW A;  4JV5 O;  3AG4 B;  4JYY A;  2HFE C;  3BA9 A;  4EEQ A;  3JAK A;  2R9A A;  4FLT A;  1I94 B;  1NH2 B;  3O65 A;  2Y0P A;  2P5O A;  3ZN1 A;  1I0H A;  1TUB A;  3J81 N;  3SYP A;  1ARO P;  1HDJ A;  1EBO A;  1I5X A;  5KHH A;  1N4C A;  1FFT B;  2WLJ A;  3KCX A;  2RN9 A;  1QCE A;  4EKW A;  2H94 A;  5CMU A;  1YXB A;  3FB5 C;  1KU9 A;  1AI5 A;  1QLE B;  3B2E E;  4Q6G A;  3RW0 A;  3TXS A;  1N36 B;  1IBK B;  3CCV V;  1RSO A;  2CAZ C;  3ASN C;  4GKK O;  3JAT A;  2LP7 A;  4G28 B;  3FB8 C;  2ZDI C;  1US6 A;  1ZLZ A;  3X2Q C;  4DR6 O;  4MW8 A;  2Q0O C;  5KAF Z;  1VQ7 V;  4GKK B;  4X89 A;  1KKD A;  4Z1V A;  1N0N A;  3BCC H;  5GON A;  1WB7 A;  3SDL A;  4O2A A;  2DN9 A;  2QEX V;  2JGD A;  4OX9 O;  1PKX A;  3FYI B;  1DGS A;  2PTM A;  5AG2 A;  1G6U A;  5CA1 A;  5K1P A;  1HR0 B;  3W7W A;  4CC5 A;  5LGU A;  3FKS G;  5L3C A;  4ZOL B;  1RM1 C;  4QPJ A;  2QTS A;  4MTG A;  4IYH A;  4UCR A;  4KFM A;  4TOI A;  5C8Y B;  4B3T O;  1K33 A;  1KKC A;  2YXY A;  4P2Z A;  3AG1 C;  2O57 A;  5JQG B;  2HG5 C;  2ZXW B;  1MZE A;  4RO2 A;  1ZSP A;  4UVA A;  4HZ3 A;  1FYJ A;  5IDJ A;  3SJA C;  2IU0 A;  1NR1 A;  3M8A A;  1XMO O;  1QU7 A;  3E2E A;  5BR8 O;  4U3J A;  2EJ7 A;  5LMN O;  5KX5 B;  3E22 A;  3DSQ A;  4F4L A;  2OT5 A;  4MTO A;  4OGQ B;  4O4L A;  1W0J G;  3CRM A;  1OCZ B;  4Q20 A;  1XMQ O;  3JSL A;  5BR8 B;  1OCR B;  2XND G;  5CBF A;  5LMN B;  2LGW A;  1Q81 W;  1IZ3 A;  2CTQ A;  1AR4 A;  1OV9 A;  3G6B A;  1GN4 A;  1AJN A;  1R3L C;  2B1I A;  5L3G A;  1XMQ B;  2QKC A;  4GT1 A;  1YVW A;  4DR1 B;  4MVU A;  3TET A;  4IIJ B;  3J80 N;  3OTF A;  1Q6U A;  1WPB A;  4JYA O;  4TSF G;  1NT2 B;  2QM7 A;  2OCH A;  2NLJ C;  2LJ2 A;  4NXM O;  4AHC A;  2LW7 A;  4KL1 A;  5J2U A;  4FZ0 A;  4J7Z A;  5H9C A;  4KHP B;  2XUM A;  4L8J A;  1Q8I A;  2Q7E A;  4JYA B;  3RBZ A;  4ZI7 A;  2Q68 A;  2Y48 A;  4NXM B;  2ZQM A;  4LNU B;  1QNM A;  4TQD A;  4HNA B;  1WA8 B;  5CA0 A;  2YC0 A;  1SER A;  3QO5 A;  1FFX A;  1LNQ A;  2CTW A;  1QBZ A;  3E8G A;  2OIE A;  1XI1 A;  4RUF A;  2EIM C;  3N27 A;  2IJH A;  3RVZ A;  3FB7 C;  3U11 A;  4J9Z B;  4W4L A;  2UUC B;  5LGT A;  3F5W C;  4G27 B;  2R9I A;  3ZN0 A;  3FFQ A;  4O2B B;  1O9G A;  2EIJ C;  1QR9 A;  1G4Y B;  1THZ A;  4UB6 Z;  4NTY A;  2KG7 A;  1Y74 A;  2Z0A A;  2UU9 O;  1XUQ A;  5KUK A;  3CCU V;  5FLX N;  4WF9 V;  4DV2 O;  3ABM B;  2JS5 A;  2Q0A A;  2UU9 B;  4UUJ C;  4MSW C;  1VAR A;  4DV2 B;  2D3O W;  4CH4 A;  2H3O A;  3WG7 C;  4LWS B;  3DC6 A;  3MD0 A;  2FML A;  3CYO