4J1OA

Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound l-proline betaine (substrate)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
369
structure length
369
Chain Sequence
MKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Isomerase
total genus 130
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4j1oA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4j1oA01
4YWSA 4H2HA 2OQHA 1L8PA 4JN7A 2PTZA 4G7FA 4GYPC 4IL0A 3N6HA 3CAWA 2QVHA 3UJRA 2OG9A 3MWCA 1E9IA 3UXKA 3UCCA 1EBHA 1TE6A 3FVDA 3BSMA 3TOYA 3DFHA 4DN1A 3ES8A 4HN8A 1P43A 1JCTA 4ZCWA 2PSNA 4K2SA 2AKMA 2GGIA 4Z17A 2GL5A 3RITA 3H8AA 2MUCA 3TW9A 3T4WA 1SJCA 1FHUA 2PGEA 4IHCA 2MNRA 4DHGA 3TTEA 1SJDA 2OKTA 3FYYA 4KPLA 1TKKA 3Q4DA 3R11A 3IJQA 3P93A 3R0UA 3TJ4A 4F4RA 3PWIA 3RR1A 3MZNA 4K1WA 3FV9A 2GGGA 3VFCA 3NFUA 3RCYA 3MKCA 4MKSA 2PU1A 2PMQA 4ZA0A 1WUFA 3R0KA 2PP0A 2PCEA 2OPJA 3OPSA 2GGHA 2FYMA 2PTYA 1F9CA 4DWDA 1EBGA 3TJIA 2XH0A 1JPMA 3UJFA 3CXOA 4A3RA 2O56A 3QLDA 3VCNA 3I6EA 2GGJA 7ENLA 1MRAA 4GIRA 4FI4A 3JW7A 3V5CA 4HCHA 4ROPA 3ZVIA 3UJEA 3U9IA 4IT1A 1WUEA 2CHRA 1SJAA 4MGGA 2XGZA 4DXKA 5FJOA 3NO1A 3OZYA 1DTNA 2HXTA 5ENLA 4E4UA 2PTXA 3TWAA 1MDRA 4J1OA 3DG6A 5FJRA 3EEZA 3VCCA 1IYXA 4HYRA 3N4EA 4IP5A 3ZVHB 3IJIA 2GDQA 2XSXA 4M0XA 1FHVA 3CT2A 1JDFA 4A6GA 2PGWA 4IL2A 2OZ3A 3S5SA 1EC8A 3DERA 3GO2A 4G8TA 1JPDX 3D46A 3DDMA 3UJSA 3VC5A 3T6CA 3JZUA 2P8BA 1P48A 3V3WA 3QN3A 3EKGA 4JN8A 3RO6A 4MMWA 2PU0A 2OFJA 3SJNA 1EC7A 1MDLA 3HPFA 3DIPA 3V4BA 4HCDA 4ENLA 1YEYA 1XPYA 3JVAA 3DESA 1NU5A 3QKEA 2P0IA 1SJBA 1ONEA 3B97A 1NELA 2OQYA 4FP1A 5FJUA 3S47A 2XH7A 3DG3A 4H19A 5J04A 5FJTA 2NQLA 2PTWA 4M6UA 2POZA 3H7VA 2AL2A 4HCLA 4GGBA 3UJ2A 3DGBA 1TZZA 3MQTA 3TWBA 3SN4A 2QJNA 4GYPA 3DFYA 2P88A 3CK5A 2GGEA 1BQGA 3PK7A 3R10A 2P8CA 4HNLA 4GMEA 2QGYA 3OP2A 3I4KA 3ZLGA 3DEQA 4DX3A 1KKRA 2PPGA 1R0MA 3BOXA 3KUMA 4E4FA 3IJLA 5BOEA 3MUCA 4KEMA 1W6TA 3RRAA 3FXGA 4KT2A 3FCPA 2P3ZA 4E8GA 4KWSA 3UCDA 4E6MA 3GY1A 4H83A 2AL1A 3R1ZA 3N6JA 3VA8A 3I6TA 4EWJA 3ZLHA 2FKPA 3TCSA 2ONEA 2PA6A 3GD6A 4HPNA 3STPA 3N4FA 3T9PA 3NZGA 3SN0A 2PS2A 4GFIA 1XS2A 5EU9A 2I5QA 3SBFA 2XH2A 2ZC8A 2OVLA 4H1ZA 4IZGA 4X2PA 3ZVHA 3VDGA 2QJJA 4E5TA 3QTPA 3GC2A 2PP1A 3P3BA 3OW1A 2PODA 1BKHA 3OZMA 1MUCA 3SSZA 3THUA 4GGHA 2PP3A 3PFRA 4K8GA 3Q45A 3ZLFA 1RVKA 3R25A 2AKZA 2HNEA 6ENLA 3NXLA 3H70A 3H12A 3ES7A 3TQPA 5FJPA 1KKOA 4JHMA 2ZADA 4HNCA 2DW6A 3VC6A 2OZ8A 3K1GA 3V5FA 3U4FA 2DW7A 4J3ZA 2RDXA 2QDDA 3FJ4A 2XH4A 2AL2B 3BJSA 4DYEA 3T8QA 2OZTA 2OLAA 3MY9A 2HZGA 3D47A 1EC9A 2OX4A 2QQ6A 5BOFA 2OO6A 1OEPA 1KD0A 3SQSA 4A35A 3P0WA 2QDEA 3CYJA 3UGVA 3CB3A 3PWGA 1MNSA 2HXUA 1PDYA 3IK4A 1ECQA 3RGTA 1KCZA 3DG7A 1ELSA 3MSYA 4GISA 1PDZA 4Z1YA 5IDZA 1R6WA 3SN1A 2GSHA 3QPEA 3ENLA 4IP4A 3UXLA 2QJMA 3OTRA
chains in the Genus database with same CATH superfamily
2XINA 3GUWA 5C9RA 1EGZA 2Q6ZA 2X16A 3CB8A 3GXDA 3VUPA 2NV1A 1MUMA 2GVLA 3GVWA 3M46A 3EOSA 1KXVA 4Y7EA 1Z48A 1LL6A 2E9LA 3N6HA 4AZGA 3HURA 5C7VA 2G41A 5BRBA 1UP0A 4GO9A 4S3EA 1UIOA 3CUZA 3UA3A 5E6ZA 2VT0A 4WSKA 3R13A 3E96A 3IRDA 4D1JA 3VFLA 1R3QA 4YU1A 2WMGA 2HK1A 4BWLC 1GYLA 3MHGA 3RHGA 4JFSA 3AU2A 3BANA 2G8ZA 2DIJA 2CCRA 3SUTA 4GBDA 1YTEA 2TODA 4FF7A 1BGAA 2EEXA 4EM3A 4UUIA 4QS6A 3UR8A 1FHUA 4OBTA 2D2OA 5HR6A 2XFYA 1A5KC 2WMFA 4OGZA 3TTEA 2FJUB 4GO8A 2YDQA 5KINA 4ROQA 5CPQA 4BQ3A 3WO8A 1EQPA 4K8HA 2D23A 4GQ0A 1OX4B 4GABA 1BWKA 4RUBA 3FV9A 2D1ZA 3ARQA 1GONA 3UWQA 3N29A 3TYDA 4HMDA 3LQGA 1YPXA 4DJEC 3MTWA 3WMSA 2XM2A 2QVNA 4JTCA 2RABA 2PCEA 1XIJA 4D9PA 4FEZA 1JULA 3CH0A 2J47A 4YWOA 4GYKA 2PLKA 3BE7A 5AYZA 5HUOA 2D3LA 2XWEA 3G1RA 3OLDA 3WG6A 3CASA 3BVJA 1O5QA 2CLIA 2PWDA 1BWCA 1G4EA 1IXQA 3B8UA 3VCNA 3I6EA 1N60C 1Y65A 1NOUA 1L6YA 5CXPA 2QCGA 4U5KA 4OOUA 3WQCA 3EPOA 4PA8A 1J93A 1JGIA 1ZSXA 3RILA 3U5UA 4JXCA 4FLSA 1TIWA 3W00A 3K5XA 3M43A 1TJPA 2YCLB 3CHEA 5HNTA 3KOFA 3OHMB 5B7ZA 5C2GA 2X09A 4UQEA 4A2RA 4EPBC 4GC4A 4S3FA 3HIJA 1VS1A 3BPWA 5HPCA 3AXMA 2C0HA 3KTXA 2ZUUA 2C13A 1BRLB 1ZJBA 2A5HA 3KEHA 1ZB5A 3ID7A 1B3WA 2Z0IA 1Q13A 2J7FA 3CV2A 2CFFA 1FFRA 3NDZA 5I3GA 4H4TA 2Y1HA 1H50A 4QAWA 1Q4WA 1ZK7A 1QNRA 1AFSA 1UH4A 4Q33A 2DUXA 3DDMA 5FSEC 1LDCA 4W5ZA 2IPWA 2WZTA 3GKAA 1EGMA 1MWOA 4GUJA 5E70A 5HNUA 1KM3A 1T41A 3LNPA 2Y70A 3TZNA 3HPFA 1JFHA 1C91A 1W1B1 3MW7A 4LUYA 2G3JA 4S38A 1E1CB 1SJBA 1DL3A 3VIJA 1BPLB 1QI2A 3B8TA 1NEYA 4PMVA 4LS2A 5FF7A 2PF0A 1FP8A 3C56A 3UD6A 3UPMA 3INPA 1XQKA 2J79A 2YCJA 3W75A 3CV7A 4AEEA 3B4UA 5KZ6A 3RLVA 1GETA 4GLEA 1NQ6A 5FD0A 1I9CB 2YA1A 3PK7A 1E3XA 1W9BM 4JN6A 1YE6A 1WOBA 3M0XA 1ZY8A 4F0SA 3RAOA 4PB5A 3M0HA 4PMXA 2GOUA 3AAMA 4OZOA 1R9YA 3MSRA 2QGYA 5JVLA 4LOCA 4PUDA 4IIEA 3T8LA 2QJHA 3NCOA 1KRAC 1AUSL 1E5NA 4LANA 4Z2GA 5XIAA 3NQEA 1ZAHA 4HZ6A 2WAGA 4RPPA 1VQZA 3QR3A 1WAUA 1VYPX 3UT0A 2CWXA 2I5GA 3M41A 4H8NA 3RRAA 4ML4A 2WV8A 4E6MA 1UZ1A 3CYVA 4LS0A 2WOQA 1IEIA 5D2XA 4H4YA 3NS1B 4U31A 3OQ8A 2DFAA 2J8TA 8CGTA 3HRDC 3FX4A 1PHQA 4PYSA 4K39A 3W28A 2WB5A 3NSNA 4EQSA 4E2BA 3A12A 4AMCA 2JALA 1W37A 3VDBA 4ZXOA 5DANA 5IDIA 2PP1A 5LYRA 2BDQA 5L6UA 