4J1RA

Crystal structure of gsk3b in complex with inhibitor 15r
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
348
structure length
343
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based approach using diversity-oriented synthesis yields a GSK3b inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
total genus 96
structure length 343
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j1rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j1rA01
3AXWA 3ITZA 2YLFA 3DDQA 3DNEA 4YZDA 4GUBA 3EFKA 3Q9ZA 4RC3A 4X2JA 3VUHA 4RVKA 3ZHPC 4AOJA 4DE4A 3B2WA 4TWOA 2Y8OA 5FG8A 2GNFA 4II5A 3W2CA 5FLFA 3ZSGA 1H1PA 3TKUA 2QLUA 3BGQA 2I7QA 1Q3DA 4NFNA 3S1HA 4MAOA 3WOWA 2X2KA 4KKEA 1Q8ZA 2OW3A 3K5VA 3KXZA 4AUAA 2QO9A 4RBLA 3FLQA 2UW4A 3JY0A 3WE4A 3QD3A 3UP2A 5F4NA 3QTSA 1WBNA 2DYLA 3L8PA 1ERKA 2UZNA 3OF0A 4CKJA 3GB2A 4NKSA 3VN9A 4DGOA 2QOIA 3H9RA 4C3RA 2ZV2A 3TNIA 3SV0A 4EK3A 3F3VA 5IF1A 4D9UA 3HRCA 3NIEA 4MXZA 5DR6A 3F66A 4J52A 3ZC6A 4F7NA 4NWMA 4FEWA 2CJMA 2DWBA 3RCJA 4RX7A 4XBUA 1OBDA 4OTRA 4JDIA 4BN1A 2CNUA 3OZ6A 4BGGA 2G15A 1JKSA 2BMCA 1BI7A 4FNZA 4YO6A 2ITPA 3U55A 4AWIA 5AA9A 5K0KA 3G51A 4XS2A 4DEAA 5J95A 5AR5A 5J7HA 3I0OA 4D5HA 2VV9A 3EN4A 4M97A 3TJCA 3TZMA 3UYTA 1APME 2BDFA 3FMEA 3NW5A 4JQEA 3WF9A 3C4FA 2ERKA 3NS9A 4P5QA 5K4IA 4O7NA 3PLSA 4ACGA 1URWA 2DUVA 2G01A 2B9HA 3QWKA 4FMQA 4AX8A 4Q5EA 4FE2A 4R8QA 4NTTA 4DTKA 3OVVA 4CVAA 4YPSA 4UBAA 4UMTA 1H00A 4GU9A 4CCBA 2A19B 2HWOA 4W4XA 4ASXA 4QO9A 1PY5A 4Z9LA 4GH2A 1AQ1A 5LQFA 4H58A 5CZHA 3R7YA 1F0QA 4MBJA 4BC6A 2ITXA 4AZFA 2EVAA 1BKXA 3EZRA 3E8EA 4FKWA 4G31A 4RA4A 5ANKA 2X9EA 5BYLA 4ERKA 1JKKA 4HYUA 1QPDA 2PE1A 3QQLA 4RSSA 1U54B 4KKHA 1H28A 2ITYA 4B7TA 2BRGA 1AD5A 3MSSA 3NR9A 4QMOA 3DXNA 3TV4A 5K4JA 5CSPA 1BL7A 1Q41A 3E7OA 3FLZA 2BIKB 1OM1A 2PL0A 2BZKB 3PE1A 4NM5A 4AG8A 2OLCA 3EZVA 4O1OA 2VTJA 3DQWA 2FSMX 4L67A 3R30A 5L6PA 2O0UA 3IDCA 3NYNA 3O8UA 2JDVA 4TNDA 3PZHA 4C61A 4CD0A 5AR8A 4X3FB 4HNIA 3FPMA 5JZNA 2VTAA 4AGCA 4ASZA 1XBBA 3FI8A 3MVJA 4UWBA 5D12A 3G15A 2PVYA 5CU0A 2CKEA 3DBEA 3GU7A 4G3CA 4CQGA 2X1NA 1S9JA 2A4LA 4P90A 4N70A 4F0GA 3ZEPA 4A06A 3VHEA 5CANA 1NA7A 3DZQA 3JR1A 3WYYA 1M7NA 4XOYA 3AD4A 4BB4A 3CTJA 2Z60A 4RX5A 5AIRA 1XWSA 3ZFMA 2B9FA 4H39A 4GIIA 4IAKA 5FGKA 4DGGA 1WMKA 4ZTHA 3MFSA 5JQ8A 1ZAOA 3QX2A 4YLKA 4BYJA 4JIKA 4Z7GA 4BDJA 3ORLA 4UALA 4ANOA 3DBQA 2BTRA 1KE5A 5AP4A 4J99A 3ORNA 4TYHB 3A7FA 4C8BA 3SD0A 4A7CA 3OOGA 3ZMMA 2AC3A 4JBOA 4GJ3A 4UMPA 1JNKA 5HBEA 3VS0A 4EUTA 3QCYA 5CU6A 3OEFX 4GK3A 4WT6A 4CFXA 5KE0A 3MPAA 1IRKA 4J97A 5E1EA 4K1BA 1IA8A 5BQ0A 1YI3A 2QOBA 5J1VA 3LMGA 4E4MA 3EQHA 3IECA 2E9UA 1Q8TA 5HX6A 4A9RA 4L3PA 2XIZA 4FKIA 3CTQA 1MRYA 2RF9A 3W16A 3W2SA 3OW4A 4O86A 3HMOA 2P0CA 4X0MA 3FMKA 3BBWA 3W8LA 2RKUA 3G33A 4DA5A 1OGUA 3F3UA 3AD6A 4I23A 4CG9A 3S4QA 3BE2A 2Y4IC 5DR2A 3QUEA 3SLSA 3RALA 3PRIA 2PHKA 4GMYA 4EJNA 2I0HA 2UVZA 4UN0C 5LJJA 4D1SA 3DKOA 2UZOA 4M84A 4E73A 1VR2A 5I0BA 3FHRA 2QCSA 5AP2A 2ZM1A 5M06A 5JRQA 3GBZA 4FTQA 2BFXA 3COKA 4GU6A 2FUMA 3TL8A 4FTKA 3CXWA 3ROCA 3V8WA 2VU3A 3OG7A 5IEVA 4QPMA 2BDJA 1RW8A 1OIYA 2WQMA 3RAIA 1WBSA 4MXXA 3L8VA 4ANQA 3LJ0A 1OZ1A 4IM2A 3LFSA 1H1QA 1YOMA 4Z7HA 3R22A 5DRBA 2BZIB 4FV3A 4EH9A 4B99A 4BKZA 2UZWE 2IVTA 4XG9A 2Y4PA 4LL5A 3R02A 2PWLA 1SVGA 4O7LA 2UW7A 3ORZA 4E7WA 3C4WA 3ODYX 4H1JA 3ZO2A 4C62A 4E6DA 3A4OX 1Q4LA 3BYUA 5GJDA 3ANQA 3EMGA 4HCTA 3DB6A 4B0GA 4HVGA 1JKTA 1R1WA 4HGSA 3ZXZA 3EKNA 4BDHA 5FP5A 5FTGA 2UZDA 3BWJA 3QTRA 2I0VA 2XJ0A 4O7SA 3GOKA 4IVBA 4MYGA 4FTRA 5EM7A 1ZMVA 4PDOA 5CEIA 2W4KA 5M55A 4BRXA 3MY0A 4EHVA 1RE8A 5HX8A 3Q2JA 4P4CA 2AUHA 2HZ0A 3FMNA 4ZSEA 3L8XA 5KCVA 3FYJX 2GQGA 3TNPC 5LVNA 2X4FA 4C4GA 3OT8A 3SG8A 4PL5A 2WMWA 1H26A 4D1ZA 1URCA 4MK0A 1OITA 2YM8A 4BBFA 3IOKA 4FICA 4OT5A 2BAKA 3V8SA 5J8IA 3FZOA 4L52A 4F1TA 3I5ZA 5AUVA 5J5SA 5E7RA 3PVWA 2ITNA 3PFQA 4W4YA 3QQJA 5ANEA 1PW2A 3DKFA 5G1XA 2V62A 2Y9QA 3RJCA 2R64A 2YCSA 2C1BA 2W5HA 5C27A 4C4FA 1A06A 1OVEA 1ZARA 2C5XA 2WMSA 4EYJA 5DLSA 5ACKA 5E8WA 2OG8A 5KBQA 3FQHA 5EYCA 4AN2A 3PY3A 4ACDA 2OZAA 4YLJA 4FSZA 4G9CA 3SVVA 4G16A 4IX3A 4QP3A 2W96B 3EWHA 3Q4TA 5KZ0A 3QTWA 3GEQA 3ERKA 3IW7A 5CXHA 3NVKI 3B8RA 3CQUA 3LFFA 3TN8A 1HCKA 3PDTA 3ANRA 3A4PA 4EYMA 4O0VA 2J5FA 3LE6A 3R28A 3RINA 2OZOA 4F09A 3LFBA 4PMPA 3PWDA 3UGCA 3NW7A 2H96A 5AIKA 3KB7A 3DOGA 5CENA 4BYIA 3SGCA 2EXEA 4GT4A 2CDZA 1YOLA 1WBTA 3MPTA 3CC6A 4QP2A 4ZK5A 2EUFB 3R7EA 3C50A 1ZYDA 4RFMA 3ZDIA 5M4FA 3PE2A 4JAIA 4ENYA 5HBHA 2HZNA 3T3UA 3OD6X 4ITIA 5K5XA 5L8KA 3F2NA 1UWJA 3TUBA 2QVSE 3GENA 4V0GA 1FOTA 2YZLA 2V7OA 4QP4A 3HRBA 2AC5A 1MRVA 5FXSA 4A9UA 3LCKA 4I93A 4BZNA 2XRWA 5ETIA 2UW3A 3BV2A 2R3RA 2XYUA 4FVRA 3ZTXA 1LR4A 2WKMA 4R78A 3WZUA 3TZ7A 3CR0A 2G2HA 4YO4A 5HVYA 3WZEA 3MIAA 4Q2AA 3Q52A 5EI6A 2Y6OA 2YM3A 4HPUE 1OIUA 4AZTA 1KE9A 4EH3A 2W1DA 3SHEA 5DT3A 3SXRA 2GQRA 3KN6A 3PP0A 2WTWA 2IZTA 1PMNA 3L9PA 4AZSA 