4J11A

The crystal structure of a secreted protein esxb (wild-type, in p21 space group) from bacillus anthracis str. sterne
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
NAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECRETED PROTEIN ESXB
publication title The Crystal Structure of a Secreted Protein Esxb (Wild-Type, in P21 Space Group) from Bacillus Anthracis Str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 38
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j11A00
4J11A 4IYIA 4W4KA 4KXRA 4J42A 4IYHA 4J10A 4J7JA 3FX7A 4J7KA 4W4LA 2G38A 2GTSA 4J41A
chains in the Genus database with same CATH superfamily
5JQGA 3ZHSA 1VQ4V 3UQ8A 2ZDIC 4EEQA 4K8XA 2QEXV 1V54C 1YJ9V 2L6LA 5F2VO 1FFXA 3SYOA 2EILB 3BHPA 2JS5A 1GRJA 2HLDG 5JCOC 1BHAA 1M56B 1NI8A 1OCRC 1PNLA 5FPRA 3JARA 4RWUA 1I08A 2LJ2A 4GZRB 4LFCO 1OCCC 1ENVA 2P4KA 4ASUG 4R8CA 3MHHC 2F4VO 2B1IA 4ZOLB 4J7JA 4G28B 4LF4O 3ZIAG 1YDXA 4FK5C 4YHHO 1AROP 2ILMA 4FM0A 4RUEA 1VQMV 1Y76B 4DK1A 1M4UA 2E74B 1OV9A 4LWSB 1XMOB 4LF5O 1H2KA 4B3MB 4K0KO 1N36B 3LNNA 2FYUH 2KSDA 1VQ8V 5CB4A 1R3JC 4O4JB 4DUYB 5JH7B 4X1IA 3AG2C 2F43G 3OR6C 4IHJA 1KBHA 1IBLB 2YSUB 2QE7G 3HPLC 5EYPB 5B1OA 4U3JA 1V55C 2IU0A 3E89A 3CC7V 1V54B 3H1HH 3GVMA 5LBQA 1M9NA 4PI0A 3ZRWB 2GHYA 2EX3A 3AK1A 4B7KA 4NXMO 1SF9A 5CA1A 4UB8Z 1S77D 1OCRB 3THOA 1HWYA 2PF4E 2DYRC 1Y74A 2Q4PA 1S0VA 2ZINA 2ZIOA 3IFXA 2JEXA 3N2KA 4P9OA 2F66C 1J5EO 3CMAV 1Q3EA 3CRMA 4X1YB 1H2GA 4JI0O 4B7EA 3K59A 1AR4A 3T2MA 2D3OW 2N04A 1NTZH 4JV5O 4LBEC 1JX9A 3CRCA 3RT3C 1TAEA 3T1HO 3P30A 1BHBA 1U97A 3L73H 4CH5A 3RYCB 2KG7A 2ETNA 4DR6B 2BCCH 2LW7A 3ZHTA 1DK1A 4J10A 4YJ2A 1FXKA 1AI4A 3F5WC 2P67A 3OEHG 3LSQA 1K92A 1NQTA 2PYJA 4JTCB 1V55B 3ICXA 3IGAC 4NXNO 3VOUA 4NKGB 2WLNA 3CSXA 4C7UA 3VBBA 4JI1O 5DECA 1P49A 1PL0A 4I4TA 3CE2A 5IE9A 4QE7A 4EFBA 4OPHA 3CCEV 2WLLB 1NTKH 3A0BZ 4PA6A 4DW0A 3FAVB 4CBCA 4LFCB 1ZL8B 1WP8A 4UV9A 2F4VB 4XBFA 1K4DC 2IJJA 4PDLA 1BMFG 2A7WA 4LF4B 1SQVH 4B08A 3W7SA 5LL6Y 3CJHB 4HBNA 1XL6A 4YHHB 2H3OA 5IJ0A 1AI7A 1DTOA 1SC5B 2IJIA 2A9HA 4LF5B 4K0KB 2R70A 5TISZ 5D5PA 2UUBO 3OTOO 3JAWA 4MVUA 3CRRA 3DC5A 4DUZO 4LF9O 1H2SB 3RGBA 2JVDA 1I7FA 2Q67A 2JEUA 4Q20A 1JJOA 3L74H 3SJCC 3RYFB 4DRXB 1I94O 1R3KC 2DW4A 2BTOA 2AHZA 3RN4A 3ZN0A 4IYHA 3UKMA 4X89A 1GN6A 3BPZA 2CTQA 2PYLA 2UXCO 3CMEV 3K5NA 2EIJB 4NXMB 2ZNJA 1M1KW 2DWEC 5B5EZ 3D36A 3G80A 4X65O 4F6RB 1M90W 3K3WA 3CS5A 4ZHQA 2QKSA 4X20B 1L8DA 3SR2C 2F93B 1J5EB 5KA5A 3KZIZ 2XTAA 4FLUA 1JCHA 4JI0B 1IX9A 3J81N 1L0LH 5H9CA 4JV5B 1YZBA 5K1XA 2N05A 3B77A 4ZIBA 1K3EA 3R66A 2R9RB 3T1HB 3SPCA 4YXWG 1N0NA 3ABLC 5LP6B 1VMGA 2XASA 4TWKA 4XDKA 2RNBA 3ZHQA 2CGNA 4DV3O 4CH4A 1YSCA 1MSWD 4DR2O 2YI9A 3K0GA 1GH6A 3Q4HA 3FB7C 1A32A 1S3JA 5L3CA 4BR6A 5IT9N 1SZXA 3CP1A 2XT9A 4NXNB 4WFGA 4MVQA 1UFIA 3OT7A 4NYKA 3CWBH 3VQYA 1VP7A 2Q6AA 1I5YA 4X8AA 4JI1B 5LHGA 2JDIG 3JD4A 3HB3B 1VQ7V 3FAVA 3L9DA 2ITCC 1NZ6A 2DJVA 1IXBA 5H6QA 4O2BA 2AZ0A 1Q43A 4LF8O 1FXVA 3N2GA 1N32O 4HNAB 1NKDA 3RFRA 4AHCA 1EN5A 2W0XA 2L35A 3UCSC 1XL4A 2H8PC 2QWRB 1FPOA 1P7GA 2CH7B 2Y69C 4DK0A 1B06A 4FJCC 2YIBA 4DV6O 3C3TA 1GM7A 1BSMA 4TV9A 4FLWA 1JOYA 4JI4O 1S5LZ 1TUBA 1U96A 2YEVB 3ABLB 3E8HA 2ZR2A 4I55B 4R50A 4L87A 4PA7A 1XI1A 5EIBC 2UUBB 3OTOB 2HVKC 3G6BA 4DUZB 3AG4C 4LF9B 1BE3H 4IL6Z 2DMXA 1B04A 4LNUB 1M57C 1YTFB 4UCRA 1R1BA 3D3IA 1I94B 1XREA 2E75B 4PDRA 2UXCB 5B1AC 1O9HA 3S3WA 1E79G 2X7RB 4I7ZB 3H1JH 5CN0A 1BZKA 1W2BU 3QO8A 5LMNO 1SQPH 1ORQC 5KX5B 4JGSA 3RW0A 4X65B 1SQFA 3E22A 1AJNA 1W59A 3W7TA 5EBMC 3ZHRA 4P2ZA 4RAIA 1Q90D 4JI5O 3IC7A 2Y69B 3TJTA 1WP7A 2ZT9B 1KYOF 1SETA 2PUSA 3BA9A 3OMNB 1J95A 1JJ2U 2OIGA 2WLJA 2W6JG 3JAKB 5LP6A 3T4DA 4FPPA 3SYPA 4YJ3B 4F6EA 1RPRA 3M7MX 1IURA 4B3TO 1SS3A 5LHHA 5LOVB 4DV3B 2R9IA 1HNXO 1M57B 4DR2B 3QTCA 2GDSA 