4J1OA

Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound l-proline betaine (substrate)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
369
structure length
369
Chain Sequence
b'MKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Isomerase
total genus 130
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4j1oA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4j1oA01
3PFRA 3VDGA 3ZVIA 3RITA 5IDZA 3DERA 1KKOA 3DIPA 1FHVA 4YWSA 3RGTA 3VCCA 3N6HA 3ZLHA 3DDMA 4DXKA 3GC2A 3UCCA 4MMWA 3DFYA 3T8QA 3TWBA 3MUCA 3IJIA 4Z17A 3SN1A 1WUFA 3JVAA 4ENLA 2FYMA 3NFUA 4K1WA 2HXTA 3QN3A 3THUA 4A6GA 3UJEA 3ES7A 3N6JA 4DX3A 3V4BA 4K8GA 3R1ZA 5EU9A 1P43A 2QJMA 3OTRA 2OO6A 3I6TA 2ONEA 4HCLA 3IK4A 2GGJA 2OZ3A 3TOYA 7ENLA 2AL2A 3H7VA 1PDZA 3V5FA 2ZC8A 3UJ2A 3T9PA 3UXLA 3FJ4A 3D47A 5FJPA 1IYXA 2PGWA 3FXGA 2P8CA 3DESA 2PTXA 3R10A 3H12A 4HN8A 4ZA0A 1YEYA 3UXKA 2GL5A 3RR1A 2PU0A 3S47A 1JCTA 2PTWA 3EEZA 4MGGA 4E4UA 1ONEA 3D46A 2AL2B 1XPYA 4KPLA 2PSNA 3P0WA 1EBHA 3UCDA 2OVLA 3RCYA 2XH7A 3OZYA 3MKCA 3GO2A 4E6MA 2MNRA 1R6WA 4Z1YA 2OFJA 3Q45A 3GY1A 3ZVHA 4GGBA 1XS2A 3SJNA 2DW6A 3BOXA 2GGGA 3GD6A 3V3WA 3TCSA 1SJDA 2GGIA 4GMEA 2AKMA 1SJCA 3JZUA 1L8PA 3MWCA 6ENLA 3EKGA 1JPMA 1SJAA 3VCNA 2QJJA 4J3ZA 2P88A 5FJOA 3OPSA 3T4WA 3H70A 3ZVHB 2XH0A 5FJRA 5FJUA 3VC5A 2PCEA 3IJLA 2XH2A 3UJRA 1EC9A 2P0IA 2QDDA 2OZTA 4F4RA 1MDLA 2GDQA 4DWDA 1ELSA 3TTEA 3HPFA 4A35A 1BQGA 3DEQA 4GISA 1MUCA 3SQSA 1NU5A 4GFIA 4JN7A 4ROPA 4IT1A 3ES8A 1P48A 4IP4A 2CHRA 3FV9A 3IJQA 2RDXA 3DGBA 3ZLFA 2OLAA 1PDYA 3RRAA 3DG6A 2OKTA 4G8TA 4GYPC 3UGVA 4FP1A 3SSZA 2DW7A 3JW7A 2MUCA 1EBGA 3FYYA 2POZA 3VA8A 3CXOA 1R0MA 4ZCWA 3TWAA 3UJFA 3NZGA 4HPNA 3DFHA 3QTPA 4J1OA 1ECQA 3T6CA 2XH4A 2AL1A 3NXLA 1MDRA 2NQLA 3KUMA 3MQTA 3CAWA 3MZNA 3TW9A 2HNEA 3PWGA 3I6EA 2PP0A 2GGEA 3SN4A 4M6UA 4HCDA 4HYRA 2PGEA 2P3ZA 3OP2A 3TJ4A 2PTZA 4EWJA 2GSHA 3K1GA 3SN0A 1KCZA 2PA6A 2P8BA 4A3RA 2OQHA 4DN1A 2GGHA 3I4KA 2QQ6A 4H19A 3R0UA 3N4FA 3CB3A 2O56A 3R0KA 4MKSA 3SBFA 2XGZA 1KD0A 3V5CA 3ZLGA 3OW1A 3UJSA 1JDFA 3QLDA 1NELA 1EC8A 4E4FA 3B97A 3N4EA 4KEMA 4HNCA 4JN8A 1EC7A 3RO6A 3Q4DA 4DYEA 2OX4A 3FVDA 2AKZA 3DG3A 1KKRA 3STPA 3TJIA 4GYPA 2QJNA 3P3BA 1SJBA 2QGYA 3DG7A 3S5SA 2HXUA 1TKKA 4G7FA 5BOEA 4H2HA 1OEPA 4GGHA 3NO1A 3U4FA 2PS2A 2PU1A 3ENLA 3VC6A 4FI4A 3P93A 2OPJA 1W6TA 1WUEA 2QDEA 3BSMA 4H1ZA 3FCPA 4IZGA 2PPGA 1DTNA 3QKEA 1RVKA 1MNSA 2QVHA 3PWIA 4HCHA 3QPEA 2OG9A 4K2SA 5BOFA 5J04A 1JPDX 3H8AA 2I5QA 1FHUA 4M0XA 2HZGA 2OZ8A 3OZMA 4IHCA 4X2PA 4HNLA 2PP3A 3MY9A 1MRAA 1F9CA 3U9IA 4E8GA 1BKHA 3MSYA 2PMQA 3BJSA 4GIRA 5FJTA 3TQPA 3CYJA 4E5TA 4IL2A 2PTYA 2XSXA 3CK5A 4JHMA 2PP1A 4KT2A 4KWSA 5ENLA 3R11A 2FKPA 2ZADA 4DHGA 3CT2A 4H83A 3VFCA 2OQYA 4IL0A 2PODA 3R25A 1TZZA 1E9IA 4IP5A 1TE6A 3PK7A
chains in the Genus database with same CATH superfamily
3UWEA 5IBXA 1W5OA 3UZXA 3NVVB 3NQ6A 4B90A 3V5OA 1IZCA 2BB0A 1WV2A 4Z1CA 1KTNA 4AW7A 4N0RA 1VR6A 3O05A 3IVUA 1OFDA 5EL1A 3GC2A 3I10A 4PRTA 3II1A 4H9VA 3IEBA 3N17A 1JZ6A 4L1GA 1BG9A 2BGSA 1WUFA 4RXGA 3QFAA 2BOEX 2CLMA 4QFUA 2JEQA 2BHYA 1IEQA 3AIBA 2B7OA 4KIEA 3QV7A 3ZYZA 1GVYA 4HYWA 4Q7IA 3CZGA 3ID7A 5FS8A 1O95A 3SCTA 3W7IA 1ZK7A 4IIBA 3KZPA 4ZQMA 1Z44A 4GUIA 2OZ3A 5IRPA 1JJKA 5CQ1A 5T91A 1SFJA 1ZENA 3LU2A 3M6DA 2X50A 4EXBA 4R27A 3GFXA 1GNXA 4LUYA 3VGFA 1G7VA 1MO0A 1UZHA 4KEVA 4P7NA 3ZT6A 4HN8A 2GJLA 2IPWA 3G1SA 3S1XA 3B9JB 2HS8A 2ZZ1A 3WDJA 2JKEA 1A0CA 4PB3A 4E3TA 4E2BA 4KFOA 2WP6A 4FHAA 1OT2A 3C2YA 2XG9A 1JCYA 5H6HA 4QCEA 1QAPA 3QZ6A 1PE1A 4P7LA 3DJGX 3QZEA 5C9UA 2YL5A 1ME9A 5FF2A 3GQYA 4JTSA 4PFHA 3KL5A 1DL3A 2Y62A 1TWSA 3LLXA 4JFTA 2QPXA 5ABEA 3WH9A 1E0XA 3QHMA 5HK4A 1KXQA 1NWRA 2GR1A 4ZXLA 1GZ1A 4UZUA 1O6IA 2RFGA 5HJLA 4O0QA 4B9YA 2VFFA 3H2OA 1TREA 1PUDA 4PB4A 3E5BA 3G1YA 3VDAA 3AXKA 2HQAA 1XIEA 1OFPA 5I3DA 4QHRA 4F9DA 2BV9A 4Y90A 4W5ZA 1TFVA 4NZ3A 4DUVA 3H2CA 3N2BA 3W2UA 2FB3A 5MHBA 2DP3A 3HBLA 3CPRA 2GDQA 4CD5A 4DWDA 5A2AA 3WG6A 3N11A 1HKKA 2ZICA 5GJMA 1UP0A 2NT0A 3R07C 1LDCA 4U33A 1SSGA 3CQHA 1W1B1 5D04C 2X8HA 4GK8A 1EX5A 3VGDA 4NY2A 5D9NA 4DO5A 1QNOA 5H8MA 3IRDA 1PKLA 4GYFA 3W7LA 4KRTA 1Z69A 1U22A 2F2HA 2WK2A 1UJQA 2OKTA 4G8TA 4FP1A 5HULA 2NX3A 1K8CA 3H6OA 1YTEA 1W32A 5LZLA 3GYEA 1JF5A 4LYQA 9RUBA 4E2DA 3FYYA 3FIGA 3CGTA 4O53A 2Y5EA 3SY5A 3UR5A 5CBBA 3UR8A 1BYDA 3NXFA 3BMXA 3QW3A 2W0HA 1KM4A 3UYCA 3IAQA 3PPGA 3F5LA 4J1OA 3CPGA 1TPC1 1UR0A 1B9BA 2NQZA 2NPXA 2E28A 1WDWA 5AYXA 3R7MA 4JTJA 2BS9A 5AYZA 2E9BA 1L6SA 1JDCA 4N9DA 1HIZA 3WELA 1JI2A 3RF9A 3MJYA 3G18A 4LU0A 2CBUA 3PF3A 5RUBA 1NARA 2QDGA 3W1MA 1XH0A 1SZGA 1PWLA 1K6AA 4FALA 4IPJA 2PWVA 1QATA 1H0IA 4BF9A 3BLDA 1EHAA 3W7EA 1VYPX 4MWAE 1CXKA 3DXIA 3AWOA 2L5HA 3LRKA 3VD3A 4G5DA 2ATSA 3R0KA 2AQVA 2YVFA 3A4JA 4MKSA 2GJXB 3GRIA 3ZLGA 2VRKA 3P8IA 5HJXA 1WOBA 3ZM8A 4A3HA 4JY8A 4PTNA 4DBEA 3BW3A 4GNVA 3GXPA 2RHGA 1PIIA 1JUKA 3M07A 2A7PA 7CGTA 1YPIA 1WDPA 3UBPC 2Y7EA 4D8LA 3KCOA 5I6SA 3TN4A 4AZ7A 4AXKA 5CSUA 2QGYA 1FWAC 1BD0A 3S5SA 5ABGA 2WOIA 3RO8A 3EUB3 4OE7A 3AYTA 3AZTA 3RDKA 2QCEA 3EX3A 2QYGA 2GUYA 3RFAA 