3NUAA 3B2TA 4E1ZA 4D4VA 3EL7A 4APPA 4RIWA 3SW4A 4FIHA 4IC8A 3PA4A 3M2WA 3CLYA 3HYHA 4ITHA 3CY2A 4L01A 2C5NA 4ACMA 2RFNA 2PZRA 5AUWA 4XOZA 3OXZA 2QOOA 5HIDA 3UJGA 4WG5A 4DBNA 4FYOA 4MXYA 4AAAA 5IQGA 5BYYA 3BU5A 3GQLA 2X8DA 1P4OA 4ZTNA 3R9OA 1PXKA 1SNUA 2VNYA 2QQ7A 1G8AA 3IDPA 4UZHA 5DE2A 3CGFA 2W1FA 5IQEA 3C5UA 1CDKA 3Q32A 4FOBA 3MN3A 2CCIA 4I20A 5I3OA 4DEBA 4TRLA 5E8SA 2OF4A 3A60A 4NW6A 3SOCA 4QMVA 5ITAA 3ZO4A 3DB8A 4O7ZA 2UVXA 1V0PA 5A4CA 5JN2A 4FZFB 4L3JA 1YI6A 3TUCA 3HV5A 2XNMA 4FT3A 4NZWB 4NJ3A 3KMUA 3UNKA 3CE3A 3HZTA 4GCJA 1MQBA 1CMKE 4FSYA 3GU4A 3R04A 4GV1A 3E3BX 4YNOA 4DYMA 5HE1A 3ZRMA 4KA3A 3RAHA 2ZDUA 4UXLA 3SRVA 3FKOA 2OH0E 3QHRA 4ZTSA 4ASDA 4L7SA 4KUJA 3NGAA 2JDTA 5CVFA 3QTIA 4TKSA 3BHTA 3ZRKA 4QT1A 3RPRA 2OJIA 3HDNA 4I94A 1PXOA 4E6AA 2UV2A 4C3PA 5BUEA 1SMHA 4H3QA 4DG3E 2F49A 1PXIA 3HMPA 1OUKA 2WHBA 3JPVA 3MVHA 3TNQB 4WKQA 2W17A 5AAGA 3MH1A 5CF4A 3A7GA 5TF9A 2IW8A 3UO5A 3KY2A 4LRKA 4BGQA 3HECA 4BDGA 3RM7A 4C4HA 4EOQA 2ZMDA 3MI9A 1PMEA 3HA6A 4KRDA 2A27A 4TL0A 5BUIA 4DAWA 5CX9A 2WTKB 3UIMA 3V04A 3IKAA 5I4NA 1W7HA 4BICA 2W1IA 2XK9A 4FI1A 5AUUA 5L2TA 2FSTX 3TCPA 4BI1A 4DFLA 3R9HA 2FA2A 5KKRC 3ULZA 3FKNA 2WTCA 2BZJA 3OC1A 4O2PA 1CKJA 3QHWA 5C03A 3UODA 3F7ZA 5KZIA 5HTCA 5KNJA 5EW9A 3OY1A 4O0SA 2XIYA 4E5WA 5M44A 1SYKA 5B2LA 3QFVA 5LXMA 4DH7A 4BIDA 2YHVA 2RGPA 1YHWA 2UW6A 4O0XA 2R0IA 2HY0A 4WO5A 3QTZA 5I5ZA 4MNEA 4UV0A 3JVSA 3EFJA 4FNXA 4AN3A 4QNYA 5CQWA 2JDOA 4BBEA 5HVKA 2Z02A 3RK7A 5A4TA 5A6NA 3UVQA 3R1SA 2WU6A 2PE2A 4GVAA 4FV7A 4I6QA 3M1SA 2W4OA 3V6RA 4CRSA 3GCUA 3HMNA 2BROA 2PU8A 5C4KA 1VJYA 2YJRA 2OIQA 4I0SA 4ZP5A 4CCUA 1DS5A 3RZBA 1P14A 2OICA 3ZCLA 3V3VA 4LGGA 3MB6A 1HOWA 3F5PA 4LV8A 4O0UA 4TTHB 2J9MA 3O17A 4O91A 4XV9A 3LM5A 4ZEGA 4D2PA 4EHZA 4NL0A 4DG2E 4JL9A 1WVXA 4K18A 1IR3A 4JDJA 1GAGA 2BDWA 2ITWA 4H1MA 5EKNA 3WYXA 5CAOA 4GRBA 4GFMA 3ZUTA 4MTAA 2XH5A 1PJKA 3I6UA 3ZONA 5HLWA 3M42A 3E3PA 3ZFYA 3EQRA 3HRFA 5JSMA 5IQAA 3OWJA 2Y6MA 1CKIA 4RVMA 3U6JA 2FGIA 3VF9A 4WNPA 5HE0A 3SQQA 4CFVA 4L42A 2OIBA 3NAYA 4MNEB 3GGFA 2QI8A 3TNHA 4B8LA 4D28A 4ORKA 1PXNA 4YBKA 4O0YA 2OFVA 4U42A 2PVRA 4BCIA 3PXZA 3TTJA 3ZLWA 4D58A 4FK3A 4HVIA 4JQ8A 4M69B 2R3IA 5HG8A 4XLIA 4FODA 3PJ8A 3FL4A 4OTDA 3ZUVA 3COHA 3ZRLA 2RL5A 5JFSA 1B38A 2YDKA 5LMKA 5HI2A 4QD6A 3OS3A 2QHNA 3TUDA 3GU6A 4ZIMA 5CAVA 5T6KA 1YWVA 5E8ZA 2OF2A 2PE0A 4WRSA 4ANNA 3QKMA 5IA5A 2Z7LA 4HNFA 4HZSA 4O84A 2I40A 4NTSA 3R8UA 3LFCA 3BI6A 5DEWA 4TYGA 5EDQA 5IQBA 3TWJA 4QMTA 5BYZA 4QMLA 2VTTA 2C3IB 3I7BA 4IAZA 4EH7A 2J0LA 3LCTA 3Q9XA 1YDTE 4EZ5A 3MPMA 4JRNA 2R3HA 4IX4A 3UOHA 3DTCA 4TWNA 4XG2A 1FINA 3ENHA 5IA2A 3SDJA 4AXAA 3EN5A 2WB8A 4NW5A 4JR3A 2J0JA 3UBDA 4E5BA 3Q53A 1UWHA 5GJGA 4OTGA 3TG1A 4FTJA 5EYMA 3RI1A 2ITOA 1ZOHA 5HCXA 1M2QA 3P0MA 3DK6A 3NUUA 4IADA 3W55A 4C4IA 4BCOA 3KQ7A 4GW8A 4W4WA 3RNIA 3PJCA 3QXPA 4J98A 3RP9A 2VX0A 2F7ZE 3L9MA 4ANMA 2QODA 2YAKA 3PG3A 4Z16A 2JIUA 3MA3A 4FSQA 4FZAB 4UX9A 2JLDA 2CNVA 3CPBA 4XP3A 4FG8A 4ACHA 3HV3A 2NO3A 3AD5A 2XKCA 3OCGA 5EOBA 3GQIA 4DT8A 1Z9XA 4AZVA 3AMYA 4WSYA 3U87A 3V5TA 2NRUA 2JAVA 4JX3A 4DFXE 3ZH8A 5AV2A 4G6OA 3HP5A 4AZEA 3BPRA 1PMVA 3R2BA 2GQSA 4RIXB 3GC8A 3C4CA 3GCQA 4C4EA 2B4SB 4N57A 3K3JA 5KMNA 2KULA 5EHOA 2R3QA 4OTPA 2P4IA 3BHHA 3F5GA 5GNKA 4X3JA 5M4IA 1W98A 5ETAA 1W83A 3NUXA 4TYIA 4AT4A 2C0OA 4WRGA 2HW6A 2PUIA 4BVUA 2PZ5A 3OT3A 3BRBA 4ZSLA 5KKRB 4ZTRA 3ACKA 2R3PA 2G2FA 3DXPA 3NMUF 4EOMA 4PX6A 2YDIA 4BI0A 2ZB1A 4PMTA 4E4XA 1KV2A 2JEDA 5CU4A 2EXCX 4W8EA 5TE0A 4MX9A 4IVDA 1M17A 4FKTA 4TPTA 3DKCA 3QAME 1XBAA 1KSWA 3R73A 5ANGA 3PRFA 5AR3A 3UP7A 2HOGA 2VX1A 3PYYA 4DEIA 5AUXA 4L44A 4E4LA 2V55A 3VC4A 2ONLC 3BIZA 2ETRA 2IJMA 3IW4A 5DT4A 3R8PA 1Y6BA 4M66A 3NCGA 2XCHA 4L45A 4XUFA 5TR6A 3PXRA 3MW1A 3PIYA 4BCMA 4A4OA 3LFDA 3LMIA 5IDNA 3HKOA 3MDYA 5E1SA 5E8UA 4BIEA 3W2QA 4HW7A 4DEDA 2WMUA 5AP6A 4J7BA 1JQHA 4M69A 5AX9A 4RWKA 5DFPA 3OEZA 3I6WA 1P2AA 2NPQA 1YHVA 5IMEA 3LIJA 1XH4A 1ATPE 4FIIA 1U46A 4E20A 5BVKA 4EQUA 1ZY5A 5FEEA 3HAMA 2RIOA 2PK9A 3P7BA 1SZMA 1XH5A 1K2PA 4CFFA 5HBJA 3R9RA 3W2OA 5AM6A 2IG7A 3RHXA 1ZYSA 3TT0A 3BLQA 5EKOA 4IX5A 4ANLA 4F6UA 5HICA 4ACCA 2GNHA 3POOA 3QTXA 4F70A 4HGTA 4UMQA 3MTFA 5C8KA 1R78A 3P9JA 2XNOA 4X7QA 5GINE 3C4ZA 4ENXA 5CWZA 3S00A 3U6IA 4C2VA 4U7ZA 2BIYA 2PVMA 2QC6A 3LQ5A 3MVLA 4K6ZA 3QF9A 4WUNA 4LUEA 4EORA 3S0OA 4BR3A 2X2MA 3GFWA 5J9ZA 3VS6A 3TTIA 3WF7A 3ZZWA 2PMNX 2I6LA 5M56A 4RQVA 4F9YA 3OBGA 4FA2A 4K0YA 3PUPA 3DCVA 1R3CA 4BHZA 5IISA 3CIKA 5T68A 4MEDA 1PKGA 3GC9A 4CKIA 4RZVA 5AV1A 4YC3A 5D7VA 4PP7A 4RIYB 4MD7E 3ZSIA 3D0EA 4TYEA 3CTHA 4R1YA 3AT2A 2BPMA 1JSTA 3E5AA 4L68A 3D7TA 3LM0A 4OR5A 2OWBA 3FLWA 4R3CA 3O50A 1T45A 3Q3BA 3EIDA 4G17A 3CY3A 4Y46A 3PLAE 5E8XA 5L2QA 5JZJA 3V01A 5LWMA 3DAKA 5JGDA 3R21A 5JK3A 4CGAA 3MY5A 3FLYA 4I5HA 4DCEA 3NUPA 4IB1A 4E26A 5HORA 3QALE 1BI8A 3A8WA 3PA5A 3OBJA 4L6QA 5HCZA 5LWNA 1TKIA 2C6TA 4YNEA 