2QKFA 1UH2A 5GPRA 3QVQA 1DQWA 3THUA 5CGTA 3L5OA 1XD0A 4L64A 2A3AA 3W7NA 3ZLFA 3GBEA 5H8PA 4NT0A 1L0PA 2EG7A 5D9PA 3N15A 2ZUWA 3ES7A 3MP3A 2XIOA 1F3EA 2W3RA 4AZCA 2ZZ5A 1F74A 5E6YA 1FOBA 1OZQA 5I02A 4M82A 1OSEA 1N62C 3LHWA 2ATSA 3RPMA 1RJPA 2Z6IA 2UBPC 3CQHA 4G1KA 1NP2A 3WJSA 1YDVA 1VBRA 1BYDA 2Z24A 3AQUA 4ZB5A 1PWLA 3HOJA 5XIMA 2PFHA 3EDFA 1YPFA 6ALDA 3HV8A 4DXVA 2REQA 1FQ0A 2ZWYA 4GY1A 4O54A 3A9BA 1C8QA 3A4WA 4OT7A 1MZRA 4J57A 4DJDC 4HU3A 4FSAA 2XWDA 3VNYA 2R24A 4S2CA 1KBKA 4ES4A 2HBVA 3NQFA 1EHAA 3OTRA 5AOUA 2OJPA 4JYDA 3BCJA 3IC9A 1E0XA 3PC0A 4HU4A 2GUUA 1H7XA 1G7VA 4E8DA 3IJ8A 3ZWSA 2XDFA 3UJRA 3T07A 4IMAA 3BURA 3TN4A 4IISA 1UR8A 3GTFA 3CH9A 3MO7A 4LCSA 3UXAA 3P6LA 3U48A 1UP2A 4J3WA 5AYYA 2CLHA 4L1XA 4ALDA 1FHLA 1VRXA 3W7PA 2VX5A 3SW6A 1EXBA 3W6YA 4INFA 4XO6A 2R6OA 2VX7A 4GVFA 1TPH1 2TSYA 5AVNA 2VWTA 2FHBA 2F84A 3CUHA 3PTMA 4CCEA 4IHCA 1T8QA 3AWOA 3T0AA 5TQLA 3K46A 3MSDA 4M80A 4OQVA 1O1ZA 4Z42C 2R9ZA 3DHPA 3S6TA 5JUVA 3Q4DA 4JIEA 4U2ZA 2NT0A 5CJMA 4Y9PA 1TQJA 2WWDA 3TJ4A 4UR8A 4B91A 2WVVB 4NZ5A 4NZCA 1GVOA 2VHLA 5BOOA 7A3HA 1VC4A 3NDOA 2WP5A 2EXOA 2ZA1A 4ERAA 1AW5A 1T5AA 3MWAA 4UB9A 4U2YA 1W5NA 4XVDA 4JTQA 2DZVA 2V3EA 4GVIA 1NIUA 3TMQA 5FF3A 3BAYA 2YFNA 3NZQA 3I68A 4MIMA 4AD4A 5DBUA 2E4TA 1XSJA 1PZ3A 2ISVA 1LL4A 3TJIA 1UKQA 4IFKA 4V15A 3VX1A 3QM3A 4P8UA 4A3RA 4HTBA 7ENLA 2PWVA 1BVWA 3H2NA 3UGRA 1Q63A 3POCA 3NO5A 5LNVA 3GHUA 5REQB 4HZMA 1PZ1A 3AS2A 3U9IA 1YTKA 2CZVA 4GYFA 4AY7A 3O15A 2W5FA 3LPFA 4Q4QA 3NVZB 4C1NB 3U4AA 1SJAA 4PTNA 4B2DA 2O4QA 4NIRA 3WF1A 3RU6A 3G1FA 3U2CA 1U5HA 1FDJA 1DOSA 2VTFA 4FXRA 1P0DA 2X8HA 1XGDA 1JCJA 4NJKA 3WSUA 1G01A 1FKWA 3EDDA 4PBGA 2FMOA 2QDGA 4XZBA 4BCEA 4M52A 2FZ8A 2OTDA 1A5CA 3CHDA 3CT2A 5I77A 1JEHA 1FVPA 1K8XA 4B4HA 3B8SA 4A3QA 4JL2A 3EAUA 4D6JA 1KGWA 4IX0A 4DNMA 5I3DA 1KM0A 3W2KA 4OU1A 1P1MA 4K38A 3LX9A 3BXWA 1P48A 2E40A 3EX2A 1KO0A 2PU0A 4AZCB 1GVSA 1PBGA 4D8AA 2WJFA 5LA0A 1JQVA 3UR5A 2VXNA 3NQ6A 3V4BA 3WDQA 2AGKA 4GY7A 1YEYA 1LBMA 1DP0A 1TG7A 2OWWA 2QCNA 1KR1A 1YTDA 2P0IA 4GVGA 5HQMA 5CC5A 2GVJA 4HJWA 1AD4A 2C3CA 3PBWA 4IP7A 2WYSA 3DG3A 4H8UA 3QZ6A 1XXXA 3LUTA 5FMHA 5E0KA 2XFRA 3T81A 1ONFA 1VEPA 5EMLA 1E6PA 3TWBA 2V5JA 1JYXA 3ABOA 4LUTA 3QOKA 1TPC1 4R7OA 1CXFA 3TAKA 3DOPA 1ISWA 1I4NA 2C1HA 2I1OA 5DO8A 1UKPA 4CN1A 3CQJA 1ZAIA 1CB2A 3ALFA 3NL3A 4YXGA 2RFGA 2Z1KA 4Q8UA 4GH3A 2V30A 4JFWA 2P1FA 4MJ4A 4M1RA 5HA7A 2Q09A 3G0SA 3AI0A 4KETA 3VOCA 2EG8A 4LUSB 5CZJA 3WL0A 4AFYA 1Q1RA 3FKRA 1M41A 4WKHA 4IIBA 3VI2A 1K02A 1XQLA 4RX0A 5AC4A 4F40A 5EU9A 4QJ4B 1WKFA 1W9PA 1HTIA 5DQPA 3VABA 1DWGM 5HQLA 1J10A 1L6FA 3SUSA 2V5DA 1QU4A 4WGXA 4ZQRA 5MF5A 4AW7A 2QJJA 3H24A 4H41A 2A3BA 4GI6A 2DZSA 4GXWA 4JQ9A 1TV4A 3C86A 3KW3A 4MB5A 1CGXA 1P7TA 3ARZA 4AF0A 1X7IA 4LRSA 4XO7A 4ZEPA 2BOFX 4JNZA 2WOIA 3ITXA 1GXFA 1Q4NX 4I3GA 1ZP3A 2VC9A 3EOLA 3IUIA 4C6CA 2XIJA 1HVQA 2GWNA 1WXYA 5FACA 1SW3A 1FUYA 1E1EA 3NEVA 4LXFA 1SFLA 4L4PA 4O52A 3S5YA 2W67A 2AL2B 3QFEA 4KS0A 4RE3A 1K4GA 4GQGA 4Q7BA 3TDFA 1HP4A 1JL8A 4UTFA 1YDNA 4IFKB 1KBIA 4KERA 5TF0A 4NZ1A 1KM1A 2YXOA 5KSWA 3HPXA 3VZXA 3PZNA 4BKNA 3DBNA 2V9DA 3J7HA 1JZ3A 1HKJA 1DNCA 4M6PA 2QAEA 2X05A 3AS1A 1RQHA 5A8MA 1EWDA 5CAKA 3AIBA 2F2KA 4FIRA 2QIIA 3S1VA 2YL8A 4UZSA 1QI5A 3DENA 2FQIA 3ZR4A 3MANA 3G0UA 1Q6EA 1CGYA 4FX8A 3BH4A 2EJAA 4XTDA 4K3ZA 5GNXA 4PUUA 1K9TA 4IQEA 1UMYA 4GNKB 1MO9A 2WLZA 3WH6A 3E0IA 3M6DA 3RMEA 1T8XA 4N9CA 4YLWA 4AZ7A 1IWAA 3L9CA 1XCFA 1XIFA 2ACSA 1ZALA 4M1BA 2WW5A 5FIPA 1OF8A 3TU9A 4HT3A 1N61C 3R12A 3FVDA 3RDKA 1GVRA 8RUCA 1J6OA 4NX5A 4Q8QA 1P43A 2Q02A 1EA9C 1LRQA 3W6LA 3HPZA 4OE7A 4DUWA 1CLKA 4YL2A 4H9UA 5K3VA 4UQCA 4IMGA 1LQ0A 1XBYA 1TV3A 4C7DA 2PGEA 4W4QA 4ZQOA 3I3DA 2X2YA 2QZRA 2NSXA 3DU0A 3B9DA 4GQBA 1GEQA 2X1SA 3QHOA 1CECA 3W73A 1DE6A 3M07A 4QGCA 3F4VA 2WNNA 4CKQA 4E0CA 3KS6A 2WMIA 1ZFJA 4QHRA 1E0TA 1OCBA 2WMHA 3ABZA 3H4GA 3RCYA 1ICQA 4I7UA 4YPJA 4WJ8A 2BFGA 1QUMA 3WENA 1QAPA 1RALA 4ATDA 4DEFA 2PBOA 3PBYA 2O9PA 2XN0A 3ME3A 3MJMA 4HPHA 1HL8A 1L8NA 2ZZ6A 3M5YA 3P8IA 4J5NA 4K68A 3C8NA 4GZJA 4JIRA 3PTQA 2V3BA 3EB2A 2FZMA 3DKJA 1GOWA 1VEOA 1US2A 3FVMA 4HMEA 3FFSA 4IOTA 5FEXA 3N14A 2PDGA 4UCGA 1KCKA 1VFHA 1VPYA 1ZJIA 3W7IA 5LGXA 2VFGA 3AYTA 4EXAA 1LL7A 4N02A 1LF1A 4WHBA 1UASA 6CGTA 2ICSA 1C7SA 4A22A 2XGZA 1GJUA 3PG9A 4DI9A 4ZE5A 3URNA 4LNCA 4XKYB 3NO3A 4DXKA 2Y7EA 4TV6A 2Z2AA 2X8RA 3M0ZA 3VD3A 3KVKA 1LLZA 1DKWA 2O9RA 4U28A 1IT0A 1ZMCA 3A13A 1KN0A 2Y7GA 2YJQA 3U5YA 1CBGA 3N4EA 1LJYA 3EA3A 1XF0A 3DCPA 3VD9A 2BMBA 4C6IA 1H1NA 1UW9A 2OZ3A 3CPUA 3SJ3A 1AW1A 2QV5A 1P7TB 3HJEA 3GTHA 2JK2A 5JBEA 2F6KA 3D46A 3G0XA 2J7EA 1ITCA 3L66A 1HJSA 2XN2A 4WIWA 4QITA 3L0KA 5FSDC 2ZRVA 2PRHA 2C3ZA 4CCZA 6XIAA 3SM0A 1TCDA 4ZQCA 3GNDA 1QHZA 4QJ1A 3QV9A 2P76A 4LGXA 2ZE0A 2YX0A 3DIPA 3UWWA 1ZMDA 3L12A 1MXSA 1EEXA 3DESA 1Q6LA 1TPWA 1QOPA 3I3BA 4OV4A 3VM7A 1ADOA 1W3JA 3G3MA 3GH4A 4C6LA 3M9YA 2Z2UA 5TNVA 3TC3A 3TSDA 3NPVA 5CG0A 1AA1B 2J27A 4DUVA 4WDTA 3NVYB 3K4DA 4CD5A 1W3IA 1HGWA 1FDYA 2ZZ4A 4AWTA 1FH8A 3PSWA 1BQGA 4CD7A 3URAA 4DO7A 2EPOA 3DN5A 2XSBA 2A8XA 3QMSA 