2XM1A 3UYIA 1W6TA 3QY7A 5LXXA 2ZDRA 3TROA 1UD3A 4H1ZA 4QDWA 1DTNA 2PDXA 3QTGA 1MNSA 2FVKA 1ZAJA 1W56A 1E5NA 1WBJA 1RA5A 2H6RA 5DRIA 5J04A 3BAYA 3H8AA 4OV4A 4FIQA 4HPHA 3LUTA 3QH2A 3REQB 4MB4A 5I00A 4OIFA 1OADA 3CLWA 3FOKA 3C86A 4HMCA 1UWIA 4PMVA 2WAGA 1E1EA 2E1DA 1CGYA 2VFGA 1R3VA 2BY2A 4Q8WA 3A21A 2CBIA 3VZXA 1GOIA 3TLQA 1VJSA 4IL2A 1GRBA 3BCFA 1YQZA 2PTYA 3DX5A 3ITOA 4MZ1A 2J9ZA 4RV8A 1UUQA 2FDMA 2X1IA 3M47A 3U2ZA 1XJBA 2C16A 5E0FA 1DIEA 1JYXA 1ADSA 5LIKX 1C90A 1IEVA 3CC1A 3NQVA 3PZTA 3MUXA 3B0UX 3IJ6A 2OEJA 3RGTA 3L2LA 1ZMDA 3NPVA 2QULA 3B8VA 3OVRA 4NJKA 3SZ8A 3W7HA 4QRNA 2X2GA 3Q94A 1Y8BA 3U7VA 2ALRA 3E12A 2XTKA 1G4TA 3IPWA 3KOYA 3EWXA 3UQNA 3O3RA 5DO8A 4ENLA 4RDVA 4RPQA 2BC1A 3QN3A 3UJEA 4CCEA 1H4PA 4PUEA 1GSNA 4LEFA 3M0IA 5CPOA 3L8KA 5G4WA 1C7TA 4JDBA 3UA4A 1ONRA 3INPA 4EF8A 2DPEA 4F0RA 1GYLA 2TPSA 2DH2A 3WSUA 2DSUA 4DAIA 3MYOA 3S83A 3VM7A 4O14A 1DQXA 4YTUA 4HMNA 2BXZA 3GRTA 1MQQA 4H41A 3AO0A 1GRHA 4HYVA 3S9YA 4RDYA 4CKQA 1JD9A 2PSNA 3CTLA 2PWDA 1TV5A 2MNRA 3H24A 4O11A 3IVSA 2WVVA 1TTIA 5HUPA 4ZE5A 3IRSA 3L23A 2Z1KA 4GVIA 5J8LA 4PCTA 1C8VA 3TR2A 1X7IA 3JZUA 1QFEA 2OO0A 1UASA 3DFOA 4G6CA 3IIPA 2A79A 1EH9A 1SSDA 3UZ5A 2J24A 2QJJA 3TYDA 1KBBA 2IUZA 1DJZA 4MNMA 4NAEB 4LUSB 3T4WA 3CEPA 4J4KA 4LJ3A 1DOSA 4NZJA 3G1HA 4GH1A 4E2VA 2E6YA 3MC5A 4NKCA 3OYXA 1EYEA 2FPVA 3W26A 2QDDA 4I6KA 4ZOHB 3MHGA 1WXJA 3ZWSA 2Y7FA 1A5MC 4IMCA 4U31A 5HWJA 5LNVA 1M3UA 5TF0A 4XUGA 4MZYA 2HE8A 2Y89A 3RNDA 4DJDD 1IE7C 1JCJA 5D2YA 3N25A 1BWKA 2QCCA 2E4TA 3VDBA 1XSIA 1J5TA 2HISA 2FHCA 4NYYA 4DAFA 3DGHA 2TPRA 2C13A 1XD1A 3D5HA 5AC5A 4QEHA 1DWHM 5CC5A 2YW3A 5G5IA 4LB3A 3PSWA 4LEQA 2BXVA 1PPIA 4NXSA 2GQ8A 4C6DA 3PJTA 3TDFA 4I7WA 4HHPA 4A22A 1D7KA 3PZMA 3QOKA 4CU6A 4AY7A 1U5VA 1AH3A 2D3NA 5IFPA 4PCPA 2TRSA 2Q8ZA 1JGMA 3OJGA 5LA2A 3MJMA 4RKAA 4QSHA 1JQVA 1EOMA 1P6BA 1XWYA 2BFGA 3HO8A 2ISVA 3ZMRA 3TAOA 3I6EA 1A3WA 3UY7A 4UFHA 3ARXA 1JRBA 3KX6A 2W3ZA 3KRBA 2I14A 1ISYA 2PTZA 4QEEA 2UY2A 2I9UA 3CAKA 2GSHA 1VFFA 1KCZA 3GXNA 1A50A 4GWEA 3EX2A 3PJXA 5JXQA 4XVEA 4AD3A 1Q13A 4XO6A 5L6UA 2GOKA 1SMDA 3I3BA 1SZRA 1NQKA 3SBFA 3AZRA 1GTEA 1MRQA 4GXPA 3BAIA 2FJKA 1LL6A 1XRTA 4O17A 3PZVA 4AF0A 3GZ3A 4I8YA 3XIMA 2C0AA 2TSYA 2XIOA 1XUUA 3CL7A 2WMFA 5HQEA 5D8WA 2WZTA 4PH6A 2E5DA 4LQ1A 3ZSSA 2VEFA 2INFA 2VFDA 1J9YA 2Z2AA 2NVDA 1S2UA 1P6CA 1I45A 3M0LA 3BV7A 3L0KA 2YXXA 1EIXA 4W8LA 4GO9A 4KWWA 1EUNA 2O4QA 2H90A 2P76A 1RP8A 1P1MA 5CBJA 5D37A 4WSKA 3KP0A 1KLYA 1Q6RA 3N34A 1DPMA 3MDWA 3PTKA 4TV5A 4Q8OA 3IUHA 4CEUC 4FA3A 4YTQA 1I8JA 1AG1O 5GQBA 3PWIA 4HB7A 5LA0A 3L4WA 4WOZA 1A5UA 2FGLA 3UPBA 1O4UA 1ML1A 1KQYA 2VX4A 4F0MA 3WF4A 3ARPA 2ZQ0A 1GRFA 3EWWA 1CYGA 1E4IA 1ZJIA 4O54A 1RALA 3TN6A 3ZT5A 1XH2A 1XSKA 4RPPA 1MYRA 4XD3A 2HCVA 5M3WA 3ZZ1A 4OHQA 3RK8A 1YNPA 1EP3A 4XBKA 2ZRXA 3QC0A 4UQBA 2V5KA 4XSMA 1YXDA 2HTMA 2BVWA 2FQIA 2XIQA 4YMZA 1FP9A 5GNZA 2EF9A 1HJQA 2CKRA 5FS7A 4AMCA 3VINA 3QR1A 3R11A 4YXGA 4H83A 4IL0A 3CL6A 4G9PA 3FJ6A 2NQHA 4ZL1A 3LTYA 3VAVA 4AHOA 1J0IA 1NF0A 4OQVA 3MI3A 2X41A 4HZMA 3PUDA 4H4PA 5U4NA 4D6GA 2EGZA 5JQ9A 2CU0A 4CNTA 1RLCL 2QAFA 3NO5A 1CECA 5CEWA 4V28A 3BW4A 1HL2A 3NL5A 1DORA 1OYCA 2X0YA 4DY1A 3QMRA 3RNMA 1JGIA 2WM1A 3RXZA 1GREA 4R85A 1XLLA 1FDJA 3R13A 1JUBA 3W37A 3O2LA 2ZZ3A 1DJHA 4DUXA 2V3BA 3HJEA 3O63A 1VP5A 4CU7A 3N12A 2C3DA 4REQA 4A8RA 4Q8UA 2NLIA 1YPFA 1F8WA 1E6SM 3PBWA 4EVZA 4N4QA 1GPWA 3TOPA 1AZ1A 1VPYA 4JYDA 1RBAA 4ZENA 4ZB2A 1RY0A 3IC9A 1NHSA 1JYVA 4PMQA 4R53A 3DHDA 2ESCA 1US3A 3OGRA 4NZ5A 4EAYA 3C3UA 3V5FA 5A8QA 4ACYA 1YNYA 2XISA 1XBXA 3WUBA 3UXLA 3FJNA 3LPPA 2V3DA 1IYXA 2UV8G 4LANA 4TO8A 3OQEA 3G24A 4IF2A 3SCSA 3QM3A 3VMOA 3TC3A 3THAA 4GIEA 3E96A 5EA9A 1DBTA 3ECQA 1DYSA 3AXHA 3EWZA 3KL0A 3QYQA 4WGHA 3QY8A 2AL2B 2R82A 1TPB1 1Z9AA 4O52A 3ARWA 3MP5A 3M0HA 3TCEA 1ICPA 4LGXA 5HQMA 4LV9A 1J4EA 1V6YA 4ML9A 4C6CA 2HBVA 2YDQA 4XAYA 2A21A 4M7SA 2PDNA 3EPOA 4DPQA 7XIMA 3FS2A 2QIWA 1QNVA 1WX0A 3UWUA 1CLKA 4C1KA 3TX9A 3WEMA 3TCSA 1YYAA 1SJDA 3BQ5A 3EB4A 1TWWA 4UBPC 1VHNA 3PC0A 3OYZA 3CIVA 4AD5A 4CN4A 1NFBA 4U3AA 5EMYA 1DIKA 2XINA 1H3GA 3A24A 2OEMA 5FJRA 4CNPA 4GE8A 3OVGA 3BGJA 2E25A 4O1DA 5FCZA 3NQMA 1N8WA 4P7QA 3VGBA 2XH2A 1J18A 1S5NA 1A0DA 1OCNA 5CPSA 4W7WA 1ZL1A 4WHBA 4CEXC 1AFSA 3W3OA 5CZJA 3WF2A 4JX5A 4TIMA 4YVPA 3WMLA 4LY8A 4IT1A 3CUGA 1GHRA 4XZLX 2X42A 2V68A 3IGSA 1P48A 4P7RA 3EWBX 3HQNA 1KBLA 2YA1A 3BJTA 4S23A 3TA6A 1KM2A 1PTDA 3ABSA 2Y85A 3IGUA 3BGGA 4RNJA 2AQOA 3SCRA 1NY1A 4HSHA 4IQEA 1S2VA 1BGGA 1FWNA 4PSRA 2JF6A 1DQWA 1JIBA 4FLOA 2CLKA 3TFXA 3HJZA 3W07A 4A8IA 1X97A 1EBGA 2E5BA 5M5DA 2DH3A 4AXNA 1FVPA 3M46A 3TQKA 3OOQA 1QMLA 3WDRA 2QUUA 3AWNA 3KLJA 2WVTA 2JIEA 3EMZA 5ABFB 2DZWA 1YDOA 1F07A 1WZLA 2YZRA 1FQ0A 2XH4A 3Q2DA 1B57A 3AYRA 3EWCA 4IG2A 3W7NA 5FESA 5KZDA 3KUMA 1R3RA 1Z42A 1V97A 3NA8A 2EG8A 1FFUC 4NG3A 3TW9A 2DIJA 2NV2A 3VIIA 3PWGA 1QO2A 1W3HA 2YCJA 1KRAC 3FDKA 3G3MA 2GJXA 1O12A 1RR2A 1C29A 4BQ4A 4QG9A 3TTOA 1QUMA 1E55A 4NI8A 1OFQA 4S1FA 1QASA 3AI0A 1DIOA 5FS6A 4DN1A 4LYKA 3I4KA 1V3MA 4Q4KA 1TJ0A 1YDYA 3R0UA 1Q7MA 3L5LA 2VI0A 