5L6WL 3ALNA 3WILA 2VGPA 4R6VA 3BLRA 4ZZNA 2VWYA 1XO2B 2YISA 4FR4A 4LRJA 4ZZOA 3AC2A 4KBKA 5TO8A 2QU5A 1UKIA 3ALOA 4EZ3A 3PTGA 5AEPA 1ND4A 3RCDA 2VTMA 3KEXA 3G0FA 4F7JA 3L9LA 4BWKA 1OL2A 4LV5A 3NSZA 4E93A 2HXLA 3MFRA 4JLCA 3E63A 3FEGA 3Q04A 3LFNA 3ZFXA 1TQMA 4QTDA 4JJRA 5HCYA 1OPJA 5HG5A 3NPCA 5GHVA 2WMXA 5EHLA 3HP2A 4G9RA 5CF6A 3P79A 2XK6A 2R3JA 4CV9A 2OI4X 4RJ3A 4DTBA 3OY3A 4RMZA 3ZM9A 4AT3A 3JY9A 4BI2A 2OH4A 5AM7A 3H3CA 4YTCA 3RKBA 1OKZA 3KVWA 3OCSA 5AR2A 3HNGA 1HCLA 3AG9A 4C7TA 5K9IA 1OECA 5BVNA 3GC7A 4D0WA 2J7TA 3RPVA 4FUYA 3TV6A 2C6EA 3S2PA 4IX6A 2Q83A 4D2TA 4F7LA 3LFQA 3VBTA 4ONAA 3MH2A 3DKGA 1H27A 2CN5A 3RPYA 5J87A 2WEIA 1PHKA 4XYFA 4BF2A 2PMLX 5AV0A 3VRZA 4D1XA 3ORPA 5TKDA 4BCQA 4G3DA 2C6DA 4RVLA 4IB3A 2UVYA 4X6QC 5F20A 4QQ5A 3C0IA 3ZS5A 2QO7A 4RA5A 3BHUA 1WFCA 4A9YA 5IQCA 5K3YA 4EOKA 4AE6A 5CEQA 1TQIA 2WQBA 5B2MA 2WU7A 3AT4A 4G1WA 1E1XA 1GZNA 4RGJA 4EK6A 4CNHA 4GT3A 1QMZA 4JBPA 2R3MA 4BDKA 4UB7A 3A99A 2R0UA 4BDEA 3R00A 4DGMA 3RPOA 4FKLA 2WQOA 3MBLA 1XH6A 2CN8A 4MH7A 2XRUA 3FWQA 4O6LA 5F1ZA 3SC1A 4GVJA 2W1GA 1FBNA 2B0QA 3IW6A 4H05A 4JDKA 4FKOA 4KD1A 1FVTA 3BYOA 2JAMA 3PJ2A 2WELA 4J71A 3UNZA 5ETCA 2BRNA 2WO6A 2C0TA 1ZYCA 5KMOA 3FJQE 4YJRA 4BWXA 4CRLA 3Q4ZA 2XIXA 5A4LA 4HYSA 4LOPA 5JKGA 1IASA 1YXSA 3R8VA 3VIDA 3QYWA 4DCAA 2VWUA 4A9TA 4W4VA 4OTWA 2O5KA 4XX9A 3N9XA 4OUCA 4OLIA 5M53A 3FI4A 3E92A 4Q9ZA 3U6HA 1W0XC 1JOWB 3C51A 2VTOA 2HAKA 1PKDA 4DH5A 4ZY5A 1UU9A 4FIFA 2VD5A 1H1WA 3QRIA 4YHFA 2BRMA 5ANJA 2R9SA 4QMQA 1ZMUA 4HVHA 3KRLA 3GT8A 3U9NA 1WAKA 5E8YA 4X2KA 4OAVB 3MJ1A 1RDQE 1DM2A 5BVFA 3EL8A 4G3EA 3Q9YA 4IMYA 3UNJA 1XR1A 3R71A 3O51A 2RFDA 3QA8A 2Z2WA 4LQMA 1Y6AA 2V0DA 1FGKA 2QR7A 2ZAZA 4FKPA 4XJ0A 3P4KA 3VUGA 2VO3A 2OIDA 4B8MA 3K54A 3ATTA 2OFUA 3H30A 4ITJA 3ZDUA 5H8BA 2PVLA 2C6MA 3IPHA 3G6HA 4QOXA 4YTIA 4IAAA 3GCSA 2C69A 2IZUA 4YJSA 3C5IA 3QLFA 4QP8A 3O8TA 4BZOA 5KMKA 4G34A 3W32A 4M67A 4W8DA 1JSUA 4XRJA 2OXXA 3CD8A 4EL9A 5LMKC 5I9VA 3NCZA 3TDVA 1M7QA 3AMAA 4IWDA 4JG7A 2EB2A 4KSQA 4MXOA 3UQCA 2Z7SA 3HA8A 2GS7A 3F2AA 1PYXA 4QP1A 5HIEA 5IQDA 1MP8A 3VBQA 5CAUA 3VS2A 3E87A 3FDNA 5D10A 1DI9A 5M08A 4CEGA 5FRIA 2P55A 4A07A 5IH5A 4QPSA 4M68A 4FIJA 4F9WA 3FQEA 4FIGA 2JDSA 3QUDA 3QC4A 2NRYA 3OMVA 3A7IA 4I1ZA 3KU2A 2BALA 3PPZA 3QCQA 4FYNA 4ZOGA 1Q24A 3AC1A 1I44A 3QLGA 2CGWA 5IU2A 1BL6A 2IN6A 4NIFA 3QBNA 4UEUA 5HZNA 4TWPA 5IA4A 5L2IA 4MNFA 3F88A 4B6LA 3FI3A 2B52A 2JKOA 2OZAB 2OXYA 1VZOA 5FEDA 3W8QA 3KGAA 1MUOA 4FF8A 2ESMA 4X3FA 1XQZA 1SNXA 2HZIA 3LOKA 4ZY4A 5HE2A 2X0GA 3LCDA 1Y57A 2WTKC 5ANOA 2XB7A 2YIWA 3UMXA 2VRXA 1LP4A 2F9GA 2XVDA 3UQGA 3P5KA 1PXJA 2XF0A 4B4LA 4U40A 3D7ZA 1J1BA 1YKRA 2R5TA 3LFAA 4IWOA 4NUSA 3QA0A 4Q5HA 5LARA 3NEWA 2B9IA 3KRXA 2PPQA 1JVPP 3KMWA 5KMMA 2J51A 3NYXA 1REJA 1CKPA 3FXXA 3KFAA 3UZRA 2UW8A 2XNGA 3I81A 4ZTLA 2FSLX 4EI4A 3O0GA 2GTNA 4FTAA 4I92A 5CSHA 1G8SA 4EZ7A 4ZLYA 3R7UA 1REKA 4KIQA 1GIJA 1H24A 3RWQA 5HNIX 2FO0A 5H8EA 4DFZE 2PVHA 5FDPA 5JFWA 1OI9A 2WIPA 4RJ7A 2VNWA 2UZTA 2BTSA 5E8VA 4RIOA 1ZYLA 3D5VA 2JFMA 3HMMA 3D2IA 4J53A 4F6WA 5LVPA 3EQIA 3GU8A 4DLIA 3HAVA 3LFEA 2CLXA 1NT2A 4C36A 2PVNA 1NXKA 2NP8A 2B9JA 1R0PA 3QKLA 1KE7A 4JS8A 5B2KA 2IZSA 1G3NA 2YABA 1H08A 1Q5KA 4E5AX 5JMSA 3VS7A 3TZ8A 4BL1A 4FV1A 4QMMA 2R7IA 5IUHA 4D0XA 1Y8YA 4LG4A 3U51A 3V5JA 1OKWA 5ACBC 3TJDA 3JYAA 2R2PA 4G5JA 3F2RA 3AC8A 3IS5A 4KAOA 4MQ2A 3KC3A 2DS1A 4EOPA 1J7LA 3Q5ZA 1KV1A 2YIXA 3CS9A 4IFCA 4AQCA 2JGZA 1ZOEA 1H1SA 2HCKA 3R63A 4FNYA 5EI8A 2I0YA 3Q9WA 3NW6A 3TI1A 3BELA 1F5QA 3LKMA 2JKKA 5CF8A 4ZS4A 1YQJA 4K2RA 4AOTA 2XKEA 4HVDA 5ANDA 4M3QA 4DEHA 3G2FA 5DN3A 2VWBA 4PTCA 2G2IA 5AA8A 5A9UA 3ZBFA 1YI4A 4F99A 2GNGA 4AACA 4M7IA 5HD4A 1GIIA 3GI3A 2O65A 4F9AA 5AAEA 4QQTA 4PPAA 3DXQA 4U80A 2J2IB 3RMFA 4OTIA 4L53A 4F0IA 3DTWA 3MTLA 4RWLA 1U54A 3DJ7A 1YXVA 2VTQA 3KN5A 4QQCA 3FSKA 4F1MA 3U8WA 3ORTA 4M12A 2XP2A 4ZSGA 1VEBA 2HXQA 3HL7A 1STCE 3R9NA 5A4QA 4HCVA 2OJFE 5A6OA 3NUNA 1YVJA 3DS6A 3IG7A 4UWCA 2RSVA 2XNNA 5AUYA 2QOLA 2LAVA 3ZBXA 2JBOA 4MWIA 3NNUA 4QYFA 4QP6A 5BX0A 5DWRA 4FSMA 2IPXA 3CGOA 5GIOE 1UNGA 3E88A 1FVVA 3WI6A 4AS0A 4BDBA 5BPYA 2WEVA 2XJ2A 3QD2B 3V51A 1OPLA 2JD5A 3I7CA 4NJDA 3ID6C 5AP0A 4TYJA 4GL9A 4JG8A 3MA6A 5I9UA 4C37A 1XBCA 2DQ7X 2XKFA 4EBVA 4PF4A 5DH3A 4DC2A 1PXMA 4QYGA 5FWKK 2W9FB 5M4CA 2W5BA 4XBRA 4FGRA 4JIAA 2IZRA 4XLVA 2GSFA 4O38A 4O7TA 3PJ1A 5FM3A 3FMMA 4FX3A 4NCTC 4R7IA 5A4EA 3VS4A 5B7VA 3HX4A 3DLZA 3I4BA 5CSXA 4Y5QA 2WFYA 4F7SA 4P2KA 5E9EA 2C3KA 2UW5A 3D9VA 1P4FA 4PL4A 2XIRA 5EOLA 3VO3A 4FG9A 2OJ9A 3UOKA 3W2RA 5J79A 2QG7A 2CGUA 5DBXA 2HK5A 3RWPA 2BHEA 5JFXA 1ZZLA 3PXKA 2CPKE 3IW5A 2WZJA 4RQKA 5C9CA 3V5LA 1MRUA 4BBMA 2VX3A 4GT5A 2H8HA 3H10A 1BMKA 4L9IA 2FB8A 4DFNA 3HUBA 4LI5A 1BUHA 2GDOA 4C0TA 4QPAA 1H1RA 2Y7JA 1O6LA 3I1AA 4RVTA 4ZJIA 3MV5A 4FTTA 4BDDA 4CMUA 2X8IA 3ZEWA 3QCXA 5CVGA 3RM6A 4DLJA 5CI7A 4ZAUA 1KWPA 2UZBA 2A1AB 5FEQA 5FTQA 5CEKA 4ID7A 3MY1A 1IG1A 3Q4CA 4PPBA 4PDSA 5FP6A 3VBVA 3OCBA 1RJBA 2BUJA 3POZA 2CLQA 2QHMA 3EHAA 3FY2A 3D83A 4P7EA 4GK4A 4V05A 5FXQA 2C68A 3ZC5A 4FTIA 2PSQA 3EQDA 4ARKA 1GZKA 4O7YA 3Q6WA 2O64A 4EKLA 2IO6A 4IFGA 3DNDA 3E8NA 2UUEA 3Q6UA 4WG3A 4ZSJA 3PG1A 4F6SA 2IW9A 3QD4A 3FY0A 5F9EA 4YJNA 5BVWA 3VS5A 2HIWA 2YWPA 4UXQA 2B54A 4XG6A 4LL0A 2YN8A 4D2VA 4TZRA 1YOJA 3ELJA 3DJ6A 5C8MA 3RNYA 3NNVA 5HESA 4PMSA 3R8MA 4A9SA 2X6EA 3EYHA 4H3BA 1O6KA 4YPDA 4O6EA 4DHFA 3VW8A 3SOAA 1FQ1B 3R0TA 5HO7A 4LOOA 3P08A 4ZTMA 4YUQA 1NW1A 2VZ6A 2JIIA 5AJQA 1M14A 5AP3A 2JKMA 4JBVA 3CKXA 4Y5HA 4R1VA 3EQCA 4YC8A 2VTRA 4IEBA 2F2CB 2CMWA 3AT3A 4YTHA 3VUKA 4OBPA 4CT2A 2XNPA 3NUYA 2CKQA 3R1NA 1LUFA 4J1RA 1H0VA 3DY7A 4QP9A 3RTPA 4FKUA 4YZNA 4D2RA 2X8EA 5CEMA 5FXRA 3KF7A 2LGCA 4BGHA 4IDVA 1H01A 5AP7A 3WF5A 1E9HA 4FKVA 5GZ9A 1UKHA 4W9XA 1U5RA 4IVAA 5LVLA 4IAFA 1FGIA 3S3IA 4PDPA 3QXOA 5LCJA 1JWHA 4QYHA 3M11A 4D4YA 4YZCA 1QL6A 4NKAA 3TM0A 3QZGA 4MQ1A 5D9HA 5L6OA 1XHAA 2VO6A 4Y73A 3R7GA 1PF8A 2PUUA 4KIPA 4PP9A 4EWQA 1J7IA 2W1ZA 2C3JA 1SVHA 4EOJA 4CT1A 3QGYA 4ZLZA 3REPA 2WMQA 4YJTA 3DPKA 4WG4A 3CEKA 5EH0A 2C47A 2BKZA 3E7VA 5HLPA 3F7WA 4X2NA 2QOCA 3SRVB 4N6YA 1FMKA 5AMNA 3SXFA 4J8NA 2VWWA 2ITQA 4MXCA 3R6XA 3F5XA 5D7AA 1Z57A 3U4UA 4IAYA 3IK3A 4YZ9A 4R7HA 5G6VA 2PVKA 2YAAA 4MF1A 4U79A 2A2AA 4PTGA 1E1VA 4O83A 4WD5A 3EQPA 3P7AA 4BTMA 1ZLTA 2GFSA 4KS7A 4EK4A 2PVFA 3KULB 3QX4A 4RFZA 4RFYA 2V22A 4RRVA 5AUTA 4AFEA 4HZRA 4U44A 3BHYA 4X2FA 3PVGA 3WZJA 3ZM4A 3QU0A 3VBYA 3F61A 3N4UA 5DMZA 5H8GA 3HVCA 3OXIA 2WTVA 2XKDA 2ZV8A 3EOCA 3GCPA 5AP1A 4G3GA 4KRCA 3QQHA 2GMXA 3LLTA 1WBPA 4G6NA 2I1MA 5CT7A 4JAJA 4DEGA 2GPHA 2UZUE 4GUEA 4UZDA 5HOAA 3HV7A 2E2BA 4QMWA 3E8CA 4WBBB 4PDYA 5I9WA 1NVQA 3UVPA 2ITTA 3R8ZA 2UZVA 1GZOA 2ZM4A 1OBGA 3OWKA 3QUPA 3TKIA 3QKKA 2FSOX 3DK3A 3O8PA 1CSNA 4ZXTA 1XH8A 1BLXA 5DYJA 3G6GA 2BAJA 4MBIA 2QOFA 4U5JA 5L4QA 3GOPA 1UA2A 2C1AA 3A61A 3H9OA 3ODZX 4RG0A 4IZYA 5D1JA 3UVRA 4EK5A 3C0GA 2WMVA 3HV6A 3W18A 4TN6A 3F6XA 4YJOA 2YCFA 3UC4A 4CTCA 4QMNA 4CXAA 4V0GB 5E8TA 2WQEA 4PUZA 5CU2A 3LXPA 4D2SA 5LMAA 4DTAA 3BGPA 3O96A 4F64A 4YHTA 4CYIA 4KB8A 1U59A 3P7CA 3UIXA 4GJ2A 4QMYA 2R3OA 4UYAA 2Q0NA 4XV2A 4D5KA 1LPUA 1ZMWA 2YCQA 4GKHA 5IG1A 4RIWB 5CF5A 2W05A 5AWMA 4Y8DA 4DINA 4GIHA 5JFVA 4S33A 3ORIA 4EONA 3FZPA 4FSWA 3UIBA 5CVHA 2PY3A 3C4XA 4PRJA 4FV8A 4TXCA 5IA1A 2ZOQA 5FTOA 3TNWA 3V6SA 4O81A 3LLAA 5E92A 4UWYA 3V8TA 1V1KA 5JEBA 2GHGA 4EHGA 1YDRE 2Z8CA 2JIVA 4ANBA 4X6RA 5AV3A 2G9XA 2WOUA 3L9NA 4NM0A 3SG9A 4KS8A 2YIRA 3HGKA 4I22A 5JH6A 2O2UA 3FMHA 3K2LA 4KINA 1B6CB 3DZOA 4IIRA 3RVGA 4WNMA 3BQCA 3ZZEA 2PUNA 4CFNA 2IWIA 5HTIA 4X3FC 2QR8A 2PULA 2VTNA 4YZMA 2ITZA 4L7FA 3RHKA 3AC5A 4AT5A 1OL5A 2BZHB 1VYZA 3NWWA 4PPCA 4C34A 4GG7A 3TXOA 2CGVA 3UZPA 4IM3A 1J7UA 3EN7A 3F3WA 3OW3A 4FEQA 3HUCA 2C30A 4XP2A 3C9WA 4U3YA 3BV3A 5BMSA 5IH6A 4CLIA 3O71A 5A14A 4JX7A 4HYIA 4N0SA 3BYMA 3O2MA 4NCTA 2GNJA 1Q99A 3KK9A 2ETKA 3VAPA 3HLLA 3P78A 4NK9A 5C8NA 2EB3A 1YXUA 4MVFA 5DRDA 5A54A 5M57A 5IA0A 5TOZA 2YM5A 5F94A 2OBJA 3ZLSA 4USEA 4DEEA 2J0KA 4MHAA 2KTYA 2AYPA 3A62A 3VWAA 4J8MA 2HY81 4D55A 3AC4A 3KULA 3PJ3A 1NVRA 4UY9A 1WZYA 4YHJA 4NU1A 4G5PA 3GNIB 4I5CA 4AW5A 3BEGA 1XJDA 3FXWA 4E4NA 3EN9A 2OJJA 3EJ1A 4GK2A 2C5VA 3IGOA 5GIPE 4FEXA 2OGVA 1YXXA 2OSCA 4S2ZA 5BMMA 4QMUA 2C6IA 3NYVA 2C6LA 4CZTA 5BVDA 4XG7A 2HWPA 3GFEA 3E64A 3JUHA 3Q4UA 4YC6A 5EW3A 4R7BA 4OTFA 5I9YA 3F5UA 3FMLA 5L2WA 1J91A 1Q62A 3G0EA 1DI8A 1JLUE 4XNEA 5IDPA 3B8QA 5KUPA 4L46A 1O9UA 3EN6A 3C1XA 3UO6A 4AW0A 5AFVA 4QRCA 4QTBA 2UW0A 4EQMA 2BRBA 2JKQA 3WARA 4M13A 4FGBA 4USDA 1GIHA 2V5QA 3LCSA 4RIXA 3PA3A 4YSMA 4XEYA 4QMZA 1RQQA 4WHZA 3TV7A 4IQ6A 4EOOA 2XNEA 3DFCB 2F7EE 4ZS0A 1GNGA 3VQUA 4I5MA 3VF8A 3L8SA 4R5SA 3DAEA 4FEVA 2XMYA 4FT0A 3WF6A 4CFUA 2ZDTA 3I60A 3IO7A 4O2ZA 3V5WA 2C3LA 2ITVA 5HKMA 1O6YA 3LAUA 4AN9A 4K77A 3FBVA 5HG7A 4FUXA 1Q8UA 2BHHA 2XK4A 2ONLA 4S31A 3GVUA 4XG8A 5HD7A 3R2YA 3VRYA 2YDJA 3FUPA 4IHPA 1KE8A 1ZZ2A 5GJFA 1SM2A 2VTPA 3AGLA 4JT3A 4LMNA 4RPVA 2J6MA 4EH5A 5CLPA 4TNBA 2CNQA 4ZMFA 4QTCA 3UOLA 5AV4A 4MD9E 4O21A 3LXNA 1YWNA 3FZTA 4FZDB 3UIUA 3FAAA 2XK7A 4HCUA 4U43A 3PSCA 3WBLA 4AGUA 4FV4A 3VJNA 2VTLA 5HQ0A 3JXWA 5HU9A 3A2CA 3FQSA 4IZ7A 4F9CA 4IBMA 1YXTA 1ZXEA 2WMTA 3OOMA 3TKHA 2CGXA 3CJFA 5EK7A 2P3GX 4D9TA 1YWRA 3LW0A 4S32A 1JKLA 4V01A 5KMLA 1QPCA 2QO2A 2W99B 3LPBA 3ORXA 4X21A 2RG6A 5LVMA 5CZIA 4KBAA 3FL5A 4NFMA 4YLLA 3FC2A 3BU6A 3VUDA 4FSRA 3UQFA 4PMMA 4EWHA 3OTVA 2YJSA 3NDMA 1M52A 1ZWSA 2XUUA 3PZEA 3VW6A 3F9NA 3Q96A 5DNRA 2VN9A 3PXYA 1JAMA 4FSUA 4IJ9A 4Y72A 2UZLA 3PVUA 4IW0A 3D5WA 1XH7A 5JRSA 5A46A 3CJGA 3BLHA 3BKBA 3COIA 4QMSA 3QZFA 4U0IA 5M07A 4FZ7A 5L3AA 3CPCA 2HENA 4EOIA 1PXPA 3FSFA 3G90X 5HIBA 3OXTA 2XCKA 3GU5A 4I5PA 2QD9A 4C57A 3LJ2A 2PUPA 2CCHA 5KMJA 5HEZA 5AADA 5M4UA 3Q5IA 1J3HA 3DDPA 4E3CA 2EXMA 1WVWA 3D7TB 2HYYA 3BEAA 3Q60A 4YSJA 4GS6A 