4J11A

The crystal structure of a secreted protein esxb (wild-type, in p21 space group) from bacillus anthracis str. sterne
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
b'NAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECRETED PROTEIN ESXB
publication title The Crystal Structure of a Secreted Protein Esxb (Wild-Type, in P21 Space Group) from Bacillus Anthracis Str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 38
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j11A00
4W4LA 3FX7A 4J7JA 2GTSA 2G38A 4IYIA 4J11A 4KXRA 4IYHA 4J7KA 4J41A 4W4KA 4J10A 4J42A
chains in the Genus database with same CATH superfamily
3FD9A 4MVUA 2OYQA 5B1AC 4FZ0A 1MNGA 4UVCA 1IBKB 5E79Z 2LJ2A 4IGGA 1AILA 2Q7HA 1F23A 2IM9A 2Q73A 1TA8A 1BQZA 1R6NA 4ZI7B 1PM9A 3JAKA 3CX5F 3H1IH 2CH7B 1VF6C 1AP5A 1EN4A 4WFEA 3SJAC 3CCMV 3G6EV 3RWRD 1XEQA 1XHXA 4R8CA 2DWDC 4GZRB 2V1DA 2QTSA 1XL4A 2YIBD 2A79B 3AG2C 4NTXA 1BHAA 1ROPA 2ZE5A 4PDMA 1WAZA 1HNZO 4OPAA 1NH2B 2OIGA 3AG7A 3JSLA 5E1AC 3C3TA 3JARA 1ENVA 4YJ3B 3H1LH 5LMNO 1N4CA 4FJCC 2DQ0A 2R70A 4JYCA 4DV6O 4X8AA 4ASUG 2ITDC 3SYQA 4N21A 4X66B 1Q6IA 1Y4MA 1VQ4V 2ZKOA 5L3DA 2WLLA 2CAZC 3A0HZ 2FMLA 1B04A 2ZNIA 2FKXA 3CRAA 3AG3B 4I50B 2WLIA 3ETDA 3RYIA 1VQ9V 2Z3YA 3K3WA 1Z5VA 1XMQB 1GM7A 4U3JA 3CPWU 4I5SA 4FFKA 2BCCH 2QWRB 5JQGA 1KB9F 3U10A 2ILMA 4IT5A 3ASOB 1M4UA 2ARHA 4WFBV 4AILC 2OTJV 1F51A 3QTCA 2JJ2G 3CJHA 2L35A 4OXSA 4CS3A 3B40A 1XQ8A 2HHHO 2VQEB 4QIWF 2KG7B 1W0KG 4KUMA 1LUVA 1BQ0A 2JEUA 3ABKC 1UJWB 3HR0A 1M1KW 3LDCA 1WJZA 3FX7A 4TWKA 1KP3A 1OCCC 2YXHA 3DXRA 3OR7C 2W0XA 2AHZA 1SQFA 3SJCC 2ZD9A 1I0HA 2E76B 4DO2A 2UU9B 5EC2C 1MZFA 3ZEDA 1Y67A 2NR5A 3QNEA 3R65A 3J80N 1P7GA 3LSUA 4YJ2B 4GLXA 3GVMA 4JI7O 1S72V 3ETGA 4FLTA 2CK3G 2LFRA 4ZHQA 5C8YA 3BAAA 3T1HO 1I08A 1E1QG 2CTPA 3SYAA 4LF9B 3C90A 5BR8O 4AQYB 1IZ3A 1XMOO 1JX9A 1NVPD 3JD0A 2Z5UA 2AGAA 1AB3A 4O2BA 2AZ0A 4DRXA 1YIJV 3RGBA 4DR2B 2EX3A 5BMVA 4TV8B 4QE7A 4WFHA 4X20A 3SJBC 1RFYA 1VARA 2QGNA 3WG7C 1YHQV 3OFNG 5KHJA 4U3FH 1XDCA 1KKCA 1H2MA 2B5UA 5BXZA 1P7BA 3K06A 3GWOA 3JAWA 4FFBA 3LDDA 5EBWC 5IT9N 2Q6AA 1IXBA 4KHPB 2QSAA 2YUAA 1HP8A 1XL6A 1FPOA 5LMNB 1Z5WA 3VQXA 1VQ8V 1R3IC 3CMAV 3CMEV 3BPZA 4JI6O 2N05A 4DV6B 4PA6A 3IC7A 3RYIB 4I7ZB 4UB8Z 3ZRWA 3QF7A 3CCJV 2A9HA 4JI4O 1E1RG 2MW2B 4NR1A 4U3JB 2EILC 4IIJB 3L9DA 5CA0B 5J2TA 4YIOA 2X0LA 3K04A 3I55V 1G6UA 4OX9O 1JQ0A 2E74B 5CBHA 4QNHB 4F4LA 2LO1A 3N2GA 2DYSB 1DTOA 4BR6A 5JCOC 3CJHB 5EZYB 3CSXA 1CXZB 1S5LZ 1T5EA 4ZKIA 3A0BZ 2A3QA 3E22B 3T2MA 1FD9A 1H2NA 4ZOLA 3DC5A 4UCSA 3CD6V 2WAMA 4XDKA 1M56C 1VQ5V 1BGYH 3OM3B 2Q0AA 3DC6A 5KMGB 2JDIG 3AG4C 3DXRB 2XNDG 2HHHB 1VQKV 2UXDB 2ZE6A 1IXMA 1YTFD 4PJ0Z 1ZWIC 4QPKA 2QWOB 4NXNO 2FTKA 4JTAB 3I56V 2CUGA 5KAFZ 2V4DA 2A0LA 2DOSA 3E83A 1SERA 3H1KH 2E5LO 2RNBA 3BRCA 3HKCA 2IU3A 1PL0A 4UVBA 4WFAV 5J2UA 3ZMSA 1ZAUA 1TUBB 1G4YB 1M57B 3P3PA 4MVSA 4B7KA 4YIPA 1GKFA 3D36C 2QJ1A 2QM8A 2F66C 5JWPA 3HKBA 2IJIA 3OMIB 3FKSG 5EBMC 2UUCO 2H94A 3B09A 2Q69A 3F5TA 1MZEA 4JI7B 1BT8A 3FB7C 2K9PA 2ATKC 1SA0B 5TISZ 4U7NA 4O2AA 3K08A 2ZE8A 4LNUA 4JI0O 2BTQB 2UXCB 5BR8B 3UM7A 1AR1B 1XMOB 5IYDO 4MVQA 1HR0O 5IY5B 4P2ZA 1EN5A 1RPOA 2CE4A 5H5NA 3BFRA 2DMXA 3KKYA 2DE0X 3N2KB 1F7YA 5HFLA 3MAQA 3B2EE 5FNVA 4FPPA 2RN9A 1FXVA 4DV1B 3A0RA 1VEWA 4MVOA 3J7AU 3L73H 3JD4A 1B6QA 5LOVB 3H1HH 1RSOA 2EIKB 2OWOA 5GONB 1V55B 3K03A 1EBOA 3UO2A 2XOKG 4KXRA 1QU7A 2OCCB 5FL7G 1AI7A 2IJJA 2WLMA 5B1AB 2HJFC 3BA8A 4ZIBA 4DV4O 1H8HG 2Q7EA 4E2LA 3W7XA 3IGAC 2CTWA 4DR6B 4Z2WA 4JI6B 4LH6A 4JPRA 4B3RB 2YIAA 2ZNJA 2VWJA 3VQYA 4FLYA 4JI4B 3N2GB 1NTMH 1SQQH 2CH7A 1OHHG 1TVKB 3AG2B 1IBLO 1GAXA 2PZSA 3WB0A 1VF5B 4YY3B 3APOA 5H6RA 4OX9B 3CRRA 4X9QA 4DUYO 1N32O 5K1XA 3SPGA 2ZT9B 2ODMA 2P06A 1BZKA 4GX5A 4PI2A 3JD1A 2PI4A 1W59A 4YJ3A 4LF5O 