1ROPA 2ZNIA 5J2UA 1WN7A 1M93A 5LA6B 4Z2WA 4IIJB 1SQXH 3U11A 2EZPA 1ZUQA 2XAQA 3HKCB 5B1BC 5BZBA 1QBZA 4WCEV 2XHBA 2DYSC 5IWAO 2EIMC 3E8GA 3K5OA 4JI8O 2ZE7A 3HKBA 4LF8B 1D5NA 4RO2A 3S3XA 2QWQB 3ZHUA 1F7YA 3E83A 2UU9O 1S5JA 1YHQV 5EZYA 3K9SA 2VQEB 1W0KG 5IY5C 3APQA 2ZIMA 4DV6B 3ABMC 5JVDB 4TSFG 3E2EA 2V7QG 1QLEC 1SQBH 4I55A 1K5SA 3H01A 4PELA 4FLXA 3X2QC 1QVFU 4JI4B 1MMMA 3CRQA 1MA1A 1MG1A 4KUMA 4K8ZA 3AK3A 1KP2A 2HFEC 5EIBD 3RWRD 1BQ0A 2WLIB 2XOKG 3CCMV 5KAFZ 3ZMZA 4IT5A 1MOFA 1T5EA 2CAZC 4R7CA 3P3NA 3TXQA 4H33A 1VF6C 5B1BB 2B5UA 3ML0A 2FTKA 3FB6C 4I0XB 2JJ1G 3ZJZA 4OX9O 2E3CA 5LMNB 4PA3A 1D2DA 4TUYB 1PD3A 1KQSU 1OCZC 3H1IH 2DYSB 4KXRA 2LP7A 1D5AA 4DYLA 2BE3A 4CC5A 1E1RG 4X62O 4NR1A 3OUSA 3DC6A 4JI5B 3ABKC 3OW2U 1F4NA 3ZMVA 2IH1C 3K0DA 1EFRG 3AEIA 5LHIA 1HW7A 4JF3A 1QLEB 4X64O 3STLC 2QKAA 2X6AA 1QR9A 3ZX6A 2WWWA 2JJ2G 4MVRA 4UVAA 3ETEA 3FKSG 1IXMA 3SGIA 4B3TB 4P9PA 4MW3A 2VWKA 1VQLV 3B2EE 1HNXB 3LUTB 1KKDA 4BIUA 2FL4A 3FX7A 4O2AB 3FB5C 4Z1MG 3ZMSA 1MZEA 2LQTA 4PHZA 1EN4A 2YXYA 2QWPB 4XDLA 1CXZB 1VARA 2WA4A 2LFSA 4UB6Z 2AW9A 1SA0B 4MT8A 1THZA 1ZTEA 2QGNA 3UO2A 4BW9A 5ITZB 4ZBMA 4BWAA 3WG7B 5FNVB 3CRAA 1LUVA 1JA8A 5IWAB 4TT3G 3R65A 4JI8B 2Q8VA 4CH6A 4DR7O 3D36C 4L8JA 5GONB 2X0LA 1TUEB 3WB1A 2UU9B 1NT2B 5JVDA 1RM1C 1YEWA 3UT5A 1NH2D 3P3PA 4QPJA 1PKXA 1COWG 2X6BA 4JZGA 5IJ9A 2OCCC 2M6YA 3C90A 3HKDA 2BSKA 2B9ZA 2WLIA 2C2AA 5BMVB 5KUKA 4RUFA 2KQXA 5L3GA 5E79Z 2E76B 3OD4A 4B3SO 3EVKA 5H2FZ 1OHHG 2PGGA 1AP5A 2Q69A 1XNQO 1OCCB 5C8YA 1IDSA 3OTFA 3GWOA 4JAUA 2GTAA 2A06H 3EFFK 4LP8A 4OX9B 4LF6O 2UXNA 1ZSPA 1K8AW 3STZC 4CS2A 2HJFC 2VQFO 2DN9A 1FYJA 3EHBB 4O4HB 4J9ZB 1JFFA 4X62B 2GTSA 4JYBA 1VF5B 1NS1A 2Q68A 2NN4A 4ICGA 2JIZG 2HHHO 4X64B 3AG2B 1NR7A 3ETGA 3DXRB 3L72H 3LSUA 2A0LA 3H1LH 2QTSA 4FLVA 4HYOA 3EXAA 1NU1H 3JCZA 5LGTA 4OGQB 4ZKIA 2DWDC 3JALB 1OCOC 5KMGB 3LDCA 1AP6A 4O2AA 2XAFA 3FFQA 2JS3A 4CS4A 1XEQA 2DYRB 2Q9LA 3TXSA 1FXHA 4U7NA 4DXWA 2YIDA 3VQVA 4J11A 2Q7HA 3A0HZ 1MABG 5IDJA 1RSOB 1HR0O 4MVOA 4Z1VA 1K34A 5CA0B 4ZOLA 5ITZA 2FB5A 5HFLA 1K73W 1Q8IA 3QNEA 4KP4A 2QTOA 1Y76A 1LNQA 3WU2Z 1JR9A 4LWSA 4DR7B 4CC6A 1WAZA 4AI8A 1Q81W 4F4LA 3T4ZA 3OUFA 3E35A 4O4JA 5JH7A 4UVCA 3P32A 2OTLV 4I9WA 5CBGA 1S72V 4FM2A 5J2TB 2IBZH 3SYQA 2ZDIA 5EYPA 1Y66A 3ABTA 4X66O 2ZXWC 4DV5O 3ZRWA 5JCOA 1WPXA 3JD0A 3CCQV 1EBOA 3G4SV 3FYIB 5B3SC 3HKEB 4B3SB 3OMAB 3C3SA 2JGDB 3QO7A 1XNQB 2OYQA 3UM7A 4DR4O 4W4LA 4X1YA 2PTMA 3K79A 4BW5A 4UVBA 2OT5A 4DR5O 1XMQO 4OXSA 4LF6B 4J80A 4GT1A 2EZOA 5H6RA 2Y48A 1QU7A 2VQFB 4P30A 1TGOA 4O4IB 1QQCA 2Y0PA 3RYCA 1E1QG 2ZE5A 3CB2A 1NTMH 2K1EA 2QR4A 1NBMG 5B66Z 1XUQA 3LDDA 4GYCB 4FFBB 3ZHVA 3CXHF 2Z3YA 4TQDA 3G6EV 1GN4A 3KG2A 2HHHB 1JPXA 1TVKB 4LCUC 3JSNA 4B3RO 1IZ3A 2WLKA 2DE0X 1US6A 1Y6XA 1VQPV 1QHTA 1X4TA 3JALA 2GUZB 2UXXA 1EZJA 3CPWU 2YIBD 4ABMA 3PJSK 4J9YB 4DV1O 1GM8A 4PDMA 3SPHA 1Y4MA 4EB6B 3BFRA 5AG2A 2O57A 2WLLA 4K3AA 4UFZA 2FMLA 1B6QA 2YICA 3MD0A 5IYZB 3IJ4A 1AR1B 1BS3A 5LGNA 3CCUV 3ZMUA 1YJWV 3B4SA 1K9MW 2AZ2A 5JWPA 2PZSA 3SPJA 4FVMA 1ZL8A 3ABUA 3N27A 4NTWA 3TK1A 3VQXA 1HR0B 4X1KB 3G71V 3F5TA 2PY5A 3CJHA 3CCJV 4KL1A 1XILA 2MK3A 1N34O 2P22C 2DQ3A 1H2MA 3RYIB 3UO3A 2Q73A 2N74A 2LW1A 4TV8B 1XDCA 5LMUO 5CBFA 4WFFA 1AB3A 4WFBV 1PL4A 5D5QA 2VS0A 1IVSA 3OGCC 1H38A 2KKWA 4QJFB 3RYFA 4DRXA 4DW1A 1SKVA 1EN6A 2BTQB 4I9QA 4X66B 3OFNG 1HNZO 5IYBO 4DV5B 2YI8A 2ADPA 3W7XA 3I5DA 1N8RW 1GO3F 4MTXA 5KHHA 1HDJA 3BRCA 3SYAA 2F23A 3SDLA 4MW8A 5KHJA 4F6RA 4DR3O 2JGDA 4X20A 1S5HC 4HZ3A 2JRIA 1AJQA 3BCCH 2R72A 2QSAA 2RQ6A 4LFAO 1Q6HA 4D7TA 4DR4B 2NNUA 2XNDG 4YIOA 3LDEA 3I55V 1XMQB 2QM8A 2QM4A 3CCRV 4O4IA 1WJZA 3ETQA 5K1PA 4JYYA 1GM9A 1BCCH 2QWNB 2HEPA 3AG3C 4GX0A 1TVKA 4DV0O 4FLZA 2AXTZ 1N0JA 3JASB 1VQ5V 2IJKA 2W0FC 1P4RA 4B3RB 3AG4B 5L3FA 5LXTB 5KHIA 1SERA 