3MYGA 2XS0A 5DOSA 1GJOA 2ZYBA 3UE4A 1G5SA 3SX9A 4N4SA 3ZOSA 2RFEA 4I4EA 4O1PA 2XZSA 4F9BA 1UV5A 3QZIA 4GFGA 2PMOX 3DFAA 5AUZA 1SVEA 2R3NA 4FSTA 4IH8A 4TY1A 5FBNC 4H3PA 4B9DA 1UU7A 1Q97A 2B55A 3DBDA 3KA0A 4E8AA 5CEPA 1UVRA 4KNBA 3NNXA 4LOQA 1CM8A 1ZRZA 3ZSHA 4FKSA 4FIEA 4O27B 4Z3VA 1Q8YA 5CSVA 4C59A 3RK9A 4K33A 2OKRA 3BWFA 2VTIA 4EBWA 5CS6A 5I9ZA 3R7VA 1WBOA 2R3KA 4R77A 2VGOA 2IVUA 3KRJA 4YGAA 3FYKX 4A4LA 5H9BA 2YM7A 3DBCA 4FT9A 4XCUA 4XMOA 4CZUA 5HTBA 2WIHA 1F3MC 3I5NA 4O96A 3OTUA 3BE9A 1PRYA 4J96A 3H0ZA 5DR9A 5JGBA 1JSVA 1UNHA 4D4SA 2VUWA 2W1EA 3BBTB 4AZWA 5EFQA 2FH9A 3OROA 3QQKA 4RIYA 5DT0A 4K11A 2WNTA 2PTKA 3LVPA 2E9NA 2Q0BA 3FPQA 3R7OA 3DJ5A 4WUAA 3FMDA 5DHJA 1NY3A 5EM6A 2ACXA 2F2UA 3KREA 2OO8X 4O7RA 1Q61A 3RGFA 1W82A 1UU8A 3VULA 5CAPA 4BZDA 2GCDA 3VVHA 2PZPA 5M09A 2X6DA 3FKLA 3LQ8A 3QRKA 3U54A 4HJOA 5TT7A 4BY9E 4ANSA 4OAUC 5AR4A 4YP8A 4FNWA 4AU8A 2BRHA 5D11A 3NLBA 4FL2A 4LM5A 4U45A 2X9FA 3EQBA 1W84A 4QYEA 2XK3A 2VWVA 1EH4A 3F3ZA 5HU3A 4J95A 3RK5A 4O0TA 2W7XA 4QTAA 3MH0A 4FV9A 3RBWA 3O7LB 5BVEA 2XJ1A 5C01A 3NYOA 4MF0A 3QTQA 4O7VA 4PV0A 4BDCA 4YU2A 3PVBA 2R3LA 3QL8A 5FBOA 4O0WA 4EK8A 1VYWA 1WBWA 2JITA 3ROYA 1JPAA 5EM8A 2WAJA 4I41A 4IZ5A 4U3ZA 4AFJA 5CAQA 3LXLA 4DT9A 4FTUA 3EFLA 4P5ZA 4BCHA 1I09A 4YURA 3NUSA 4QQJA 1WBVA 4RX9A 5HLNA 5HNGA 4GYGA 4YJUA 1R0EA 2WQNA 2X2LA 4IVCA 5I9XA 3ZUUA 5AR7A 2QOQA 3PY1A 3BU3A 4JNWA 2GNIA 4C58A 3VBWA 3ZXTA 2GFCA 4GKIA 3LQ3A 2W9ZB 2HELA 2J4ZA 4GG5A 4JQ7A 3R8LA 4M0ZA 4DITA 2YFXA 4KSPA 2Y0AA 4I24A 4JG6A 3WE8A 1U4DA 2B1PA 2XM8A 2YEXA 1MQ4A 4WOVA 5LMBA 4PNKA 4DH3A 1PYEA 3DA6A 3WZKA 2GHMA 4XRLA 2W5AA 3Q2MA 3QQGA 1CTPE 4FTLA 4HGLA 1BYGA 5CSWA 4F63A 3CKWA 4OTQA 4PWNA 4I21A 3PPKA 1NVSA 3QTUA 3ZLXA 5K0XA 2GNLA 3K5UA 4XV3A 4D2WA 2IVVA 3MVMA 2FVDA 4JR7A 4QMPA 3IGGA 4UMRA 1Z5MA 3KCKA 4FBXA 4WIHA 3VHKA 3N4TA 1B39A 1LEZA 5CU3A 3DV3A 4FL3A 4LGDA 4KIOA 3DU8A 4XH6A 3ORMA 1Y8GA 3LXKA 5L8LA 4BKJA 1YRPA 4L00A 5CALA 2C4GA 3UOJA 4MD8E 5DG5A 3KRRA 2QU6A 3PP1A 4MBLA 2H9VA 5EHYA 1OMWA 5EW8A 1GY3A 1R39A 2W06A 5FM2A 4EUUA 2ITUA 2ZMCA 1PMUA 2PZYA 5L8JA 4ZMEA 2J50A 4I0TA 3MS9A 2C0IA 3KMMA 3KXMA 2X7GA 2W1HA 4FG7A 1T46A 4PQNA 1J1CA 5HNBA 2R3GA 4NM7A 3PWYA 3ENMA 5DEYA 3ATSA 4FV2A 2XIKA 4OBOA 4IWQA 4PL3A 4RT7A 3VS1A 5H2UA 2UZEA 4I6HA 4BCJA 1PXLA 4EOLA 2HW7A 2BKKA 3OWLA 4BCGA 3A8XA 3D14A 5CQUA 4IB5A 3H9FA 4IC7A 3DK7A 4HPTE 4BDAA 2I0EA 3DBFA 4Q9SA 1H8FA 1OUYA 1JBPE 5ICPA 3FE3A 5BVOA 4EH4A 1QPEA 3IONA 5J7BA 4BDFA 1QPJA 5ANIA 2J90A 3F69A 4O82A 3N4VA 3R7IA 4IWPA 4WA9A 5BNJA 2VTSA 3P23A 5F95A 3BYVA 1M2PA 2WTIA 4JDHA 1L8TA 5KHXA 3ETAA 1XKKA 2O8YA 2C6KA 2PZIA 3QRUA 2R4BA 5KBRA 1FMOE 4IAIA 4IZAA 2WTDA 3KVXA 4FT5A 3A7HA 3DGKA 2ERZE 3QC9A 5EQEA 5E91A 5DPVA 3FI2A 3KXNA 4AOIA 2O63A 1OIRA 5EYDA 3UDBA 3U9CA 4CG8A 4YJPA 2XK8A 3W2PA 2IW6A 1YW2A 2E9VA 3E93A 4GYIA 4O22A 2E9PA 4DN5A 2UW9A 4I3ZA 4C33A 3D4QA 2QKWB 3FC1X 3QQUA 2XYNA 2Y4IB 3ZLYA 4X2GA 2ZB0A 3ZU7A 1KUTA 4FKGA 4FZ6A 3NAXA 4IXPA 1DAWA 3MFUA 3V5PA 2B53A 3FXZA 4AA5A 5EQYA 4FVPA 1OL7A 1X8BA 4KIKB 4PTEA 4RLLA 5JT2A 3G9NA 4RX8A 5EM5A 2ETMA 3SXSA 2P2HA 5EI2A 4AA4A 5JGAA 3OUNB 4FT7A 2EU9A 1IAHA 1Y91A 3MB7A 2CSNA 3U4WA 3KL8A 5E90A 4AE9A 3RAKA 5HG9A 3SKCA 1GOLA 3KK8A 3LCOA 4ZSAA 1OKVA 4QYYA 1S9IA 3I79A 3F3TA 4QNAA 4W9WA 5K5NA 5IMXA 4DF3A 3T9IA 3PSDA 2EWAA 2C5YA 2ZJWA 3NZ0A 2XBAA 3PIXA 5LCKA 4FV6A 2BFYA 3AGMA 2CKOA 1LEWA 2ZVAA 4RJ6A 5M51A 2XM9A 2R7BA 4R3PA 2GU8A 3SAYA 3FZRA 3ULIA 4KBCA 4DG0E 5IUGA 2QNJA 3CQEA 3KCFA 4BFMA 3IOPA 4L8MA 3MGYA 3D2KA 4EJ7A 4BCFA 2VWZA 4BCKA 4D4RA 2YM6A 3FLSA 5CXZA 5BUJA 2YCRA 3BX5A 2PMIA 1K9AA 3NRMA 2WPAA 4LGHA 4UYNA 4DFYA 4H36A 2R3FA 4XG4A 2NNWB 3QRTA 3R1YA 4RJ4A 2VTHA 2YIYA 4AW2A 4ERWA 1ZYJA 2E9OA 3EH9A 4IACA 5FUTA 4IJPA 2A0CX 2V7AA 3KRWA 4GFOA 5CT0A 4JBQA 3P86A 4OTHA 3PIZA 2BAQA 2PVJA 4NT4A 2PYWA 2BILB 4A4XA 5IQFA 3W33A 5IKWA 4BDIA 5J9LA 2BVAA 3ZYAA 4C02A 5KMIA 4YJVA 2XA4A 3UPXA 4Y83A 5IQIA 3CBLA 4APCA 4GSBA 1M2RA 2CHLA 2YIQA 3D5UA 3THBA 3UZTA 4U41A 1UNLA 3MFTA 2WGJA 4I6FA 2OU7A 4WNOA 5FDXA 3TACA 3DAJA 3QRJA 2XEYA 4JOAA 3NNWA 3HEGA 4RZWA 3AC3A 1FPUA 3H0YA 4RWIA 3LHJA 3BYSA 3TEIA 3ZO3A 3HMIA 4WSQA 4AW1A 5L2SA 4F65A 4ZJJA 4RLKA 4BIBA 5IH4A 2QG5A 1ZOGA 3S95A 3GXLA 3VUTA 2P2IA 3FHIA 5DA3A 2WXVA 4OGRA 3P1AA 4L43A 3FMJA 3BCEA 4YTFA 2IVSA 5IUIA 5EQPA 4NIFB 2GS6A 3QQFA 4TW9A 4G3FA 2Z7RA 2YERA 5KX8A 5B0XA 3VBXA 1Q8WA 1BX6A 3F82A 5T3QA 4JI9A 4CV8A 4Y95A 4E6QA 4Z55A 4CSVA 1P5EA 3C0HA 4MWHA 1IAJA 3CCNA 5FD2A 5AX3A 3KXXA 1H0WA 3DQXA 3NX8A 4HGEA 5FQDC 2WMAA 4BCNA 2J0MB 2Z7QA 3HDMA 4ZY6A 5I3RA 1IA9A 3FZSA 4LMUA 3OWPA 4N6ZA 5A3XA 3CD3A 1OPKA 3VNTA 1Q3WA 2VWIA 2YITA 5IPJA 1AGWA 2GS2A 2VO7A 3G9LX 4FSNA 4LFIA 4TWCA 2XNBA 3GP0A 3OP5A 4RC4A 3OHTA 4O7WA 4BWPA 3RPSA 3UMWA 4S30A 5IQHA 3D15A 2F4JA 4WBOA 2YLEA 4FK6A 4LRMA 4S34A 3LJ1A 4GEOA 3AMBA 4FV5A 2XBJA 4JVGA 2GTMA 5CNNA 4EC9A 4CMTA 4NYEA 3C4EA 