3ZMTA 3JD2A 4ZBMA 1VQ6V 1MOFA 1SZXA 4PD4F 2VQFB 1A32A 1Y66A 2OIEA 5GTIZ 4RQEA 2ZDIA 4PA4A 3HKEA 2CTRA 1P49A 3B8NA 2MK3A 2P22C 3ZMUA 4FLVA 4I50A 3E2EA 2ZCEA 2NNUA 4BIUA 4NXNB 1SQGA 2ZQMA 3FB8C 4G2KA 1H8EG 4JV5B 3K79A 4JAVA 4CH5A 1N33B 2JGDB 1F4NA 1AR4A 2H3OA 1UFIA 5JCOA 5KUKA 1BE3H 4LF4B 2DJVA 4K3AA 4X1IB 1H2KA 3SJQC 4JZ2A 4GKJB 2P7TC 3UQ8A 2F1MA 5EIBD 4JI1O 1J95A 4IYHA 3RW0A 2XAQA 4PELA 1QLEC 2IH3C 3ABKB 2GUZB 3LSSA 2KG7A 3H1JH 3EXAA 1OCCB 3UT5B 1VP7A 3K0GA 4L87A 4DV5O 5L3CA 5KHHA 1ZSPA 4JI0B 3T4DA 5FPRA 1FFXA 3S3XA 1FKAO 3EFFK 1THZA 4U7OA 1HR0B 3K9AA 3T4ZA 1N34O 1K34A 4J11A 1DLBA 3ZHVA 5IJ9A 2N74A 4PDVA 5LA6B 4LP8A 2F43G 3CC7V 3TXQA 1NI8A 1US6A 1YJWV 3Q4HB 1PV0A 4RQFA 2IJKA 4DV7B 2BTOA 1SESA 3K59A 4FZ1A 4QJFB 4Z1VA 1SQXH 2YI8A 3ICXA 2VRZA 4DV0O 4NB5A 2FB5A 1CP9A 4JI3O 3L72H 4P30A 1S77D 1ZUQA 4B3SO 4DR5O 1N8RW 2QKCA 3F7VC 3SGIA 1U97A 3BEHA 3MDSA 1RM1C 3L75H 4WFFA 3CE2A 1X4TA 4GX2A 5GTHZ 2AHYA 4DR7B 3TETA 1MA1A 3JSNA 4RO2A 4TV8A 1BCCH 2UXNA 5LL6Y 4IL6Z 2IW5A 2E3CA 1SQBH 2Q4PA 3JALA 4O4HB 5L3EA 2F93B 1P4RA 4DUYB 3O65A 4DR3O 4PA3A 2WLHA 3CHXA 3QO7A 1Q3EA 3SPJA 1F4MA 2B1GA 3HKEB 1VQMV 2Y48A 4LF5B 4MTFA 4X89A 4DK0A 1QLNA 3UO3A 1VQLV 1YVWA 2Q67A 4D7SA 2RQ6A 5CB4B 1N36O 2XTAA 2A06H 4IIJA 2W0FC 2XAJA 4UCOA 5CA0A 1RP3B 4DR4O 4WFGA 2BOBC 5JJJB 2P4VA 5IYZA 4LF7B 2ZR3A 3VQVA 4I9WA 4X1YB 5EZYA 4TSFG 3AEIA 1IURA 1M56B 4YXWG 1Q90D 3E22A 1TAEA 5KX5B 2YXLA 1J5EO 4B7EA 3AG4B 1V54C 5B66Z 4B3MO 1K7DA 1SQVH 1ORQC 2ADQB 5BZBA 3NR7A 4OGQB 1Y6XA 4JI1B 2ZIOA 3ABMC 2XAFA 5KMGA 1SKVA 3W7UA 1FFXB 3H9VA 3NXSA 4B08A 1AI4A 2QKSA 3OEEG 3LNMB 2IBZH 3CRQA 4UCRA 3ML0A 5IJ9B 1KP2A 4DV5B 4DK1A 3AG1C 1QVGU 3ZS8C 4X64O 3ABTA 1OCRC 4MVMA 2E75B 3CC4V 3LNNA 4JYYA 3I5DA 3KCXA 1W0JG 1B3QA 1AI6A 1TUBA 3PN1A 4J9YB 1XNQO 3RBZA 1OCOB 3ZHTA 3SYOA 1NBMG 4DR1O 1KYOF 1NS1A 1FXKA 1NT2B 4JTCB 3WU2Z 3FAVA 5D5PA 1HNXB 2GDSA 5LXTB 4FLWA 4GKKO 5LMUO 1SA0A 1SZTA 2JGUA 1Q86W 1FFTB 4DV0B 1Q6HA 1XNRO 1KUQA 4X1KB 5CA1B 5LP6C 3K0DA 1XI1A 4RAIA 2BTQA 3ZX6A 3ZJZA 4B3SB 3T1CA 1TGOA 1FS0G 3F7YC 4RWUA 4DR5B 4LFBO 2HVJC 2ADPA 1MMMA 3WFVA 4H37A 3FB5C 4JYAO 3ZRSA 5EYPB 2QE7G 3G4SV 5LHHA 2WA4A 3N2KA 4E4EA 2AZ2A 2GTSA 4LF8O 3JALB 1URFA 3L74H 4WF9V 3RT3C 4JI5O 2Q8VA 3ZHQA 1SETA 3QVNA 2O57A 5LOVA 1HNZB 4FVMA 4KFMA 4MVZA 4PA9A 4H33A 1GN2A 5GONA 2XAGA 2GHYA 4DXWA 5EIBC 3A2FA 4LBEC 3FFQA 3JASB 2JK5C 5L3BA 1BS3A 3E8GA 1SF9A 3SPIA 2HP8A 2X6AA 4P9OA 2GTAA 1FXHA 2KSDA 4PA7A 2Y4TA 3W7WA 4MTOA 3O9OA 1HWYA 4NTWA 1VF6A 1GK9A 3APQA 5IYZB 2CTQA 4LWSA 5K1PA 1XOUA 3STZC 2WPDG 1TVKA 2F4VO 4DR4B 1YSCA 2ZXWC 1LR1A 4QE9A 3UCSC 3K9SA 2PUSA 2JIZG 3WB2A 4C7UA 4R50A 1JOYA 3U11A 1NVPB 3JD3A 4CS2A 4J80A 4PDLA 2DWEC 1BMFG 1VIBA 2B9ZA 4K35A 4EB6B 5CA3A 5A2QN 2YI9A 1OJHA 2UUBO 1J5EB 3ABUA 3ASOC 3DTUB 4B3MB 3N27A 4R6ZA 4D7TA 3SPCA 5LGNA 5CN0A 1NTKH 2HG5C 3KG2A 1XBLA 1H38A 4DV3O 1YJNV 3W7SA 2BSKB 2AW9A 3KCYA 3M99B 1GO3F 3UKMA 1NKDA 2HVKC 1S5JA 3G67A 1QCEA 2ZR2A 1PPJH 2WWWA 1I5YA 2YSUB 4X64B 5DN6G 1FXKB 4AI8A 2JGDA 1R3KC 2ZE7A 3ZN0A 3FAVB 4MVRA 4H44B 4JGSA 1XNQB 4DR1B 1YDXA 3R66A 1NJIW 4D6TH 1Y76B 1QLEB 1S3JA 4X1IA 4TOIA 3RVYA 1Q82W 3T1HB 2X6BA 4ICGA 4O4LB 4RUEA 3OTOO 3ZHUA 5LBQA 2P67A 5LMUB 1FJGO 1M9NA 4DW1A 2GUZA 5BY1A 3CCSV 3UT5A 1OZ0A 1JMKC 1XNRB 4PV1B 3B8MA 4FM2A 2QM4A 5JJNB 1XILA 2F23A 1NU1H 2M7WA 2QM7A 1YITV 2BOCC 2WSSG 4UVAA 5B3SC 4XDJA 4LFBB 2OTLV 1RPRA 3VBBA 1OCZC 3ZRVA 4I4TB 3CCQV 5LYJB 1QR9A 3S3WA 2LW1A 2P6JA 5LA6A 2AXTZ 1JFFB 3THOA 4UXNA 3SR2C 2IH1C 4LF8B 4WCEV 3Q4HA 3E35A 3HPLC 1YXBA 5KAIZ 5B1BC 2YXYA 1Q81W 2D2CB 3P3NA 3OGIB 1YTFB 1RM1B 4LCUC 1K92A 1DK1A 4MT8A 5H2FZ 1IBKO 3K5NA 4TUYB 5IWAO 4JAAA 2CDYA 3OMAB 4LWSB 4HBNA 3BCCH 4UUJC 5CMUA 1K8AW 1QR8A 4Q6GA 2PYJA 1AVMA 3CCVV 4CZZA 3ZBHA 3D3IA 2RDCA 3OMNB 4TQDA 1S76D 2XASA 4CH6A 