2YXHA 4ZI7B 4LH6A 1YITV 2ATKC 3E8FA 4J41A 5B1AB 2ZKOA 5EC2C 5IYZA 4K35A 3QVNA 3CXCU 4DV1B 5JQGB 1F51A 3WB0A 1NVPD 2LGQA 2H94A 3OM3B 1Q5OA 4CH3A 2ZQMA 4JI2O 4HNAA 2BOCC 1FFXB 3BABA 1BL8A 1IBKO 2ZR3A 1N32B 2MW2B 5A9GA 1VQNV 2HR3A 3K08A 2CH7A 3DSQA 3SJBC 1H2LA 3K03A 5GTHZ 4TV8A 2UXBO 4JPRA 1N34B 2XAJA 3ZRXA 3TETA 3AG3B 3O65A 2YEVA 2VWJA 3U10A 5LMUB 2YXLA 2WLMA 1NR1A 4MSWC 2ADQB 3ZRSA 4JTAB 4PD4F 1MZFA 2BTQA 4LNUA 2ODMA 4QE9A 3K5MA 2Q0OC 4WFHA 5FLXN 2WAMA 5CB4B 1HNZB 4X1IB 3ASNC 3A8TA 4FFKA 1FXKC 1GKFA 3HR0A 2NLJC 1QCEA 5FL7G 1YIJV 4IHJB 4H44B 1KKCA 1O9GA 5KX5A 1WLEA 4DR3B 3CCSV 3B8NA 2EIMB 5CA1B 2EILC 4J7KA 2Q7GA 4H13B 1B3QA 4LFAB 1SESA 1Y74B 4GX5A 4N23A 1KU9A 2JGUA 2Q0AA 3K5LA 4MVSA 2CTPA 3DGEA 5IY5B 1NH2B 1RFYA 3N2KB 3ABMB 3JAMN 3JAKA 4PDVA 1KECA 4FMTA 5A2QN 4LFBO 3X2QB 2CK3G 4YJ3A 3SYCA 4AQYO 5GTIZ 1OJHA 4MS2A 4DV0B 2UUCO 2HVJC 2B1GA 5LOVA 3B40A 3OGIB 4FLTA 4UCSA 1Q7YW 5E1AC 4PJ0Z 4UCUA 2OTJV 4O4LB 2LFRA 3CC2V 3WFVA 5LA6A 2GSMB 1AVMA 4CS3A 3T1YO 4IIJA 5KLVH 3ASNB 4YJ2B 1FXKB 3J80N 3DTUB 3OE7G 3HKCA 4E2LA 1VQOV 1Q82W 5EK0A 1YI2V 3KKYA 1XHZA 1S76D 1OCZB 3ZEDA 1Y67A 4MVZA 2QWOB 4NVPA 5C93A 1G6UA 2OCHA 1DGSA 1FJGO 4I4TB 3ASOC 2YS8A 2ITDC 4JI2B 1URFA 5IYDO 3QF7A 1P84F 1IBKB 1K7DA 3B8MA 3ABKB 1PPJH 2IH3C 1FS0G 2HP8A 2V4DA 2R9AA 3A0RA 2ZD9A 5LYJB 4XDJA 5L3BA 1WB7A 2UXBB 3K58A 2UUAO 3L71H 2KB1A 1KD1W 4MTFA 3H9VA 4UUJC 5EBWC 2YC0A 2P06A 3AG7A 2XAGA 1XOUA 1AILA 2YDEA 1QNMA 5IJ0B 2DOSA 1CP9A 3K9AA 2ZE6A 2GV9A 5KHKA 1GN2A 2FKXA 2WA3A 4DV7O 2W6IG 1R3LC 3JAWB 1JVMA 4I0XA 4FIPC 4TUYA 2LGWA 4NTXA 2ARHA 3ASOB 2QA4V 1PNKA 3MAQA 3KCXA 3JD1A 2WPDG 4TOIA 2G38A 4IGGA 2Y0IA 4GKKO 3MDSA 1SQQH 4QPKA 1RM1B 4ZHQB 2EJ7A 4GUNA 2Z0AA 3SJQC 1SRYA 2M7WA 4LFBB 2OCCB 1FAFA 1YJNV 3ZBHA 1PM9A 2A3QA 3CD6V 2PI5A 4AQYB 2AGAA 2JK5C 4JI3O 2WSSG 3E8BA 5LGUA 4QIWF 1HNWO 2UUCB 4DR1O 4MVMA 3CYOA 4O4LA 1VF6A 1XQ8A 1LUWA 3F7VC 2EBOA 4FZ1A 1R6NA 4NB5A 2CDYA 3T1YB 2F95B 1BT8A 1W0JG 1SA0A 3Q4HB 2HKOA 1CPYA 4G2KA 3L75H 4UCVA 1M5IA 5FNVA 2QDOA 2YIAA 4W4KA 3I56V 3K57A 2EIJC 2RDCA 4UCOA 1FJGB 4J42A 4D7SA 4TQFA 1VIBA 1R6KA 5GONA 4WFAV 4JASA 4UXNA 1Q6IA 3ZCCA 5LYJA 1YCIA 1H2NA 2OIEA 5BY1A 4WF9V 3JD2A 4JYCA 1R3IC 4O2BB 4QNHB 1NJIW 3N2GB 2HJDA 1L1FA 1LR1A 2UUAB 1VQ6V 1N4CA 1SQGA 4X9QA 5IYCO 2HG5C 4PA4A 5DEDA 3WB2A 3BY6A 1XNRO 3E86A 3T1CA 4GKJO 2LO1A 2RN9A 2OWOA 1OCOB 5BMVA 3IAYA 3BVOA 4TV9B 1JMKC 3OMIB 4U3FH 4X88A 1TUBB 4E4EA 1Q6UA 1ZX3A 5LP6C 1GMGA 1KC8W 4LF7O 2CTRA 4GCZA 1IBMO 3NXSA 4BAYA 1AI6A 3OAAG 5BXZA 4DV7B 1AR5A 1RPOA 5H5NA 2QM7A 5CBHA 3H1KH 3U0ZA 2E5LO 4JZ2A 4KFMA 2QJ1A 2CTWA 4WFEA 4GX2A 2XUMA 1L0NH 1EZVH 2Z5UA 1HP8A 1UPGA 1R6TA 4O4HA 3RYHB 2RJZA 4GKKB 4JI7O 3APOA 2P7TC 2P90A 3E22B 4MTGA 3M99B 3DXRA 5L3DA 1EM1A 1I0HA 1ZLZA 1AI5A 1AJPA 3KCYA 1QVGU 2PI4A 4WBNB 5L3EA 4LH7A 3ZS8C 2D2CB 4UCTA 1WB8A 2ZXWB 3JCUZ 5KMGA 1N33O 4JI3B 1HNWB 4DR1B 5KHGA 3LNMB 1CEZA 1Z2GA 3F7YC 5B3SB 1X59A 3D8CA 4J7ZA 5CA3A 4NTYA 4DV2O 1H8HG 5BR8O 4PI2A 1RSOA 3FYEB 4EFEA 5CMUA 4AILC 4UV8A 5CA0A 3B09A 4RQEA 4JI6O 5FPOA 1MSDA 3L70H 2BOBC 1BGYH 5J2UB 3VQWA 2Y4TA 5DM6V 1QLNA 1FD9A 2ZM6O 2IW5A 1WA8B 4DV4O 4FLYA 1G1XB 1WPBA 2K9PA 4A5UB 3BEHA 1KP3A 3AG1C 1WNSA 3FB8C 2IU3A 3HKBB 5KA6A 4YY3O 1FFTB 5DN6G 5J2TA 1F4MA 2VQEO 3RVZA 2IJHA 2EIKC 4RQFA 5EZYB 1SZTA 3JATB 1XNRB 3ZN1A 3ETDA 4GKJB 4LC1A 3M8AA 4BIOA 3CCLV 1NVPB 4EKWA 4JYAO 3HKEA 1PNMA 4JAAA 3AK2A 1F23A 4LF7B 1IBMB 3RVYA 1MNGA 4JAVA 2P5OA 1JQ0A 1GTOA 3CHXA 4I5SA 3CCVV 2VRZA 4YIPA 1YF2A 4Q6GA 2EULA 4I50B 4U7OA 1K97A 2E5LB 1K33A 4QGPA 4GX1A 1P7BA 2ZCEA 4DR5B 2V1DA 1XHXA 4KHPO 3RYHA 2CGOA 4MTOA 3SPGA 2P4VA 3A2FA 2DQ0A 3AG1B 3K04A 4FFBA 4JI7B 4IYIA 1GAXA 4N21A 4H37A 1VEWA 4WBNA 2EJRA 3MHSC 2EIKB 1Z5WA 3RBZA 2UXDO 3ZRVA 2GUZA 3NR7A 1YXBA 2Y4UA 1N33B 3GB7C 3JSLA 5HFMA 4EB6A 