1FWSA 4QG9A 3W9ZA 3BLIA 3WLIA 4N9DA 4LYPA 1KGUA 4DAIA 4FDCB 3NVDA 3WX7A 3V18A 2Y24A 2VZVA 3M47A 3TKFA 2Y5EA 1OJXA 2WHKA 4JEJA 3P62A 1HX0A 4FNPA 1H1ZA 4CUCA 3VGBA 5A6MA 4P8XA 4UIOA 1TRDA 2Y89A 1ZDLA 1KW1A 1RH9A 3RN6A 4TVYA 3FDGA 4RE0A 4S3AA 4C65A 2Q3RA 4GYJA 4F2TA 4PRRA 4H83A 5HJXA 2CHOA 4CEXC 3LSCA 2HWGA 4HMNA 3W7DA 4HPNA 1VYSX 4DAFA 5XINA 2ZZBA 4XZIA 3CMJA 4IX2A 3SN0A 5B80A 1S3HA 4LF2A 1XFBA 4NG3A 4U3AA 4YNGA 4ERIA 2ZUSA 4NXSA 2AGTA 1EQCA 1E73M 1U2YA 4UNKA 4F0HA 2QCCA 2FTPA 1AODA 1JPIA 4Q7NA 4B90A 3MJYA 4RR4A 4FOUA 4APNA 2GUYA 2BY1A 1EDQA 4M6VA 1PUDA 5D03A 2V68A 2VGBA 3RR4A 2DZTA 2IPFA 5EMUA 3K4AA 1RVKA 2PE4A 2INZA 3JUGA 4Q4KA 3AOFA 4DJFA 2QEZA 6ENLA 5IFTA 1EF2A 3E1F1 3QLLA 3RXZA 2WBGA 4HSNA 3TQPA 4TX9A 2J8FA 3O0FA 2PBGA 2J7GA 3VC6A 3HG3A 1RJQA 5F2GA 2YXXA 5D9NA 3QYQA 4ZBCA 3U2EA 4Z2HA 3OJGA 3C52A 4J2MA 4GXMA 3DYPA 1U30A 2PDPA 1V6WA 1J2WA 4ZSUA 1OIMA 4H8HA 4HOXA 9CGTA 4UC5A 4O1AA 5U7SA 2IPGA 5J8LA 1Q85A 1VPQA 3U7BA 4H4WA 3BJTA 1NP0A 1WDDA 3E5PA 1OEPA 1WP6A 1S7MA 1C29A 3H2OA 1WPCA 2QCDA 3DUGA 1XPGA 1JR1A 3LI0A 3DKLA 1X1NA 2WMJA 3RGTA 3UNDA 2ZRUA 5C70A 4DJDD 3MSYA 5LNSA 2G3IA 1O1HA 3CQIA 3WQOA 1QASA 5CSRA 5DMYA 3W71A 2ESCA 3K2GA 3SFWA 1O60A 4MF4A 3QFBA 3Q37A 3ENLA 3C4UA 1AD1A 1RA5A 2YQUA 1VBHA 4J3TA 1QNVA 4AWEA 1D3HA 4MWAA 1RZMA 3QRHA 1GORA 1NHQA 4MWAE 3MWCA 3UXKA 3WMBA 4LBUA 2D24A 3KFTA 1QTWA 3ARSA 4HZ7A 4DN1A 1FCUA 1NTHA 4PB3A 1W1ZA 3L0NA 4NNBA 4DWSA 3ITCA 4AZIA 1JAEA 1B54A 5I3IA 1KQZA 3LG3A 2GL5A 3UFYA 4O4WA 3H8AA 1H62A 3BV7A 3UG4A 1REQB 2VP8A 2YBVA 5AC5A 3W76A 2BVWA 3CT7A 4M6QA 4XBSA 4LY8A 1KRMA 4OBSA 1FWEC 1TKKA 3TW7A 2OWCA 4P7OA 2DSWA 4PSPA 1P6CA 3CBWA 1BAGA 4K1WA 1OT1A 3WQWA 1RM6B 1UZDA 2EQ9A 3VFCA 3PJXA 4HIBA 1TR1A 4QDWA 1XIEA 1GKPA 2GR0A 3WD1A 4MKSA 4PODA 4M3PA 2BV9A 4BY3A 5H8UA 2WOWA 3OIHA 5HANA 1CWYA 4X63A 3PZ9A 2FZ9A 1L6WA 3CHVA 5FS8A 5JBFA 3F5KA 2KX9A 2PTYA 1O95A 5K2ZA 1JUBA 3D9XA 1CGTA 1FWRA 3TYUA 4HPGA 1JPMA 1XIIA 2Y2WA 4LS1A 2O56A 3WQ4A 4IPJA 5I78A 1GREA 4AZ5A 4PH6A 2OSYA 3UWEA 4JGDA 4ZOHB 4DUOA 2ZOXA 3MHUA 4MHBA 4B3ZA 4K7VA 4C6BA 1B4KA 3GHSA 1EJUC 2NPXA 3M0IA 5U25A 4C5YA 2HCVA 3KBJA 2D20A 3WD2A 2VYOA 4E4UA 2ZUNA 3LENA 4W8LA 3RM8A 4AEOA 2CKRA 2VC5A 3APGA 4IP5A 1SR9A 2NV9A 1YQZA 3SURA 1LBFA 4WX2A 4UTLA 4A6GA 3LCGA 3CJPA 3H2CA 3EWZA 4GI8A 5DY2A 4Q4OA 4G8TA 1ZJAA 1XWYA 1JPDX 3WZ0E 2HE8A 4PB4A 5D9OA 2ZCGA 4M29A 1U1UA 1KFWA 4GHRA 4L56A 2VGIA 1BXCA 1F4AA 2WC4A 3UNTA 3QHNA 3HQOA 3EKGA 4F0MA 3SJNA 3BGJA 4IMCA 4RL3A 4F79A 1H7NA 3NQ8A 2CHNA 4M8UA 3VMOA 1G0CA 3NAVA 1D8WA 4J35A 4UQ9A 3W2UA 1MFUA 4G2DA 4H8VA 4O8AA 3TJXA 2KZHA 4GZ7A 4H01A 3SGUA 1IWBA 1H6VA 2ISWA 1HKWA 4K7ZA 1F5ZA 2J7BA 1YADA 1TWSA 1S5NA 3UJ2A 5EB8A 5FS7A 1IIHA 1GZGA 2MANA 2P5NA 2ZA3A 3L4VA 3P0XA 4Z2IA 2QPXA 2V5CA 3T0TA 3QFAA 2CESA 3R5EA 3WH7A 3T0CA 2IXUA 1JCXA 2GGEA 2V3AA 1UHVA 2ZYFA 1W32A 1V6VA 2CZDA 3AMDA 2BZNA 2FB3A 3MV01 1GQIA 2VD8A 1MYRA 2RDTA 2A7RA 3NURA 1RA0A 4GMEA 2PGFA 1RBOB 4HYVA 4IIFA 3OBEA 3A3WA 4UQDA 2PC4A 2GJNA 3UWYA 1Z32X 2JE8A 1XLMA 4QDMA 4AIUA 3NZ1A 3A7UA 3O1NA 2FVKA 2ZX5A 3BOXA 1UBPC 3EDKA 3IJLA 3TN6A 4X22A 1I2RA 2YFOA 3CAVA 3MPGA 4MWAB 5TD4A 4KT2A 4P7LA 3ZMRA 2XVPA 2Z1VA 4PMDA 1S38A 1E72M 4EWJA 1BYCA 2WVUA 3M0KA 4QIUA 2E6YA 3PZIA 4O1DA 4OKDA 2PA6A 1AMKA 4S3KA 3F2CA 3W24A 1MEWA 1Q65A 3AIRA 3PS7A 2QLYA 2I5QA 1AZ2A 4PE8A 2XVGA 1VCVA 2DP3A 4V1XA 1V0MA 3VGDA 3QTPA 4HSOA 2E5CA 1JF5A 2PODA 1BKHA 4NAEB 3K8MA 4B5NA 1K3UA 4X2RA 1GTEA 2XZ7A 3OGVA 2X50A 1GERA 2VURA 3UWVA 4KKXA 3SUUA 1JQXA 4JHOA 3VNKA 1UR3M 2WZEA 3NNTA 5D37A 1RCXB 1EHNA 5DXXA 4A3HA 2V6OA 1UROA 1FWIC 3AJXA 4RE4A 3GWQA 5H8MA 4PTDA 4UR9A 2WP6A 5T9CE 3N17A 5HNNA 4WXZA 3IAQA 3D5HA 3ICJA 2PWEA 3KBSA 4US5A 3VGGA 1W5PA 1X97A 1XRVA 4JX4A 5LIKX 3SECA 4AXKA 1T7LA 2J77A 3GFXA 1DJZA 1B2YA 4MKNA 2FGLA 4NRSA 3OHIA 1UD5A 4ZSTA 2PDJA 1J0IA 1V59A 3CB3A 2DJLA 3T09A 3W72A 3EWUA 3M7SA 4PMQA 2V5KA 4AVNA 2DSKA 3HGRA 3KCJA 1QO5A 2Y5JA 1PDZA 4OTKA 2PWUA 3GXIA 1V3KA 5C2XA 4UFIA 4QCEA 2WHLA 3HQPA 4B5TA 1W5MA 2VFDA 1F07A 1GW9A 2ZIDA 4W7VA 1QWGA 4IP4A 3SCUA 3LCFA 1JDCA 4WEVX 4AH7A 4KMQA 2BASA 4WD0A 1VB9A 4EAYA 1G1YA 2P10A 2QVHA 4GR1A 1XLAA 3VKJA 2AQVA 5JRBA 3T44A 3UCCA 4W87A 1GOMA 5JMUA 2ZDSA 3CMGA 3TOYA 3ES8A 4HN8A 1N5XA 4W89A 5ABHA 3NA8A 4DRSA 3QOMA 3UZYA 4MNLA 2GSJA 4DO5A 3T0DA 4BEQA 4FNTA 4WSJA 2NV2A 3L7RA 1MW1A 3S42A 2BVDA 2QMKA 1HL9A 3MBFA 2G3NA 4IPNB 4ZOAA 1JCMP 3L23A 1PZ0A 4RDWA 4PSRA 3BZGA 1M7XA 3B40A 1GW1A 2OYMA 1B3YA 1WO2A 4GWEA 4WJXA 5LA1A 3N73A 1DIEA 5GJPA 1P6BA 4MADA 1TR9A 4L1WA 3NFUA 3WYZA 3MKCA 1D3CA 4LUJA 1WB0A 4OFCA 2RDUA 3CO8A 3TXZA 3QQ0A 4I7WA 2FGBA 2WQDA 5D4YA 2GQ9A 3IACA 3FK4A 4QSFA 2Q8ZA 1SGJA 4DJFC 2GJXA 4H6EA 5RUBA 3QEZA 4CVWA 4Y2WA 1GQJA 1UA3A 4EX4A 3LU2A 2BY2A 4CEUC 1EJRC 1BGGA 2SFPA 4JR5A 4AD5A 2OT1A 2R9RA 3C2YA 2CHRA 1ZUAX 4YHEA 1XYAA 5C9ZA 4ICCX 3EOOA 3TTSA 2NVDA 2UY5A 3G5EA 4HP5A 2NQHA 4MAVA 5ENLA 1DXEA 2KAUC 3UZXA 1EUNA 3USBA 4MNMA 2OT0A 4XZ9A 3FA4A 5GNZA 3VCCA 1JXKA 2PZNA 2E1DA 3CWHA 3NYDA 2OX1A 2YCKX 3B3DA 2X41A 2WHJA 2XSXA 2ZRYA 1E4IA 3LSBA 2PI6A 4QJ5B 