1RSCA 1QO5A 2CKSA 1SZEA 3MW7A 1VH7A 3K46A 3MCOA 2WLYA 4LVFA 1J2BA 3AS0A 2BODX 4H4QA 3OG3A 4PUKA 1FKXA 3ATYA 5KVIA 2OU4A 1CGWA 4GY1A 1BVNP 1VCGA 4CCZA 4AIBA 1KM5A 3H2EA 2ZUUA 4ZQNA 4NX5A 3VD4A 4UTFA 2FGBA 4QNEA 1J5SA 1UG6A 3WNPA 4MJ2A 1FFRA 2OX4A 3PZQA 1P0EA 5LGZA 4CVWA 4J2MA 4C6OA 3ABXA 3TA9A 3K30A 2O9TA 3P3BA 4H6EA 4AZ5A 4YTSA 5A95A 3QQ1A 2ZDSA 3DG7A 3UA3A 4AEOA 3CMJA 3ZS4A 4IJCA 1KR0A 5AHIA 1L6WA 3CH0A 4JL2A 3KTXA 3MUZ1 3U3HA 3REQA 1H41A 1W9VA 4FI4A 4M29A 3S9ZA 3S5ZA 4CQAA 2FZNA 3CB8A 3OGVA 1TVPA 3CS2A 3T0BA 4KW2A 4L61A 1RVGA 1EB3A 1NWUA 1T5AA 3HGOA 1C9WA 4M1BA 3WQ5A 3M0YA 1PZ1A 2YLLA 2OG9A 1JPDX 2J7HA 4ILSA 2I5QA 3GXMA 4J3XA 1AUSL 3WEOA 1M6JA 1EO5A 4WD0A 4PTVA 4GR1A 1KCLA 1FWHC 1QHZA 1LBFA 1T96A 4B5VA 3TYAA 1VB9A 5BOOA 4FOUA 4IQJA 4ZSUA 3SR7A 1ZJAA 5XIMA 2OX1A 4HNLA 3MSRA 3GIPA 1JOAA 2ZZ0A 4QROA 1XBZA 4KETA 1WDDA 4NU7A 2VZSA 1QNPA 3PN8A 2ZRWA 4AG0A 3E2SA 4UNKA 3TMLA 3TEVA 4JD4A 5BZAA 4DF0A 2WPFA 4JHMA 4JFVA 1NVMA 4EXQA 4L4OA 3DC0A 2ZADA 1E6RA 1QI3A 3UETA 1IHIA 2WPBA 4NAFB 2WC4A 1Y5VA 1DHPA 2FLIA 1KWGA 4AU0A 2EQDA 1E1FA 3H4XA 3DFPA 4YCOA 1HFBA 2IMRA 4JBRA 2NZLA 1XYZA 1AH0A 5IDZA 1VCVA 1KKOA 2ZZ7A 3S1WA 1DWFM 2BZNA 3AROA 2XVGA 4M80A 2D2HA 1QR7A 4URIA 3MHUA 4QE1A 3UY8A 2J7BA 1GKRA 2V67A 4WLCA 2WNZA 1OQFA 5C2XA 1EZWA 1Q66A 1AQHA 4HKPA 1UIPA 5D2TA 3GU2A 3ANYA 1XCFA 1BSIA 4WXZA 4Z17A 1OFOA 1TTPA 5HNNA 1IXQA 3T1GA 3LDVA 4BWLC 1VEOA 3T2QA 2J7CA 1PWMA 4JNMA 4RW3A 2PTDA 1KLZA 2YA2A 2VXNA 2Z0IA 2QJMA 3HGSA 4UOQA 2VX7A 1FX6A 4I6VA 3V0TA 2QCMA 3GG7A 1GETA 1HKVA 1XQKA 3QMSA 1RPKA 1KFEA 3B9DA 1W3IA 4E8DA 1QI0A 1RBLA 2Z29A 3WFZA 4C6IA 4J9JA 2ZZ5A 4EQXA 4INFA 1TB3A 3VOGA 1JZ7A 5AYIA 1H7RA 3KDNA 1UD4A 2OB3A 2J6XA 4N6EA 4KERA 2Z1WA 4Y9MA 5G4EA 1CGVA 3GWQA 3W71A 2VOMA 3N2CA 4FLRA 4LVGA 3MDUA 3IV8A 4I5RA 3KS6A 5G1MA 2Q3RA 4KKXA 3N29A 3AMZA 3O9NA 2BOFX 4AHQA 1EJSC 2F5ZA 3QFEA 3VNLA 3OQ8A 3GH5A 3V3WA 4S39A 3WQFA 2HVNA 3TR9A 3VE9A 2AKMA 5D02A 3BG9A 4IPNB 3N2XA 2CLIA 4BQ2A 3WJYA 1MWOA 5CJNA 3GDTA 1OABA 1JCNA 3AXMA 1Q65A 4X3ZA 3V1HA 5HOSA 3VM5A 4BWLA 2VP8A 3DFSA 5HWNA 3UZJA 4PSPA 4KFPA 4CQDA 1O66A 1HZYA 2V9DA 1XW8A 5L9FA 2WYSA 3TN5A 4BZYA 1WPCA 4JTGA 4W9TA 1CXFA 4GFIA 1OB0A 4ECLA 3LHWA 4ROPA 1OC6A 4JQ2A 2CZEA 1WDQA 2X0SA 4D6HA 1H11A 1FEAA 1Z8AA 2W55A 3NTYA 3O6CA 4TXEA 5T9BG 4WJEA 4KMQA 2YL6A 2VGFA 2V38A 3EDKA 3MSDA 3GD3A 4M8UA 3RLHA 1ITCA 1WE5A 3DKJA 1VRDA 1QOPA 3CUFA 3OLIA 4QJ4B 2RUSA 3KP1A 3W38A 2DJLA 2EHHA 3GC4A 2A7NA 2XJ7A 3KS5A 3W75A 4FPSA 4LNYA 3S2NA 1N55A 3DHPA 2XN2A 1V3HA 1GGOA 1O94A 5A2BA 2CIPA 4RR4A 1E43A 4FF5A 1XH1A 1NFGA 1XFCA 3KLKA 2CC0A 4S3EA 3VNJA 1E0WA 1KFKA 2QCHA 2CLHA 2PP0A 1ZY8A 3B8IA 1FOBA 4ZOBA 2ZA2A 4LAKA 4W85A 1K7EA 1Y7VA 5AYYA 3LI1A 3PANA 5HINA 3VE7A 1SUXA 3HW2A 2WW5A 4TTGA 2ZOXA 2XIBA 4RNFA 1S3HA 4QXIA 4A3RA 3UWZA 1TWZA 1T40A 2V5DA 3DC8A 4N42A 6XIMA 2WHMA 3THDA 2DT3A 2VEMA 2FVLA 2R9RA 1B3YA 1X38A 1ZB5A 3TH6A 3LGDA 2INZA 4EP8C 5D9PA 1TPVA 5AB3A 1BLIA 1F3TA 3TUUA 1GQKA 1EC8A 3VPLA 4PBGA 4UC5A 3C0QA 3Q4DA 5DY3A 1JYWA 3O0KA 2VRQA 4AZCB 1AODA 1TQXA 4WOQA 1R5YA 1F05A 1TJ1A 1ZTVA 4IUGA 2A3LA 2G97A 3ORWA 3LLFA 1KO0A 1XIHA 2YCIX 1O5XA 2HXUA 4I7UA 1ONFA 4JTDA 1Q1WA 3DFTA 4O19A 3ANVA 5EMMA 3O6YX 2ZZBA 3JRKA 4UIOA 4UR8A 3EPNA 4GQ0A 1YPXA 3VGGA 2PS2A 5I06A 3D3FA 5EB8A 3VTRA 4MB3A 1VBJA 1QOQA 3S2CA 2DSVA 3CGCA 3V36A 5F2GA 4HK6A 1TYPA 2QV4A 1D3HA 2J78A 1JZ5A 2ZBTA 1YE4A 2NV1A 3HOJA 3RLVA 1OX4B 2D69A 2Z1SA 5A5WA 4ATWA 2GVJA 4C65A 1ADDA 1QW8A 4F0KA 2ZA3A 5FACA 3ZXWA 4K3ZA 2X09A 2VGIA 2KZHA 4GZ7A 1N62C 1JQXA 1MRAA 3BAWA 1YDVA 3EKLA 4H6QA 4GG9A 4UTIA 4WR3A 2OT0A 1PIGA 4BEUA 5CC3A 3BJSA 4PRRA 1W9UA 2VC6A 3FKKA 4RDZA 3Q37A 4D1JA 4C1NB 4PUJA 1TV4A 1L2UA 2R1KA 1HJUA 1GOMA 4FF7A 5JMUA 3WDHA 1R7AA 2G3NA 2OQYA 4F2BA 2JE8A 3SQLA 2P50A 3O15A 1ZY9A 3R25A 2WNQA 1UR2A 4UQDA 4AEFA 5PTDA 3NAVA 2P5NA 1EWEA 1LPFA 2DQWA 5DLCA 3PFRA 3DHFA 3ZVIA 4DI8A 1UUOA 2BY1A 2O92A 3UD6A 3WD4A 2ACQA 1K7XA 4JQ1A 4LNCA 4X60A 4K8EA 4XD4A 2C15A 2YQUA 2RKXA 1GQJA 2FH6A 5LA1A 3TSDA 4RE3A 2CWXA 4EQRA 1GERA 2AOSA 4DBUA 3EANA 3A12A 2UZ9A 2VD9A 3WBYA 3NFUA 1Q7QA 3VOIA 1MZRA 1OSEA 1GEQA 3TIMA 1J6PA 1T0OA 1K77A 1X6LA 4UFIA 1WNOA 1XD0A 3QMTA 4HCLA 3IS4A 3MS8A 4HK5A 1N7KA 2AL2A 4AD1A 1I75A 1JEZA 1ZQ5A 4JDYA 3B40A 2JKAA 1UIOA 2J77A 5EFDA 5EBAA 1E0UA 5E5CA 1W1IE 2E09A 1W91A 4P5UA 2W3SA 1CLVA 2QV5A 1LCOA 4UTHA 3OBEA 3BAJA 1MFUA 2DZPA 3EB2A 1P5BA 3NZQA 4TUFA 2ON3A 3W82A 3SQMA 4HHLA 1EEPA 2F38A 2CZVA 2PFHA 1K4GA 1LWIA 4RUBA 4H9MA 3FA5A 1RK5A 2OFJA 2QCGA 1PKMA 4ICMA 1M53A 3N18A 2DUAA 2Z7KA 1XS2A 2V0TA 3O8AA 4H4TA 1HJWA 1N5WC 4HNUA 4AVOA 3URQA 1IXNA 1FWFC 4V33A 5J5DA 4PEKA 3OU8A 1BSLA 1PTGA 1VQTA 3MWCA 3W7MA 2GK1B 2YX0A 4L4PA 4DPPA 4IOTA 1C91A 3ZT7A 1MXSA 4LRTA 3OPSA 2DZUA 3ZVHB 3KOFA 2QVNA 4QAWA 3AUJA 3HG4A 4B5TA 2GJNA 1SR0A 2GVEA 5DT5A 1LRQA 3T07A 4CNSA 5LIYX 4MOZA 1HJXA 3QR3A 3WEZA 1EDQA 1MFVA 1BVZA 3TTEA 4FX9A 5LIWX 3OA5A 4A35A 5EMUA 3T0TA 1OD0A 1CWYA 1E9ZB 4H6RA 2ALDA 1QPQA 1TG7A 1OK4A 3UF9A 1UPMB 4IMFA 5HDRA 4EMJA 3LNMA 2HQMA 3W7QA 5DMLA 5BROA 1AMKA 1TIWA 4D6EA 