3D3QA 2Q7EA 3LSSA 2ZE8A 3CEIA 5KUMA 1KB9F 1DLBA 3G67A 2P6JA 2YUAA 4DV2B 2A79B 5BR8B 5KAIZ 4X1KA 2QKCA 1G8MA 5B1NA 3PN1A 3CC4V 1K5QA 2X6CA 4JI6B 1YTFD 5JJEB 4D6TH 1ZAUA 1UJWB 1WA8A 1G4YB 3RYIA 3JARB 2ZM6B 1KUQA 4DV4B 1I5XA 2XAHA 1H8EG 3K06A 4PA9A 4GLXA 5EBLC 3TGUH 2CUGA 4CZZA 4G27B 2GBOA 4YY3B 3JYCA 1XMOO 4B3MO 2EINC 3CX5F 5JJNB 1KMIZ 1N36O 4OPAA 1DF4A 3JATA 1PV0A 1ZWIC 2IM9A 4DUYO 1R73A 4HAMA 3UT5B 1IBLO 1Q86W 3BAAA 1XBLA 5IJ9B 2WLHA 1GK9A 1PP9H 4FM1A 4DO2A 3HKDB 2BSKB 4JYAB 2CE4A 2AHYA 4R6ZA 4U3JB 2F1MA 5J9PC 2NR5A 2RMKB 3BA8A 4I50A 2Q5ZA 5EC1C 3W7WA 2RCVA 5JJJB 1M56C 4JTDB 1GN3A 5GW7A 3OR7C 1YVWA 5C8YB 4KHPB 1BQZA 3O9OA 3SJAC 3W7UA 3IC9A 3OEEG 3QG5A 3WG7C 3JD3A 4BIZA 3J7AU 3GWKC 3JASA 3FD9A 2EINB 1K4CC 5LXTA 3QO5A 3TCUA 4DR6O 4H0LB 1JFFB 4ZI7A 2UXDB 3SPIA 3ZMTA 1Z5VA 1DF5A 2KG7B 1RP3B 4LR3A 1TA8A 1OZ0A 4PV1B 1FKAO 1QR8A 1VF7A 4FZ0A 1VQKV 1VQ9V 1V9PA
chains in the Genus database with same CATH topology
4J11A 4IYIA 4W4KA 4KXRA 4J42A 4IYHA 4J10A 4J7JA 3FX7A 4J7KA 4W4LA 2G38A 2GTSA 4J41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J11 A;  4IYI A;  4W4K A;  4KXR A;  4J42 A;  4IYH A;  4J10 A;  4J7J A;  3FX7 A;  4J7K A;  4W4L A;  2G38 A;  2GTS A;  4J41 A; 
#chains in the Genus database with same CATH topology
 5JQG A;  3ZHS A;  1VQ4 V;  3UQ8 A;  2ZDI C;  4EEQ A;  4K8X A;  2QEX V;  1V54 C;  1YJ9 V;  2L6L A;  5F2V O;  1FFX A;  3SYO A;  2EIL B;  3BHP A;  2JS5 A;  1GRJ A;  2HLD G;  5JCO C;  1BHA A;  1M56 B;  1NI8 A;  1OCR C;  1PNL A;  5FPR A;  3JAR A;  4RWU A;  1I08 A;  2LJ2 A;  4GZR B;  4LFC O;  1OCC C;  1ENV A;  2P4K A;  4ASU G;  4R8C A;  3MHH C;  2F4V O;  2B1I A;  4ZOL B;  4J7J A;  4G28 B;  4LF4 O;  3ZIA G;  1YDX A;  4FK5 C;  4YHH O;  1ARO P;  2ILM A;  4FM0 A;  4RUE A;  1VQM V;  1Y76 B;  4DK1 A;  1M4U A;  2E74 B;  1OV9 A;  4LWS B;  1XMO B;  4LF5 O;  1H2K A;  4B3M B;  4K0K O;  1N36 B;  3LNN A;  2FYU H;  2KSD A;  1VQ8 V;  5CB4 A;  1R3J C;  4O4J B;  4DUY B;  5JH7 B;  4X1I A;  3AG2 C;  2F43 G;  3OR6 C;  4IHJ A;  1KBH A;  1IBL B;  2YSU B;  2QE7 G;  3HPL C;  5EYP B;  5B1O A;  4U3J A;  1V55 C;  2IU0 A;  3E89 A;  3CC7 V;  1V54 B;  3H1H H;  3GVM A;  5LBQ A;  1M9N A;  4PI0 A;  3ZRW B;  2GHY A;  2EX3 A;  3AK1 A;  4B7K A;  4NXM O;  1SF9 A;  5CA1 A;  4UB8 Z;  1S77 D;  1OCR B;  3THO A;  1HWY A;  2PF4 E;  2DYR C;  1Y74 A;  2Q4P A;  1S0V A;  2ZIN A;  2ZIO A;  3IFX A;  2JEX A;  3N2K A;  4P9O A;  2F66 C;  1J5E O;  3CMA V;  1Q3E A;  3CRM A;  4X1Y B;  1H2G A;  4JI0 O;  4B7E A;  3K59 A;  1AR4 A;  3T2M A;  2D3O W;  2N04 A;  1NTZ H;  4JV5 O;  4LBE C;  1JX9 A;  3CRC A;  3RT3 C;  1TAE A;  3T1H O;  3P30 A;  1BHB A;  1U97 A;  3L73 H;  4CH5 A;  3RYC B;  2KG7 A;  2ETN A;  4DR6 B;  2BCC H;  2LW7 A;  3ZHT A;  1DK1 A;  4J10 A;  4YJ2 A;  1FXK A;  1AI4 A;  3F5W C;  2P67 A;  3OEH G;  3LSQ A;  1K92 A;  1NQT A;  2PYJ A;  4JTC B;  1V55 B;  3ICX A;  3IGA C;  4NXN O;  3VOU A;  4NKG B;  2WLN A;  3CSX A;  4C7U A;  3VBB A;  4JI1 O;  5DEC A;  1P49 A;  1PL0 A;  4I4T A;  3CE2 A;  5IE9 A;  4QE7 A;  4EFB A;  4OPH A;  3CCE V;  2WLL B;  1NTK H;  3A0B Z;  4PA6 A;  4DW0 A;  3FAV B;  4CBC A;  4LFC B;  1ZL8 B;  1WP8 A;  4UV9 A;  2F4V B;  4XBF A;  1K4D C;  2IJJ A;  4PDL A;  1BMF G;  2A7W A;  4LF4 B;  1SQV H;  4B08 A;  3W7S A;  5LL6 Y;  3CJH B;  4HBN A;  1XL6 A;  4YHH B;  2H3O A;  5IJ0 A;  1AI7 A;  1DTO A;  1SC5 B;  2IJI A;  2A9H A;  4LF5 B;  4K0K B;  2R70 A;  5TIS Z;  5D5P A;  2UUB O;  3OTO O;  3JAW A;  4MVU A;  3CRR A;  3DC5 A;  4DUZ O;  4LF9 O;  1H2S B;  3RGB A;  2JVD A;  1I7F A;  2Q67 A;  2JEU A;  4Q20 A;  1JJO A;  3L74 H;  3SJC C;  3RYF B;  4DRX B;  1I94 O;  1R3K C;  2DW4 A;  2BTO A;  2AHZ A;  3RN4 A;  3ZN0 A;  4IYH A;  3UKM A;  4X89 A;  1GN6 A;  3BPZ A;  2CTQ A;  2PYL A;  2UXC O;  3CME