2RMKB 2LFSA 5JVDB 4WBNB 1GN6A 1WNSA 3TGUH 4G27B 1YI2V 1NQTA 4JAUA 3T1YO 1PD3A 1ZTEA 2UXBO 3ASNC 2Q7GA 4O4HA 1WA8B 3K5OA 5LGUA 2RJZA 3G6BA 2PF4E 2ZIMA 2OCHA 3ZIAG 2Q9LA 3CCRV 1KC8W 4BW5A 2HEPA 5HFMA 3RN4A 4J7ZA 3X2QC 3ZCCA 4YHHO 2N04A 5KUMA 1EZVH 2LW7A 3OE7G 1U96A 4UCVA 2UUBB 4DYLA 4GX0A 2P4KA 3FYIB 1SQPH 1Q6UA 5CB4A 1PKXA 2E5LB 3K5LA 4HNAB 2Y4UA 2YIDA 1VQOV 1XMQO 1OV9A 4TT3G 2DYRC 5B1NA 1AR5A 4CS4A 1GTOA 2GBOA 2PTMA 3J81N 3ABLC 3LUTB 1AJPA 3ETQA 4FIPC 2UUCB 4X1YA 3MD0A 4JZGA 4GX1A 2G38A 1VQPV 5KX5A 1NH2D 4EFEA 4LR3A 2EZOA 4BWAA 4GUNA 5IJ0A 3JAMN 1WLEA 3OTOB 1QBZA 3B77A 4BIZA 4O4JB 3HB3B 3AG1B 4K8XA 3E8FA 2EBOA 1OCRB 4LH7A 2HJDA 2Z0AA 1O9HA 2R9IA 2UU9O 2YIBA 2HLDG 1D5NA 2QDOA 3D36A 4DW0A 2EIMC 2EZPA 2IJHA 2QTOA 4I0XB 1COWG 2JS3A 3E89A 1GN3A 4EKWA 4L8JA 4O4IA 3D8CA 5LXTA 2WLJA 3JCZA 5LP6B 1IBMO 2PYLA 3QO5A 3AK1A 4DV4B 2LQTA 1KU9A 4X1KA 5CA1A 2DN9A 2OCCC 1K5QA 4X62O 3WG7B 5LHIA 2KB1A 4NYKA 3HKDB 2Q0OC 5B5EZ 4K0KO 2WA3A 2VWKA 1LNQA 2QKAA 5IWAB 3TCUA 4DR2O 2NN4A 2W6JG 3ZMVA 5EYPA 4J7JA 3JATB 4NTYA 4MTXA 1IBLB 1ZLZA 5H9CA 4J41A 4HZ3A 4FMTA 1K3EA 1N0JA 4UB6Z 4TV9A 1N32B 2PY5A 2PI5A 3BY6A 3IJ4A 4XBFA 1L0NH 3T1YB 1AJQA 2UXBB 3OT7A 4IHJB 1HNWO 3RYCB 4KHPO 2M6YA 2Y69C 1IVSA 3JASA 1M90W 2GV9A 2EILB 2R72A 1YCIA 3EHBB 4QGPA 1JCHA 4UCUA 3PJSK 3K58A 4Z1MG 3ZMZA 2LP7A 3ZHSA 1KECA 2EIJC 2HFEC 4YHHB 1TUEB 4W4LA 5D5QA 4MSWC 2EINC 3OEHG 4KP4A 1I5XA 1G1XB 4JI8O 4DV2O 1AP6A 1PNMA 3SDLA 3OR6C 4KL1A 2ZXWB 2DW4A 3OGCC 3ZRXA 1K4CC 3AK2A 4X65O 3K5MA 5ITZA 4I55B 5FLXN 3DSQA 2IU0A 1XHZA 3CYOA 1K33A 1PNLA 3TXSA 4A5UB 2QWPB 3E86A 1DGSA 2L6LA 1GN4A 5JH7B 2JEXA 1UPGA 1Y74B 3L71H 2V7QG 1IDSA 2YICA 1K5SA 3RYFB 5IJ0B 3IC9A 3L70H 1GMGA 5C93A 2WLNA 2D3OW 4EB6A 4N23A 1Q8IA 1EM1A 4G28B 4UFZA 3C3SA 4Q20A 2UXDO 5DM6V 5FPOA 4FM0A 2YC0A 4CC5A 2UXXA 3CXHF 2KQXA 2BSKA 1QHTA 5H6QA 3BABA 1L0LH 3MHSC 5J9PC 3MHHC 1N34B 2QWNB 4J7KA 2ITCC 3H01A 4JASA 3VOUA 3RFRA 2FYUH 1CPYA 4FLUA 5DECA 3QO8A 4O4IB 3CP1A 2F95B 2HKOA 3LDEA 2WLKA 1Y76A 5JJEB 2XHBA 3OAAG 4CH3A 1B06A 4JI3B 4O4LA 1ZL8A 4MW8A 1ZX3A 2YS8A 5L3GA 3KZIZ 1QQCA 2EJRA 3G71V 2P5OA 1M5IA 1IBMB 3OTFA 2QWQB 2UXCO 2EULA 5B3SB 2UUAO 1HW7A 1Z2GA 4JTDB 1OCZB 1WP7A 3JAKB 4X62B 3IFXA 1X59A 4UCTA 4K0KB 4P9PA 1YZBA 4TV9B 3E8BA 2VS0A 4LFCO 4LF6O 4I4TA 3SYCA 5LYJA 2JVDA 2RCVA 4PDRA 1AROP 4DV1O 1MG1A 1DF4A 1JFFA 4UV8A 2ETNA 3U0ZA 1O9GA 4GT1A 5B1BB 2XT9A 3JARB 4AHCA 2YEVA 3F5WC 4DR3B 4BIOA 3CWBH 4FLXA 5IE9A 1NZ6A 4F6RA 1R6TA 1KMIZ 2LGQA 3M7MX 4B3TO 1HNWB 1Q5OA 4NKGB 3CC2V 1SRYA 1SS3A 2W6IG 2Q68A 2WLLB 4TUYA 4DR6O 3CRCA 2ZDIC 3FYEB 5DEDA 1N36B 2WLIB 2JJ1G 1BSMA 5ITZB 3P30A 4B3RO 1QNMA 1JVMA 4DV2B 4JI8B 1H2LA 1NR1A 3AG3C 5KA6A 2X6CA 3ASNB 4YY3O 5JVDA 4WBNA 1M93A 3CCLV 5JQGB 4X65B 1WPBA 1JA8A 1Q43A 1WP8A 4EFBA 5F2VO 2Y0IA 5EK0A 1WA8A 3DGEA 3X2QB 3CEIA 1V9PA 4CC6A 4R7CA 4ABMA 3LSQA 2VQFO 4H0LB 3P32A 2QEXV 1MABG 3TK1A 4LFAO 4DUZO 5KHGA 1K97A 1PNKA 4J9ZB 1YJ9V 4CH4A 2DYRB 1P84F 5IYBO 3G80A 4RUFA 2X7RB 4HNAA 4NXMO 4JV5O 4OPHA 4JF3A 3OW2U 3E8HA 3ABLB 1N33O 3CXCU 3BHPA 4HAMA 4HYOA 1MSWD 3RYHA 1R73A 4JI2O 2CGOA 1QVFU 1XREA 3OUSA 4LF4O 4ZHQB 5C8YB 1XUQA 1ZL8B 4IYIA 3WB1A 2QA4V 4GKJO 4K8ZA 3OD4A 5A9GA 3SPHA 4GKKB 3IAYA 1OCOC 1I94O 1BHBA 2R9RB 4PI0A 2FL4A 1HDJA 2P90A 4O2BB 5GW7A 4XDLA 4O4JA 4DRXB 4LC1A 1E79G 4JYAB 2UUAB 5BMVB 1KKDA 4X20B 3M8AA 1K73W 2EIMB 1WB7A 2NLJC 3SYPA 1AJNA 1D5AA 1GRJA 4LFCB 4JI5B 4CBCA 2ZM6O 4LF6B 2YEVB 3GWKC 3QG5A 4I0XA 3W7TA 3EVKA 4DV7O 5B1OA 4F6RB 3JAWB 5LHGA 4FFBB 1N0NA 4J10A 2BE3A 2K1EA 3ETEA 1JJ2U 2EJ7A 5CBFA 5LP6A 1K4DC 4F6EA 2OT5A 3AK3A 3ZRWB 4B3TB 3RVZA 1EZJA 3TJTA 3HKDA 4H13B 4MS2A 3OUFA 5J2TB 4DR7O 4UV9A 1D2DA 2B1IA 3JATA 1K9MW 4ZI7A 2F4VB 4W4KA 5EC1C 3STLC 5KHKA 4GCZA 1NTZH 1AI5A 2DQ3A 2JRIA 2KKWA 1DF5A 1NR7A 2HR3A 1VF7A 1WN7A 5LGTA 2DYSC 3VQWA 2Y69B 4ZOLB 1R3JC 1BL8A 5EBLC 4IHJA 2ZINA 4FK5C 3RYCA 1VMGA 1I7FA 4X66O 2EIJB 1R1BA 1YF2A 4I9QA 2A7WA 5KLVH 2EINB 1FAFA 3ZN1A 2PGGA 4GYCB 2XUMA 5KA5A 4DV3B 4MTGA 2H8PC 5IYCO 4LFAB 2QR4A 1JPXA 1G8MA 1KBHA 4EEQA 1R6KA 4DUZB 1VQNV 4FLZA 3ZHRA 4J42A 3HKCB 4JYBA 4FM1A 2GSMB 5J2UB 5L3FA 3JYCA 3RYHB 1GM9A 1WPXA 1H2SB 2C2AA 1WB8A 2Y0PA 4TQFA 4I55A 4LF7O 1FYJA 1JJOA 2YDEA 4NXMB 3A8TA 3CRMA 1V54B 1GH6A 3HKBB 4BAYA 5JH7A 1PP9H 3B4SA 2LGWA 3D3QA 3JCUZ 1M57C 1Y74A 4NVPA 3ABMB 5CBGA 2R9AA 4JI2B 1FXKC 3CCUV 1S0VA 2VQEO 3RYFA 5AG2A 1SC5B 4MW3A 1CEZA 1JR9A 2XAHA 4QPJA 4O2AB 4PHZA 1S5HC 1FJGB 1YEWA 3CS5A 1I94B 4LNUB 4X88A 1KD1W 1MSDA 1VQ7V 3BA9A 2Q5ZA 1GM8A 1PL4A 1H2GA 2JS5A 2CGNA 1EN6A 5IDJA 1EFRG 3CCEV 5FNVB 5IY5C 1L8DA 3K57A 1KQSU 1RSOB 1IX9A 3GB7C 2ZM6B 1Q7YW 1R3LC 1L1FA 4YJ2A 3BVOA 1HNXO 4BW9A 5KHIA 4LF9O 2EIKC 4AQYO 3CB2A 1V55C 1LUWA 1W2BU 3FB6C
chains in the Genus database with same CATH topology
4W4LA 3FX7A 4J7JA 2GTSA 2G38A 4IYIA 4J11A 4KXRA 4IYHA 4J7KA 4J41A 4W4KA 4J10A 4J42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4L A;  3FX7 A;  4J7J A;  2GTS A;  2G38 A;  4IYI A;  4J11 A;  4KXR A;  4IYH A;  4J7K A;  4J41 A;  4W4K A;  4J10 A;  4J42 A; 
#chains in the Genus database with same CATH topology
 3FD9 A;  4MVU A;  2OYQ A;  5B1A C;  4FZ0 A;  1MNG A;  4UVC A;  1IBK B;  5E79 Z;  2LJ2 A;  4IGG A;  1AIL A;  2Q7H A;  1F23 A;  2IM9 A;  2Q73 A;  1TA8 A;  1BQZ A;  1R6N A;  4ZI7 B;  1PM9 A;  3JAK A;  3CX5 F;  3H1I H;  2CH7 B;  1VF6 C;  1AP5 A;  1EN4 A;  4WFE A;  3SJA C;  3CCM V;  3G6E V;  3RWR D;  1XEQ A;  1XHX A;  4R8C A;  2DWD C;  4GZR B;  2V1D A;  2QTS A;  1XL4 A;  2YIB D;  2A79 B;  3AG2 C;  4NTX A;  1BHA A;  1ROP A;  2ZE5 A;  4PDM A;  1WAZ A;  1HNZ O;  4OPA A;  1NH2 B;  2OIG A;  3AG7 A;  3JSL A;  5E1A C;  3C3T A;  3JAR A;  1ENV A;  4YJ3 B;  3H1L H;  5LMN O;  1N4C A;  4FJC C;  2DQ0 A;  2R70 A;  4JYC A;  4DV6 O;  4X8A A;  4ASU G;  2ITD C;  3SYQ A;  4N21 A;  4X66 B;  1Q6I A;  1Y4M A;  1VQ4 V;  2ZKO A;  5L3D A;  2WLL A;  2CAZ C;  3A0H Z;  2FML A;  1B04 A;  2ZNI A;  2FKX A;  3CRA A;  3AG3 B;  4I50 B;  2WLI A;  3ETD A;  3RYI A;  1VQ9 V;  2Z3Y A;  3K3W A;  1Z5V A;  1XMQ B;  1GM7 A;  4U3J A;  3CPW U;  4I5S A;  4FFK A;  2BCC H;  2QWR B;  5JQG A;  1KB9 F;  3U10 A;  2ILM A;  4IT5 A;  3ASO B;  1M4U A;  2ARH A;  4WFB V;  4AIL C;  2OTJ V;  1F51 A;  3QTC A;  2JJ2 G;  3CJH A;  2L35 A;  4OXS A;  4CS3 A;  3B40 A;  1XQ8 A;  2HHH O;  2VQE B;  4QIW F;  2KG7 B;  1W0K G;  4KUM A;  1LUV A;  1BQ0 A;  2JEU A;  3ABK C;  1UJW B;  3HR0 A;  1M1K W;  3LDC A;  1WJZ A;  3FX7 A;  4TWK A;  1KP3 A;  1OCC C;  2YXH A;  3DXR A;  3OR7 C;  2W0X A;  2AHZ A;  1SQF A;  3SJC C;  2ZD9 A;  1I0H A;  2E76 B;  4DO2 A;  2UU9 B;  5EC2 C;  1MZF A;  3ZED A;  1Y67 A;  2NR5 A;  3QNE A;  3R65 A;  3J80 N;  1P7G A;  3LSU A;  4YJ2 B;  4GLX A;  3GVM A;  4JI7 O;  1S72 V;  3ETG A;  4FLT A;  2CK3 G;  2LFR A;  4ZHQ A;  5C8Y A;  3BAA A;  3T1H O;  1I08 A;  1E1Q G;  2CTP A;  3SYA A;  4LF9 B;  3C90 A;  5BR8 O;  4AQY B;  1IZ3 A;  1XMO O;  1JX9 A;  1NVP D;  3JD0 A;  2Z5U A;  2AGA A;  1AB3 A;  4O2B A;  2AZ0 A;  4DRX A;  1YIJ V;  3RGB A;  4DR2 B;  2EX3 A;  5BMV A;  4TV8 B;  4QE7 A;  4WFH A;  4X20 A;  3SJB C;  1RFY A;  1VAR A;  2QGN A;  3WG7 C;  1YHQ V;  3OFN G;  5KHJ A;  4U3F H;  1XDC A;  1KKC A;  1H2M A;  2B5U A;  5BXZ A;  1P7B A;  3K06 A;  3GWO A;  3JAW A;  4FFB A;  3LDD A;  5EBW C;  5IT9 N;  2Q6A A;  1IXB A;  4KHP B;  2QSA A;  2YUA A;  1HP8 A;  1XL6 A;  1FPO A;  5LMN B;  1Z5W A;  3VQX A;  1VQ8 V;  1R3I C;  3CMA V;  3CME V;  3BPZ A;  4JI6 O;  2N05 A;  4DV6 B;  4PA6 A;  3IC7 A;  3RYI B;  4I7Z B;  4UB8 Z;  3ZRW A;  3QF7 A;  3CCJ V;  2A9H A;  4JI4 O;  1E1R G;  2MW2 B;  4NR1 A;  4U3J B;  2EIL C;  4IIJ B;  3L9D A;  5CA0 B;  5J2T A;  4YIO A;  2X0L A;  3K04 A;  3I55 V;  1G6U A;  4OX9 O;  1JQ0 A;  2E74 B;  5CBH A;  4QNH B;  4F4L A;  2LO1 A;  3N2G A;  2DYS B;  1DTO A;  4BR6 A;  5JCO C;  3CJH B;  5EZY B;  3CSX A;  1CXZ B;  1S5L Z;  1T5E A;  4ZKI A;  3A0B Z;  2A3Q A;  3E22 B;  3T2M A;  1FD9 A;  1H2N A;  4ZOL A;  3DC5 A;  4UCS A;  3CD6 V;  2WAM A;  4XDK A;  1M56 C;  1VQ5 V;  1BGY H;  3OM3 B;  2Q0A A;  3DC6 A;  5KMG B;  2JDI G;  3AG4 C;  3DXR B;  2XND G;  2HHH B;  1VQK V;  2UXD B;  2ZE6 A;  1IXM A;  1YTF D;  4PJ0 Z;  1ZWI C;  4QPK A;  2QWO B;  4NXN O;  2FTK A;  4JTA B;  3I56 V;  2CUG A;  5KAF Z;  2V4D A;  2A0L A;  2DOS A;  3E83 A;  1SER A;  3H1K H;  2E5L O;  2RNB A;  3BRC A;  3HKC A;  2IU3 A;  1PL0 A;  4UVB A;  4WFA V;  5J2U A;  3ZMS A;  1ZAU A;  1TUB B;  1G4Y B;  1M57 B;  3P3P A;  4MVS A;  4B7K A;  4YIP A;  1GKF A;  3D36 C;  2QJ1 A;  2QM8 A;  2F66 C;  5JWP A;  3HKB A;  2IJI A;  3OMI B;  3FKS G;  5EBM C;  2UUC O;  2H94 A;  3B09 A;  2Q69 A;  3F5T A;  1MZE A;  4JI7 B;  1BT8 A;  3FB7 C;  2K9P A;  2ATK C;  1SA0 B;  5TIS Z;  4U7N A;  4O2A A;  3K08 A;  2ZE8 A;  4LNU A;  4JI0 O;  2BTQ B;  2UXC B;  5BR8 B;  3UM7 A;  1AR1 B;  1XMO B;  5IYD O;  4MVQ A;  1HR0 O;  5IY5 B;  4P2Z A;  1EN5 A;  1RPO A;  2CE4 A;  5H5N A;  3BFR A;  2DMX A;  3KKY A;  2DE0 X;  3N2K B;  1F7Y A;  5HFL A;  3MAQ A;  3B2E E;  5FNV A;  4FPP A;  2RN9 A;  1FXV A;  4DV1 B;  3A0R A;  1VEW A;  4MVO A;  3J7A U;  3L73 H;  3JD4 A;  1B6Q A;  5LOV B;  3H1H H;  1RSO A;  2EIK B;  2OWO A;  5GON B;  1V55 B;  3K03 A;  1EBO A;  3UO2 A;  2XOK G;  4KXR A;  1QU7 A;  2OCC B;  5FL7 G;  1AI7 A;  2IJJ A;  2WLM A;  5B1A B;  2HJF C;  3BA8 A;  4ZIB A;  4DV4 O;  1H8H G;  2Q7E A;  4E2L A;  3W7X A;  3IGA C;  2CTW A;  4DR6 B;  4Z2W A;  4JI6 B;  4LH6 A;  4JPR A;  4B3R B;  2YIA A;  2ZNJ A;  2VWJ A;  3VQY A;  4FLY A;  4JI4 B;  3N2G B;  1NTM H;  1SQQ H;  2CH7 A;  1OHH G;  1TVK B;  3AG2 B;  1IBL O;  1GAX A;  2PZS A;  3WB0 A;  1VF5 B;  4YY3 B;  3APO A;  5H6R A;  4OX9 B;  3CRR A;  4X9Q A;  4DUY O;  1N32 O;  5K1X A;  3SPG A;  2ZT9 B;  2ODM A;  2P06 A;  1BZK A;  4GX5 A;  4PI2 A;  3JD1 A;  2PI4 A;  1W59 A;  4YJ3 A;  4LF5 O;  3ZMT A;  3JD2 A;  4ZBM A;  1VQ6 V;  1MOF A;  1SZX A;  4PD4 F;  2VQF B;  1A32 A;  1Y66 A;  2OIE A;  5GTI Z;  4RQE A;  2ZDI A;  4PA4 A;  3HKE A;  2CTR A;  1P49 A;  3B8N A;  2MK3 A;  2P22 C;  3ZMU A;  4FLV A;  4I50 A;  3E2E A;  2ZCE A;  2NNU A;  4BIU A;  4NXN B;  1SQG A;  2ZQM A;  3FB8 C;  4G2K A;  1H8E G;  4JV5 B;  3K79 A;  4JAV A;  4CH5 A;  1N33 B;  2JGD B;  1F4N A;  1AR4 A;  2H3O A;  1UFI A;  5JCO A;  5KUK A;  1BE3 H;  4LF4 B;  2DJV A;  4K3A A;  4X1I B;  1H2K A;  3SJQ C;  4JZ2 A;  4GKJ B;  2P7T C;  3UQ8 A;  2F1M A;  5EIB D;  4JI1 O;  1J95 A;  4IYH A;  3RW0 A;  2XAQ A;  4PEL A;  1QLE C;  2IH3 C;  3ABK B;  2GUZ B;  3LSS A;  2KG7 A;  3H1J H;  3EXA A;  1OCC B;  3UT5 B;  1VP7 A;  3K0G A;  4L87 A;  4DV5 O;  5L3C A;  5KHH A;  1ZSP A;  4JI0 B;  3T4D A;  5FPR A;  1FFX A;  3S3X A;  1FKA O;  3EFF K;  1THZ A;  4U7O A;  1HR0 B;  3K9A A;  3T4Z A;  1N34 O;  1K34 A;  4J11 A;  1DLB A;  3ZHV A;  5IJ9 A;  2N74 A;  4PDV A;  5LA6 B;  4LP8 A;  2F43 G;  3CC7 V;  3TXQ A;  1NI8 A;  1US6 A;  1YJW V;  3Q4H B;  1PV0 A;  4RQF A;  2IJK A;  4DV7 B;  2BTO A;  1SES A;  3K59 A;  4FZ1 A;  4QJF B;  4Z1V A;  1SQX H;  2YI8 A;  3ICX A;  2VRZ A;  4DV0 O;  4NB5 A;  2FB5 A;  1CP9 A;  4JI3 O;  3L72 H;  4P30 A;  1S77 D;  1ZUQ A;  4B3S O;  4DR5 O;  1N8R W;  2QKC A;  3F7V C;  3SGI A;  1U97 A;  3BEH A;  3MDS A;  1RM1 C;  3L75 H;  4WFF A;  3CE2 A;  1X4T A;  4GX2 A;  5GTH Z;  2AHY A;  4DR7 B;  3TET A;  1MA1 A;  3JSN A;  4RO2 A;  4TV8 A;  1BCC H;  2UXN A;  5LL6 Y;  4IL6 Z;  2IW5 A;  2E3C A;  1SQB H;  2Q4P A;  3JAL A;  4O4H B;  5L3E A;  2F93 B;  1P4R