5C8BB 3FY1A 5G5HB 4GUIA 5D04C 4FNQA 3NPUA 1IZKA 1FWHC 3TOPA 5AHMA 1JDEA 3A4JA 1S2CA 3UCQA 4IGNA 1H0IA 1RUSA 4Z1AA 2DH3A 4L1GA 2E5BA 3B8WA 3UJSA 7TAAA 3IGHX 4JBRA 3O9NA 1T96A 5ECUA 1XUZA 1K9DA 3JZUA 5HJLA 1BD0A 4L9YA 3UBPC 2W0UA 1IXPA 1V3MA 1ZKQA 6REQB 3QMRA 1SZGA 3ABXA 1NFGA 1Z41A 4MJMA 1OK6A 2WNQA 2ON3A 3MUZ1 3QGAC 3OGRA 4LWWA 4DO6A 5LHFA 4EQWA 4EQXA 4QISA 2PD5A 1NARA 1KV8A 4MWAC 4CCCA 4UTUA 3B97A 4UBPC 1ICSA 2WVSA 3DHUA 2WPBA 5K7JA 1V8EA 3LHUA 5E9AA 1BYAA 2PTWA 4BF5A 1PX4A 3WD3A 4C1KA 2BVYA 4L6OA 1AW2A 3VX0A 4FHAA 1ZS2A 2ABBA 2HS8A 3DGBA 4DWSC 1J0KA 2BGSA 1HFBA 2JKAA 1ITXA 3P7YA 2JKEA 4CCDA 5M5DA 3NRZB 3R10A 3BG5A 1XH2A 1NWRA 2Z27A 5LIXX 1TTIA 1FXPA 4DYKA 2ZUVA 1POKA 3VIPA 3BG9A 1Q7MA 4F66A 1EJVC 3CL7A 3UESA 4DBEA 1V0NA 3T2OA 2ZZ1A 1EPVA 2X42A 1GPFA 3GRIA 3EMQA 7TIMA 2Z7GA 2VO5A 2EQ7A 3GM8A 3LMYA 3WFZA 5HK4A 3LHTA 4F2BA 4NF7A 1W54A 3WQ8A 1W6TA 3FXGA 1JCLA 4HTYA 3UVIA 1EJ7L 3G1XA 2AL1A 1JIBA 1P0KA 5LNUA 2J7DA 3TW6A 3IANA 3II4A 4OIFA 3W01A 1UD6A 1XISA 3MUY1 4RNHA 3N34A 4V27A 2HS6A 4C6JA 3NVWB 4L4LA 3VDAA 3SCPA 4UTMA 1A5NC 4ZXLA 1JAKA 4J4KA 1XFCA 3OZMA 1GKQA 2WO5A 5E5CA 1TMHA 1EOMA 4NNCA 3S6DA 1A5UA 2G3FA 2PURA 4S3GA 3YPIA 3Q6JA 3GDLA 3O6CA 2VJXA 3G24A 4NX0A 3H70A 1QFEA 3H12A 3F2BA 1CPUA 1P1XA 5EBAA 1A5BA 2XM1A 4G7EA 3UA4A 4AUBA 3A7RA 1I8JA 2VDHA 3WJWA 2EPHA 1O68A 4EF9A 1CLXA 3MV11 3PP7A 3O63A 2FZNA 4EXBA 3NPWA 3S3GA 2WSYA 3IJ7A 3GB6A 2QDDA 1TTQA 2GFTA 3TYAA 5BW6A 2INFA 2V0TA 1VRDA 4U4MA 3RMJA 1GVQA 2G3MA 4QAIA 5F7UA 1GRBA 8TIMA 5DF0A 3LA4A 2R1LA 4Q8TA 1LCOA 3W7GA 4EMWA 4LBRA 3HO8A 1RV8A 4O19A 3UGVA 4B5UA 5LZLA 1PCWA 2E6DA 2HXUA 4FOJA 4Y8EA 2TMDA 3FDKA 5DY3A 1HNYA 4AYGA 2VZTA 4TIMA 1ONWA 5LIYX 3DK8A 2PZ0A 4NYUA 1J0JA 4H04A 3O05A 3QPEA 2D69A 1JG9A 3V35A 2VFEA 2YSWA 3LXDA 3W83A 2ANUA 4UTIA 3AUJA 2HQMA 4G7FA 3IPWA 1QI4A 1XIDA 4ZMGA 4W84A 4O0ZA 3RU8X 3CO4A 4TO8A 3W7MA 5CC3A 4PCNA 1DJYA 2WJEA 1TPDA 3OVPA 2TYSA 1VGAA 4I5RA 1WDRA 1E4NA 4QG6A 4LV9A 3MUIA 3F2DA 4ZQMA 3UYCA 4IQJA 1OZMA 1Z69A 2AKMA 4IJRA 2J62A 1OK4A 1KLZA 4IUGA 4J9JA 1OYAA 2PC8A 4WOQA 3O16A 3GXPA 2DIEA 1TWIA 3T78A 1SJCA 3L4UA 4OHQA 4MNKA 4FK9A 5BXPA 3ZJ6A 1XR2A 2W9MA 4QCFA 2WPGA 1LG1A 2OLSA 4W93A 1XYCA 4WY0A 3O8AA 4NEVA 4KRZA 1XUUA 4A8LA 2BWGA 1US0A 2I57A 4EXQA 1DXFA 2E9MA 1CDGA 4O0QA 2BODX 2I14A 2AOSA 3TQ0A 3K13A 2PMQA 3BAWA 3GVQA 5G4HC 1E71M 3R0KA 1GOIA 1W5OA 2YBTA 1R3SA 3QFWA 1JD9A 1W5QA 5LNWA 1ME7A 3GBDA 2A4AA 3VD7A 4F0KA 3MKKA 1T6MA 1F9CA 3GXTA 4NZFA 4WR3A 4B3LA 1W31A 4BQ2A 3IARA 4JTEA 1W56A 1PVNA 3GNNA 1R7OA 4AIEA 3W88A 3V5OA 3GW3A 1OGSA 2R82A 3MB9A 3BO9A 3QLDA 3C0QA 3NL2A 3CGCA 1R9XA 2GGJA 4ZO9A 1CW2A 1LG2A 3WH8A 3PN8A 4XZNX 4LA1A 2V3GA 2E5AA 3JZEA 3W2MA 4HVXA 1MVYA 4GBUA 4EPDC 3UJEA 5D05A 5HMFA 3XIMA 3PBMA 2Q8LA 4XZMX 3DHDA 2GH5A 3E6EA 1ENUA 1Q6GA 4WDWA 2PDHA 1SZNA 2AMGA 1E0VA 2IMRA 1XCWA 3GG0A 1A4MA 3GZAA 3PTDA 4NJIA 1HL2A 1R3RA 3LZ5A 3I65A 1XHCA 3SRHA 3FN9A 3IIZA 3ITGA 5EMMA 3FYOA 4QR6A 3URQA 1OFAA 2X1TA 4TU1A 2E1WA 4QP0A 3R58A 5FAGA 3LERA 4BJHA 2E9BA 2VNCA 5FL1A 5JCKA 1ODUA 1Q8AA 5CLWA 2POTA 5ABFA 3OVRA 2PDMA 1V77A 1VFOA 4KESA 2NUXA 1DJQA 1XBXA 5M17A 1TPEA 1VCGA 4G7EB 1W3HA 3COTA 3OA3A 1YNPA 1R2TA 1US3A 3CGEA 4BF7A 1MDLA 1ISZA 1YRRA 2FTYA 3ZZ1A 1W9XA 3JVAA 3AISA 1DIKA 1O66A 3PM6A 2CBUA 4GKTA 3W37A 5ABEA 3AM9A 1F3WA 1QNOA 3UWUA 2XH7A 3G1HA 4EQRA 4P7QA 1LORA 3MA8A 1QNQA 4M6UA 1CCWB 1EL3A 3ECQA 1ZPTA 3H7VA 1UZ4A 1XIBA 3U0HA 1VLWA 4GYPA 1GQKA 4B5VA 4BI6A 2TPRA 3P60A 2OMAA 1Q2SA 3QBUA 4JAWA 5CLTA 3BSHA 2CLFA 3S2NA 1FKXA 2G5WA 3R79A 1JI1A 3IWPA 2YB1A 3FOKA 3OC4A 3H21A 4C6OA 1VFUA 1GOOA 4MDPA 2R94A 2E8YA 3TTQA 2X1UA 4AVFA 5M3WA 1GYNA 1Q6CA 3CUFA 5IHSA 4M7TA 3QQWA 2G95A 3APTA 3LV5A 3CNYA 2DSZA 3WF4A 2FLIA 1UKSA 3WBAA 4NSBA 1MFVA 3LM7A 4C6DA 3N9KA 1I6NA 1A5AA 3NGJA 4I9MA 3WEOA 1GRAA 5FS6A 3L67A 3NQ2A 5EY5A 1KM4A 3K1DA 3S2JA 1GJWA 3AS0A 5MKGA 1G67A 3GG1A 1IR2A 1GZJA 3GC2A 3L2LA 3VGHA 3W2NA 2VX4A 3SGGA 3SSZA 4JIIX 2UWFA 1UJPA 4B9YA 3VKBA 2QCFA 4JIHA 2QMJA 1J01A 3GLCA 4WY0B 4UFLA 2HEJA 2Y4SA 1KXHA 2V3DA 3R8RA 2DEPA 1MW2A 2DY3A 1RCOB 3QXBA 1XIMA 2VVNA 4JTJA 3CZLA 3GK0A 1FO4A 4WDXA 1RD5A 4EOUA 3GUGA 4IMEA 4N9BA 2QUMA 3R8GA 4HQVA 4NAFA 3QW4B 2RUSA 3K8KA 4J3ZA 2E09A 1JNDA 4UTJA 3FJ4A 2QJIA 4H4SA 4ATLA 4LCQA 4XBKA 1EUAA 3N04A 3E38A 2NX1A 4UZUA 3AIQA 1XIGA 3AMZA 1QW7A 1J96A 1E0WA 3NWRA 1A5SA 1GRTA 4AD2A 4RW3A 4S3CA 3KXQA 2JGYA 2YL6A 3W26A 4GCAA 3G18A 5BOFA 4JTKA 4FB7A 3TC6A 1KD0A 3SUWA 2ZXBA 4D8LA 1EWEA 2IKGA 3E2QA 3W7CA 3CEUA 4ERGA 1V6XA 1AVAA 1W3NA 1E6XM 4HJFA 4RLIA 1XYZA 3REQA 4A2SA 1J0ZA 1NDYA 1UCWA 4DPQA 1R38A 1Q6DA 1XYLA 3WDJA 3SN1A 1K03A 4GG9A 1UR2A 3PF3A 4AY1A 1OFEA 1G4SA 3OVGA 1ZNNA 1PKMA 2EO7A 1QCWA 2AAMA 2FPVA 1HN1A 3CUXA 1JUEA 4J3UA 2OQHA 2V2HA 1CIUA 3ZQ9A 4JX6A 1A3HA 1XRFA 2WCAA 7CGTA 4MPKA 1K6WA 4NY2A 2V69A 3SCNA 3R89A 4QXIA 1MRQA 3BAJA 4PMZA 3I4EA 2DZBA 3T42A 1OF6A 2CERA 1Y5XA 2OG9A 1EBHA 2QCHA 4HZ8A 1OFOA 4Q8PA 1NOFA 1C8XA 5ABFB 3KBMA 3W1PA 1T99A 5AC7A 4O1CA 3NSXA 3WK1A 1JCTA 4KWWA 1VBGA 2QIWA 3UPWA 3ITYA 2E5DA 3KBVA 4NHVA 4Z17A 3EX1A 3GXNA 