A;  5DED A;  3QO8 A;  4N23 A;  1M9N A;  2UUA O;  4H37 A;  2FTK A;  4CS3 A;  3ETQ A;  1GO3 F;  3VOU A;  3ABK B;  1VMG A;  4J11 A;  2UUA B;  4B3M O;  2BCC H;  4JAA A;  2ZR2 A;  1GM8 A;  3T1Y O;  4AI8 A;  4WFF A;  2KB1 A;  4B3M B;  5L3E A;  3OUF A;  5LA6 B;  4X66 B;  1R6K A;  2YEV B;  3ETD A;  5C93 A;  1Z5V A;  4JYB A;  5KLV H;  2E5L B;  3T1Y B;  4B3R O;  4JI0 B;  4LF6 O;  3L74 H;  1PL0 A;  3SJQ C;  1VF5 B;  1I7F A;  1LUV A;  2EIK B;  3IFX A;  2ZM6 B;  1NU1 H;  5B1O A;  3ZMS A;  3IJ4 A;  1FJG O;  1BCC H;  3ZX6 A;  2B9Z A;  3CS5 A;  4X1K A;  3JAR B;  2P22 C;  4MT8 A;  3D8C A;  1WP7 A;  1W0K G;  3RN4 A;  4ZOL A;  1KQS U;  1MNG A;  2BE3 A;  3ZRV A;  3UO2 A;  3AG4 C;  4W4K A;  4X1I B;  5KMG B;  3THO A;  5C8Y A;  1R3J C;  4GCZ A;  3E8F A;  5KA6 A;  5JQG A;  4PV1 B;  4PD4 F;  2ZIM A;  2IH3 C;  4XBF A;  1YZB A;  2XAQ A;  1AIL A;  2EJR A;  4LF8 O;  3BHP A;  3ETE A;  2DYS B;  2LW1 A;  5KX5 A;  4O4J B;  2K9P A;  2WLM A;  2OWO A;  4BIU A;  5L3D A;  2G38 A;  3R65 A;  5D5Q A;  1QLE C;  2ITC C;  4LF8 B;  1SC5 B;  4O4H B;  2QWR B;  1IXB A;  1YDX A;  4YJ3 B;  2NN4 A;  1NKD A;  1N34 O;  4JI7 O;  2CGO A;  1Q6I A;  4GYC B;  1BZK A;  3RYF B;  1RPR A;  4LH7 A;  1VQ4 V;  1N34 B;  3H1I H;  4JI7 B;  3B8M A;  3IC7 A;  4MVZ A;  4JI8 O;  1W2B U;  2YIC A;  4X65 O;  5JH7 B;  5IT9 N;  2EZP A;  2ADQ B;  4LP8 A;  2X6A A;  1AJP A;  2H8P C;  4GX0 A;  4DV0 O;  4JI8 B;  5EYP B;  1R6T A;  1M1K W;  4I9W A;  4X65 B;  1SKV A;  2YIB A;  4LF5 B;  3OMA B;  2JS3 A;  4JZ2 A;  1BHA A;  4HNA A;  1WA8 A;  3K08 A;  2XT9 A;  4FLX A;  5H6R A;  1S3J A;  4DV0 B;  1QVG U;  2Y0I A;  4X9Q A;  2ZXW C;  2QKS A;  3SGI A;  4FZ1 A;  1MSW D;  3DTU B;  2Y69 B;  2W0F C;  5GTH Z;  2A0L A;  1BGY H;  1JR9 A;  2JJ1 G;  2K1E A;  2Q9L A;  4J41 A;  4IT5 A;  4O2B A;  3FX7 A;  4MVM A;  2ZD9 A;  1OCZ C;  1L0N H;  1OCR C;  4DV1 B;  1IDS A;  2CTP A;  3ZMT A;  2WSS G;  2XOK G;  3WB1 A;  5GTI Z;  1WAZ A;  2HKO A;  4TUY B;  3JAM N;  1EZV H;  4JTD B;  3H1L H;  1JVM A;  1K97 A;  3B77 A;  5EIB C;  4U7O A;  1CEZ A;  5CA3 A;  2MW2 B;  2Y4T A;  3K5M A;  2WA3 A;  1Q5O A;  5H6Q A;  3W7U A;  2EBO A;  4LF4 O;  2LFS A;  4LFC O;  5DEC A;  4FLW A;  1F4N A;  2HJD A;  4UCT A;  1GTO A;  4LWS A;  4B3S B;  4O4I A;  1ORQ C;  5BXZ A;  1GMG A;  1SQQ H;  3OGC C;  3ZMV A;  1S76 D;  4LFC B;  4DR5 O;  3BRC A;  5B1B B;  5LP6 B;  3CJH A;  2QM4 A;  3QNE A;  3F7Y C;  3LDE A;  4JF3 A;  3FAV B;  2XAG A;  4L87 A;  4UV9 A;  2P67 A;  1FS0 G;  2E75 B;  4DYL A;  