A;  4DUY B;  3O65 A;  4DR3 O;  4PA3 A;  2WLH A;  3CHX A;  3QO7 A;  1Q3E A;  3SPJ A;  1F4M A;  2B1G A;  3HKE B;  1VQM V;  2Y48 A;  4LF5 B;  4MTF A;  4X89 A;  4DK0 A;  1QLN A;  3UO3 A;  1VQL V;  1YVW A;  2Q67 A;  4D7S A;  2RQ6 A;  5CB4 B;  1N36 O;  2XTA A;  2A06 H;  4IIJ A;  2W0F C;  2XAJ A;  4UCO A;  5CA0 A;  1RP3 B;  4DR4 O;  4WFG A;  2BOB C;  5JJJ B;  2P4V A;  5IYZ A;  4LF7 B;  2ZR3 A;  3VQV A;  4I9W A;  4X1Y B;  5EZY A;  4TSF G;  3AEI A;  1IUR A;  1M56 B;  4YXW G;  1Q90 D;  3E22 A;  1TAE A;  5KX5 B;  2YXL A;  1J5E O;  4B7E A;  3AG4 B;  1V54 C;  5B66 Z;  4B3M O;  1K7D A;  1SQV H;  1ORQ C;  2ADQ B;  5BZB A;  3NR7 A;  4OGQ B;  1Y6X A;  4JI1 B;  2ZIO A;  3ABM C;  2XAF A;  5KMG A;  1SKV A;  3W7U A;  1FFX B;  3H9V A;  3NXS A;  4B08 A;  1AI4 A;  2QKS A;  3OEE G;  3LNM B;  2IBZ H;  3CRQ A;  4UCR A;  3ML0 A;  5IJ9 B;  1KP2 A;  4DV5 B;  4DK1 A;  3AG1 C;  1QVG U;  3ZS8 C;  4X64 O;  3ABT A;  1OCR C;  4MVM A;  2E75 B;  3CC4 V;  3LNN A;  4JYY A;  3I5D A;  3KCX A;  1W0J G;  1B3Q A;  1AI6 A;  1TUB A;  3PN1 A;  4J9Y B;  1XNQ O;  3RBZ A;  1OCO B;  3ZHT A;  3SYO A;  1NBM G;  4DR1 O;  1KYO F;  1NS1 A;  1FXK A;  1NT2 B;  4JTC B;  3WU2 Z;  3FAV A;  5D5P A;  1HNX B;  2GDS A;  5LXT B;  4FLW A;  4GKK O;  5LMU O;  1SA0 A;  1SZT A;  2JGU A;  1Q86 W;  1FFT B;  4DV0 B;  1Q6H A;  1XNR O;  1KUQ A;  4X1K B;  5CA1 B;  5LP6 C;  3K0D A;  1XI1 A;  4RAI A;  2BTQ A;  3ZX6 A;  3ZJZ A;  4B3S B;  3T1C A;  1TGO A;  1FS0 G;  3F7Y C;  4RWU A;  4DR5 B;  4LFB O;  2HVJ C;  2ADP A;  1MMM A;  3WFV A;  4H37 A;  3FB5 C;  4JYA O;  3ZRS A;  5EYP B;  2QE7 G;  3G4S V;  5LHH A;  2WA4 A;  3N2K A;  4E4E A;  2AZ2 A;  2GTS A;  4LF8 O;  3JAL B;  1URF A;  3L74 H;  4WF9 V;  3RT3 C;  4JI5 O;  2Q8V A;  3ZHQ A;  1SET A;  3QVN A;  2O57 A;  5LOV A;  1HNZ B;  4FVM A;  4KFM A;  4MVZ A;  4PA9 A;  4H33 A;  1GN2 A;  5GON A;  2XAG A;  2GHY A;  4DXW A;  5EIB C;  3A2F A;  4LBE C;  3FFQ A;  3JAS B;  2JK5 C;  5L3B A;  1BS3 A;  3E8G A;  1SF9 A;  3SPI A;  2HP8 A;  2X6A A;  4P9O A;  2GTA A;  1FXH A;  2KSD A;  4PA7 A;  2Y4T A;  3W7W A;  4MTO A;  3O9O A;  1HWY A;  4NTW A;  1VF6 A;  1GK9 A;  3APQ A;  5IYZ B;  2CTQ A;  4LWS A;  5K1P A;  1XOU A;  3STZ C;  2WPD G;  1TVK A;  2F4V O;  4DR4 B;  1YSC A;  2ZXW C;  1LR1 A;  4QE9 A;  3UCS C;  3K9S A;  2PUS A;  2JIZ G;  3WB2 A;  4C7U A;  4R50 A;  1JOY A;  3U11 A;  1NVP B;  3JD3 A;  4CS2 A;  4J80 A;  4PDL A;  2DWE C;  1BMF G;  1VIB A;  2B9Z A;  4K35 A;  4EB6 B;  5CA3 A;  5A2Q N;  2YI9 A;  1OJH A;  2UUB O;  1J5E B;  3ABU A;  3ASO C;  3DTU B;  4B3M B;  3N27 A;  4R6Z A;  4D7T A;  3SPC A;  5LGN A;  5CN0 A;  1NTK H;  2HG5 C;  3KG2 A;  1XBL A;  1H38 A;  4DV3 O;  1YJN V;  3W7S A;  2BSK B;  2AW9 A;  3KCY A;  3M99 B;  1GO3 F;  3UKM A;  1NKD A;  2HVK C;  1S5J A;  3G67 A;  1QCE A;  2ZR2 A;  1PPJ H;  2WWW A;  1I5Y A;  2YSU B;  4X64 B;  5DN6 G;  1FXK B;  4AI8 A;  2JGD A;  1R3K C;  2ZE7 A;  3ZN0 A;  3FAV B;  4MVR A;  4H44 B;  4JGS A;  1XNQ B;  4DR1 B;  1YDX A;  3R66 A;  1NJI W;  4D6T H;  1Y76 B;  1QLE B;  1S3J A;  4X1I A;  4TOI A;  3RVY A;  1Q82 W;  3T1H B;  2X6B A;  4ICG A;  4O4L B;  4RUE A;  3OTO O;  3ZHU A;  5LBQ A;  2P67 A;  5LMU B;  1FJG O;  1M9N A;  4DW1 A;  2GUZ A;  5BY1 A;  3CCS V;  3UT5 A;  1OZ0 A;  1JMK C;  1XNR B;  4PV1 B;  3B8M A;  4FM2 A;  2QM4 A;  5JJN B;  1XIL A;  2F23 A;  1NU1 H;  2M7W A;  2QM7 A;  1YIT V;  2BOC C;  2WSS G;  4UVA A;  5B3S C;  4XDJ A;  4LFB B;  2OTL V;  1RPR A;  3VBB A;  1OCZ C;  3ZRV A;  4I4T B;  3CCQ V;  5LYJ B;  1QR9 A;  3S3W A;  2LW1 A;  2P6J A;  5LA6 A;  2AXT Z;  1JFF B;  3THO A;  4UXN A;  3SR2 C;  2IH1 C;  4LF8 B;  4WCE V;  3Q4H A;  3E35 A;  3HPL C;  1YXB A;  5KAI Z;  5B1B C;  2YXY A;  1Q81 W;  2D2C B;  3P3N A;  3OGI B;  1YTF B;  1RM1 B;  4LCU C;  1K92 