V;  3K5N A;  2EIJ B;  4NXM B;  2ZNJ A;  1M1K W;  2DWE C;  5B5E Z;  3D36 A;  3G80 A;  4X65 O;  4F6R B;  1M90 W;  3K3W A;  3CS5 A;  4ZHQ A;  2QKS A;  4X20 B;  1L8D A;  3SR2 C;  2F93 B;  1J5E B;  5KA5 A;  3KZI Z;  2XTA A;  4FLU A;  1JCH A;  4JI0 B;  1IX9 A;  3J81 N;  1L0L H;  5H9C A;  4JV5 B;  1YZB A;  5K1X A;  2N05 A;  3B77 A;  4ZIB A;  1K3E A;  3R66 A;  2R9R B;  3T1H B;  3SPC A;  4YXW G;  1N0N A;  3ABL C;  5LP6 B;  1VMG A;  2XAS A;  4TWK A;  4XDK A;  2RNB A;  3ZHQ A;  2CGN A;  4DV3 O;  4CH4 A;  1YSC A;  1MSW D;  4DR2 O;  2YI9 A;  3K0G A;  1GH6 A;  3Q4H A;  3FB7 C;  1A32 A;  1S3J A;  5L3C A;  4BR6 A;  5IT9 N;  1SZX A;  3CP1 A;  2XT9 A;  4NXN B;  4WFG A;  4MVQ A;  1UFI A;  3OT7 A;  4NYK A;  3CWB H;  3VQY A;  1VP7 A;  2Q6A A;  1I5Y A;  4X8A A;  4JI1 B;  5LHG A;  2JDI G;  3JD4 A;  3HB3 B;  1VQ7 V;  3FAV A;  3L9D A;  2ITC C;  1NZ6 A;  2DJV A;  1IXB A;  5H6Q A;  4O2B A;  2AZ0 A;  1Q43 A;  4LF8 O;  1FXV A;  3N2G A;  1N32 O;  4HNA B;  1NKD A;  3RFR A;  4AHC A;  1EN5 A;  2W0X A;  2L35 A;  3UCS C;  1XL4 A;  2H8P C;  2QWR B;  1FPO A;  1P7G A;  2CH7 B;  2Y69 C;  4DK0 A;  1B06 A;  4FJC C;  2YIB A;  4DV6 O;  3C3T A;  1GM7 A;  1BSM A;  4TV9 A;  4FLW A;  1JOY A;  4JI4 O;  1S5L Z;  1TUB A;  1U96 A;  2YEV B;  3ABL B;  3E8H A;  2ZR2 A;  4I55 B;  4R50 A;  4L87 A;  4PA7 A;  1XI1 A;  5EIB C;  2UUB B;  3OTO B;  2HVK C;  3G6B A;  4DUZ B;  3AG4 C;  4LF9 B;  1BE3 H;  4IL6 Z;  2DMX A;  1B04 A;  4LNU B;  1M57 C;  1YTF B;  4UCR A;  1R1B A;  3D3I A;  1I94 B;  1XRE A;  2E75 B;  4PDR A;  2UXC B;  5B1A C;  1O9H A;  3S3W A;  1E79 G;  2X7R B;  4I7Z B;  3H1J H;  5CN0 A;  1BZK A;  1W2B U;  3QO8 A;  5LMN O;  1SQP H;  1ORQ C;  5KX5 B;  4JGS A;  3RW0 A;  4X65 B;  1SQF A;  3E22 A;  1AJN A;  1W59 A;  3W7T A;  5EBM C;  3ZHR A;  4P2Z A;  4RAI A;  1Q90 D;  4JI5 O;  3IC7 A;  2Y69 B;  3TJT A;  1WP7 A;  2ZT9 B;  1KYO F;  1SET A;  2PUS A;  3BA9 A;  3OMN B;  1J95 A;  1JJ2 U;  2OIG A;  2WLJ A;  2W6J G;  3JAK B;  5LP6 A;  3T4D A;  4FPP A;  3SYP A;  4YJ3 B;  4F6E A;  1RPR A;  3M7M X;  1IUR A;  4B3T O;  1SS3 A;  5LHH A;  5LOV B;  4DV3 B;  2R9I A;  1HNX O;  1M57 B;  4DR2 B;  3QTC A;  2GDS A;  1ROP A;  2ZNI A;  5J2U A;  1WN7 A;  1M93 A;  5LA6 B;  4Z2W A;  4IIJ B;  1SQX H;  3U11 A;  2EZP A;  1ZUQ A;  2XAQ A;  3HKC B;  5B1B C;  5BZB A;  1QBZ A;  4WCE V;  2XHB A;  2DYS C;  5IWA O;  2EIM C;  3E8G A;  3K5O A;  4JI8 O;  2ZE7 A;  3HKB A;  4LF8 B;  1D5N A;  4RO2 A;  3S3X A;  2QWQ B;  3ZHU A;  1F7Y A;  3E83 A;  2UU9 O;  1S5J A;  1YHQ V;  5EZY A;  3K9S A;  2VQE B;  1W0K G;  5IY5 C;  3APQ A;  2ZIM A;  4DV6 B;  3ABM C;  5JVD B;  4TSF G;  3E2E A;  2V7Q G;  1QLE C;  1SQB H;  4I55 A;  1K5S A;  3H01 A;  4PEL A;  4FLX A;  3X2Q C;  1QVF U;  4JI4 B;  1MMM A;  3CRQ A;  1MA1 A;  1MG1 A;  4KUM A;  4K8Z A;  3AK3 A;  1KP2 A;  2HFE C;  5EIB D;  3RWR D;  1BQ0 A;  2WLI B;  2XOK G;  3CCM V;  5KAF Z;  3ZMZ A;  4IT5 A;  1MOF A;  1T5E A;  2CAZ C;  4R7C A;  3P3N A;  3TXQ A;  4H33 A;  1VF6 C;  5B1B B;  2B5U A;  3ML0 A;  2FTK A;  3FB6 C;  4I0X B;  2JJ1 G;  3ZJZ A;  4OX9 O;  2E3C A;  5LMN B;  4PA3 A;  1D2D A;  4TUY B;  1PD3 A;  1KQS U;  1OCZ C;  3H1I H;  2DYS B;  4KXR A;  2LP7 A;  1D5A A;  4DYL A;  2BE3 A;  4CC5 A;  1E1R G;  4X62 O;  4NR1 A;  3OUS A;  3DC6 A;  4JI5 B;  3ABK C;  3OW2 U;  1F4N A;  3ZMV A;  2IH1 C;  3K0D A;  1EFR G;  3AEI A;  5LHI A;  1HW7 A;  4JF3 A;  1QLE B;  4X64 O;  3STL C;  2QKA A;  2X6A A;  1QR9 A;  3ZX6 A;  2WWW A;  2JJ2 G;  4MVR A;  4UVA A;  3ETE A;  3FKS G;  1IXM A;  3SGI A;  4B3T B;  4P9P A;  4MW3 A;  2VWK A;  1VQL V;  3B2E E;  1HNX B;  3LUT B;  1KKD A;  4BIU A;  2FL4 A;  3FX7 A;  4O2A B;  3FB5 C;  4Z1M G;  3ZMS A;  1MZE A;  2LQT A;  4PHZ A;  1EN4 A;  2YXY A;  2QWP B;  4XDL A;  1CXZ B;  1VAR A;  2WA4 