2V3GA 2CHRA 3FV9A 1WYIA 3W24A 3CLMA 3RX3A 4POCA 3VXGA 2OOGA 3KBMA 2E5CA 2OCZA 3DGBA 8XIMA 4H4IA 3VILA 3WJXA 5ABFA 3S5NA 2PZNA 3SCPA 4H4UA 3HFTA 1HL9A 3EPMA 4WKFA 3SSZA 2D3LA 2Z6JA 1THFD 4H6KA 1G5AA 2G3JA 1XKJA 3PNZA 5DFAA 1XCWA 4ZCWA 4N2YA 1XP3A 3UG5A 1H6VA 2JIWA 1YNQA 2B7NA 1D8WA 1EJXC 3SFWA 5IOBA 4PCFA 5D03A 5FAJA 1G1YA 4NF7A 2NT1A 4LY4A 3G5EA 3EB3A 3H4WA 3N04A 1NWSA 2WMGA 1GZJA 2WCGA 2EPNA 3P2VA 4Z1DA 1QVBA 1CB2A 5I02A 3OO2A 1WZMA 3C0SA 1FHDA 1JRPA 3EZ4A 4J3WA 4YTRA 1PBGA 1T8QA 1D7YA 1OBAA 2C1IA 4E0CA 2QUTA 1PXGA 3KLLA 3BOLA 4NVTA 4GZJA 4AZBA 1RCQA 3A5VA 1W3KA 3HV8A 5LXEA 5DRCA 2QUNA 3B8SA 3N9RA 3WNLA 1M7XA 1NELA 4E4FA 4TVUA 4BQ5A 1XPGA 4S3JA 3CBWA 4WY0B 3VX1A 2D0GA 4BKNA 2ABAA 5EYWA 1N2VA 1TR9A 3BSGA 3ONCA 3MO4A 1BWCA 4HHHA 3GFZA 4IUOA 2BY0A 3UWVA 3W00A 4LUIA 4I5XA 1JULA 2QJNA 3E74A 3RG6A 2A5HA 1ZGDA 4E8CA 1HW6A 3EX4A 4PC8A 4TVYA 3IIXA 1W0MA 1D9EA 4DF1A 1OEPA 1XG4A 1TV8A 1ZLPA 1TELA 3U4FA 1OIFA 4XSLA 4W8AA 2Q8XA 4L80A 1ZUAX 4LS0A 4JIQA 2VNCA 2FJUB 2XVPA 4XIAA 5A6AA 5EPDA 1V7YA 3I7QA 2NX1A 2A3EA 1V8EA 1VLIA 4ORIA 3UWYA 5EBUA 3CUHA 1G9HA 2Z7GA 4JQ4A 4UCFA 1FHUA 3MMTA 4MFEA 4YCPA 3OVPA 1LOLA 3C2OA 1RAKA 5IFTA 4M24A 5CPLA 1Q6CA 1R46A 2PP3A 5IHSA 6TIMA 3AU2A 4XIMA 4GIRA 3S0CA 1OK6A 2XIMA 3CYJA 3HN3A 4MDPA 3K2GA 7REQB 3MHFA 4NZ1A 4S2CA 3NWRA 5G2HA 3GDKA 3TW6A 3U7BA 2PP1A 3TTSA 3MCNA 2WOQA 5FF4A 1KFLA 4QCFA 5ABHA 3B9EA 2JFEX 1GKPA 2EQ7A 3FG2P 5LNSA 5ABTA 2QIIA 3NNTA 1QWKA 1XDLA 1PYFA 3KTSA 3GVWA 3GM8A 2YAUA 2FZ9A 4NX0A 3RITA 1XLJA 3GTIA 1Q7ZA 1FWEC 3DDMA 1GRAA 3VIFA 3BZJA 3FXYA 1O60A 1PHQA 4LX4A 2C3ZA 1W5PA 2PURA 4WY0F 3T44A 1UOKA 3CMFA 4H04A 3LCFA 4IJBA 4Y2WA 1ZX9A 1DP0A 4G1NA 4LUTB 5I0DA 7PTDA 3BO9A 5H91A 5F2LA 2YJQA 3UT0A 2C3CA 3V4BA 4K8GA 1XGEA 3FKRA 2J9YA 1U30A 1TO3A 2OO6A 1HP4A 3TU9A 3T4CA 5A3HA 3L12A 4QNWA 3WD2A 4TVCA 2IPJA 2X7VA 4Z42C 4C6FA 4XZHA 3TOYA 3AIQA 4D71A 1R2SA 2Y5SA 3GTFA 1EGMA 2PDJA 2WBKA 3NSMA 1KV5A 3FW6A 1UBSA 2WZIA 1XRFA 3ZWTA 4LVDA 2TYSA 1TCMA 1C8QA 3DESA 1X1OA 2PTXA 3MV01 2D23A 5CCZA 3ARYA 2AMGA 3KRSA 2WVSA 4MGGA 4AWEA 4E4UA 1XPYA 3STCA 2FZ8A 4IPPA 2BGNE 3P0WA 3HV9A 2QJIA 2OODA 4JHOA 3USBA 1WOAA 2OVLA 4RL3A 3EA1A 1TZ9A 1OX6A 4MWAC 3MI2A 2QCDB 4PMDA 4EKJA 4UOJA 4GGBA 5I24A 3RYSA 3QHNA 2XHYA 3PJWA 1CBGA 1S5VA 1SO6A 2PAJA 1N63C 3PZIA 3PULA 3R8HA 4ZO6A 2F9RA 3GVRA 3ITYA 4UXDA 1UD2A 4HZ6A 4YHGA 1E4MM 5LNUA 4HQVA 2J74A 1UA7A 1JPMA 1VPXA 1NJJA 3OVQA 4HU0A 2WPGA 3WENA 3BARA 5JBFA 2XN1A 4ZXOA 1XV8A 4MKNA 3W70A 1NOWA 1TTQA 3MKVA 3TFCA 3GZAA 2P0IA 5CXPA 4B5NA 1GHSA 3AICA 1EKOA 4HJWA 3NS1B 1MW3A 3GR8A 5AC4A 3LA4A 3UXDA 3DEQA 5A6SA 1OC5A 1NU5A 1XLGA 3F5JA 1LORA 3OODA 4ZOAA 1AZ2A 4S3KA 3QFBA 2BLEA 3BGAA 3GVQA 3S5OA 3ZJKA 1R9YA 5G4HC 2W91A 3T81A 4K8DA 1DIDA 5XIAA 3VIOA 3ZR4A 4XKYB 3R43A 3ZLFA 4D72A 4Z2IA 4HTBA 3W1QA 2V5LA 3SB0A 4O57A 2ZUTA 4RZBA 3WLJA 4PUDA 4ZODA 5HA7A 2NXIA 1MXGA 3NQAA 3VA8A 1T8XA 1XUZA 1MEWA 1M6IA 2V3AA 1FH8A 5HNUA 4CNNA 4FNSA 4UTJA 2E6FA 3IAPA 4MWAA 3ARZA 3L5MA 4GJ1A 1GVQA 4GACA 2NQ9A 3D9XA 4J35A 1H2JA 3NYZA 3NXLA 5B80A 3A64A 2X8CA 1MDRA 3VKBA 1GORA 4E4PA 3MQTA 5I7GA 4JCLA 1EIBA 5DMMA 1KM1A 3B04A 3AYVA 4C6QA 3KCJA 4HMDA 3CGDA 5CGTA 2PRLA 3NZRA 5EFFA 1V93A 3KFTA 3NVTA 1JEHA 4XVDA 2YVGA 4ATLA 4ERGA 1JCXA 1CI1A 2X2YA 2P8BA 1K8ZA 1PTAA 3VOHA 3FNDA 3BW2A 1LYXA 2VFHA 4EMWA 4WCJA 4H9TA 4MYAA 1V6VA 2G41A 3W23A 1C92A 3OEXA 2YGYA 4O10A 4KWOA 5AVHA 2GPTA 2VCAA 1KD0A 3VABA 3M5XA 4AZCA 4EPEC 3BQ6A 3BCDA 3UVAA 1X96A 3ISIX 1JZ2A 3V1PA 1VFSA 3C56A 4IJRA 3TSBA 1JROA 3FJLA 2PDLA 3LCHA 1FECA 3B97A 2DT0A 2VJXA 5M2FX 2Y8UA 1O5KA 4ZR8A 2X7WA 1MOKA 4DYEA 1F7BA 1Q6DA 2ISWA 3MP4A 1ALDA 2WJZA 1OM0A 3WH5A 5DXYA 3RJYA 2ZXQA 4GINA 5KITA 3N4AA 4GZIA 6XIAA 4XBSA 4ZVJA 3POCA 4Z1BA 1Y65A 1EO7A 3NM1A 5E6YA 2CYGA 1R9XA 3B9NA 1U2YA 1GOOA 3LGEA 3S6TA 1Q2SA 1BF2A 4PMJA 3P93A 2OPJA 5MKGB 2QDEA 3G1XA 3RLUA 4Y96A 3SCQA 3H2AA 5D33A 2A3BA 4S3BA 3GBEA 1XLBA 2QCLA 3LERA 3UW6A 3TKFA 3QQ0A 5AHEA 2QUVA 3SO7A 5A1AA 1JAEA 2YFNA 2EPHA 3GE7A 1ITXA 1W3NA 3NQ8A 3NIYA 2BC0A 1HL8A 4C6PA 4X63A 3N2MA 4H8HA 1H1YA 1WKDA 4L5ZA 1HQTA 1BKHA 1EZ2A 3LHVA 4KQNA 2WP5A 3WBAA 3U2EA 5FJTA 5A6JA 3TQPA 2WSYA 1GTHA 5T9CE 2XWDA 3SEPA 2OYKA 1K8YA 4AZGA 2CW6A 4IX0A 7A3HA 4F2TA 1IIHA 4PMXA 4JXCA 5ENLA 3PFMA 1XINA 3A9BA 1H2IA 3TN3A 1B31A 4ZE4A 5FEWA 2WSPA 1P0NA 3T08A 1UKSA 3L5OA 1E0VA 3OLEA 1VENA 1CEOA 1E72M 5KZ6A 2QXWA 1UHVA 2J13A 1LLWA 1H5VA 2V81A 3G6MA 3CV7A 2CLFA 2EPLX 3MANA 2ACSA 3VU2A 5BRPA 3W25A 1NEYA 2EG7A 5HAOA 4P8WA 3VVGA 4KWUA 4QQ3A 1NSJA 1GPFA 2AAQA 1FWSA 4JTTA 3GK0A 5EGRA 3DFYA 3T8QA 4R33A 3KBSA 3GS6A 1HF6A 3MUCA 1J96A 3PWAA 1EYWA 3NPWA 1VZWA 1EOKA 2EXOA 1I4NA 4JR5A 3O0FA 2FMOA 4A6GA 4QISA 1MW1A 3RU6A 3EWYA 1A3HA 5TR3A 4GQRA 1RQBA 1XYAA 5C54A 1S5WA 4DIAA 4JTCA 1HGWA 1Q6GA 2YBVA 3FYPA 1C8YA 4X9YA 4Z2GA 3IK4A 1WAWA 4HOXA 2G96A 1L8NA 3WH7A 4LCRA 2H9AA 2PDCA 4NJHA 3H7VA 3NQCA 3AHXA 1D3GA 3BG3A 4H4XA 3BLIA 3LSCA 5CSYA 4CNOA 1KNWA 4HNVA 2CLPA 4JDRA 1SM9A 3W9ZA 4LRSA 1VIWA 1YEYA 3WH8A 1O68A 4F8XA 3P67A 2HNHA 1JCTA 1FHLA 1WKEA 5FA5A 5I77A 3NVWB 3SR6B 