5DGZA 3RAWA 2BR1A 4U97A 3TIYA 2YA9A 3C7QA 1KE6A 3N51A 4YBJA 1V0OA 4NM3A 4IB0A 4XV1A 3MWUA 3R83A 3VJOA 4MCVA 5HO6A 3QZHA 4OT6A 3II5A 3WF8A 3ZO1A 4C3FA 4M0YA 4DH1A 4LUDA 4CMOA 4EH2A 5J9YA 3EKKA 3COMA 4BTJA 2P33A 3VUMA 5DVRA 2C5OA 3R01A 3EQGA 4R3RA 4ZZMA 3QD0A 5CEOA 4AGDA 2JC6A 4I6BA 5IEXA 3BGZA 3T9TA 3WIGA 3BQRA 4FVQA 2RG5A 4FKJA 4XHKB 4AGWA 4XP0A 4KABA 3EFWA 3ET7A 3FZ1A 5EDPA 3V5QA 4HVSA 2WMRA 2OK1A 3AOXA 4BTFA 3SA0A 3EYGA 2W4JA 4NEUA 5E4HA 4DFBA 1WVYA 4ZLOA 3HV4A 3TIZA 4NH1A 4EEVA 4WNKA 3PXQA 3JS2A 5LVOA 2H34A 3QYZA 4TYHA 1UU3A 5EYKA 3GC0A 5GZ8A 4U8ZA 5HGIA 2QLQA 3CSVA 5HE3A 4ZJVA 3SW7A 4CYJA 2X7OA 5J1WA 5C26A 3H4JA 2WTJA 3G5DA 1U5QA 2HZ4A 3LMHA 2WMBA 4QMXA 4C2WA 4DBXA 3O7LD 5C1QB 4FKQA 2X7FA 4U9AA 1H25A 4FTNA 2O3PA 3OCTA 4G6LA 4IM0A 2F57A 4NSTA 4RC2A 4U6RA 3L1SA 4FC0A 4XG3A 4BKYA 4ALUA 5KHWA 4M15A 5HHWA 1KOAA 4USFA 2J0IA 3OFMA 2WOTA 4EHEA 5AAFA 3R9DA 5H3QA 4PNIA 2JFLA 4EH8A 2ZV9A 4DH8A 3GUBA 3UO4A 3IQ7A 4K9YA 3CQWA 4U81A 3ORKA 2CKPA 3EQFA 4MKCA 4ALWA 3ACJA 3WZDA 1OL1A 4KIKA 3BZ3A 3D94A 1KOBA 2X4ZA 4QP7A 3D5XA 1A9UA 3DT1A 2SRCA 3A7JA 2H6DA 1V0BA 2JBPA 5DIAA 5GZAA 3PXFA 4AF3A 5IZFA 3UTOA 1TVOA 3MJ2A 3RZFA 2W0JA 2YWVA 5IA3A 2YZAA 3JVRA 2YACA 4R5YA 3IW8A 3CP9A 1DAYA 4HOKA 4YJQA 2G1TA 4YR8A 4EC8A 3EB0A 4KKGA 4F4PA 1OB3A 3C13A 4IDTA 4CKRA 3TDWA 3KKVA 4RJ5A 1OL6A 2OJGA 3NVMB 3QWJA 2VAGA 2C6OA 3FLNC 5CTPA 3UG1A 1OKYA 4G2FA 2XEZA 5D41A 4FTOA 4QTEA 4RWJA 4EOSA 4FEUA 4JXFA 5CNOA 3VUIA 4CZYB 3MH3A 4C4JA 2X81A 3R1QA 4FKRA 5EDRA 4FTCA 2WD1A 3E62A 5HVJA 4CQEA 4EH6A 1YHSA 4I0RA 3AQVA 4MXAA 4ALVA 4TT7A 3BHVA 3VS3A 2X39A 4CFWA 4EQCA 3TZ9A 3OUKA 4L3LA 2QONA 2QOHA 3UC3A 4DGNA 5EG3A 2YM4A 5LOHA 1H4LA 4Y85A 3I0QA 1ZY4A 4FV0A 4OBQA 5HO8A 4OW8A 3NIZA 4YZBA 3IDBA 3QGWA 3PPJA 1IEPA 3KF4A 3T3VA 3UPZA 1A48A 4C35A 4V04A 4DGLC 4DFUA 4BHNA 4IANA 4M14A 3MESA 4KWPA 4FTMA 2VO0A 2JDRA 3T8OA 4BTKA 4EKKA 4HYHA 5AP5A 5IEYA 2QKRA 2REIA 4ASEA 5CASA 1QCFA 1K3AA 4RJ8A 4CTBA 5CY3A 2ZM3A 1TQPA 2RFSA 1L3RE 2W1CA 4JRVA 1GZ8A 2ZV7A 3QCSA 1XH9A 1OIQA 3K3IA 3E8DA 4YMJA 2FYSA 4F1OA 3VQHA 2GHLA 2BCJA 3W10A 5CYIA 1YDSE 2OXDA 4E6CA 2QURA 3PSBA 1H07A 3GCVA 4F08A 4F0FA 5ETFA 4BCPA 3LZBA 3UG2A 4PY1A 3WIKA 4UMUA 4CFMA 3UYSA 2F7XE 4FOCA 3PY0A 4LYNA 1FVRA 2VWXA 4IE9A 5C4LA 5CI6A 5JQ5A 3W1FA 4O0RA 4FL1A 2J5EA 3KXHA 3FV8A 4CLJA 3DLSA 2QOKA 3MIYA 4K8AA 2B7AA 5J5TA 5KO1A 3KXGA 4ZTQA 3O23A 5DI1A 4AA0A 4AP7A 1WCCA 4I4FA 1W8CA 4M8TA 4C38A
chains in the Genus database with same CATH superfamily
3AXWA 3ITZA 2YLFA 3DDQA 3DNEA 4YZDA 4GUBA 3EFKA 3Q9ZA 4RC3A 4X2JA 3VUHA 4RVKA 3ZHPC 4AOJA 4DE4A 3B2WA 4TWOA 2Y8OA 5FG8A 2GNFA 4II5A 3W2CA 5FLFA 3ZSGA 1H1PA 3TKUA 2QLUA 3BGQA 2I7QA 1Q3DA 4NFNA 3S1HA 4MAOA 3WOWA 2X2KA 4KKEA 1Q8ZA 2OW3A 3K5VA 3KXZA 4AUAA 2QO9A 4RBLA 3FLQA 2UW4A 3JY0A 3WE4A 3QD3A 3UP2A 5F4NA 3QTSA 1WBNA 2DYLA 3L8PA 1ERKA 2UZNA 3OF0A 4CKJA 3GB2A 4NKSA 3VN9A 4DGOA 2QOIA 3H9RA 4C3RA 2ZV2A 3TNIA 3SV0A 4EK3A 3F3VA 5IF1A 3AKLA 4D9UA 3HRCA 3NIEA 4MXZA 5DR6A 3F66A 4J52A 3ZC6A 4F7NA 4NWMA 4FEWA 2CJMA 2DWBA 3RCJA 4RX7A 4O4EA 4XBUA 1OBDA 4OTRA 4JDIA 3BL9A 4BN1A 2CNUA 3OZ6A 4BGGA 2G15A 1JKSA 2BMCA 1BI7A 4FNZA 4YO6A 2ITPA 3U55A 4AWIA 5AA9A 5K0KA 3G51A 4XS2A 4DEAA 5J95A 5AR5A 5J7HA 3I0OA 4D5HA 2VV9A 3EN4A 4M97A 3TJCA 3TZMA 3UYTA 1APME 2BDFA 3FMEA 3NW5A 4JQEA 3WF9A 1OGYA 3C4FA 2ERKA 3NS9A 4P5QA 5K4IA 4O7NA 3PLSA 4ACGA 1URWA 2DUVA 2G01A 2B9HA 3QWKA 4FMQA 4AX8A 4Q5EA 4FE2A 4R8QA 4NTTA 4DTKA 3OVVA 4CVAA 4YPSA 4UBAA 4UMTA 1H00A 4GU9A 4CCBA 2A19B 2HWOA 4W4XA 4ASXA 4QO9A 1PY5A 4Z9LA 2AQXA 4GH2A 1AQ1A 5LQFA 4H58A 5CZHA 3R7YA 1F0QA 4MBJA 4BC6A 2ITXA 4AZFA 2EVAA 1BKXA 3EZRA 3E8EA 4FKWA 4G31A 4RA4A 5ANKA 2X9EA 5BYLA 4ERKA 1JKKA 4HYUA 1QPDA 2PE1A 3QQLA 4RSSA 1U54B 4KKHA 1H28A 2ITYA 4B7TA 2BRGA 1AD5A 3MSSA 3NR9A 4QMOA 3DXNA 3TV4A 5K4JA 5CSPA 1BL7A 1Q41A 3E7OA 3FLZA 2BIKB 4JMQA 1OM1A 2PL0A 2BZKB 3PE1A 4NM5A 4AG8A 2OLCA 3EZVA 4O1OA 2VTJA 3DQWA 2FSMX 4L67A 3R30A 5L6PA 2O0UA 3IDCA 3NYNA 3O8UA 2JDVA 4TNDA 3PZHA 4C61A 4CD0A 5AR8A 4X3FB 4HNIA 3FPMA 5JZNA 2VTAA 4AGCA 4ASZA 1XBBA 3FI8A 3MVJA 4UWBA 5D12A 3G15A 2PVYA 5CU0A 2CKEA 3DBEA 3GU7A 4G3CA 4CQGA 2X1NA 1S9JA 2A4LA 4P90A 4N70A 4F0GA 3ZEPA 4A06A 3VHEA 5CANA 1NA7A 3DZQA 3JR1A 3WYYA 1M7NA 4XOYA 3AD4A 4BB4A 3CTJA 2Z60A 4RX5A 5AIRA 1XWSA 3ZFMA 2B9FA 4H39A 4GIIA 4IAKA 5FGKA 4DGGA 1WMKA 4ZTHA 3MFSA 5JQ8A 1ZAOA 3QX2A 4YLKA 4BYJA 4JIKA 4Z7GA 4BDJA 3ORLA 4BJJA 4UALA 4QDEA 4ANOA 3DBQA 2BTRA 1KE5A 5AP4A 4J99A 3ORNA 4TYHB 3A7FA 4C8BA 3SD0A 4A7CA 3OOGA 3ZMMA 2AC3A 4JBOA 4GJ3A 4UMPA 1JNKA 5HBEA 3NFFB 3VS0A 4EUTA 3QCYA 5CU6A 3OEFX 4GK3A 4WT6A 4CFXA 5KE0A 3MPAA 1IRKA 4J97A 5E1EA 4K1BA 1IA8A 5BQ0A 1YI3A 2QOBA 5J1VA 3LMGA 4E4MA 3EQHA 3IECA 2X0OA 2E9UA 1Q8TA 5HX6A 4A9RA 4L3PA 2XIZA 4FKIA 3CTQA 1MRYA 2RF9A 3W16A 3W2SA 3OW4A 4O86A 3HMOA 2P0CA 4X0MA 3FMKA 3BBWA 3W8LA 2RKUA 3G33A 4DA5A 1OGUA 3F3UA 3AD6A 4I23A 