A;  2LFS A;  4UB6 Z;  2AW9 A;  1SA0 B;  4MT8 A;  1THZ A;  1ZTE A;  2QGN A;  3UO2 A;  4BW9 A;  5ITZ B;  4ZBM A;  4BWA A;  3WG7 B;  5FNV B;  3CRA A;  1LUV A;  1JA8 A;  5IWA B;  4TT3 G;  3R65 A;  4JI8 B;  2Q8V A;  4CH6 A;  4DR7 O;  3D36 C;  4L8J A;  5GON B;  2X0L A;  1TUE B;  3WB1 A;  2UU9 B;  1NT2 B;  5JVD A;  1RM1 C;  1YEW A;  3UT5 A;  1NH2 D;  3P3P A;  4QPJ A;  1PKX A;  1COW G;  2X6B A;  4JZG A;  5IJ9 A;  2OCC C;  2M6Y A;  3C90 A;  3HKD A;  2BSK A;  2B9Z A;  2WLI A;  2C2A A;  5BMV B;  5KUK A;  4RUF A;  2KQX A;  5L3G A;  5E79 Z;  2E76 B;  3OD4 A;  4B3S O;  3EVK A;  5H2F Z;  1OHH G;  2PGG A;  1AP5 A;  2Q69 A;  1XNQ O;  1OCC B;  5C8Y A;  1IDS A;  3OTF A;  3GWO A;  4JAU A;  2GTA A;  2A06 H;  3EFF K;  4LP8 A;  4OX9 B;  4LF6 O;  2UXN A;  1ZSP A;  1K8A W;  3STZ C;  4CS2 A;  2HJF C;  2VQF O;  2DN9 A;  1FYJ A;  3EHB B;  4O4H B;  4J9Z B;  1JFF A;  4X62 B;  2GTS A;  4JYB A;  1VF5 B;  1NS1 A;  2Q68 A;  2NN4 A;  4ICG A;  2JIZ G;  2HHH O;  4X64 B;  3AG2 B;  1NR7 A;  3ETG A;  3DXR B;  3L72 H;  3LSU A;  2A0L A;  3H1L H;  2QTS A;  4FLV A;  4HYO A;  3EXA A;  1NU1 H;  3JCZ A;  5LGT A;  4OGQ B;  4ZKI A;  2DWD C;  3JAL B;  1OCO C;  5KMG B;  3LDC A;  1AP6 A;  4O2A A;  2XAF A;  3FFQ A;  2JS3 A;  4CS4 A;  1XEQ A;  2DYR B;  2Q9L A;  3TXS A;  1FXH A;  4U7N A;  4DXW A;  2YID A;  3VQV A;  4J11 A;  2Q7H A;  3A0H Z;  1MAB G;  5IDJ A;  1RSO B;  1HR0 O;  4MVO A;  4Z1V A;  1K34 A;  5CA0 B;  4ZOL A;  5ITZ A;  2FB5 A;  5HFL A;  1K73 W;  1Q8I A;  3QNE A;  4KP4 A;  2QTO A;  1Y76 A;  1LNQ A;  3WU2 Z;  1JR9 A;  4LWS A;  4DR7 B;  4CC6 A;  1WAZ A;  4AI8 A;  1Q81 W;  4F4L A;  3T4Z A;  3OUF A;  3E35 A;  4O4J A;  5JH7 A;  4UVC A;  3P32 A;  2OTL V;  4I9W A;  5CBG A;  1S72 V;  4FM2 A;  5J2T B;  2IBZ H;  3SYQ A;  2ZDI A;  5EYP A;  1Y66 A;  3ABT A;  4X66 O;  2ZXW C;  4DV5 O;  3ZRW A;  5JCO A;  1WPX A;  3JD0 A;  3CCQ V;  1EBO A;  3G4S V;  3FYI B;  5B3S C;  3HKE B;  4B3S B;  3OMA B;  3C3S A;  2JGD B;  3QO7 A;  1XNQ B;  2OYQ A;  3UM7 A;  4DR4 O;  4W4L A;  4X1Y A;  2PTM A;  3K79 A;  4BW5 A;  4UVB A;  2OT5 A;  4DR5 O;  1XMQ O;  4OXS A;  4LF6 B;  4J80 A;  4GT1 A;  2EZO A;  5H6R A;  2Y48 A;  1QU7 A;  2VQF B;  4P30 A;  1TGO A;  4O4I B;  1QQC A;  2Y0P A;  3RYC A;  1E1Q G;  2ZE5 A;  3CB2 A;  1NTM H;  2K1E A;  2QR4 A;  1NBM G;  5B66 Z;  1XUQ A;  3LDD A;  4GYC B;  4FFB B;  3ZHV A;  3CXH F;  2Z3Y A;  4TQD A;  3G6E V;  1GN4 A;  3KG2 A;  2HHH B;  1JPX A;  1TVK B;  4LCU C;  3JSN A;  4B3R O;  1IZ3 A;  2WLK A;  2DE0 X;  1US6 A;  1Y6X A;  1VQP V;  1QHT A;  1X4T A;  3JAL A;  2GUZ B;  2UXX A;  1EZJ A;  3CPW U;  2YIB D;  4ABM A;  3PJS K;  4J9Y B;  4DV1 O;  1GM8 A;  4PDM A;  3SPH A;  1Y4M A;  4EB6 B;  3BFR A;  5AG2 A;  2O57 A;  2WLL A;  4K3A A;  4UFZ A;  2FML A;  1B6Q A;  2YIC A;  3MD0 A;  5IYZ B;  3IJ4 A;  1AR1 B;  1BS3 A;  5LGN A;  3CCU V;  3ZMU A;  1YJW V;  3B4S A;  1K9M W;  2AZ2 A;  5JWP A;  2PZS A;  3SPJ A;  4FVM A;  1ZL8 A;  3ABU A;  3N27 A;  4NTW A;  3TK1 A;  3VQX A;  1HR0 B;  4X1K B;  3G71 V;  3F5T A;  2PY5 A;  3CJH A;  3CCJ V;  4KL1 A;  1XIL A;  2MK3 A;  1N34 O;  2P22 C;  2DQ3 A;  1H2M A;  3RYI B;  3UO3 A;  2Q73 A;  2N74 A;  2LW1 A;  4TV8 B;  1XDC A;  5LMU O;  5CBF A;  4WFF A;  1AB3 A;  4WFB V;  1PL4 A;  5D5Q A;  2VS0 A;  1IVS A;  3OGC C;  1H38 A;  2KKW A;  4QJF B;  3RYF A;  4DRX A;  4DW1 A;  1SKV A;  1EN6 A;  2BTQ B;  4I9Q A;  4X66 B;  3OFN G;  1HNZ O;  5IYB O;  4DV5 B;  2YI8 A;  2ADP A;  3W7X A;  3I5D A;  1N8R W;  1GO3 F;  4MTX A;  5KHH A;  1HDJ A;  3BRC A;  3SYA A;  2F23 A;  3SDL A;  4MW8 A;  5KHJ A;  4F6R A;  4DR3 O;  2JGD A;  4X20 A;  1S5H C;  4HZ3 A;  2JRI A;  1AJQ A;  3BCC H;  2R72 A;  2QSA A;  2RQ6 A;  4LFA O;  1Q6H A;  4D7T A;  4DR4 B;  2NNU A;  2XND G;  4YIO A;  3LDE A;  3I55 V;  1XMQ B;  2QM8 A;  2QM4 A;  3CCR V;  4O4I A;  1WJZ A;  3ETQ A;  5K1P A;  4JYY A;  1GM9 A;  1BCC H;  2QWN B;  2HEP A;  3AG3 C;  4GX0 A;  1TVK A;  4DV0 O;  4FLZ A;  2AXT Z;  1N0J A;  3JAS B;  1VQ5 V;  2IJK A;  2W0F C;  1P4R A;  4B3R B;  3AG4 B;  5L3F A;  5LXT B;  5KHI A;  1SER A;  2YXH A;  4ZI7 B;  4LH6 A;  1YIT V;  2ATK C;  3E8F A;  4J41 A;  5B1A B;  2ZKO A;  5EC2 C;  5IYZ A;  4K35 A;  3QVN A;  3CXC U;  4DV1 B;  5JQG B;  1F51 A;  3WB0 A;  1NVP D;  2LGQ A;  2H94 A;  3OM3 B;  1Q5O A;  4CH3 A;  2ZQM A;  4JI2 O;  4HNA A;  2BOC C;  1FFX B;  3BAB A;  1BL8 A;  1IBK O;  2ZR3 A;  1N32 B;  2MW2 B;  5A9G A;  1VQN V;  2HR3 A;  3K08 A;  2CH7 A;  3DSQ A;  3SJB C;  1H2L A;  3K03 A;  5GTH Z;  4TV8 A;  2UXB O;  4JPR A;  1N34 B;  2XAJ A;  3ZRX A;  3TET A;  3AG3 B;  3O65 A;  2YEV A;  2VWJ A;  3U10 A;  5LMU B;  2YXL A;  2WLM A;  1NR1 A;  4MSW C;  2ADQ B;  3ZRS A;  4JTA B;  4PD4 F;  1MZF A;  2BTQ A;  4LNU A;  2ODM A;  4QE9 A;  3K5M A;  2Q0O C;  4WFH A;  5FLX N;  2WAM A;  5CB4 B;  1HNZ B;  4X1I B;  3ASN C;  3A8T A;  4FFK A;  1FXK C;  1GKF A;  3HR0 A;  2NLJ C;  1QCE A;  5FL7 G;  1YIJ V;  4IHJ B;  4H44 B;  1KKC A;  1O9G A;  5KX5 A;  1WLE A;  4DR3 B;  3CCS V;  3B8N A;  2EIM B;  5CA1 B;  2EIL C;  4J7K A;  2Q7G A;  4H13 B;  1B3Q A;  4LFA B;  1SES A;  1Y74 B;  4GX5 A;  4N23 A;  1KU9 A;  2JGU A;  2Q0A A;  3K5L A;  4MVS A;  2CTP A;  3DGE A;  5IY5 B;  1NH2 B;  1RFY A;  3N2K B;  3ABM B;  3JAM N;  3JAK A;  4PDV A;  1KEC A;  4FMT A;  5A2Q N;  4LFB O;  3X2Q B;  2CK3 G;  4YJ3 A;  3SYC A;  4AQY O;  5GTI Z;  1OJH A;  4MS2 A;  4DV0 B;  2UUC O;  2HVJ C;  2B1G A;  5LOV A;  3B40 A;  3OGI B;  4FLT A;  4UCS A;  1Q7Y W;  5E1A C;  4PJ0 Z;  4UCU A;  2OTJ V;  4O4L B;  2LFR A;  3CC2 V;  3WFV A;  5LA6 A;  2GSM B;  1AVM A;  4CS3 A;  3T1Y O;  4IIJ A;  5KLV H;  3ASN B;  4YJ2 B;  1FXK B;  3J80 N;  3DTU B;  3OE7 G;  3HKC A;  4E2L A;  1VQO V;  1Q82 W;  5EK0 A;  1YI2 V;  3KKY A;  1XHZ A;  1S76 D;  1OCZ B;  3ZED A;  1Y67 A;  4MVZ A;  2QWO B;  4NVP A;  5C93 A;  1G6U A;  2OCH A;  1DGS A;  1FJG O;  4I4T B;  3ASO C;  2YS8 A;  2ITD C;  4JI2 B;  1URF A;  5IYD O;  3QF7 A;  1P84 F;  1IBK B;  1K7D A;  3B8M A;  3ABK B;  1PPJ H;  2IH3 C;  1FS0 G;  2HP8 A;  2V4D A;  2R9A A;  3A0R A;  2ZD9 A;  5LYJ B;  4XDJ A;  5L3B A;  1WB7 A;  2UXB B;  3K58 A;  2UUA O;  3L71 H;  2KB1 A;  1KD1 W;  4MTF A;  3H9V A;  4UUJ C;  5EBW C;  2YC0 A;  2P06 A;  3AG7 A;  2XAG A;  1XOU A;  1AIL A;  2YDE A;  1QNM A;  5IJ0 B;  2DOS A;  1CP9 A;  3K9A A;  2ZE6 A;  2GV9 A;  5KHK A;  1GN2 A;  2FKX A;  2WA3 A;  4DV7 O;  2W6I G;  1R3L C;  3JAW B;  1JVM A;  4I0X A;  4FIP C;  4TUY A;  2LGW A;  4NTX A;  2ARH A;  3ASO B;  2QA4 V;  1PNK A;  3MAQ A;  3KCX A;  3JD1 A;  2WPD G;  4TOI A;  2G38 A;  4IGG A;  2Y0I A;  4GKK O;  3MDS A;  1SQQ H;  4QPK A;  1RM1 B;  4ZHQ B;  2EJ7 A;  4GUN A;  2Z0A A;  3SJQ C;  1SRY A;  2M7W A;  4LFB B;  2OCC B;  1FAF A;  1YJN V;  3ZBH A;  1PM9 A;  2A3Q A;  3CD6 V;  2PI5 A;  4AQY B;  2AGA A;  2JK5 C;  4JI3 O;  2WSS G;  3E8B A;  5LGU A;  4QIW F;  1HNW O;  2UUC B;  4DR1 O;  4MVM A;  3CYO A;  4O4L A;  1VF6 A;  1XQ8 A;  1LUW A;  3F7V C;  2EBO A;  4FZ1 A;  1R6N A;  4NB5 A;  2CDY A;  3T1Y B;  2F95 B;  1BT8 A;  1W0J G;  1SA0 A;  3Q4H B;  2HKO A;  1CPY A;  4G2K A;  3L75 H;  4UCV A;  1M5I A;  5FNV A;  2QDO A;  2YIA A;  4W4K A;  3I56 V;  3K57 A;  2EIJ C;  2RDC A;  4UCO A;  1FJG B;  4J42 A;  4D7S A;  4TQF A;  1VIB A;  1R6K A;  5GON A;  4WFA V;  4JAS A;  4UXN A;  1Q6I A;  3ZCC A;  5LYJ A;  1YCI A;  1H2N A;  2OIE A;  5BY1 A;  4WF9 V;  3JD2 A;  4JYC A;  1R3I C;  4O2B B;  4QNH B;  1NJI W;  3N2G B;  2HJD A;  1L1F A;  1LR1 A;  2UUA B;  1VQ6 V;  1N4C A;  1SQG A;  4X9Q A;  5IYC O;  2HG5 C;  4PA4 A;  5DED A;  3WB2 A;  3BY6 A;  1XNR O;  3E86 A;  3T1C