5CH9A 1ONEA 4ADUA 4M7TA 3V75A 2ISDA 1QI2A 3HPXA 4JFWA 1J6OA 2BHZA 1AJZA 2NVCA 2CITA 5AYBA 1G94A 1R6WA 5TNVA 5K4ZA 1HG3A 5D09A 2GR2A 1EJWC 1GEHA 3TNOA 2VR4A 3NO3A 5C7HA 2AAMA 1N60C 3ZVHA 3SJNA 2DW6A 3EDJA 2WJEA 4N9EA 4L9YA 1WAUA 4LYPA 1NP0A 4CN1A 2WVUA 1IQ8A 3GDLA 5LNWA 2R91A 4V15A 1QXLA 4V1XA 1ZU8A 1XLHA 5FL1A 3V35A 5U25A 1YTDA 3VCNA 1IT0A 2UY5A 4OUEA 4ZB0A 1AOGA 3W7OA 1ZFJA 3VIKA 2DGAA 5KTLA 4AZIA 3VC5A 3ZOAA 4EF9A 5K7JA 4GX8A 2AQWA 3RHGA 1V6XA 4MZ8A 1F6KA 4AX6A 4HD5A 4XUYA 1FCVA 4F4RA 3AU6A 4K7ZA 3ELFA 1Y5WA 2WNNA 3B9OA 3IIVA 5EMJA 3GG1A 3NL6A 5CC7A 5C8BB 3SRKA 1XG3A 2V63A 1XBYA 1XIFA 3A5FA 4Z2JA 1XBVA 8RUCA 2PGRA 3WF1A 3WYZA 3R79A 3W53A 3ARQA 5I09A 5AZ0A 1YBQB 5CAKA 1PVNA 1QHPA 4IQDA 2PI6A 4ASTA 3W2JA 1QT1A 5LHFA 4C1LA 1E3ZA 3PB2A 4MG4A 3EYPA 4OV9A 4B9ZA 3HMJG 5A8NA 1NOFA 2VVNA 3UJFA 3ZQ9A 4PN2A 4MPQA 2CZFA 3DFHA 5BRQA 1NWTA 3TXZA 1WQ5A 5E6ZA 3W1NA 4B3LA 3T6CA 1F3XA 3GH7A 2ACUA 3WJZA 3H7UA 3OIHA 3DI1A 4RXFA 3TTQA 2YFOA 1F3EA 2GGEA 3G0SA 3LGGA 4IIGA 1XDMA 2P3EA 2GR0A 4BA0A 3KBVA 1H49A 1V6WA 3EXSA 4MNLA 3NEVA 1B9ZA 4LH8A 2G3IA 4KIRA 2G0WA 1M7JA 1VIZA 3LHZA 3K1GA 1HN1A 2OQHA 2X0HA 3PR2A 2WZMA 4WY0A 4HZ8A 4J3VA 3ICJA 2NV9A 5C9RA 1V03A 3EX6A 2R9ZA 1EUAA 4F66A 3V5CA 2BVTA 4U5KA 5U7SA 3VGHA 4DXXA 1HKMA 5AHMA 1ICSA 3GVGA 3RMJA 4UTTC 1VC4A 2G5WA 3OZOA 3IJ8A 4U4MA 4H4VA 1HVXA 2VTFA 3A3HA 1CW2A 4GO8A 4AD0A 2A3AA 1QNQA 5E93A 4NSBA 2QEZA 1VHCA 1QK0A 2DZTA 3IUDA 1UUMA 3DG3A 4ZOCA 1HXJA 1ZAHA 4JKMA 3TJIA 4IMDA 3VKAA 2WHKA 3HG3A 3MPGA 1POJA 2ZWYA 1WYGA 1SJBA 4HNOA 1OCBA 1FH9A 2J7GA 3RLGA 2B7PA 2IXVA 3TLLA 2CFYA 1XLCA 3EOLA 1U5HA 3HQPA 6PTDA 1LT8A 2J88A 1TX2A 1GG1A 2CNCA 3K13A 4F3HA 1E1CB 1SYTA 5FS9A 1I2NA 1FWJC 1GONA 5SWUA 1K02A 3DU0A 1EQCA 4JCMA 2OZ0A 4RK8A 4Z2LA 3QPEA 1FBAA 3TP4A 7REQA 2QJGA 1HP5A 2EPOA 1FDZA 1ZALA 4BI5A 3LQLA 1EF3A 4JZ5A 4KCUA 1W54A 5D2WA 3SCUA 1W9PA 1C9DA 4JPGA 3OZMA 3NDYA 3KBNA 3F4CA 1BRLB 4LAUA 4Y9NA 1QPNA 3GXTA 4UFKA 3NDOA 4EQWA 1JZ4A 1XIBA 2PMQA 3IJ9A 3BXWA 3ATZA 3ALGA 3TC7A 1VRXA 1KXVA 3AOFA 5C9WA 2BG5A 2J62A 1OG6A 2DQXA 1EPXA 4CLMA 3M0XA 2VL4A 2WHLA 1BYBA 1R86A 1VBHA 3UERA 5D8ZA 3EA2A 5AC7A 5FIPA 5C9ZA 3NYDA 4UTTA 2WPCA 3F1QA 1BEUA 2PODA 1WZKA 3U57A 4DO6A 4H4WA 2FTPA 3FHQA 3M7SA 1GZGA 4LUTA 2DFAA 3H22A 3CWHA 3HRDC 3CV2A 1VGAA 5K9CA 4PTMA 3UVIA 4ZQCA 2GZXA 1TTJA 2CERA 2NVAA 1XISA 3K1DA 2BMBA 1JFHA 1K70A 4MWAD 3LXCA 2ZXBA 3L68A 4A8NA 1OJTA 4MFDA 4LAZA 4JFSA 3W22A 1NM9A 4AVNA 3RCNA 1Z89A 3I6TA 1B3WA 2R1MA 6REQA 3PBGA 3M5YA 1UR1A 2HPIA 2C91A 5I3KA 3LYEA 2OWWA 1IR2A 1RD5A 4EM4A 3H55A 4I9AA 4MNJA 3WLQA 4CD6A 5C2GA 2PWHA 1KTBA 1UZ4A 3I3EA 4J28A 4QE4A 3WNNA 2HE5A 2E3ZA 4LW7A 3EEGA 3T2OA 3UWWA 3GG8A 2QCDA 1W5MA 4IGNA 3TTYA 2ZA1A 4GUHA 2C8NA 3F4VA 2V3FA 2Q02A 4LA1A 4RE4A 4DBSA 4IPLA 1WCGA 1DE6A 3UCDA 1NFPA 2J25A 2ZE3A 2XH7A 5C55A 1JNDA 2WC3A 1BWLA 1PX3A 1CB7B 3W2LA 4B5WA 5A6LA 2QW5A 4ADTA 3W02A 3THQA 4HA1A 2GUUA 3EOOA 4D8AA 3UZYA 3GNNA 3SGZA 3GY1A 3DBPA 3CV6A 3DECA 4BCEA 1TPWA 4GMEA 3R0DA 5JH1A 2TODA 4H50A 3BK0A 3LY0A 4MJZA 4QJ5B 1IZKA 1J8VA 2CZDA 1SFLA 3A6OA 1Q63A 3WLKX 1A3XA 4QITA 3GFYA 1Z32X 3TYBA 2V5JA 3T0CA 5FJUA 3V16A 2VHLA 4A29A 4IIFA 5HMSA 4XO7A 1DV7A 3STGA 4H01A 1KXTA 1JCMP 4FEZA 4D6CA 4LVAA 1MDLA 2QF7A 1G4EA 2VOTA 1W17A 1ESWA 2GOUA 2GSEA 3SCOA 3FK4A 1MUCA 3NSNA 4TR9A 4JN7A 1T3QC 5XINA 1LQAA 3W1LA 2I5GA 2PBGA 4I3GA 1UKPA 4KEUA 4BY3A 1W5QA 2Y6ZA 4UFJA 3P80A 4Z0SA 2OLAA 4GH3A 5JIPA 2A6LA 1TJPA 3RN6A 2WV8A 1RH9A 3W2MA 3CZJA 4IIDA 2YYUA 2MUCA 1A80A 1DKWA 1GOWA 4MY9A 1P7TA 2H8XA 1OYAA 1GXFA 5AHNA 2PF0A 5IXEA 4C6MA 4X0VA 3NOEA 1QW9A 1F8IA 1ECQA 2BSLA 5CG7A 1SO4A 4PBFA 3TZFA 1TV3A 3F2CA 4FK9A 1GVSA 3WFLA 1POKA 3GTNA 3MZNA 4IFKA 5F2IA 3N15A 4UFMA 3QBUA 4TMCA 3DYOA 3WY1A 2HROA 3M64A 3B0VC 4HYRA 2YYTA 4O4VA 5F4SA 2PD9A 4L6OA 4Y9PA 4K36A 1GQIA 3BV4A 4GKLA 2HPMA 4LSBA 4HSNA 5FEPA 1W8SA 4JIEA 3NSXA 2IKGA 1IWBA 5CZKA 3WF3A 2GVYA 1JF6A 2ZZ2A 4EPKA 1FCQA 3OW1A 1EJRC 3PZUA 1VFTA 3UNDA 3GXIA 3CTTA 2XVKA 4FDCB 1AW1A 3SUVA 4PMRA 1TMHA 2UWFA 1XSJA 3N4EA 4OVXA 4CCCA 2YR1A 4NNAA 3G8EA 3I7RA 3KOXA 1PX4A 3VI2A 4NP7A 1VJIA 4PUMA 1EDTA 2AAAA 3STPA 4FR6A 3GU1A 3WUFA 1F61A 5CAHA 1V51A 4CQ9A 3JS3A 4GRSA 1UA3A 1KM3A 5CZTA 4KPRA 4H2HA 1X6UA 3F4DA 2A3HA 1KFBA 1Q6OA 1G67A 3B0YA 3PPFA 2OYMA 2CXEA 3WLOA 5CLTA 1VEPA 3W6LA 3VC6A 2PWUA 4UTWC 4S3FA 3PAOA 1AH4A 3M6YA 4B16A 1X98A 1CTNA 4EOUA 2ZCGA 3EDEA 1RVKA 3BAKA 1UP3A 5DMNA 4C90A 2XSBA 1L6GA 1MVYA 3EWDA 3AM9A 1BG4A 2X99A 3QXBA 4UMBA 4ZFCA 3GDBA 3ITGA 3BE7A 1E40A 5I3IA 3IIZA 3M0JA 1NHQA 1N8FA 3DBNA 1QHOA 3QPYA 3ABOA 3WUEA 3A4AA 1LRNA 4IFOA 4Q4RA 3HQOA 3GX9A 2IQTA 1IWAA 2QF8A 4JTRA 3AIUA 4IMEA 2XGIA 3CK5A 1D2KA 3DN5A 3FY1A 3WBWA 4TU1A 4FNPA 3LB8A 2G50A 4UCGA 2BOGX 4CNUA 4US5A 3LLDA 2Y0FA 3H2FA 4KCVA 3H26A 3P5ZA 5AFDA 1E9IA 3G0XA 4JEQA 1VPQA 1AQ0A 3A7AA 3TMQA 3AFBA 4OOZA 2I56A 1NDWA 4WIWA 4DWSC 4EPDC 4IMGA 1KRCC 4WJXA 4DUWA 3ZLHA 1FO4A 2WKLA 4FNTA 4EQSA 1LL7A 4HA0A 2VX6A 1ZSXA 3RAOA 3CM4A 1CT5A 2J9XA 3CJPA 2A7RA 4PMOA 4O18A 3U6WA 2IPFA 4UTWA 3ARSA 4O4WA 2O55A 1PKNA 3RILA 4NT0A 