4CG9A 3S4QA 3BE2A 2Y4IC 5DR2A 3QUEA 3SLSA 3RALA 3PRIA 2PHKA 4GMYA 4EJNA 2I0HA 2UVZA 4UN0C 5LJJA 4D1SA 3DKOA 2UZOA 4M84A 4E73A 1VR2A 5I0BA 3FHRA 2QCSA 5AP2A 2ZM1A 5M06A 5JRQA 3GBZA 4FTQA 2BFXA 3COKA 4GU6A 2FUMA 3TL8A 4FTKA 3CXWA 3ROCA 3V8WA 2VU3A 3OG7A 5IEVA 4QPMA 2BDJA 1RW8A 1OIYA 2WQMA 3RAIA 1WBSA 4MXXA 3L8VA 4ANQA 3LJ0A 1OZ1A 4IM2A 3LFSA 1H1QA 1YOMA 4Z7HA 3R22A 5DRBA 2BZIB 4FV3A 4EH9A 4B99A 4BKZA 2UZWE 2IVTA 4XG9A 2Y4PA 4LL5A 3R02A 2PWLA 1SVGA 4O7LA 2UW7A 3ORZA 4E7WA 3C4WA 3ODYX 4H1JA 3ZO2A 4C62A 4E6DA 3A4OX 1Q4LA 3BYUA 5GJDA 3ANQA 3EMGA 4HCTA 3DB6A 4B0GA 4HVGA 1JKTA 1R1WA 4HGSA 3ZXZA 3EKNA 4BDHA 5FP5A 5FTGA 2UZDA 3BWJA 3QTRA 2I0VA 2XJ0A 4O7SA 3GOKA 4IVBA 4MYGA 4FTRA 5EM7A 1ZMVA 4PDOA 5CEIA 2W4KA 5M55A 4BRXA 3MY0A 4EHVA 1RE8A 5HX8A 3Q2JA 4P4CA 2AUHA 2HZ0A 3FMNA 4ZSEA 3L8XA 5KCVA 3FYJX 2GQGA 3TNPC 5LVNA 2X4FA 1G8JA 4C4GA 3OT8A 3SG8A 4PL5A 2WMWA 1H26A 4D1ZA 1URCA 4MK0A 1OITA 2YM8A 4BBFA 3IOKA 4FICA 4OT5A 2BAKA 2XARA 3V8SA 5J8IA 3FZOA 4L52A 4F1TA 3I5ZA 5AUVA 5J5SA 5E7RA 3PVWA 2ITNA 3PFQA 4W4YA 3QQJA 5ANEA 1PW2A 3DKFA 5G1XA 2V62A 2Y9QA 3RJCA 2R64A 2YCSA 2C1BA 2W5HA 5C27A 4C4FA 1A06A 1OVEA 1ZARA 2C5XA 2WMSA 4EYJA 5DLSA 5ACKA 5E8WA 2OG8A 5KBQA 3FQHA 5EYCA 4AN2A 3PY3A 4ACDA 2OZAA 4YLJA 4FSZA 4G9CA 3SVVA 4G16A 4IX3A 4QP3A 2W96B 3EWHA 3Q4TA 5KZ0A 4AXDA 3QTWA 3GEQA 3ERKA 3IW7A 5CXHA 3NVKI 3B8RA 3CQUA 3LFFA 3TN8A 1HCKA 3PDTA 3ANRA 3A4PA 4EYMA 4FRFA 4O0VA 2J5FA 3LE6A 3R28A 3RINA 2OZOA 4F09A 3LFBA 4PMPA 3PWDA 3UGCA 3NW7A 2H96A 5AIKA 3KB7A 3DOGA 5CENA 4BYIA 3SGCA 2EXEA 4GT4A 2CDZA 1YOLA 1WBTA 3MPTA 3CC6A 4QP2A 4ZK5A 2EUFB 3R7EA 3C50A 1ZYDA 4RFMA 3ZDIA 5M4FA 3PE2A 4JAIA 4ENYA 5HBHA 2HZNA 3T3UA 3OD6X 4ITIA 5K5XA 5L8KA 3F2NA 1UWJA 3TUBA 2QVSE 3GENA 4V0GA 1FOTA 2YZLA 2V7OA 4QP4A 3HRBA 2AC5A 1MRVA 5FXSA 4A9UA 3LCKA 4I93A 4BZNA 2XRWA 5ETIA 2UW3A 3BV2A 2R3RA 2XYUA 4FVRA 3ZTXA 1LR4A 2WKMA 4R78A 3WZUA 3TZ7A 3CR0A 2G2HA 4YO4A 5HVYA 3WZEA 3MIAA 4Q2AA 3Q52A 5EI6A 2Y6OA 2YM3A 4HPUE 1OIUA 4AZTA 1KE9A 4EH3A 2W1DA 3SHEA 5DT3A 3SXRA 2GQRA 3KN6A 3PP0A 2WTWA 2IZTA 1PMNA 3L9PA 4AZSA 3NUAA 3B2TA 4E1ZA 4D4VA 3EL7A 4APPA 4RIWA 3SW4A 4FIHA 4IC8A 3PA4A 3M2WA 3CLYA 3HYHA 4ITHA 3CY2A 4L01A 2C5NA 4ACMA 2RFNA 2PZRA 5AUWA 4XOZA 3OXZA 2QOOA 5HIDA 3UJGA 4WG5A 4DBNA 4FYOA 2XAOA 4MXYA 4AAAA 5IQGA 5BYYA 3BU5A 3GQLA 3VONA 2X8DA 1P4OA 4ZTNA 3R9OA 1PXKA 1SNUA 2VNYA 2QQ7A 1G8AA 4LDTA 3IDPA 4UZHA 5DE2A 3CGFA 2W1FA 5IQEA 3C5UA 1CDKA 3Q32A 4FOBA 3MN3A 2CCIA 4I20A 5I3OA 4DEBA 4TRLA 5E8SA 2OF4A 3A60A 4NW6A 3SOCA 4QMVA 5ITAA 3ZO4A 3DB8A 4O7ZA 2UVXA 1V0PA 5A4CA 5JN2A 4FZFB 4L3JA 1YI6A 3TUCA 3HV5A 2XNMA 4FT3A 4NZWB 4NJ3A 3KMUA 3UNKA 3CE3A 3HZTA 4GCJA 1MQBA 1CMKE 4FSYA 3GU4A 3R04A 4GV1A 3E3BX 4YNOA 1XMMA 4DYMA 5HE1A 3ZRMA 4KA3A 3RAHA 2ZDUA 4UXLA 3SRVA 3FKOA 2OH0E 4DHJA 3QHRA 4ZTSA 4ASDA 4L7SA 4KUJA 3NGAA 2JDTA 5CVFA 3QTIA 4TKSA 3BHTA 3ZRKA 4QT1A 3RPRA 2OJIA 3HDNA 4I94A 1PXOA 4E6AA 2UV2A 4C3PA 5BUEA 1SMHA 4H3QA 4DG3E 2F49A 1PXIA 3HMPA 1OUKA 2WHBA 3JPVA 3MVHA 3TNQB 4WKQA 2W17A 5AAGA 3MH1A 5CF4A 3A7GA 5TF9A 2IW8A 3UO5A 3KY2A 4LRKA 4BGQA 3HECA 4BDGA 3RM7A 4C4HA 4EOQA 2ZMDA 3MI9A 1PMEA 3HA6A 4KRDA 2A27A 4TL0A 5BUIA 4DAWA 5CX9A 2WTKB 3UIMA 3V04A 3IKAA 5I4NA 3ML1A 1W7HA 4BICA 2W1IA 2XK9A 4FI1A 5AUUA 5L2TA 2FSTX 3TCPA 4BI1A 4DFLA 3R9HA 2FA2A 5KKRC 3ULZA 3FKNA 2WTCA 2BZJA 3OC1A 4O2PA 1CKJA 3QHWA 5C03A 3UODA 3F7ZA 5KZIA 5HTCA 5KNJA 5EW9A 3OY1A 4O0SA 2XIYA 4E5WA 5M44A 1SYKA 5B2LA 3QFVA 5LXMA 4DH7A 4BIDA 2YHVA 2RGPA 1YHWA 2UW6A 5BV3A 4O0XA 2R0IA 2HY0A 4WO5A 3QTZA 5I5ZA 4MNEA 4UV0A 3JVSA 3EFJA 4FNXA 4AN3A 4QNYA 5CQWA 2JDOA 4BBEA 5HVKA 2Z02A 3RK7A 5A4TA 5A6NA 3UVQA 3R1SA 2WU6A 2PE2A 4GVAA 4FV7A 4I6QA 3M1SA 2W4OA 3V6RA 4CRSA 3GCUA 3HMNA 2BROA 2PU8A 5C4KA 1VJYA 2YJRA 2OIQA 4I0SA 4ZP5A 4CCUA 1DS5A 3RZBA 1P14A 2OICA 3ZCLA 3V3VA 4LGGA 3MB6A 1HOWA 3F5PA 4LV8A 4O0UA 4TTHB 2J9MA 3O17A 4O91A 4XV9A 3LM5A 4ZEGA 4D2PA 4EHZA 4NL0A 4AXFA 4QEBA 4DG2E 4JL9A 1WVXA 4K18A 1IR3A 4JDJA 1GAGA 2BDWA 2ITWA 4H1MA 5EKNA 3WYXA 5CAOA 4GRBA 4GFMA 3ZUTA 4MTAA 2XH5A 1PJKA 3I6UA 3ZONA 5HLWA 3M42A 3E3PA 3ZFYA 3EQRA 3HRFA 5JSMA 5IQAA 3OWJA 2Y6MA 1CKIA 4RVMA 3U6JA 2FGIA 3VF9A 4WNPA 5HE0A 3SQQA 4CFVA 4L42A 3TYKA 2OIBA 3NAYA 4MNEB 3GGFA 2QI8A 3TNHA 4B8LA 4D28A 4ORKA 1PXNA 4YBKA 4O0YA 2OFVA 4U42A 2PVRA 4BCIA 1G8KA 3PXZA 3TTJA 3ZLWA 4D58A 3O5AA 4FK3A 4HVIA 4JQ8A 4M69B 2R3IA 5HG8A 4XLIA 4FODA 3PJ8A 3FL4A 4OTDA 3ZUVA 3COHA 3ZRLA 2RL5A 5JFSA 1B38A 2YDKA 5LMKA 5HI2A 4QD6A 3OS3A 2QHNA 3TUDA 3GU6A 4ZIMA 5CAVA 5T6KA 1YWVA 5E8ZA 2OF2A 2PE0A 4WRSA 4ANNA 3QKMA 5IA5A 2Z7LA 4HNFA 4HZSA 4O84A 2I40A 4NTSA 3R8UA 3LFCA 3BI6A 5DEWA 4TYGA 5EDQA 5IQBA 3TWJA 4QMTA 5BYZA 4QMLA 2VTTA 2C3IB 3I7BA 4IAZA 4EH7A 2J0LA 3LCTA 3Q9XA 1YDTE 4EZ5A 3MPMA 4JRNA 2R3HA 4IX4A 3UOHA 3DTCA 4TWNA 4XG2A 1FINA 3ENHA 5IA2A 3SDJA 4AXAA 3EN5A 2WB8A 4NW5A 4JR3A 2J0JA 3UBDA 4E5BA 3Q53A 1UWHA 