A;  4GKJ O;  2LO1 A;  2RN9 A;  2OWO A;  1OCO B;  5BMV A;  3IAY A;  3BVO A;  4TV9 B;  1JMK C;  3OMI B;  4U3F H;  4X88 A;  1TUB B;  4E4E A;  1Q6U A;  1ZX3 A;  5LP6 C;  1GMG A;  1KC8 W;  4LF7 O;  2CTR A;  4GCZ A;  1IBM O;  3NXS A;  4BAY A;  1AI6 A;  3OAA G;  5BXZ A;  4DV7 B;  1AR5 A;  1RPO A;  5H5N A;  2QM7 A;  5CBH A;  3H1K H;  3U0Z A;  2E5L O;  4JZ2 A;  4KFM A;  2QJ1 A;  2CTW A;  4WFE A;  4GX2 A;  2XUM A;  1L0N H;  1EZV H;  2Z5U A;  1HP8 A;  1UPG A;  1R6T A;  4O4H A;  3RYH B;  2RJZ A;  4GKK B;  4JI7 O;  3APO A;  2P7T C;  2P90 A;  3E22 B;  4MTG A;  3M99 B;  3DXR A;  5L3D A;  1EM1 A;  1I0H A;  1ZLZ A;  1AI5 A;  1AJP A;  3KCY A;  1QVG U;  2PI4 A;  4WBN B;  5L3E A;  4LH7 A;  3ZS8 C;  2D2C B;  4UCT A;  1WB8 A;  2ZXW B;  3JCU Z;  5KMG A;  1N33 O;  4JI3 B;  1HNW B;  4DR1 B;  5KHG A;  3LNM B;  1CEZ A;  1Z2G A;  3F7Y C;  5B3S B;  1X59 A;  3D8C A;  4J7Z A;  5CA3 A;  4NTY A;  4DV2 O;  1H8H G;  5BR8 O;  4PI2 A;  1RSO A;  3FYE B;  4EFE A;  5CMU A;  4AIL C;  4UV8 A;  5CA0 A;  3B09 A;  4RQE A;  4JI6 O;  5FPO A;  1MSD A;  3L70 H;  2BOB C;  1BGY H;  5J2U B;  3VQW A;  2Y4T A;  5DM6 V;  1QLN A;  1FD9 A;  2ZM6 O;  2IW5 A;  1WA8 B;  4DV4 O;  4FLY A;  1G1X B;  1WPB A;  2K9P A;  4A5U B;  3BEH A;  1KP3 A;  3AG1 C;  1WNS A;  3FB8 C;  2IU3 A;  3HKB B;  5KA6 A;  4YY3 O;  1FFT B;  5DN6 G;  5J2T A;  1F4M A;  2VQE O;  3RVZ A;  2IJH A;  2EIK C;  4RQF A;  5EZY B;  1SZT A;  3JAT B;  1XNR B;  3ZN1 A;  3ETD A;  4GKJ B;  4LC1 A;  3M8A A;  4BIO A;  3CCL V;  1NVP B;  4EKW A;  4JYA O;  3HKE A;  1PNM A;  4JAA A;  3AK2 A;  1F23 A;  4LF7 B;  1IBM B;  3RVY A;  1MNG A;  4JAV A;  2P5O A;  1JQ0 A;  1GTO A;  3CHX A;  4I5S A;  3CCV V;  2VRZ A;  4YIP A;  1YF2 A;  4Q6G A;  2EUL A;  4I50 B;  4U7O A;  1K97 A;  2E5L B;  1K33 A;  4QGP A;  4GX1 A;  1P7B A;  2ZCE A;  4DR5 B;  2V1D A;  1XHX A;  4KHP O;  3RYH A;  2CGO A;  4MTO A;  3SPG A;  2P4V A;  3A2F A;  2DQ0 A;  3AG1 B;  3K04 A;  4FFB A;  4JI7 B;  4IYI A;  1GAX A;  4N21 A;  4H37 A;  1VEW A;  4WBN A;  2EJR A;  3MHS C;  2EIK B;  1Z5W A;  3RBZ A;  2UXD O;  3ZRV A;  2GUZ A;  3NR7 A;  1YXB A;  2Y4U A;  1N33 B;  3GB7 C;  3JSL A;  5HFM A;  4EB6 A;  3D3Q A;  2Q7E A;  3LSS A;  2ZE8 A;  3CEI A;  5KUM A;  1KB9 F;  1DLB A;  3G67 A;  2P6J A;  2YUA A;  4DV2 B;  2A79 B;  5BR8 B;  5KAI Z;  4X1K A;  2QKC A;  1G8M A;  5B1N A;  3PN1 A;  3CC4 V;  1K5Q A;  2X6C A;  4JI6 B;  1YTF D;  5JJE B;  4D6T H;  1ZAU A;  1UJW B;  1WA8 A;  1G4Y B;  3RYI A;  3JAR B;  2ZM6 B;  1KUQ A;  4DV4 B;  1I5X A;  2XAH A;  1H8E G;  3K06 A;  4PA9 A;  4GLX A;  5EBL C;  3TGU H;  2CUG A;  4CZZ A;  4G27 B;  2GBO A;  4YY3 B;  3JYC A;  1XMO O;  4B3M O;  2EIN C;  3CX5 F;  5JJN B;  1KMI Z;  1N36 O;  4OPA A;  1DF4 A;  3JAT A;  1PV0 A;  1ZWI C;  2IM9 A;  4DUY O;  1R73 A;  4HAM A;  3UT5 B;  1IBL O;  1Q86 W;  3BAA A;  1XBL A;  5IJ9 B;  2WLH A;  1GK9 A;  1PP9 H;  4FM1 A;  4DO2 A;  3HKD B;  2BSK B;  4JYA B;  2CE4 A;  2AHY A;  4R6Z A;  4U3J B;  2F1M A;  5J9P C;  2NR5 A;  2RMK B;  3BA8 A;  4I50 A;  2Q5Z A;  5EC1 C;  3W7W A;  2RCV A;  5JJJ B;  1M56 C;  4JTD B;  1GN3 A;  5GW7 A;  3OR7 C;  1YVW A;  5C8Y B;  4KHP B;  1BQZ A;  3O9O A;  3SJA C;  3W7U A;  3IC9 A;  3OEE G;  3QG5 A;  3WG7 C;  3JD3 A;  4BIZ A;  3J7A U;  3GWK C;  3JAS A;  3FD9 A;  2EIN B;  1K4C C;  5LXT A;  3QO5 A;  3TCU A;  4DR6 O;  4H0L B;  1JFF B;  4ZI7 A;  2UXD B;  3SPI A;  3ZMT A;  1Z5V A;  1DF5 A;  2KG7 B;  1RP3 B;  4LR3 A;  1TA8 A;  1OZ0 A;  4PV1 B;  1FKA O;  1QR8 A;  1VF7 A;  4FZ0 A;  1VQK V;  1VQ9 V;  1V9P A; 
#chains in the Genus database with same CATH homology
 4J11 A;  4IYI A;  4W4K A;  4KXR A;  4J42 A;  4IYH A;  4J10 A;  4J7J A;  3FX7 A;  4J7K A;  4W4L A;  2G38 A;  2GTS A;  4J41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...