3ZWTA 2I9UA 3LB8A 1UWAA 1UQZA 2OKTA 2FIQA 2GQ3A 4XISA 3FYYA 3SDOA 1GVFA 1LWJA 2XIMA 2C3DA 1V02A 4XX6A 1M1BA 4AWSA 4NILA 1V02E 2QAFA 2XHYA 5FCZA 1VYRA 1X98A 5HULA 4LBSA 3BWWA 5JCLA 5FA5A 2G4FA 1HJXA 4JOMA 1R7AA 2GUBA 4DM1A 3SQPA 4E38A 4ZA0A 4AAJA 4FX7A 4QSHA 3UQNA 3DJGX 3E2VA 3WJXA 4BZYA 1H49A 2ISFA 4C90A 4DLMA 4O10A 3MKVA 2E0PA 3S1XA 3LLDA 3D6NA 3CTTA 1Q2RA 3VZYA 3W1LA 2E68A 1I2NA 3MCOA 4DJFD 4IPLA 1CZ1A 2FPTA 3PY2A 1DBTA 1JOAA 4QE4A 1VLIA 1I45A 1B90A 4HCHA 3AXIA 4IT1A 3HF3A 4BA0A 2A7PA 3M0LA 1QRQA 2WCGA 3TNOA 4H4VA 1W3KA 5U1OA 2J9YA 2OEKA 1ZCOA 3CIWA 4IFRA 1M5WA 1W9DM 5HMSA 1O6IA 4I7VA 4Y9NA 3W1NA 5CZKA 1DTNA 3BL3A 1P6WA 1A0DA 3EUB3 3WUFA 3AMGA 2A3HA 4FAMA 1OT2A 1FRBA 3BW2A 3U2OA 5MKGB 3ALGA 3S83A 2Z1BA 5DBTA 3M1ZA 3TFCA 1G4TA 1JDFA 1Q1WA 4LTSA 4O15A 2FB2A 1JCYA 5AKQA 3RCMA 2CLMA 2ZVIA 4POCA 4RCXA 3GTNA 4PMNA 3ZFHA 1KNWA 4ONVA 5G2HA 4H4UA 2A0NA 4XTIA 4MY8A 3RX3A 1Z8AA 1OC5A 1E56A 1TJRA 4W9TA 2DV0A 3GSMA 5DT5A 1DORA 4EK7A 1PX8A 3SO7A 3FGCA 5D38A 2ZBTA 4MWAD 1VQTA 3TXVA 4H4IA 5DCEA 4LX4A 1G7UA 3WD0A 4Z2LA 3SCTA 1NDWA 1B1YA 3HQ1A 3W4RA 4JTHA 3BJFA 2YL9A 3UG3A 5LIWX 1LVLA 4HCLA 4DWSD 4GGBA 3V0SA 3W1XA 2PWFA 4L5ZA 4JTDA 2GJRA 5FESA 1NAL1 3CZ8A 3GTIA 3FS2A 3NQAA 4NI8A 3CK5A 4UR7A 3REQB 7XIMA 3W07A 2Y8VA 4TMBA 3LEPA 2ZXQA 1S2TA 1E51A 3N4AA 4O12A 1VIWA 2FVMA 4QEEA 2F2HA 1C8YA 2CFYA 4GRSA 2VGGA 3T2PA 3CMFA 2ACQA 4L80A 3BW3A 3IVTA 4H50A 4AISA 3GDTA 4PUKA 3S2MA 2ZXDA 3NM3A 3KUMA 3W53A 4M5PA 3UW6A 3ZSSA 3LRMA 5D30A 2OR2A 1WA3A 3NQMA 4J3VA 2OO0A 3FCPA 2PDLA 5I0DA 2ZICA 3WJYA 2V5BA 3EDJA 3VA8A 3CZKA 2FKPA 1C3FA 5I2UA 5A1AA 5DCDA 1SO4A 1VD6A 5CPOA 4KCTA 1GT8A 1AQFA 1IHIA 1ZRQA 2YOCA 4AMAA 5IM51 2ACUA 1TTPA 3O7UA 4U33A 1AK5A 2DUAA 1DE5A 2GPTA 3EWXA 4WVXA 3TVAA 3OW1A 3LCHA 3TA9A 1DWJM 2CIPA 2CXEA 3MS8A 2OSWA 3PPHA 3Q45A 4DELA 3Q58A 2O7SA 4W8AA 5A6BA 4I9AA 5DXYA 2GRTA 3NXLA 3S9IA 1UQYA 2V8ZA 2DZXA 4D6DA 3ZJ7A 4DF0A 5L9FA 3EWDA 4GUGA 5EYWA 2RDXA 4RNIA 1ESWA 2XH4A 1WCGA 1SW7A 3HJZA 4JKLA 1K8CA 3VDCA 4KGLA 2X8GA 3GG8A 4PEKA 3M4HA 3N3TA 3KVJA 3L4XA 4BEUA 2V2DA 1U5VA 5FOOA 3LQLA 1X96A 4DZHA 3CEPA 4KWVA 2XZ9A 1EC9A 3PWAA 2V5LA 5A8GA 2OGJA 4EKJA 1JRPA 2WBAA 1BLIA 1XI3A 2OO6A 5F4WA 4LAKA 1FX6A 1O5RA 3M5VA 1LT7A 1U1HA 4IJCA 4CD6A 1H5YA 1EDGA 4BURA 3MI2A 4KPRA 3IIXA 4ZGYA 1QVBA 3NQBA 3SUVA 2VCCA 3KZSA 4MJZA 4AX7A 1KBLA 1STZA 2XIIA 4GISA 2YYTA 1AH4A 1WDSA 4MFEA 5D2TA 3N2OA 2LLEA 1V7AA 2YDRA 3B0YA 4GY0A 4PMOA 1V0LA 3QW3A 4V28A 3WQ5A 3L65A 2ZUMA 1GPWA 2R1KA 3BLLA 2NQ5A 3FIGA 4GYPC 1AH3A 4FXJA 1X39A 4PMRA 2A85A 1WZAA 3MSGA 4GJIA 4K6AA 3LOTA 3P82A 1WZKA 1WX0A 4FF5A 2Y8UA 3NQVA 4DBSA 4R33A 4ZE4A 1JYWA 4IMDA 3DFHA 1X38A 4JTIA 3B4YA 4X0VA 5I5RA 4OWGA 2FFCA 2WK2A 4NJJA 2H6RA 4JPGA 6PTDA 1XRTA 2F7FA 1L9WA 3N2MA 1Y5WA 2GQAA 2OEJA 3SEPA 3TW9A 2F38A 1RLCL 1XKJA 4YS1A 5A94A 2MNRA 3H54A 1X2GA 1HJWA 1F4HA 1JZ2A 3EDEA 2A3LA 4Q4MA 3LDVA 1DJIA 4OBRA 4S1FA 2Y61A 3OQEA 2R8WA 3WLNA 1EEPA 1TA3B 4KCVA 3W1UA 5A69A 4F4RA 3PWIA 1CYGA 3W74A 1QXLA 3DGZA 1HJQA 5JIPA 4JTGA 3PAJA 3P81A 3W7RA 4V1YA 4Y9OA 3RRXA 3S2CA 3CHFA 2Y7FA 4I9TA 1FCBA 1SW0A 5GVJA 1N7KA 2PP0A 3O0KA 3TAOA 3EWCA 4ADUA 1RCQA 2XIBA 2DVXA 2Y85A 4AHOA 2WC7A 3W2LA 4CNUA 1E15A 1V51A 4JL1A 3BLKA 4LVDA 3P61A 2ZKMX 3C8FA 1U83A 5EBKA 1I0DA 3PBVA 1IE7C 5I03A 2OEMA 1SZRA 9RUBA 2WJDA 4RNFA 4GIYA 2YVJA 1OIFA 2V3FA 5GRTA 5KVHA 2Z25A 4US5D 3B0UX 1RY0A 5CZTA 2CBJA 4PFMA 4D2JA 2JKPA 1BSIA 1XH1A 3SAZA 4A29A 4YTTA 3OZYA 4MLJA 4F3HA 2GDVA 5BWFA 2W92A 4DO4A 4YTSA 1V4YA 1FWWA 4QLJA 1KGXA 3EEZA 3BQ5A 5FJIA 1UD3A 4ZB0A 2FJKA 2XYLA 1SO6A 3KAOA 4CNSA 1GV4A 1M3UA 3W7OA 2YZ5A 1FHVA 1Y7VA 1JJKA 3BZJA 1ZCCA 1MW3A 2X7WA 1B3VA 2F61A 3A7AA 3LPGA 3WLTA 1LOSA 4D71A 4PTVA 4KFNA 4TXEA 3OZPA 3E0LA 1ZP4A 3QJAA 1AJZA 2NVAA 1PIGA 3QN3A 3ZJ8A 1NF0A 2OFJA 1K7EA 4GIAA 1GG0A 2VR2A 1S2UA 2DH2A 2XVNA 3CHCA 3AS3A 2IQDA 3ANYA 1WXZA 3KVMA 1XPYA 3NXFA 4JNMA 4JX5A 1OFBA 4XUYA 1EJXC 1AH0A 1W1IE 2VZSA 3GFZA 3KTCA 3NOYA 3A6OA 5J5RA 2A6NA 5G1YA 1TFVA 3WN6A 3IJ6A 4KFOA 1LRNA 5FJUA 4NJGA 1B3XA 2XGIA 1XDJA 4GI9A 3HGSA 4UMAA 1PSCA 4Y9MA 1AQ0A 3JS3A 4UTKA 4PC8A 3ITTA 3I7RA 4HU8A 1D3GA 2V2CA 3AIUA 4CVUA 3TA6A 3VIKA 3A24A 1FFQA 2IS7A 1A80A 3N9RA 4Y9AA 2ADAA 3MI3A 4GXPA 3TN5A 5K9XA 1W9UA 3EX4A 4MB4A 1V0KA 2WSPA 3NGFA 3VGEA 1OABA 1V79A 2P53A 4NZJA 1YKWA 1NWTA 4U10A 5I3KA 1Y0EA 1WAWA 3PUDA 3U8GA 1HJUA 1E4MM 5H2ZA 3ARXA 2HV5A 4NI3A 1UOZA 2YLLA 3UG8A 5IRPA 4J7RA 1HJVA 1Z7AA 3QZAA 4CQBA 2ALDA 5HMEA 3OOQA 3HG4A 3TH6A 3EXSA 3TEVA 4J56A 1E6QM 4OJYA 3PPCA 1EF3A 3E9AA 1UPMB 4J3XA 4RW5A 2Y6ZA 5ECVA 4URIA 3HMCA 2VUYA 3HU7A 2OVLA 1MOKA 1A0EA 4J3SA 2QV4A 1H2JA 3PZUA 4NZ3A 3SY5A 3VDGA 1X6LA 2YDAA 4B5XA 4E5TA 3VXGA 2HSAA 2HROA 5CPMA 1Q7QA 1NWUA 4MUZA 3PTKA 2AKZA 4XD4A 1YIXA 5EA9A 3PG8A 3AIWA 4UMBA 1R46A 3IGUA 1WZLA 2XFWA 3V0TA 1E40A 2BY3A 5G5IA 3FYPA 3U6WA 2JEPA 3V0UA 3S1WA 2J88A 3GU9A 2W3ZA 3V5FA 4MB1A 4PTXA 1GRHA 2WZHA 3VE9A 4LC6A 1QHOA 3MMWA 3TNBA 3GC4A 4AIOA 1NSJA 4P7NA 2X40A 3WQEA 2J8GA 2CEQA 2J25A 2VEPA 4JTLA 2Z26A 4HA1A 2O0TA 3LYEA 4A35A 1J8VA 3OODA 2Q71A 3L4TA 