3SYC A;  1Q90 D;  4JZG A;  5LA6 A;  1JMK C;  2QWP B;  1M56 B;  3L75 H;  2YEV A;  3H9V A;  2E74 B;  1R3K C;  1EN6 A;  1FKA O;  1JA8 A;  1MMM A;  2A06 H;  3OR6 C;  3L9D A;  5L3F A;  5LYJ B;  4JGS A;  3A8T A;  1WN7 A;  1N32 O;  1E79 G;  2AW9 A;  2VWK A;  1XDC A;  2N04 A;  4IL6 Z;  1EM1 A;  4TWK A;  5KHK A;  1GN2 A;  4YY3 O;  2XAF A;  4K8Z A;  2F95 B;  3ABM C;  2UXB O;  5B5E Z;  2Z3Y A;  4PA6 A;  3B8N A;  2KSD A;  1DTO A;  2DYR B;  4YIP A;  2N74 A;  4X1I A;  5KMG A;  4FFK A;  3WU2 Z;  3ZIA G;  2VRZ A;  1W59 A;  4GZR B;  3QG5 A;  4EFB A;  1I08 A;  3IGA C;  3SPJ A;  1L8D A;  4DW0 A;  1YSC A;  3CX5 F;  4PHZ A;  4FM2 A;  3D3Q A;  2UXN A;  3QVN A;  3CCM V;  2WA4 A;  5ITZ B;  4CC6 A;  1NTK H;  4UCU A;  3D3I A;  1I94 O;  4O4J A;  4PI0 A;  2Q8V A;  4BR6 A;  1WPX A;  3ABK C;  1UFI A;  3OW2 U;  1TVK B;  4FM1 A;  4O4H A;  1JX9 A;  4YJ3 A;  2ODM A;  5CN0 A;  1GRJ A;  1VQ5 V;  2IM9 A;  1Y66 A;  4PDR A;  1H8H G;  4OPA A;  4GUN A;  2V4D A;  2IJJ A;  1OZ0 A;  3AK3 A;  1N36 O;  3RYF A;  2GTA A;  1Q7Y W;  1IBK O;  1PL4 A;  1TGO A;  2IH1 C;  3SYQ A;  3L73 H;  2YUA A;  2EZO A;  3JD2 A;  5F2V O;  5JH7 A;  1LR1 A;  1VQO V;  2L6L A;  2EIK C;  3AK1 A;  1M93 A;  4FVM A;  2ITD C;  2WLN A;  4X20 B;  2Q67 A;  1UPG A;  2JEX A;  4QJF B;  5EYP A;  4BAY A;  2HEP A;  1JJO A;  5EBW C;  3W7X A;  1RPO A;  5EBL C;  1B06 A;  3JD4 A;  2XAJ A;  3E8B A;  3WB0 A;  3UO3 A;  1YJN V;  4Z1M G;  2F93 B;  3CSX A;  2JK5 C;  3WFV A;  3F5T A;  2VS0 A;  1HR0 O;  1M57 B;  1Q6H A;  1XHX A;  2E3C A;  3HPL C;  3ZMU A;  1BSM A;  1OCO B;  2ETN A;  1H38 A;  3LSQ A;  4X1K B;  2GTS A;  5IJ9 B;  3K59 A;  2DYS C;  1V54 B;  5HFL A;  1HNX O;  1COW G;  4J9Y B;  3K9A A;  1XIL A;  3H1K H;  4FPP A;  4QIW F;  3EVK A;  2DMX A;  3W7T A;  4UXN A;  2XHB A;  1DF5 A;  3ABT A;  4J7J A;  3MHS C;  1AI4 A;  4LCU C;  1HNX B;  1R1B A;  4TUY A;  2YS8 A;  3TCU A;  2MK3 A;  3GWK C;  1U97 A;  3IC9 A;  2BTO A;  4CS4 A;  1WLE A;  1NS1 A;  4KUM A;  3CHX A;  5L3B A;  3I5D A;  1NVP B;  1SES A;  3P3P A;  4WFG A;  1IUR A;  3CCQ V;  5FNV B;  1HNZ B;  2NR5 A;  5IY5 B;  2QDO A;  4DV7 B;  4DR1 O;  4B7K A;  2P06 A;  4I55 A;  2WWW A;  4UCV A;  2WLK A;  4JPR A;  3CCJ V;  5LP6 A;  3SJB C;  1YEW A;  1YTF B;  2DQ0 A;  4U3F H; 
#chains in the Genus database with same CATH homology
 4W4K A;  2G38 A;  4J11 A;  3FX7 A;  4IYH A;  4J7K A;  4J10 A;  4J41 A;  2GTS A;  4W4L A;  4J42 A;  4IYI A;  4KXR A;  4J7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...