A;  1DK1 A;  4MT8 A;  5H2F Z;  1IBK O;  3K5N A;  4TUY B;  5IWA O;  4JAA A;  2CDY A;  3OMA B;  4LWS B;  4HBN A;  3BCC H;  4UUJ C;  5CMU A;  1K8A W;  1QR8 A;  4Q6G A;  2PYJ A;  1AVM A;  3CCV V;  4CZZ A;  3ZBH A;  3D3I A;  2RDC A;  3OMN B;  4TQD A;  1S76 D;  2XAS A;  4CH6 A;  2RMK B;  2LFS A;  5JVD B;  4WBN B;  1GN6 A;  1WNS A;  3TGU H;  4G27 B;  1YI2 V;  1NQT A;  4JAU A;  3T1Y O;  1PD3 A;  1ZTE A;  2UXB O;  3ASN C;  2Q7G A;  4O4H A;  1WA8 B;  3K5O A;  5LGU A;  2RJZ A;  3G6B A;  2PF4 E;  2ZIM A;  2OCH A;  3ZIA G;  2Q9L A;  3CCR V;  1KC8 W;  4BW5 A;  2HEP A;  5HFM A;  3RN4 A;  4J7Z A;  3X2Q C;  3ZCC A;  4YHH O;  2N04 A;  5KUM A;  1EZV H;  2LW7 A;  3OE7 G;  1U96 A;  4UCV A;  2UUB B;  4DYL A;  4GX0 A;  2P4K A;  3FYI B;  1SQP H;  1Q6U A;  5CB4 A;  1PKX A;  2E5L B;  3K5L A;  4HNA B;  2Y4U A;  2YID A;  1VQO V;  1XMQ O;  1OV9 A;  4TT3 G;  2DYR C;  5B1N A;  1AR5 A;  4CS4 A;  1GTO A;  2GBO A;  2PTM A;  3J81 N;  3ABL C;  3LUT B;  1AJP A;  3ETQ A;  4FIP C;  2UUC B;  4X1Y A;  3MD0 A;  4JZG A;  4GX1 A;  2G38 A;  1VQP V;  5KX5 A;  1NH2 D;  4EFE A;  4LR3 A;  2EZO A;  4BWA A;  4GUN A;  5IJ0 A;  3JAM N;  1WLE A;  3OTO B;  1QBZ A;  3B77 A;  4BIZ A;  4O4J B;  3HB3 B;  3AG1 B;  4K8X A;  3E8F A;  2EBO A;  1OCR B;  4LH7 A;  2HJD A;  2Z0A A;  1O9H A;  2R9I A;  2UU9 O;  2YIB A;  2HLD G;  1D5N A;  2QDO A;  3D36 A;  4DW0 A;  2EIM C;  2EZP A;  2IJH A;  2QTO A;  4I0X B;  1COW G;  2JS3 A;  3E89 A;  1GN3 A;  4EKW A;  4L8J A;  4O4I A;  3D8C A;  5LXT A;  2WLJ A;  3JCZ A;  5LP6 B;  1IBM O;  2PYL A;  3QO5 A;  3AK1 A;  4DV4 B;  2LQT A;  1KU9 A;  4X1K A;  5CA1 A;  2DN9 A;  2OCC C;  1K5Q A;  4X62 O;  3WG7 B;  5LHI A;  2KB1 A;  4NYK A;  3HKD B;  2Q0O C;  5B5E Z;  4K0K O;  2WA3 A;  2VWK A;  1LNQ A;  2QKA A;  5IWA B;  3TCU A;  4DR2 O;  2NN4 A;  2W6J G;  3ZMV A;  5EYP A;  4J7J A;  3JAT B;  4NTY A;  4MTX A;  1IBL B;  1ZLZ A;  5H9C A;  4J41 A;  4HZ3 A;  4FMT A;  1K3E A;  1N0J A;  4UB6 Z;  4TV9 A;  1N32 B;  2PY5 A;  2PI5 A;  3BY6 A;  3IJ4 A;  4XBF A;  1L0N H;  3T1Y B;  1AJQ A;  2UXB B;  3OT7 A;  4IHJ B;  1HNW O;  3RYC B;  4KHP O;  2M6Y A;  2Y69 C;  1IVS A;  3JAS A;  1M90 W;  2GV9 A;  2EIL B;  2R72 A;  1YCI A;  3EHB B;  4QGP A;  1JCH A;  4UCU A;  3PJS K;  3K58 A;  4Z1M G;  3ZMZ A;  2LP7 A;  3ZHS A;  1KEC A;  2EIJ C;  2HFE C;  4YHH B;  1TUE B;  4W4L A;  5D5Q A;  4MSW C;  2EIN C;  3OEH G;  4KP4 A;  1I5X A;  1G1X B;  4JI8 O;  4DV2 O;  1AP6 A;  1PNM A;  3SDL A;  3OR6 C;  4KL1 A;  2ZXW B;  2DW4 A;  3OGC C;  3ZRX A;  1K4C C;  3AK2 A;  4X65 O;  3K5M A;  5ITZ A;  4I55 B;  5FLX N;  3DSQ A;  2IU0 A;  1XHZ A;  3CYO A;  1K33 A;  1PNL A;  3TXS A;  4A5U B;  2QWP B;  3E86 A;  1DGS A;  2L6L A;  1GN4 A;  5JH7 B;  2JEX A;  1UPG A;  1Y74 B;  3L71 H;  2V7Q G;  1IDS A;  2YIC A;  1K5S A;  3RYF B;  5IJ0 B;  3IC9 A;  3L70 H;  1GMG A;  5C93 A;  2WLN A;  2D3O W;  4EB6 A;  4N23 A;  1Q8I A;  1EM1 A;  4G28 B;  4UFZ A;  3C3S A;  4Q20 A;  2UXD O;  5DM6 V;  5FPO A;  4FM0 A;  2YC0 A;  4CC5 A;  2UXX A;  3CXH F;  2KQX A;  2BSK A;  1QHT A;  5H6Q A;  3BAB A;  1L0L H;  3MHS C;  5J9P C;  3MHH C;  1N34 B;  2QWN B;  4J7K A;  2ITC C;  3H01 A;  4JAS A;  3VOU A;  3RFR A;  2FYU H;  1CPY A;  4FLU A;  5DEC A;  3QO8 A;  4O4I B;  3CP1 A;  2F95 B;  2HKO A;  3LDE A;  2WLK A;  1Y76 A;  5JJE B;  2XHB A;  3OAA G;  4CH3 A;  1B06 A;  4JI3 B;  4O4L A;  1ZL8 A;  4MW8 A;  1ZX3 A;  2YS8 A;  5L3G A;  3KZI Z;  1QQC A;  2EJR A;  3G71 V;  2P5O A;  1M5I A;  1IBM B;  3OTF A;  2QWQ B;  2UXC O;  2EUL A;  5B3S B;  2UUA O;  1HW7 A;  1Z2G A;  4JTD B;  1OCZ B;  1WP7 A;  3JAK B;  4X62 B;  3IFX A;  1X59 A;  4UCT A;  4K0K B;  4P9P A;  1YZB A;  4TV9 B;  3E8B A;  2VS0 A;  4LFC O;  4LF6 O;  4I4T A;  3SYC A;  5LYJ A;  2JVD A;  2RCV A;  4PDR A;  1ARO P;  4DV1 