4RK8A 1SM9A 1LQ2A 3H23A 2BC0A 5I3FA 3ZSTA 3A9IA 3AHYA 4DM2A 2DJXA 2X30A 3EOUA 2HBXA 2PLCA 3G6LA 4M19A 5AHNA 4Q6JA 3GTXA 1R6WA 2H9AA 1R47A 4PUJA 4EF8A 5K4XA 4E2DA 1GCYA 5AHLA 4XAPA 2E3ZA 3H22A 1L6SA 2G4JA 2RAGA 1PTDA 5F4XA 4PMYA 1WYIA 3E2RA 1I2PA 1ML1A 4YTRA 4IL0A 2CC0A 5C2CA 2RGMA 1P4CA 2PLJA 1E9IA 5FEPA 1ZBKA 3WL1A 5FS9A 1J5SA 4BFAA 3OB8A 4AU0A 1RR2A 1PKNA 4HA3A 3W87A 1RPXA 2PDFA 4NUWA 3EXRA 4ZCWA 5CEWA 4ICMA 4J28A 3UY7A 5LXEA 1AL7A 2QDHA 2VEFA 1EPXA 1FA2A 3FG2P 2QAPA 3CS2A 2C1IA 3M6YA 4A8IA 4UTWA 3TLQA 2PDNA 3B8DA 1RP8A 3I3EA 3TQVA 1K70A 3R0DA 2BLEA 2FH8A 1ISXA 3LBCA 2AQWA 4PFHA 3UR7A 3WLSA 5LHEA 3MT1A 2YZRA 3BICA 5DMMA 3WELA 4RZ6A 4MB3A 4ZQNA 3CL8A 3GAKA 3KRBA 2Z1XA 3MYPA 1K7XA 4H00A 1MNZA 3N1AA 4LVAA 4JY9A 3ELFA 4H2CA 3WDRA 4H7CA 4MY1A 2VX6A 3C2RA 3G1SA 3G2GA 4CQ8A 3T4CA 4PL1A 1ZBCA 3GIPA 2Z28A 1N8WA 5KEZA 4HPXA 2REQB 4LAMA 1RHCA 4F0RA 1YBQA 3LGEA 3VTRA 5BROA 2C1GA 2JBMA 3UJFA 3DH7A 1W1YA 1BHGA 2CLEA 3M0VA 2PDIA 1UWRA 4R7JA 3PBUA 1M6IA 1A3XA 4XK2A 1A5MC 4NEWA 1FWDC 2A6LA 2J24A 1BKSA 4HD5A 2VRJA 4JDYA 5IFPA 2NUYA 3IAPA 5E1QA 3L68A 3HM7A 1H0GA 4FR6A 3JRKA 3MHFA 1VJSA 4XSLA 3WFLA 2HRWA 4UFKA 3DFQA 4DI8A 1OJTA 2WWCA 1JYNA 1HKVA 1TELA 3SSJA 3FJLA 5A8QA 1S1PA 3T05A 3P14A 3GIYA 4IL2A 3W85A 1KM5A 3GXMA 3VNDA 3UVAA 3G77A 3M64A 4FA3A 1OQFA 3A4AA 1UWIA 3A21A 3CPRA 2B0MA 4JN8A 2BXYA 3W7LA 1VR6A 1XLBA 1YNYA 4KFPA 1KWGA 3G3DA 1XYMA 2GJLA 2OGYA 4O4VA 3B03A 1UWQA 1B5TA 2BHUA 1H09A 3PUGA 4C7GA 4R85A 1EP3A 4PRWA 5B7YA 1Z3NA 2A21A 4YHGA 1U1JA 2NVKX 2NQLA 2XFFA 3QQ1A 5HMDA 1GJPA 2ZVRA 1L6GA 3QH2A 4W85A 3TYCA 4CD8A 3TIMA 1OGGA 3MQTA 2B4GA 1SFTA 1UOKA 5TR3A 2OLHA 3BARA 2GR1A 1RQEA 4IGSA 2CLPA 4K1GA 1PB0A 4UNIA 1NHRA 4PBEA 4Q4SA 5DMLA 2Y62A 2CYGA 1UUMA 2GR3A 3DH9A 2P8CA 2H9AB 4N6EA 4AB4A 1OGBA 3ZLGA 4I8DA 1OG6A 4UOZA 1UR4A 1FH7A 1NH6A 3AZSA 4GKLA 1XSIA 4I9JA 4FLRA 1OCNA 1P0BA 1OFDA 5A6TC 3LD5A 3USZA 3GIQA 3ABQA 3WFAA 1QW9A 1ZBWA 1JXJA 4S23A 3N2CA 5BOEA 1H7PA 5AHEA 4O28A 3SY8A 2XG9A 2PLMA 3MP5A 2CDUA 2XSAA 2I17A 1EIXA 1FWCC 4MPQA 3TONA 3GU1A 2HK0A 1TWZA 1A0CA 2EQ6A 3GD6A 5EFDA 3GR4A 3STPA 3UZWA 3OZOA 1Y8BA 3VUSA 4XIMA 1AZ1A 5BRQA 4UQBA 1BF2A 3TR2A 3KLJA 1BTCA 2ZC8A 3NVTA 1TX0A 5CPTA 3NTYA 3QHMA 5CJ5A 4YVXA 3G8EA 1RBAA 3AHZA 1BXBA 3ZT7A 1BYBA 3PUEA 1H7WA 2Q8XA 1K9EA 4EE9A 4GGHA 4DVOA 3PFRA 5ER0A 3VU2A 1GVIA 3R25A 1QOQA 1UD2A 1M04A 2WSQA 1QATA 1UZHA 3BLOA 3IGSA 4PMJA 1UA7A 2DW6A 4AZBA 4HOZA 3CM4A 3GDBA 3N6QA 4KIEA 4XG1A 3VOFA 1HKMA 3WY1A 2WPEA 3M16A 4GVHA 4JQ2A 1Q8JA 1G94A 4I5UA 1NQKA 5JIWA 4J2PA 4H7ZA 5AB3A 3EPNA 4W8BA 3IRSA 1W3TA 3WD4A 4EMJA 1X6NA 3B9EA 1VKFA 5HQEA 7REQA 5C9XA 2WJZA 3P5YA 2QCLA 4DJED 4WUIA 3A22A 3GHTA 4LUTB 1LPFA 5KZDA 1TZ7A 4K8DA 1UH3A 2HZGA 3S5NA 4HNTA 4J27A 1H63A 1U22A 3VIIA 1R30A 1J0YA 1KTCA 2GVEA 1VJIA 3NYZA 3WLPA 2CXGA 1P0NA 4WKFA 4C6EA 4AHPA 2Q3OA 1OFQA 2FFIA 2H8ZA 1KFBA 2Z1SA 2DZAA 2H3DA 2C91A 3HB9A 3PJUA 5G1TA 3GRSA 5M2FX 3KE0A 3A3HA 3AROA 1FEBA 2BSLA 2DZWA 3NQGA 1KR0A 1CI1A 1LLOA 2J9XA 5JBDA 1H51A 4NP7A 4AZHA 2YCLA 3KBWA 1CT5A 5GQBA 5C71A 3Q94A 5HWJA 1XH0A 4XAYA 3LCIA 3UETA 3H55A 4CQ9A 3LHZA 5I3HA 5I3JA 2B7OA 1T3QC 3AC0A 3BGGA 5GNYA 1XGZA 3LI1A 1TE6A 1BRLA 2QUNA 3IEBA 5F2LA 3BC9A 4KIRA 1YNQA 4A05A 5E9XA 3ARUA 1HGYA 4O14A 4R88A 4UTHA 4HU0A 1F73A 3B9OA 5T91A 3STGA 1OCQA 2GGIA 5MHBA 1FBAA 3IV3A 4AF0B 1JNEA 1IEVA 3DI1A 3T4WA 4W7UA 3AFBA 4GINA 4H9ZA 4XAFA 1WZMA 3UP8A 7PTDA 3HA1A 3SY1A 5HWMA 4AC1X 1K6AA 3H2FA 1M7OA 3DECA 1CB7B 1PIFA 1QK0A 4JICA 4ZZ9A 5HXMA 1HUVA 4AC7C 3B8VA 1OB0A 1LLWA 1JZ6A 3H7RA 4UOJA 1E1CA 2B31A 3KCLA 4F0LA 1SZEA 4M51A 1X6UA 2PF8A 2BX7A 4FLQA 4M56A 2DVUA 2FDMA 3E12A 3W70A 2AAQA 1XLEA 4BQ4A 2VCBA 4A8NA 1WOAA 1IT8A 3W0KA 2RH9A 3ZOAA 1MEHA 4N6FA 1UR9A 3P84A 1M65A 1IGSA 1EBGA 4NRRA 1BVNP 3O3RA 2C7FA 4K36A 2W66A 3MZ2A 3CZJA 3XINA 2C19A 2BG5A 3PZTA 2VZUA 4W5UA 3NQDA 3ABSA 4PR4A 3LXBA 1G4PA 2GSEA 1JI2A 2BY0A 4S3BA 5E0FA 3VOHA 3VNMA 3VINA 3QY8A 1ZZMA 5AYBA 2NW0A 1HO4A 4EANA 2YLAA 5EBUA 3L5LA 2O7QA 3NL6A 3OA5A 1HQTA 3TFXA 1XV8A 3GS6A 4CQDA 4ATWA 2YVFA 5CC7A 1IYXA 4WK9A 3L4ZA 5CSYA 3PVFA 1X7FA 3UYIA 2PDYA 1J11A 2ZWZA 4ZFCA 4KEZA 1DTUA 3QYSA 1A4LA 4PL2A 4ZOEA 3OYZA 3STFA 3WNPA 5D02A 1NDVA 1ZGDA 2QCMA 3PSVA 3DERA 3GO2A 1QPRA 4AIBA 4QBXA 5AZ1A 3N12A 2V81A 2NXHA 3ETRB 5BRPA 3ZR6A 1QPKA 4N2YA 3F4CA 4WQ6A 2Y88A 1E6RA 1A3WA 2YGYA 3RO6A 4OUIA 3PG6A 4LH8A 2PDQA 1EC7A 3ARVA 3AYVA 4O11A 1DWFM 1F76A 3F1QA 2WMIB 2VI0A 3V1PA 1ONEA 1EP2A 2I9EA 3KOWA 7REQB 4E3TA 1CXKA 4I90A 5FJTA 2G0WA 2X0YA 2ZC1A 3O07A 2D2HA 1LM1A 4GNJA 3DYOA 3G22A 3JU2A 4O16A 2X1IA 1NVMA 4MYAA 1OD0A 1EYWA 1XGEA 2VKZG 1A53A 5C5YA 4RZBA 4ADTA 8XIAA 2CLKA 3FXYA 4AX6A 1A5OC 4PCFA 5A6LA 5BCAA 1AMYA 4UTWC 3KBNA 5EMJA 4Q8VA 2QYGA 4GI4A 1AOGA 3AHTA 4HNLA 4IH3A 1GHSA 5KTLA 3DFNA 2ACRA 3WEMA 3VYLA 3MI6A 2F9RA 3RJYA 2TRSA 1TWWA 3ARTA 1UWSA 1DJHA 3S1GA 4LT9A 4E4FA 3CUIA 1LQAA 4F9DA 4KEMA 1EJSC 1XG4A 1CGVA 4YTUA 4TTGA 3SI9A 4NQ1A 3PPFA 3TTOA 3L2IA 1AL8A 4O18A 3WLOA 2IQTA 3T9PA 3U2ZA 1GESA 4L9ZA 4UQAA 4GFIA 2J66A 4G9PA 4QE5A 4LALA 4B5SA 4MZ1A 3GH5A 1XLLA 