3L4ZA 5HR7A 2E6DA 1ISZA 1I60A 1I9CB 1MSSA 4A05A 2DIEA 3B0PA 4DLMA 4E38A 2PDHA 5G5GB 2JGQA 3AXIA 2YPIA 1UW9A 2KAUC 3SSJA 2OGJA 4KGJA 2ZUWA 4ZB5A 5KEZA 2BNJA 5B7YA 5F1UA 3G22A 5HATA 3KW3A 2WO5A 4IIHA 4TTUA 3KRZA 3QV6A 4FXSA 2IXUA 3BG5A 3CQJA 4J5NA 2DVTA 2Z6IA 3EA3A 4LYRA 1TPEA 4LV4A 4YWOA 5A6MA 4QBXA 3UGRA 3NL2A 1CZ1A 3TC6A 1CGUA 2X1TA 2IS7A 4AY8A 3PTQA 2YCEA 2OWXA 3P60A 4V27A 3P61A 2V6OA 5BXPA 4OZOA 3TV8A 3W73A 3TW7A 3MKCA 1BTMA 5FF3A 1ME7A 1H7NA 3DGZA 2OR2A 1IV8A 4L4LA 2H3DA 2ZRUA 2F61A 3E0IA 5BXSA 4NHVA 3SRDA 4DWSA 4IWWA 1PKYA 1MUWA 1V08A 2QGHA 4YWIA 3L67A 3GBDA 2OMAA 4FZIA 1Q2RA 3R94A 1D7FA 4DNAA 1UROA 5I2UA 1V02E 4QR6A 2F6UA 3VGEA 1UB3A 5FJOA 1ODZA 2YCKX 2ZFAA 5BU6A 3OLGA 1RA0A 3QC3A 1VAHA 5A8MA 5BXTA 3IJLA 4UMAA 4HOWA 3GU9A 5JU6A 2CZ5A 3WNKA 4R7WA 4N7QA 4W93A 1YBQA 4D6JA 3TK7A 4Y8FA 1PYMA 4C91A 4DLFA 4LAMA 1EDGA 3GB6A 3P8JA 3CHFA 2ZX5A 4YN5A 4AIOA 2DORA 1NTHA 2X40A 4FLQA 3O7UA 1A5AA 1OVDA 1WP6A 1AL8A 1QK2A 4JKLA 5TQLA 3IGXA 1H1ZA 5E0KA 1E6NA 5AHFA 2YXOA 3N3MA 4JGDA 2BCPA 3WF0A 3OBAA 2VR2A 3KEHA 4J3SA 2VZTA 3W7PA 4DZIA 3LZ3A 2GSJA 1LF1A 3IVTA 4YNGA 1A5CA 3BLEA 3NPUA 1EJVC 5E70A 5BCAA 1VYSX 1B3VA 4FX8A 1FCBA 2VQUA 3QTPA 1ZBCA 2J8TA 3PUEA 2PLMA 1GYMA 5DT7A 4UR7A 3LMYA 4JX6A 3B4YA 1E70M 3SUWA 3CT7A 3AIVA 5AOUA 2FZMA 2GVGA 2J8FA 2VD8A 1BAGA 3AMKA 4L9ZA 2J7EA 1TPDA 4NXKA 2QCFA 4HNNA 4XAGA 3KBJA 3PG6A 3FGCA 2BASA 5D2VA 5LKYA 2Z1VA 2YCLA 2CHOA 3A4WA 3VNIA 3PTDA 2WVVB 3M0ZA 2ZX6A 1XF0A 3SURA 4QE5A 1KQZA 1FUYA 1X1ZA 3TNBA 1QBBA 2VZVA 3PB0A 1LVLA 3B0XA 2ACRA 2XIIA 1V0KA 1BYAA 1GQNA 4WZHA 3LM7A 4WEVX 4L56A 3VCRA 2D24A 3E49A 2W63A 3EOEA 2WHJA 2CBVA 1V3KA 1A5KC 2ZUVA 3XINA 4ALDA 4JIPA 2ISSA 3ARVA 2V6AA 3URAA 3PJUA 3GNPA 2GUBA 2RJHA 1E1CA 5I79A 1R9ZA 3KOWA 2JALA 1GJWA 3T40A 1KFJA 1VFHA 1DJYA 1FH7A 1OFBA 3B3DA 4GJJA 2F6KA 2A6NA 2FH8A 3AMDA 3R4IA 2V5BA 1TYGA 3BLOA 2EKGA 4O1CA 5HNTA 5AVNA 3BSMA 4H3DA 5E9XA 1UH4A 1KWKA 3CASA 5IM51 1Y0EA 2Q8LA 5HNRA 4EM3A 3MMDA 3G8RA 4DVOA 3LEPA 1LLOA 4D6DA 1JDAA 1J01A 1H7OA 3PP7A 4HU4A 2AGTA 2HBXA 3PS7A 4LC8A 3NGFA 4FO4A 2OZ8A 2PEVA 1R8LA 3LK6A 4NRRA 4X2PA 5FF0A 2PWFA 1A5NC 4W89A 1MEIA 1E71M 3G3DA 3I6RA 3DFNA 1TE1A 5D4YA 2ZZ6A 3PAJA 2ZX8A 1LUCB 1VLWA 2JBMA 4AWTA 1CXLA 4DM1A 2YW4A 2VDIA 8TIMA 3DJJA 3W7JA 3ZO9A 1XFBA 3E38A 4JQ3A 4NNCA 1RJQA 2P1FA 3W1TA 3FHAA 3PZGA 2VFIA 1OZQA 4GPNA 1RM6B 2FTYA 5FSEC 3GNXA 2XSAA 5D05A 3VNZA 4EIVA 3AS1A 2HDJA 6A3HA 2XFYA 1QW7A 2PUZA 3VOJA 3VDGA 1E51A 2QKFA 4B15A 1XHCA 2CESA 2VWSA 1JZ3A 1E6PA 4BI6A 1MW2A 2XVNA 3DIPA 3WD1A 3AC0A 4FOKA 1RJPA 3K4AA 3SQPA 3DAQA 4QS5A 1PZ2A 4DBWA 3N6HA 4LIIA 3DOPA 3KHJA 2DUZA 4TX8A 2WWDA 5HJYA 3UCCA 1HNYA 2PLJA 4KRZA 3TWBA 1B3XA 4AF0B 1Z6KA 4CQ8A 4DNMA 1KBKA 4RNIA 4NILA 1A49A 3ERPA 5E9AA 3NGJA 3CHEA 2VCBA 1BYCA 3ES7A 5CGQA 1IGSA 1BXBA 3ITVA 3WK3A 4GRTA 3WLNA 4BJHA 3EAUA 3E1F1 3OTRA 3G1RA 4PTXA 2QAPA 3GR4A 4LBSA 3L2IA 2GQ9A 3UJ2A 1DJNA 3S2LA 3NRZB 3D47A 3LV6A 2UBPC 4YHEA 3AS3A 1B4EA 3F7JA 1LM1A 4R9XA 3W7KA 1G4PA 2BTMA 4RZ5A 4J56A 3MUIA 3KVKA 2VEIA 2W61A 3N1AA 2HV5A 2QCNA 1VD6A 3E0WA 4IXXA 2F2KA 3W87A 1EBHA 4ONVA 1IXPA 2XVLA 1Q8AA 2DDXA 3OZYA 1R3SA 1TA3B 4TV6A 4KEZA 5CJ5A 1Q8JA 3L9CA 5LYRA 1NDZA 2WNWA 2E8YA 3TYCA 1GV4A 3W6YA 4JTLA 1G69A 3VZYA 1QTWA 2Z00A 2IPGA 2YL9A 4P8UA 2WM0A 3MZ2A 3SY1A 3M5VA 3P7YA 1Q85A 4PCNA 2PDUA 1W1PA 4H8UA 3JZEA 3SJ3A 3LB0A 3QHOA 3SIMA 1EF2A 2A1YA 4AYSA 2A3CA 3HGRA 3LHTA 1UKOA 1IZJA 2UY3A 2DEPA 1QNRA 1GOKA 1US0A 1OCQA 1OGSA 2Q71A 3LPGA 4GCXA 1BQCA 2FB2A 4JIIX 2ZZCA 1V6TA 2ZUSA 2R8WA 4YL2A 4BK9A 5JIWA 3VUSA 5A6KA 4O12A 1FRBA 4ZMGA 4Q33A 4MUPA 4AD4A 2POTA 3C2FA 4W8BA 5CJMA 3LBMA 4REQB 2Z2UA 4PGLA 1ZAIA 3DK8A 3ZJ8A 4NRSA 3K5XA 4Y6GA 3AUOA 3WQ8A 4GC3A 4DJEC 3USZA 3D3AA 1F73A 1I0BA 2PD5A 2EPMX 3RMEA 1R3YA 4CVUA 1O1ZA 3VNMA 2WMIB 3HGJA 3FLUA 4US5D 4W84A 1KFWA 3O6AA 1UQYA 1YKWA 2J8GA 2GFTA 1FEBA 3CUIA 1UWTA 3U2OA 1GCYA 2VEGA 1TMLA 4ZTYA 3L0NA 1ZRQA 2Y61A 2R6OA 3ONBA 1AW5A 1UMYA 2HNEA 3CHVA 3UPWA 4K7YA 1N8IA 4C7GA 4GI6A 1E73M 4RV3A 1V0MA 3UR2A 1XLMA 2A2IA 2O7QA 2JKPA 4HHMA 1KXHA 3P74A 1YTKA 4A4AA 3F4WA 1VYRA 2VGGA 4MVAA 3WDIA 5GNYA 4AYGA 2G3MA 3N4FA 3WD0A 3HU7A 3PUOA 1RK6A 1M68A 4NQ1A 3BANA 2REQB 1C8XA 2QR6A 2XIJA 2V69A 4Q7BA 2GDUA 1R87A 4I90A 1TVNA 3HIJA 3LCXA 2J75A 5BMWA 1KGXA 4ZSTA 2FPYA 3SI9A 1BZLA 4JKKA 1H7PA 4DO7A 1QU4A 2PC4A 3BMWA 2RH9A 1J2WA 4DBDA 1EC7A 1TRDA 4ZO9A 1EWDA 4ROQA 4F2UA 4B4HA 1E3XA 5I3HA 5FEZA 3UU0A 1XIGA 2B31A 2BVDA 1REQB 2PWEA 3A13A 1U5JA 2YOCA 4DJEA 1WKYA 2PDFA 3CUXA 1KRMA 2GWGA 3VNYA 2X1SA 1NPXA 3C2RA 2F8QA 3CH9A 4RE0A 1G01A 1TRIA 1UR8A 1PO9A 1WUEA 3FEQA 4DWSD 4JIRA 4GC4A 4MJ4A 3VIJA 4A8LA 4HCHA 1CXHA 4K2SA 5BOFA 4O0KA 5LNRA 1UWQA 2I57A 4LBRA 3ETRB 2ZVRA 2NWRA 3W1XA 3F5KA 3G0UA 1K7FA 1ITUA 5K2ZA 4H4RA 5A6TC 4XK2A 1AJ2A 4WF7A 3W81A 1NQ6A 2DSWA 5K9XA 2GLKA 2D2OA 4GIYA 4MAZA 2QUMA 4JYFA 4QX4A 1EJ7L 4IG2B 5I3GA 8XIAA 4S3CA 2PCQA 3GTHA 4DRSA 1KA9F 1N82A 3UG8A 3WQVA 4KWSA 3RX2A 1XDJA 4WGXA 4NAEA 4R3UA 4LUSA 3WD3A 3ZR6A 2FKPA 4QTGA 3CT2A 1SO3A 3T42A 3VIGA 4WSHA 1JNEA 1DJIA 3PBVA 1GVRA 2OJPA 4OKDA 