O;  1MG1 A;  1DF4 A;  1JFF A;  4UV8 A;  2ETN A;  3U0Z A;  1O9G A;  4GT1 A;  5B1B B;  2XT9 A;  3JAR B;  4AHC A;  2YEV A;  3F5W C;  4DR3 B;  4BIO A;  3CWB H;  4FLX A;  5IE9 A;  1NZ6 A;  4F6R A;  1R6T A;  1KMI Z;  2LGQ A;  3M7M X;  4B3T O;  1HNW B;  1Q5O A;  4NKG B;  3CC2 V;  1SRY A;  1SS3 A;  2W6I G;  2Q68 A;  2WLL B;  4TUY A;  4DR6 O;  3CRC A;  2ZDI C;  3FYE B;  5DED A;  1N36 B;  2WLI B;  2JJ1 G;  1BSM A;  5ITZ B;  3P30 A;  4B3R O;  1QNM A;  1JVM A;  4DV2 B;  4JI8 B;  1H2L A;  1NR1 A;  3AG3 C;  5KA6 A;  2X6C A;  3ASN B;  4YY3 O;  5JVD A;  4WBN A;  1M93 A;  3CCL V;  5JQG B;  4X65 B;  1WPB A;  1JA8 A;  1Q43 A;  1WP8 A;  4EFB A;  5F2V O;  2Y0I A;  5EK0 A;  1WA8 A;  3DGE A;  3X2Q B;  3CEI A;  1V9P A;  4CC6 A;  4R7C A;  4ABM A;  3LSQ A;  2VQF O;  4H0L B;  3P32 A;  2QEX V;  1MAB G;  3TK1 A;  4LFA O;  4DUZ O;  5KHG A;  1K97 A;  1PNK A;  4J9Z B;  1YJ9 V;  4CH4 A;  2DYR B;  1P84 F;  5IYB O;  3G80 A;  4RUF A;  2X7R B;  4HNA A;  4NXM O;  4JV5 O;  4OPH A;  4JF3 A;  3OW2 U;  3E8H A;  3ABL B;  1N33 O;  3CXC U;  3BHP A;  4HAM A;  4HYO A;  1MSW D;  3RYH A;  1R73 A;  4JI2 O;  2CGO A;  1QVF U;  1XRE A;  3OUS A;  4LF4 O;  4ZHQ B;  5C8Y B;  1XUQ A;  1ZL8 B;  4IYI A;  3WB1 A;  2QA4 V;  4GKJ O;  4K8Z A;  3OD4 A;  5A9G A;  3SPH A;  4GKK B;  3IAY A;  1OCO C;  1I94 O;  1BHB A;  2R9R B;  4PI0 A;  2FL4 A;  1HDJ A;  2P90 A;  4O2B B;  5GW7 A;  4XDL A;  4O4J A;  4DRX B;  4LC1 A;  1E79 G;  4JYA B;  2UUA B;  5BMV B;  1KKD A;  4X20 B;  3M8A A;  1K73 W;  2EIM B;  1WB7 A;  2NLJ C;  3SYP A;  1AJN A;  1D5A A;  1GRJ A;  4LFC B;  4JI5 B;  4CBC A;  2ZM6 O;  4LF6 B;  2YEV B;  3GWK C;  3QG5 A;  4I0X A;  3W7T A;  3EVK A;  4DV7 O;  5B1O A;  4F6R B;  3JAW B;  5LHG A;  4FFB B;  1N0N A;  4J10 A;  2BE3 A;  2K1E A;  3ETE A;  1JJ2 U;  2EJ7 A;  5CBF A;  5LP6 A;  1K4D C;  4F6E A;  2OT5 A;  3AK3 A;  3ZRW B;  4B3T B;  3RVZ A;  1EZJ A;  3TJT A;  3HKD A;  4H13 B;  4MS2 A;  3OUF A;  5J2T B;  4DR7 O;  4UV9 A;  1D2D A;  2B1I A;  3JAT A;  1K9M W;  4ZI7 A;  2F4V B;  4W4K A;  5EC1 C;  3STL C;  5KHK A;  4GCZ A;  1NTZ H;  1AI5 A;  2DQ3 A;  2JRI A;  2KKW A;  1DF5 A;  1NR7 A;  2HR3 A;  1VF7 A;  1WN7 A;  5LGT A;  2DYS C;  3VQW A;  2Y69 B;  4ZOL B;  1R3J C;  1BL8 A;  5EBL C;  4IHJ A;  2ZIN A;  4FK5 C;  3RYC A;  1VMG A;  1I7F A;  4X66 O;  2EIJ B;  1R1B A;  1YF2 A;  4I9Q A;  2A7W A;  5KLV H;  2EIN B;  1FAF A;  3ZN1 A;  2PGG A;  4GYC B;  2XUM A;  5KA5 A;  4DV3 B;  4MTG A;  2H8P C;  5IYC O;  4LFA B;  2QR4 A;  1JPX A;  1G8M A;  1KBH A;  4EEQ A;  1R6K A;  4DUZ B;  1VQN V;  4FLZ A;  3ZHR A;  4J42 A;  3HKC B;  4JYB A;  4FM1 A;  2GSM B;  5J2U B;  5L3F A;  3JYC A;  3RYH B;  1GM9 A;  1WPX A;  1H2S B;  2C2A A;  1WB8 A;  2Y0P A;  4TQF A;  4I55 A;  4LF7 O;  1FYJ A;  1JJO A;  2YDE A;  4NXM B;  3A8T A;  3CRM A;  1V54 B;  1GH6 A;  3HKB B;  4BAY A;  5JH7 A;  1PP9 H;  3B4S A;  2LGW A;  3D3Q A;  3JCU Z;  1M57 C;  1Y74 A;  4NVP A;  3ABM B;  5CBG A;  2R9A A;  4JI2 B;  1FXK C;  3CCU V;  1S0V A;  2VQE O;  3RYF A;  5AG2 A;  1SC5 B;  4MW3 A;  1CEZ A;  1JR9 A;  2XAH A;  4QPJ A;  4O2A B;  4PHZ A;  1S5H C;  1FJG B;  1YEW A;  3CS5 A;  1I94 B;  4LNU B;  4X88 A;  1KD1 W;  1MSD A;  1VQ7 V;  3BA9 A;  2Q5Z A;  1GM8 A;  1PL4 A;  1H2G A;  2JS5 A;  2CGN A;  1EN6 A;  5IDJ A;  1EFR G;  3CCE V;  5FNV B;  5IY5 C;  1L8D A;  3K57 A;  1KQS U;  1RSO B;  1IX9 A;  3GB7 C;  2ZM6 B;  1Q7Y W;  1R3L C;  1L1F A;  4YJ2 A;  3BVO A;  1HNX O;  4BW9 A;  5KHI A;  4LF9 O;  2EIK C;  4AQY O;  3CB2 A;  1V55 C;  1LUW A;  1W2B U;  3FB6 C; 
#chains in the Genus database with same CATH homology
 4W4L A;  3FX7 A;  4J7J A;  2GTS A;  2G38 A;  4IYI A;  4J11 A;  4KXR A;  4IYH A;  4J7K A;  4J41 A;  4W4K A;  4J10 A;  4J42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...