1F3XA 1TIMA 4GQQA 3NVVB 5E93A 3EXTA 4Q3MA 3RLUA 1EX1A 4L6HA 1YYAA 1MUCA 1N8IA 1XBZA 1YXCA 4QJ3B 3RPDA 1PYFA 2E25A 3P2VA 1TV5A 2PP3A 3UF9A 1MQQA 3EKLA 2VENA 2WKLA 2IUZA 4KRTA 2EQDA 4H6RA 3FEMA 3VIFA 1DJNA 1JD7A 5T9BG 3TMLA 1KKOA 4JEQA 4HNCA 4YJ5A 3NOEA 3DI0A 4GNVA 4OUEA 3GAYA 2VELA 2O9OA 3U4FA 3W27A 1WBHA 4PCSA 2EG6A 2WVVA 3BAKA 4NZ4A 3BJSA 1V97A 3T8QA 2YA0A 3H2EA 3LADA 4PTMA 4Q8MA 3KRSA 1BFNA 2IKIA 1A49A 1LT8A 2C16A 1W2PA 3AHVA 3T55A 2VQTA 4NU7A 3D47A 1UPPA 1MSSA 1WQ5A 4I6KA 1LYXA 3PHAA 3VOGA 2NUWA 1FCVA 2WKJA 5A8NA 4O8RA 1SZFA 2C8NA 5HBFA 4GZEA 1UJQA 2PUZA 4IXXA 5AC6A 3VAVA 3L4WA 1F3TA 3QY6A 5HOSA 4KW2A 3GD4A 4FX9A 2GK1A 3B04A 4Z1BA 4PUMA 2WOVA 1XDIA 4OV9A 3TSBA 1KWKA 5REQA 1JPKA 4ICNA 2DZUA 2W63A 3WH5A 1RP9A 4AVOA 5I06A 1LWIA 4C1NA 4FALA 4E2OA 4QFUA 3CZGA 2R1NA 1V3JA 2P50A 3LTSA 3IVSA 3NEHA 2ASHA 1E3ZA 4UTTA 2WANA 3ZJKA 4FLOA 4ZFMA 3QSRA 3MC5A 5AN7A 2JK6A 3TTYA 1M53A 1RLDA 2AAAA 1E55A 3PPGA 3THCA 2PEVA 2BHYA 5C9UA 1YE4A 3WKZA 3UEQA 1DWHM 1VENA 3BSMA 4NYYA 3WLHA 2ZX8A 3VD4A 2O92A 3VCRA 3U57A 4Z0SA 4O17A 2R1MA 4LB3A 1VBJA 4CNPA 5CKSA 3VOJA 4DPPA 3DGHA 2ZTKA 3KP1A 4UMCA 1UP3A 4YN5A 2PB1A 3TROA 1A50A 3BMVA 1OM0A 4LB4A 5CCZA 1BVZA 2QPUA 3F4NA 3NQCA 4QNWA 1TB3A 4BQ5A 1N8FA 5ABGA 2FDSA 4A3UA 1C8VA 3ARWA 2GR2A 2JEQA 5LNRA 2CITA 2PU1A 5CBBA 4FR1A 1WUFA 3ARPA 4UFJA 1KFJA 1W1PA 5A95A 3OBKA 4C6MA 2GGHA 1QJWA 2QCDB 4JY8A 1FP9A 2VOMA 3CLWA 3FJ6A 3P67A 1TV2A 3NG3A 1PTAA 4G56A 1SFJA 5A6BD 2QT3A 4MVAA 3GDMA 1Q45A 3EAOA 3WQDA 3QV8A 2ZZ0A 4RE2A 3POHA 4FI4A 3ITOA 1Z6KA 7ODCA 4WRHA 3BQ6A 3KLLA 1YMYA 3DZ1A 3QC0A 1V03A 2EHHA 2ZX9A 3AIEA 4C6FA 3H4XA 4LU0A 4EP8C 3U3HA 1MQPA 4JD4A 2HNHA 1F6PA 3PZQA 4AD0A 4C7FA 1IV8A 5FF4A 3RNDA 2YA2A 5M1TA 2HXTA 1I0BA 3MCMA 1M7PA 5JCNA 4LUSA 4TUFA 4KEVA 3BLPX 2F8QA 3TWAA 3UERA 2EPMX 3W81A 4DF1A 2XGBA 3NIYA 1VH7A 1VJZA 3ANUA 4DWSB 3LN3A 5HR7A 4E4PA 4JTUA 3ZT5A 4US6A 1VBUA 1R2SA 4R3UA 3DFSA 4IGMA 1YDYA 3WBEA 5A6JA 1NY1A 3W22A 2TPSA 1GYMA 2V82A 1J4EA 3UZJA 3RIKA 3QY7A 3ARYA 2OELA 2WSRA 1WKDA 1YHTA 1AQMA 3WNMA 3MBDA 1FWTA 1QMLA 3BLFA 1WV2A 3OLIA 4MM1A 3OLEA 4A21A 1DIDA 3NQ7A 4D72A 1CLVA 1BG4A 4O0KA 2X7VA 4A4AA 3PNZA 1WDWA 1D2KA 1CNVA 1NF7A 4FP1A 3QV7A 4GIEA 2VEMA 4MOZA 1LBLA 1X8CA 4IWWA 2Y5SA 1HKKA 4XD3A 3ZYZA 2AL2A 3QF0A 1WYGA 1HXJA 3NM1A 1TZZA 4NJHA 1KXQA 1TV7A 5CG7A 2ZRWA 2CBIA 4L9XA 2RKXA 3N2TA 1TJ1A 4S3DA 1V5XA 3M0MA 2GK1B 2CBVA 1K8YA 2J6XA 4XSMA 4XAGA 1SMDA 2XVKA 3UG5A 4AD1A 2HQAA 3IGXA 3WK0A 1PIIA 1LRTA 4TOQA 2WKGA 1YXDA 2GLKA 5BXSA 1JZ4A 3R8HA 4H6KA 3GYEA 3CAQA 1ZXIC 2WSKA 2NQZA 1O5XA 2DORA 1MQRA 1E6NA 3HFTA 1OINA 4XQ6A 1KFLA 3VKKA 1PKLA 2VMFA 4PUWA 2R1PA 2FMNA 1LWHA 4UWMA 2VEKA 4IJBA 4O57A 4D6FA 3N11A 3TE9A 4KWSA 1ADDA 1L2UA 1OHLA 3AXXA 3RG6A 2BXZA 3BCFA 1MXGA 2ONEA 3SQMA 4AG0A 3W7QA 4HKPA 3UZZA 1K8ZA 4QNEA 4H9XA 5HJYA 2QGHA 4IIHA 2JF7A 1S5WA 5DFAA 3T40A 4D1IA 3OVQA 4DXXA 1A5LC 1KM6A 1MXDA 4LAZA 5G5GB 3DC8A 3CWOX 1RJRA 1CXHA 2PRMA 4TMCA 3DAQA 1PXGA 4LAOA 1FWAC 1KXTA 2YW4A 1FFUC 4JTSA 2X0SA 1F8WA 1M01A 1EYEA 1G9HA 1FEAA 1G6CA 5G1MA 1SB3B 1E43A 4ZO7A 2JFEX 2W61A 3I10A 1C93A 4YCOA 4U5IA 1R3TA 2D0FA 2BOEX 4XD5A 2WNWA 1LP6A 1TREA 1TMQA 5JU6A 1XC6A 4B5WA 1C7TA 3EB4A 2Y63A 3IIVA 8XIMA 2OLAA 4IIGA 4HHPA 2GQ8A 2P0OA 2JQXA 4FOKA 2YPIA 3C2FA 1DV7A 3PZMA 3CZEA 3TP4A 1OC6A 1U5JA 4EACA 2GVGA 3HFYA 2QDEA 4N0RA 1R3YA 4HMCA 3QZEA 4EVZA 2XUCA 3H53A 1MNSA 5HPOA 1EKOA 1PDYA 2X1RA 4DZAA 2YAUA 3SIMA 3W7EA 3DG7A 1EX5A 3M44A 1IZJA 3WF3A 1WDPA 3ZM8A 1EH9A 3BCDA 2E6AA 4O13A 1P5BA 1I1WA 4Z1YA 1XRSA 4KH2A 5A2BA 1KRCC 1ZX9A 3C2EA 2ZFAA 3UZ5A 3IUDA 2GSHA 2ZZ3A 1KQYA 4M24A 1JRCA 2NWSA 4KCUA 1VDVA 4JN7A 4XKYA 2DT2A 5E0CA 1PHWA 3THQA 1IZCA 2H3BA 5D09A 3I7SA 4X0NA 5KITA 4DUXA 3OU8A 1GHRA 3V75A 2GZXA 2Z1WA 2GYIA 4LRTA 4TX8A 2NLIA 2TAAA 1H2IA 1UYQA 3T7VA 4HNVA 1Z44A 4KRUA 5K9DA 3MO4A 3WDHA 1VP5A 4F2UA 1DJXA 1S5TA 3IVUA 1KBJA 1JPHA 1Z9AA 3RLGA 1ADSA 2IW0A 3LRLA 3DK9A 3TV8A 1PX3A 1F05A 4KPLA 1W3LA 2EF9A 4GQRA 3R11A 4XBJA 3IJQA 4JQ3A 3C0LA 1PEZA 4OOZA 4LCRA 5LKYA 4HOWA 4K8EA 1TYGA 1QWKA 4C6PA 2QCEA 4Z1CA 5DELA 3SCRA 4L4MA 5FEWA 3LS9A 1NDZA 1W17A 3A5VA 1M9HA 1Q6QA 4I8YA 5A8PA 4DYJA 2EPNA 1OY0A 4H4ZA 3C0JA 1THFD 3HGJA 1XHGA 3CGDA 1UUQA 4HK5A 1SR0A 3WH9A 5H6HA 4PN2A 4ZODA 5SWUA 3WBXA 1H11A 5ABTA 3CIXA 1IIGA 4WF7A 5FKYA 4HPJA 1JYVA 4AZ6A 1NPXA 3WDIA 1PYMA 2J6VA 2XU2A 3GE7A 3IJ9A 3LV6A 2WM0A 1RBLA 5F1UA 1IEXA 3BTNA 3SZ8A 5FJOA 4HNOA 1ISYA 3KRUA 4XD6A 4CU7A 3VILA 4QDPA 1T40A 4X9SA 3DG6A 5FJRA 3PZGA 2J7HA 4ZVJA 1LTDA 2DDXA 1V3LA 2XIQA 4QLLA 4R34A 1DEDA 2F6XA 3W7HA 3EWYA 3L8KA 2X8CA 4PRTA 4LEFA 1MMFA 1TUXA 1DXIA 5BYWA 4JHZA 3D0CA 1UD8A 4CD4A 4QQUA 3OG2A 4HK7A 3APYA 1NM9A 1I2OA 1XLFA 2P8BA 3V3WA 2DT0A 2GOKA 2VC6A 1AJ2A 3WLMA 2FZBA 4WY0F 5FJJA 5EPDA 3MMDA 4B2DD 5EMYA 2VCAA 2Y8KA 2BC1A 4IICA 1SMAA 4UTTC 2VDIA 1EGVA 2E8ZA 3S9ZA 1I1XA 1EBDA 3AZTA 3DX5A 4JFVA 4Z2KA 3AN1A 3M5XA 3AYSA 3VMPA 4H19A 2CKSA 4WJEA 3EMZA 3W02A 4QG8A 1HZYA 4XVEA 4PTWA 3B9AA 1V6UA 3DFYA 1DXLA 1TUFA 3CTLA 2W55A 3GNOA 4XUGA 4FZIA 3BAIA 2A7NA 1TJ0A 3HBLA 3O6DA 2GJXB 