4HSOA 1ENUA 4M6VA 4IFRA 2O4MA 3UESA 2O0TA 2WQPA 3F2DA 3QSRA 3K8KA 1CX9A 3QRHA 3B8DA 3ITLA 5D30A 3ALFA 4GIAA 2VDHA 1LJYA 5FD0A 4Q7NA 1XC6A 1FXPA 2WSKA 1TQJA 5C7VA 1BHGA 5CSRA 3SN1A 4GHRA 4IXHA 4M6PA 4PZVA 4LWWA 3CZKA 4KH2A 4K1WA 4HZ7A 3AHVA 3CIXA 4ACZB 1E9LA 1Q6FA 3OBKA 1GQLA 4Q4OA 3DH7A 1A5BA 5EU9A 1P43A 2CCRA 3CAQA 4AHPA 1M5WA 2Z24A 1K4HA 4QM1A 2W79A 4DZAA 1CCWB 7ENLA 4HOZA 1PDZA 3APYA 3VOFA 3N2TA 3NQGA 3BLKA 4F0LA 1KR1A 4FAMA 5BWAA 3S8HA 2XUCA 5H1WA 1R2RA 1TUFA 2PLCA 3BOFA 2HMCA 2XFFA 3M9YA 2PGWA 3ZSTA 2NWSA 4X9SA 3KWXA 4A21A 3C2EA 3SADA 2NUWA 4NJIA 4HU3A 4O1FA 1LL4A 1S2WA 3S47A 2XDFA 1E6XM 1K9EA 4QJ3B 4QS6A 2E0PA 2VFEA 4EANA 1ZMCA 1ODUA 2CBJA 2RDWA 3BUVA 1TPH1 1J10A 1UC5A 4FLSA 5CZSA 4E6MA 5FJIA 2DZSA 1NOUA 1PHWA 2E7FA 3VD5A 2YSWA 4C6EA 2YZ5A 1J79A 1JDDA 1XQLA 1NDVA 4F9JA 3OHMB 4A2RA 2IKIA 1OINA 2JEPA 3AIRA 4PYSA 3BLFA 4YLWA 4X2RA 3WZ0E 3OA3A 1W9XA 4IPIA 3TAKA 1BXCA 3E2RA 2DSKA 2OSWA 3V18A 3WL1A 1Z3NA 1CIUA 3HG2A 2J27A 1TJ2A 4J3ZA 3AMCA 3T0AA 3L66A 1UD5A 2VC9A 3POHA 4W88A 4WJ8A 4XBJA 3R12A 4WDUA 4L6DA 2OZTA 4HMEA 1J0YA 1DNCA 1CGTA 4N02A 4FNQA 2V30A 4GOAA 4CQBA 4R9OA 3K4WA 1TSIA 3HTWA 4YIWA 2FDSA 1QNSA 4H2CA 3BTNA 4MF4A 3SQSA 1V3JA 4Q4MA 5HMFA 1OF6A 3C4UA 1E9YB 3AALA 2P53A 3OC4A 2GQWA 1N5XA 1AJ0A 1GW1A 3K8MA 3WQWA 3G1AA 2D20A 4GBDA 2B7QA 4OTKA 2PRHA 3DK4A 1DEDA 3PSVA 4MY1A 1HVQA 1GYNA 4GJIA 2FPTA 4UR9A 4ZQOA 3IJDA 3M16A 2BWGA 3VIHA 1M9HA 1XLIA 3SDOA 2GRTA 5BW6A 3NEHA 4HP5A 4JQAA 2J7FA 2WSRA 1LG2A 3FA4A 3IANA 4B5SA 1SGJA 3SUSA 3RIKA 2V2DA 2W66A 1OZMA 3F2BA 4Q4QA 4MM1A 1W1A1 4EPBC 1NDYA 4PUWA 3ARRA 4W5UA 2YDAA 4DM2A 3FDGA 1NIUA 1E4NA 4WDTA 3KVMA 3M4HA 4D8ZA 5FF7A 4HBKA 1FWRA 2BHUA 2PGEA 2P3ZA 3TJXA 5HMEA 1EGVA 4CD4A 5HANA 1O5RA 3C3NA 3MP3A 5HUOA 4ERIA 3NZ1A 2NXGA 3WLIA 1B3OA 3D6NA 4F48A 3JU2A 2Y5JA 3DGRA 3TJLA 2D22A 3WLPA 2CWNA 1X8CA 3LHYA 1LRTA 2ZX9A 1KBJA 4AMAA 1UJPA 3AHTA 3F03K 1O7AA 1JDFA 1VJZA 1I1WA 2NXHA 2FHFA 1RUSA 3S6OA 1ZKQA 3SCNA 4C6NA 5CBIA 1LBMA 4HNCA 2O9OA 3BMVA 5GJPA 2RGLA 2DU2A 3FVDA 4MSSA 5BYWA 3R8GA 4JAWA 2E67A 5EBKA 4I9TA 4W86A 3DHUA 4Q4SA 3WMSA 5IHRA 4I8DA 2WBAA 3GAKA 4B4FA 1AMYA 5C5YA 7ODCA 1HGYA 3NM3A 3TYEA 5E0CA 4P8XA 2OWCA 3WUGA 3WQ6A 3LPOA 2EQ9A 1KGWA 4GQQA 1A47A 4MYXA 4YS1A 1W9DM 3GW3A 3NO1A 4O1BA 5TAOA 2VYOA 2VM8A 2W54A 2FFCA 3EDDA 2YBTA 1OHLA 4X22A 3I3DA 4XTDA 1JYNA 5A69A 4H7CA 4BI7A 3VKKA 2IQDA 2Y8VA 3TYZA 1TIMA 1OY0A 2OT1A 4TX6A 4C6KA 2X05A 4R7OA 1S5MA 1LUCA 1I6NA 2YVJA 4H9YA 4K68A 4D6IA 3IUIA 3W29A 4KESA 1Q4NX 1XIDA 1RXOB 4DJFC 3WLRA 1TPUA 1SW3A 3CZEA 2HK0A 1D3CA 3MSYA 3S5YA 3L65A 4QQUA 3CUJA 1J0JA 3V7PA 2JGYA 2PGFA 4DO4A 3B8WA 5M03A 3HFYA 4KCTA 1JVNA 3BC9A 1LROA 2WMHA 3GUWA 1CXEA 3MU7A 3HA1A 5K9DA 1M7OA 3EBVA 2VZUA 3FYOA 2W92A 3S9IA 4O1AA 3B8UA 3NG3A 4H4ZA 4PA8A 2KX9A 4DHGA 5JBEA 3CMGA 2VUNA 3ABZA 2E9LA 4UFLA 3C61A 2Z1XA 3WBEA 4IP5A 5CSSA 1ZXIC 3NVYB 1FWGC 1IEXA 4NL1A 4OUIA 5DY2A 1DTUA 2CEQA 3B05A 3NURA 2CPUA 1XLDA 3PBUA 4WK9A 1LZOA 1T6MA 4V2XA 3PZOA 3RJXA 3EOSA 3GKFA 1UH2A 2ANUA 2GH5A 4BF7A 3TYUA 1TX0A 3QPZA 2D2JA 2NUXA 5A8PA 1V77A 3KBWA 5KZMA 4D9PA 3TVAA 1UWAA 4NYUA 2HVOA 4IP7A 1GT8A 3GVVA 3LBCA 4P61A 3GDMA 2ZXAA 3W7CA 3CZLA 4JTKA 4G2DA 3BJFA 1X2HA 1UWUA 3N14A 4DX3A 1KCXA 1DQUA 3BLLA 3LM3A 3GUGA 2WXDM 4GUFA 1YE6A 3EWUA 1ZP4A 5CZ0A 3N19B 4JICA 3LTSA 2E9MA 1UMLA 4XAZA 2Y7GA 1AL7A 5HXMA 4UB9A 2O9RA 4GLEA 4DJFA 2C79A 2W6RA 4H8VA 1AA1B 4LBUA 3A4XA 1OFEA 1TA3A 3ZJ6A 4KCWA 1S2CA 5KMYA 4JN6A 5J5RA 3R8RA 4YYFA 3PG8A 2ZTKA 1RJRA 3FSTA 1BVWA 2F7FA 2PTWA 1MXDA 2JF7A 1ZNNA 4GYJA 1F74A 1JG9A 4ERAA 1EP1A 1FXQA 4S3AA 1FWTA 4K8HA 1YADA 3GIYA 3ZFHA 4JTFA 1QBAA 3UXIA 1SMAA 4Z1AA 3P0XA 5LIUX 3T8LA 1V3LA 1RCOB 4FSAA 4NIRA 2RABA 1ICQA 5CGMA 3CNYA 3OLDA 5IDIA 3S1VA 4N6FA 2RGMA 4DJED 1H5YA 3AN1A 5I5RA 4U3CA 3WCZA 1UQZA 2VRJA 4XZNX 3VMPA 1K3UA 1W9BM 4BEQA 4OBTA 5CPTA 1DXFA 4KS0A 1FWBC 4IMAA 4J57A 3WQOA 3MMWA 2A0NA 5FI8A 1X39A 4R88A 3WK1A 5D9MA 3IWPA 3A9IA 4IGSA 4IM4A 2GYIA 1I1XA 2J6VA 3JUGA 1FWWA 3H54A 3O06A 3SRHA 4XZIA 1QCWA 1GW9A 5M1TA 5LSMA 5KINA 4N4PA 2Y1HA 2Z2BA 4Q4PA 1F4HA 2G37A 1EC9A 1R3WA 1H1NA 2DV0A 2QT3A 3A47A 1KB3A 3T0DA 1PIFA 2EPKX 3WQPA 2VELA 2YBUA 3THCA 3HPFA 4CN6A 4XD5A 1VF8A 4GI4A 4GI8A 4HA3A 1S2TA 1KM6A 3WX7A 4B3ZA 3MCMA 2PDIA 2WMIA 3G2GA 4LCSA 2XWEA 3WMCA 3IJQA 2RDXA 4GYKA 3IGHX 3QJAA 4DQWA 2PDBA 3N9SA 2PZ0A 5D32A 3NQBA 2V8ZA 3VZZA 3LD5A 4F0HA 5GRTA 1SW0A 3MWAA 5I03A 3PNUA 2Q6ZA 3H2MA 3KHDA 2W0UA 4UNLA 3PPCA 4GBUA 3QW4B 1R47A 3MKKA 3R89A 5HPCA 3IJ7A 2O7SA 2OSYA 4L4MA 4HPNA 2VR5A 2W4XA 3DENA 3JR2A 3L4YA 3BAXA 1K9DA 3B9AA 3K8LA 2PDKA 1MI3A 1VS1A 3MBFA 4Q8MA 3CHDA 5FAGA 1MEHA 1DJQA 5A6BA 3L4XA 3RX4A 4QG8A 4RCXA 2REQA 4PR4A 4XAFA 4EACA 4NAFA 1ZCCA 2I17A 3MYPA 3LTPA 3OP2A 2F84A 3N13A 1BPLB 3BDKA 5A2CA 1P0BA 1ZCOA 4RJEA 3SN0A 2CXGA 1G7UA 2PA6A 1OX5A 3E3HA 3MT1A 3Q65A 8CGTA 4C5ZA 2I5IA 2QQ6A 1L2QA 4CD7A 3WN6A 1UD8A 3MVTA 1Q6QA 3CB3A 5KETA 1SZFA 1UR3M 4HA4A 3DKLA 2VURA 1RHCA 3O07A 1PB0A 4ADSA 3BLPX 4MUZA 3QLDA 1REQA 3VOCA 5FOOA 3U8GA 3CAVA 2WZEA 2PF8A 4ICNA 3C6CA 1Q6LA 4B92A 5ER0A 