3WNLA 1E6SM 3EF6A 3SQLA 4MNJA 4ECLA 3UXIA 3I4KA 4P2VA 4B15A 5AC8A 4LPCA 4MUPA 1EA0A 1H7RA 3STCA 2EKCA 3WLLA 4XZHA 1POJA 1PAMA 3CIVA 5BU6A 1GEHA 5HUPA 4E2VA 1PL9A 3DFPA 3N6JA 4R9XA 3WUBA 2DT1A 4N4PA 4B9ZA 2RGLA 4P8WA 3N4FA 4IXHA 3W38A 4D8ZA 1VCFA 5EL1A 4LNYA 5PTDA 2ZRXA 5C6MA 1MW0A 1FTXA 3B0VC 4X2PA 3BUVA 1TPUA 2VR4A 3WNNA 1N63C 4CNOA 1GK8A 1KCXA 1EO7A 4D6EA 3TK7A 3KM8A 4MKVA 1WXJA 5JCMA 1YPIA 1XIHA 1E9LA 1E70M 2DT3A 1KC7A 1R5YA 1REQA 3MUXA 3W1TA 4W86A 2FGZA 4ZTYA 3W3OA 4JTRA 3ATYA 1H4PA 3AXHA 3IJDA 2UV8G 5FJPA 2OZ0A 1IXNA 3NR0A 4ZENA 2C0AA 1D7KA 4CNTA 2OODA 3SR6B 3E5BA 3WQ6A 1W91A 3L5MA 2QULA 2C6QA 2QR6A 3EEGA 3WQGA 4F48A 3ITVA 4Q7IA 4F9JA 3SCSA 2PDCA 2HJPA 1ZL1A 3IIOA 4HHMA 1SO3A 2VEGA 3P0WA 1J12A 4LIIA 3TCEA 2Z2BA 4WGHA 3P74A 5FAJA 3HMJG 1GUVA 1KCZA 3RPTA 5D2WA 1DIOA 4JCMA 1LOQA 3N25A 3VKDA 3WMCA 2NZLA 2D0GA 4CQAA 4TX6A 4B92A 4YTQA 3B9NA 1T0OA 2QJMA 1TPB1 4ZL1A 1WNOA 1HVXA 2EJ1A 3AU6A 3RUBL 4PEEA 1VFLA 4JCLA 2XTKA 2VFIA 3BOLA 1XYFA 5CAHA 1B30A 4N42A 1XC4A 2W91A 1GKRA 1F61A 1VF8A 2C18A 4MDOA 4XV0A 4M7SA 2NQ9A 4JTTA 4ZOBA 3ANVA 1YXYA 4C5ZA 4ZQPA 3S2LA 1ZBVA 3PBGA 4QEHA 4H6QA 5D33A 4UCFA 1AG1O 2Y0FA 1J2BA 1X1ZA 3WLJA 1H60A 3LXAA 2OKOA 1NHPA 4GCXA 1YX1A 5DRCA 3W84A 4I5XA 3UY8A 4UXDA 3N13A 2BGQA 3BLEA 3LZ3A 2H8XA 3PNUA 2YDSA 1W2VA 3RR1A 4ADWA 1OWQA 2VZOA 5G2IA 3OBAA 4RJEA 5I6SA 1E4LA 5D8ZA 1X1OA 2XISA 2PDKA 4JYEA 1KFKA 1J0HA 1KTNA 4QQ3A 2ATMA 2WHMA 4F8XA 1F2JA 2ZX6A 1YLVA 4L7ZA 4L65A 1J79A 1GOQA 2OPJA 4BI7A 5A3HA 3F4DA 2EPLX 1UB3A 4LY4A 3URHA 2YXGA 5DCBA 2PD9A 4NNAA 3E3HA 1XLIA 3TUUA 1XP3A 4JTFA 3EWWA 1Q66A 4Z08A 5I07A 1QPQA 2OYLA 1GQNA 1S46A 3LLFA 2RDWA 3HN3A 1QNPA 3SCVA 1JDDA 4KWUA 5A6KA 1NHSA 2BP1A 4GIRA 2ZRZA 1TSIA 2BBFA 4H4PA 3JW7A 3W23A 3IK2A 1O4UA 2WPCA 5CPLA 4V2XA 4UOQA 1PZ2A 3U7VA 3G1YA 2VVSA 3FNDA 3MCNA 3K30A 1DHKA 3TLLA 1DQXA 3AO0A 3OLGA 2OXNA 4AWUA 1YDOA 3GXFA 1SUXA 1FXQA 4LC8A 3PJWA 4JQ4A 2PWHA 4LSBA 5A6AA 2J74A 4G1NA 3PB2A 3F7JA 2PTXA 4J1OA 3NZRA 1OVDA 3QGVA 3BK0A 1OX5A 4AD3A 2CETA 3IJIA 3NSMA 1TV8A 1IGWA 4Q4PA 1CENA 1B57A 3RLHA 5DT7A 2PGWA 2F6UA 3E0FA 3GQYA 3S5SA 1KCLA 2UY2A 1EC8A 4BI5A 2ZE3A 4TVUA 3II1A 2ZX7A 5C9WA 2CZ5A 2R14A 3NL5A 2JF6A 3VC5A 1CGWA 2OCZA 9XIAA 1Y5VA 4PULA 4NAEA 1GQLA 1ME8A 4MMWA 4QE1A 1U33A 1C9WA 3KOYA 2VWSA 4MSSA 3EPMA 1H61A 5DMNA 1B31A 1GSNA 2G37A 5KMYA 3R07C 1TO3A 4W7WA 5I00A 3LHVA 5F1VA 1TX2A 5D9MA 4TQTA 3WCZA 1W1TA 4LJ3A 3F03K 3DFTA 4LFYA 2UY3A 1NELA 3HV9A 3S47A 1MO0A 2BCPA 4L4OA 2XN1A 3M0JA 2VFHA 1VHNA 3HG5A 4HN4A 4GX9A 1X8FA 1N5WC 1XJBA 5D2YA 5AYXA 3W82A 2E28A 1S2WA 1VFFA 2HVOA 1WDQA 4KWOA 2QJNA 3QR1A 1JDAA 1GGOA 1YQ2A 2Y7DA 1HT6A 1TWDA 3VIOA 2QS8A 2VQUA 3OO2A 1M7JA 3KDNA 4DF2A 3FLUA 4BF9A 1XSKA 4JNYA 5BXRA 2X0HA 2E6FA 1BWLA 3L2MA 4FMVA 5IBXA 1UG6A 4LYRA 1QPOA 3H4KA 3KWXA 1Z89A 2QUUA 1JUKA 4Q8NA 3KWSA 4FX6M 2W62A 3C2VA 3GRTA 4DBUA 3MDUA 3MP4A 1R85A 1I60A 3N9SA 3OYXA 1O12A 2CLLA 3MMUA 1JCNA 4R5EA 3QSTA 4GUFA 3C6CA 2NQJA 3VDHA 4KBXA 3E49A 3GY1A 1PCKA 1EJWC 1EXPA 4A3YA 3PZOA 4EAMA 1GNXA 3ZLHA 2V6AA 3LCWA 5IOBA 3TCSA 4Z1DA 4RDYA 1QOXA 2DSVA 1ITUA 3WJZA 1UC4A 2Z29A 3LXCA 3N3MA 2OWXA 5A5WA 2QNEA 4H1ZA 5G4EA 3LB0A 2OQLA 1UKOA 1XX1A 2IPJA 3ZVHA 1HO1A 4S39A 4JIQA 4R9OA 4GJJA 1Q5MA 2YIHA 1KRBC 1BZLA 3H26A 2WXDM 4Y8FA 3VIHA 1DWIM 4AY8A 4QROA 3IS4A 1RPKA 2RJHA 3KRZA 3H6OA 3PANA 3E0VA 3CQ0A 3W7JA 4HNNA 1TMLA 3W1QA 4H3DA 2VOTA 1KFEA 2J4GA 1XBVA 3C3UA 2OZ8A 3ISIX 1J5TA 1NFPA 3IIPA 1EZ2A 2VEIA 1B3OA 4CU6A 1JROA 3P8JA 3FW6A 4LVBA 4P61A 3V16A 2GVYA 3AALA 2BS9A 1KV5A 4KF1A 1FWFC 4EPEC 1GOKA 3KVLA 5FF0A 4GK8A 4IPPA 1V6TA 3GDRA 2NWRA 4AXNA 3SQSA 4LF1A 1EDTA 3GC5A 5HATA 3N2XA 3PWGA 5JH1A 3LBMA 2CZEA 3ITLA 4KQNA 5M03A 5C7HA 4G6CA 1XLDA 4IFOA 1JGMA 3DC0A 3H4WA 3LCLA 3GR8A 3CPGA 4C91A 1XDLA 4A8RA 3GW0A 4XAZA 3H2AA 1H41A 3LNMA 3WLRA 5DLCA 3S46A 1G5AA 4FNUA 5AHIA 4CN6A 3FKKA 1OCJA 6TAAA 1J18A 2ZZ7A 3UWZA 4BV6A 1ISVA 3TYZA 4UFHA 3K8LA 2XJ7A 3GU2A 1WKEA 4HGXA 2ABAA 4H4RA 2J9ZA 4HA0A 2VDGA 3CAWA 4MZ8A 4BK9A 2GJPA 1F8MA 1BEUA 3VGFA 3UU0A 5D32A 2ISSA 4L6DA 3D3AA 4H4QA 5FL0A 4DLFA 2PRLA 1WKYA 3TYBA 1QK2A 1OYCA 3LGGA 3SFKA 4QX4A 4PCPA 3VNJA 2PSNA 2HPMA 1W8GA 3AZRA 4D6GA 1K4QA 2VGFA 3RITA 4YWIA 1QBAA 1TTJA 3V7PA 4DZ5A 4JKKA 3VKCA 1R86A 4DHGA 2E7FA 3AJ7A 1ZJHA 4O1BA 4WOZA 2B7QA 1SJDA 4ZO8A 5JCIA 5I7GA 4JDRA 1L2QA 6REQA 3P93A 1QO2A 4NAFB 3ZO9A 3URBA 2J7CA 3CGBA 3GFYA 2I5IA 1TQXA 2FPYA 3RO8A 1N82A 3AXKA 3RX2A 3PUOA 1NDAA 3EWBX 2VD9A 2HE5A 1R8LA 2VM8A 3SADA 1DVJA 2WMKA 4C1LA 5CPNA 1H1YA 1PJ9A 2YCIX 1NFBA 1B4EA 3OPSA 3H2MA 2L5HA 3KX6A 4GFSA 5C0QA 4EIVA 1FIQB 2QPSA 4DWDA 4Q32A 5BWAA 4GC3A 3ARRA 3TSMA 4CU8A 1SSDA 2YR1A 4RKAA 2QF7A 4CQCA 2R91A 1AJ0A 1FECA 1H7OA 3N18A 4RNJA 1VPXA 4ZO6A 5HDRA 5CJNA 4CLMA 4M81A 4ROPA 1D8CA 3BV4A 1CXEA 1BTMA 3FHQA 3G6MA 4DQWA 5CSUA 3VO0A 3T2QA 3KLKA 3FSUA 1FY6A 4ADSA 2WCSA 4J40A 1MUWA 3C3NA 1E6ZA 4BS0A 1QBBA 1DJGA 3G1VA 3ATZA 1W8SA 3W25A 3QKZA 4R53A 2WC3A 1SPQA 2I56A 3GNRA 1D7FA 3ZVHB 1PV8A 4YYCA 1CEOA 2O4MA 1FHDA 1H5VA 2FVLA 3CV1A 2FH6A 4PUNA 3RF9A 2FTWA 2X99A 1NWSA 3T6CA 1Q3NA