3URHA 2AMXA 3LHUA 4JN8A 3G77A 3WLMA 3E9AA 1XKYA 4GNJA 3HM7A 3W0KA 2FZBA 1EXPA 1PCWA 1MQPA 4WQ6A 2YKKA 4IIEA 2A85A 2HS6A 3RPTA 1RZMA 4B91A 5CPMA 2R1LA 4G7FA 5DF0A 1MQRA 4GGHA 2OYLA 1NAL1 3LN3A 2VENA 2PU1A 1VQZA 3BWWA 3AJXA 1YXYA 3V0UA 2QS8A 2Y70A 1AQFA 3FCPA 4I7VA 5A8OA 3ABRA 4O0ZA 2QVHA 4H9UA 4P7OA 5DQPA 1A4MA 3H4KA 5AKQA 3VO0A 1QI4A 4YVXA 2D1ZA 1TPFA 3KE0A 5C0QA 4UMCA 3S2MA 2V82A 4XAPA 3S4TA 1S1PA 3GNDA 4NJGA 2ZZ4A 4QDMA 1SU5A 4WDWA 3W86A 1U1JA 5GVJA 4AC1X 1H62A 4C5YA 5E09A 1XLKA 1F3WA 1DXLA 3E0VA 1I0DA 1TZ7A 1Q45A 1FFQA 5HPOA 5FMHA 5JRBA 2OEKA 4ZO7A 1FWDC 1QI5A 1O5QA 1SZNA 2D2GA 3AHZA 4AIUA 2PDGA 1ECEA 4PODA 2ZE0A 2XSXA 4G7EB 3U48A 3S1UA 4E2OA 2H3BA 4TOQA 5KZEA 3SUUA 1EP2A 2HWGA 3GXFA 9XIMA 1XI3A 1TZZA 1WKFA 2HJPA 2E68A 4WVXA 3F4NA 1YQ2A 4RX0A 3AMLA 3T09A 1EHNA 2WZHA 2C1GA 3FAWA 1MUMA 5GJNA 4GKTA 3RPDA 5TD4A 1W3LA 2FVMA 1QWGA 2GQAA 4IH3A 4ACZA 2WQDA 1LT7A 2VZOA 3WFAA 1ZZMA 4WRHA 3KXQA 1TV7A 1OIMA 1TWDA 3V0SA 3SFKA 4ZQPA 2NUYA 3T2PA 3TQ0A 3N73A 1UP2A 1YLVA 2GVLA 3WNOA 3O0HA 4MNKA 4ZOEA 1PZ0A 2E1WA 4GXWA 4TQTA 4ML4A 3T7VA 3NQDA 3OGSA 4Q8NA 2VWTA 3PBMA 4JQ9A 2GDVA 3DZ1A 3ITXA 1SVDA 2GGJA 1XIIA 4UWMA 4Q8VA 2RAGA 3VDCA 2ZC8A 1GRTA 4MHBA 4GFSA 4IGHA 3N9KA 4FXFA 2INEA 2VEKA 3OHIA 3S42A 1IF2A 4Y8EA 3R10A 1TUXA 4UQAA 2PC8A 2UY4A 4Z08A 4UQEA 2HVMA 3RR1A 1NHPA 2PU0A 3XISA 4UTMA 1JPIA 5CPNA 3EEZA 1JPHA 1BKSA 4CQCA 3W2NA 1EEXA 1O1HA 1TV2A 4OT7A 2Z28A 3AISA 1IXOA 3RRXA 1IR1A 1RP9A 1XHGA 3W72A 1R38A 3CO8A 1V6UA 4HPGA 1S3TC 1T7LA 2ZWZA 5DX7A 5HBFA 4GQBA 3G1DA 3W27A 3DH9A 1LLZA 3LZ5A 2WPEA 1PJ9A 2XFWA 3BOXA 1JCLA 3AQUA 4OJYA 2GGIA 4O1EA 5I78A 3T05A 1B4KA 4PTDA 1XYLA 1SJCA 1OCJA 1L8PA 2BX7A 1WXZA 5FJJA 1E56A 4K1GA 4B3KA 1Z48A 2WOVA 2VX5A 1JFXA 1PS9A 1XGZA 2TMDA 3FEMA 3DK9A 3URNA 2ZRVA 4JOMA 2ZVIA 4ZGYA 3CEUA 1JXKA 1K9FA 1H0GA 1SFTA 4NI3A 4FS9A 3QYSA 2JK2A 3L2MA 3QY6A 3VIPA 4D1IA 3ME3A 4GNKB 1ITQA 4KBXA 2V5CA 4HT3A 2EQ6A 3KAOA 1OYBA 1PL9A 4DYKA 1SB3B 3I68A 2A8XA 4HJFA 3KDOA 4AWUA 1MW0A 4XD6A 3AAMA 1H7XA 4S38A 4XZWA 3VNKA 4ICCX 1NDAA 1DXEA 3L4UA 3WLSA 1W1TA 1VEMA 2Q01A 3FFSA 1HKIA 5F1VA 3GKAA 2BDQA 4LF1A 1E6ZA 2XU2A 1XICA 1OX4A 4PMZA 3AHYA 1E4LA 3PM6A 3CL8A 4JTHA 3IARA 4LPCA 4F79A 3BCJA 1GG0A 2NQ5A 3WQGA 3P6LA 3PPHA 3TZNA 5EMKA 3QKZA 4NNBA 3VIMA 3NDZA 1X7FA 2G8ZA 3M43A 4O13A 4MPKA 4NUWA 1KV8A 2HEJA 3VKCA 4C1NA 1HKJA 3CAWA 3GH4A 4FIRA 2RDTA 4QGCA 1XRVA 1UD6A 4UTUA 3WJWA 4XQ6A 1LOSA 1FWIC 3LMZA 4UQCA 3S6DA 1OJXA 3CZ8A 2OKOA 2Z27A 2BY3A 4RW5A 3TJ4A 3KM8A 4PE8A 4H7VA 2NSXA 4PUNA 4Q32A 1IT8A 4J3TA 4A3UA 3NVDA 3W1UA 1STZA 3BURA 4PUUA 1KGUA 4H19A 1Z7AA 2DZVA 4L9XA 4NEWA 1TJRA 4GI9A 4QG6A 1M7PA 2G4JA 1L6FA 3MB9A 3AMGA 3OZPA 5CG0A 2V3EA 4B2DA 4DJFD 4M51A 3QSTA 4CU8A 1V0NA 4L1XA 2HSAA 2ZXDA 3U4AA 5HWMA 4LALA 2B81A 2E77A 4IICA 3W6MA 3I7SA 4OFCA 3II4A 4NJJA 5A8GA 1TMQA 2ICSA 4HGXA 3BL3A 4LS1A 1UR4A 1M65A 1MNZA 3WL0A 3UPMA 3TQVA 1MMFA 1VDVA 4Q8TA 1TKKA 1UYQA 2WBGA 5BOEA 4HK7A 1EX1A 1I2PA 3R6IA 4ZEPA 1KBIA 1T99A 3LXBA 1UR9A 3C2VA 1BF6A 5G1YA 3SRFA 3EF6A 2AGKA 4K39A 4QLKA 1V59A 4ZQRA 1A4LA 1X2GA 2XFRA 4XB3A 2IQ0A 3R2GA 4IZGA 1LOQA 4J27A 3HZ3A 1EA9C 4QLLA 3W1AA 4PCSA 1EBDA 1HO4A 2DSZA 1QOXA 1W3TA 2E8ZA 1FKWA 2ATMA 4M82A 1KRBC 3S2JA 1D8CA 2QPSA 4PEEA 2W62A 3ABQA 4M0XA 4AFYA 2EBNA 3LS9A 3FVMA 3FSUA 4Z2KA 3TXVA 3MY9A 1PV8A 2R1NA 1YHTA 1HT6A 4WUIA 2R14A 1TCDA 4MWAB 2VUYA 1XIMA 1YDNA 1K1DA 4PTWA 2Y7DA 2GK1A 4EXAA 4K7VA 1MO9A 3VFLA 3B4UA 5CPQA 3T55A 2OLHA 3UNTA 1GRGA 3STFA 3L21A 5FKYA 3NL3A 4DEFA 4JS3A 2J7DA 1A0EA 3W1RA 4M56A 1TWIA 5JH2A 5AN7A 1LP6A 2P10A 1B5TA 1JZ8A 3N2OA 1VBGA 3MUY1 4AZHA 3URBA 4APNA 2Y24A 3R58A 4X61A 4O28A 1VCFA 3CQKA 4YWSA 5BRBA 3VCCA 1JAKA 1VFUA 3L0GA 1TYTA 2OSXA 4FR1A 3C8NA 3Q6JA 4DXKA 1DJXA 5T8GA 2NLYA 2XN0A 1S38A 3LNPA 2OXNA 4PMNA 2J3NA 1H63A 1R3QA 4HN4A 1R3TA 3QVQA 2CETA 3SECA 3EX1A 3M41A 2FYMA 1F6PA 2NQJA 1CPUA 3WMBA 4H4SA 4CCDA 3W2KA 5A6BD 2VT0A 3N6JA 4ADWA 4QSFA 3U2CA 2X1UA 3GSMA 4KWVA 2WLZA 5AY7A 5KSWA 1WXYA 1M03A 4C6JA 1UCWA 3C0JA 5I23A 1SW7A 4EMIA 5F7UA 3COTA 3FAXA 1G4SA 3LX9A 2ZX7A 1HX0A 1XYMA 3BZGA 3QFWA 1K4QA 1BXNA 1RY8A 3E2VA 1BTCA 3FJ4A 5FJPA 3ZR5A 1XDIA 1M1BA 1EQPA 4LOCA 2JK6A 7TIMA 4ZA0A 4JNYA 2LLEA 3UXKA 4BR1A 3SW6A 4PMYA 1CNVA 4UOZA 1F2JA 4XZMX 4JTUA 4EK7A 7TAAA 1U83A 1V02A 5HQLA 1QPRA 3EXTA 2BGQA 3U5UA 4F0SA 3RCYA 1TR1A 4O16A 2PE4A 3UZZA 4DELA 1EXBA 2BXYA 4P2VA 5AHLA 3QEZA 3QQWA 3VKDA 2W5FA 3NVZB 1S39A 3LCGA 2Q09A 1IGWA 4U5IA 5JCIA 2C0HA 3HPAA 1QDSA 3IIOA 2XM2A 1ZBVA 4YTTA 2VC5A 2VO5A 3CO4A 3GD6A 1EJTC 2GJRA 4KF1A 1WO2A 3QGKC 4YYCA 1W31A 1S7MA 6ENLA 2OTDA 2WKGA 1G6CA 5AC6A 1J12A 5D2XA 4WX2A 1DXIA 2FHBA 4J3UA 2P88A 4Q6XA 4GVGA 3R5EA 3LBOA 4LAOA 4XTIA 2Z25A 4OBRA 5JCLA 6TAAA 3KVJA 2PCEA 1JDEA 2YB4A 1U1HA 1K6WA 1ISXA 3LXAA 3UG3A 3BPWA 2EJ1A 2DVUA 3BH4A 3PZNA 3W83A 5ECUA 3RM9A 5C2CA 3QZAA 3DYMA 2I1OA 3NQ7A 3LQGA 1UPPA 4J40A 4M6QA 4PULA 5G5HB 3LI0A 4IP4A 5FL0A 3WJSA 2I9EA 2ZRYA 2ABBA 1I2RA 2D0FA 1A5LC 1PAMA 5REQB 1E6QM 4XZ9A 4GABA 4P8VA 5K4XA 3VDHA 1H50A 1RPXA 1UC4A 2DUXA 4ZBCA 3NQFA 3P5YA 5G1TA 2DJXA 2QNEA