5GJGA 4OTGA 3TG1A 4FTJA 5EYMA 3RI1A 2ITOA 1ZOHA 5HCXA 1M2QA 3P0MA 3DK6A 3NUUA 4IADA 3W55A 4C4IA 4BCOA 3KQ7A 4GW8A 4W4WA 3RNIA 3PJCA 3QXPA 4J98A 3RP9A 2VX0A 2F7ZE 3L9MA 4ANMA 2QODA 2YAKA 3PG3A 4Z16A 2JIUA 3MA3A 4FSQA 4FZAB 4UX9A 2JLDA 2CNVA 3CPBA 4DDGA 4XP3A 4FG8A 4ACHA 3HV3A 2NO3A 3AD5A 2XKCA 3OCGA 5EOBA 3GQIA 4DT8A 1Z9XA 4AZVA 3AMYA 4WSYA 3U87A 3V5TA 2NRUA 2JAVA 4JX3A 4DFXE 2X0PA 5AV2A 3ZH8A 4G6OA 3HP5A 4AZEA 3BPRA 1PMVA 3R2BA 2GQSA 4RIXB 3GC8A 3C4CA 3GCQA 4C4EA 2B4SB 4N57A 3K3JA 5KMNA 2KULA 5EHOA 2R3QA 4OTPA 2P4IA 3BHHA 3F5GA 5GNKA 4X3JA 5M4IA 1W98A 5ETAA 1W83A 3NUXA 4TYIA 4AT4A 2C0OA 4WRGA 2HW6A 2PUIA 4BVUA 2PZ5A 3OT3A 3BRBA 4ZSLA 5KKRB 4ZTRA 3ACKA 2R3PA 2G2FA 3DXPA 3NMUF 4EOMA 4PX6A 2YDIA 4BI0A 2ZB1A 4PMTA 4E4XA 1KV2A 2JEDA 5CU4A 2EXCX 4W8EA 5TE0A 4MX9A 4IVDA 1M17A 4FKTA 4TPTA 3DKCA 3QAME 1XBAA 1KSWA 3R73A 5ANGA 3PRFA 5AR3A 3UP7A 2HOGA 2VX1A 3PYYA 4DEIA 5AUXA 4L44A 4E4LA 4O4FA 2V55A 3VC4A 2ONLC 3BIZA 2ETRA 2IJMA 3IW4A 5DT4A 3R8PA 1Y6BA 4M66A 3NCGA 2XCHA 4L45A 4XUFA 5TR6A 3PXRA 3MW1A 3PIYA 4BCMA 4A4OA 3LFDA 3LMIA 5IDNA 3HKOA 3MDYA 5E1SA 5E8UA 4BIEA 3W2QA 4HW7A 4DEDA 2WMUA 5AP6A 4J7BA 1JQHA 4M69A 5AX9A 4RWKA 5DFPA 3OEZA 3I6WA 1P2AA 2NPQA 1YHVA 5IMEA 3LIJA 1XH4A 1ATPE 4FIIA 1U46A 4E20A 5BVKA 4EQUA 1ZY5A 5FEEA 3HAMA 2RIOA 2PK9A 3P7BA 1SZMA 1XH5A 1K2PA 4CFFA 5HBJA 3R9RA 3W2OA 5AM6A 2IG7A 3RHXA 1ZYSA 3TT0A 3BLQA 5EKOA 4IX5A 4ANLA 4F6UA 5HICA 4ACCA 2GNHA 3POOA 3QTXA 4F70A 4HGTA 4UMQA 3MTFA 5C8KA 1R78A 3P9JA 2XNOA 4X7QA 5GINE 3C4ZA 4ENXA 5CWZA 3S00A 3U6IA 4C2VA 4U7ZA 2BIYA 2PVMA 2QC6A 3LQ5A 3MVLA 4K6ZA 3QF9A 4WUNA 4LUEA 4EORA 3S0OA 4BR3A 2X2MA 3GFWA 5J9ZA 3VS6A 3TTIA 3WF7A 3ZZWA 2PMNX 2I6LA 5M56A 4RQVA 4F9YA 3OBGA 4FA2A 4K0YA 3PUPA 3DCVA 1R3CA 4BHZA 5IISA 3CIKA 5T68A 4MEDA 1PKGA 3GC9A 4CKIA 4RZVA 5AV1A 4YC3A 5D7VA 4PP7A 4RIYB 4MD7E 3ZSIA 3D0EA 4TYEA 3CTHA 4R1YA 3AT2A 2BPMA 1JSTA 3E5AA 4L68A 2IF8A 3D7TA 3LM0A 2OWBA 3FLWA 4OR5A 4R3CA 3BLAA 3O50A 3NFGB 1T45A 3Q3BA 3EIDA 4G17A 3CY3A 4Y46A 3PLAE 5E8XA 5L2QA 5JZJA 3V01A 5LWMA 3DAKA 5JGDA 3R21A 5JK3A 4CGAA 3MY5A 3FLYA 4I5HA 4DCEA 3NUPA 4IB1A 4E26A 5HORA 3QALE 1BI8A 3A8WA 3PA5A 3OBJA 4L6QA 5HCZA 5LWNA 1TKIA 2C6TA 4YNEA 5L6WL 3ALNA 3WILA 2VGPA 4R6VA 3BLRA 4ZZNA 2VWYA 1XO2B 2YISA 4FR4A 4LRJA 4ZZOA 3AC2A 4KBKA 5TO8A 2QU5A 1UKIA 3ALOA 4EZ3A 3PTGA 5AEPA 1ND4A 3RCDA 2VTMA 3KEXA 3G0FA 4F7JA 3L9LA 4BWKA 1OL2A 4LV5A 3NSZA 4E93A 2HXLA 3MFRA 4JLCA 3E63A 3FEGA 3Q04A 3LFNA 4O4CA 1TQMA 4QTDA 4JJRA 3ZFXA 5HCYA 1OPJA 5HG5A 3NPCA 5GHVA 2WMXA 5EHLA 3HP2A 4G9RA 5CF6A 3P79A 2XK6A 2R3JA 4CV9A 3W0QA 2OI4X 1W2FA 4RJ3A 3OY3A 4RMZA 3ZM9A 4DTBA 4AT3A 3JY9A 4BI2A 2OH4A 5AM7A 3H3CA 4YTCA 3RKBA 1OKZA 3KVWA 3OCSA 5AR2A 3HNGA 1HCLA 3AG9A 4C7TA 5K9IA 1OECA 5BVNA 3GC7A 4D0WA 2J7TA 3RPVA 4FUYA 3TV6A 2C6EA 3S2PA 4IX6A 2Q83A 4D2TA 4F7LA 3LFQA 3VBTA 4ONAA 3MH2A 3DKGA 1H27A 2CN5A 3RPYA 1VLRA 5J87A 2WEIA 1PHKA 4XYFA 4BF2A 2PMLX 5AV0A 3VRZA 4D1XA 3ORPA 5TKDA 4BCQA 4G3DA 2C6DA 4RVLA 3P5JC 4IB3A 2UVYA 4X6QC 5F20A 4QQ5A 3C0IA 3ZS5A 2QO7A 4RA5A 3BHUA 1WFCA 4A9YA 5IQCA 5K3YA 4EOKA 4AE6A 5CEQA 1TQIA 2WQBA 5B2MA 2WU7A 3AT4A 4G1WA 1E1XA 1GZNA 4RGJA 4EK6A 4CNHA 4GT3A 1QMZA 4JBPA 2R3MA 4BDKA 4UB7A 3A99A 2R0UA 4BDEA 3R00A 4DGMA 3RPOA 4FKLA 2WQOA 3MBLA 1XH6A 2CN8A 4MH7A 2XRUA 3FWQA 4O6LA 5F1ZA 3SC1A 4GVJA 2W1GA 1FBNA 2B0QA 3IW6A 4H05A 4JDKA 4FKOA 4KD1A 1FVTA 3BYOA 2JAMA 3PJ2A 2WELA 4J71A 3UNZA 5ETCA 2BRNA 2WO6A 2C0TA 1ZYCA 5KMOA 3FJQE 4YJRA 4BWXA 4CRLA 3Q4ZA 2XIXA 5A4LA 4HYSA 4LOPA 5JKGA 1IASA 1YXSA 3R8VA 3VIDA 3QYWA 4DCAA 2VWUA 4A9TA 4W4VA 4OTWA 2O5KA 4XX9A 3N9XA 4OUCA 4OLIA 5M53A 3FI4A 3E92A 2NYAA 4Q9ZA 3U6HA 1W0XC 1JOWB 3C51A 2VTOA 2HAKA 1PKDA 4DH5A 4ZY5A 1UU9A 4FIFA 2VD5A 1H1WA 3QRIA 4YHFA 2BRMA 5ANJA 2R9SA 4QMQA 1ZMUA 4HVHA 3KRLA 3GT8A 3U9NA 1WAKA 5E8YA 4X2KA 4OAVB 3MJ1A 1RDQE 1DM2A 5BVFA 3EL8A 4G3EA 3Q9YA 4IMYA 3UNJA 1XR1A 3R71A 3O51A 2RFDA 3QA8A 2Z2WA 4LQMA 1Y6AA 2V0DA 1FGKA 2QR7A 2ZAZA 4FKPA 4XJ0A 3P4KA 3VUGA 4O4DA 2VO3A 2OIDA 4B8MA 3K54A 3ATTA 2OFUA 3H30A 4ITJA 3ZDUA 5H8BA 2PVLA 2C6MA 3IPHA 3G6HA 4QOXA 4YTIA 4IAAA 3GCSA 2ZFYA 2C69A 2IZUA 4YJSA 3C5IA 3QLFA 4QP8A 3W0SA 3O8TA 4BZOA 5KMKA 4G34A 3W32A 4M67A 4W8DA 3AKKA 1JSUA 4XRJA 2OXXA 3CD8A 4EL9A 5LMKC 5I9VA 3NCZA 3TDVA 1M7QA 3AMAA 4IWDA 4JG7A 2EB2A 4KSQA 4MXOA 3UQCA 2Z7SA 3HA8A 4AXCA 2GS7A 3F2AA 1PYXA 4QP1A 5HIEA 5IQDA 1MP8A 3VBQA 5CAUA 3VS2A 3E87A 3FDNA 5D10A 1DI9A 5M08A 4CEGA 5FRIA 2P55A 4A07A 5IH5A 4QPSA 3UDZA 4M68A 4FIJA 4F9WA 1ST0A 3FQEA 4FIGA 2JDSA 3QUDA 3QC4A 2NRYA 3OMVA 3A7IA 4I1ZA 3KU2A 2BALA 3KIOC 3PPZA 3QCQA 4FYNA 4ZOGA 1Q24A 3AC1A 1I44A 3QLGA 2CGWA 5IU2A 1BL6A 2IN6A 4NIFA 3QBNA 4UEUA 5HZNA 4TWPA 5IA4A 5L2IA 4MNFA 3F88A 4B6LA 3FI3A 2B52A 2JKOA 2OZAB 2OXYA 1VZOA 5FEDA 3W8QA 3KGAA 1MUOA 4FF8A 2ESMA 4X3FA 1XQZA 1SNXA 2HZIA 3LOKA 4ZY4A 5HE2A 2X0GA 3LCDA 1Y57A 2WTKC 5ANOA 2XB7A 2YIWA 3UMXA 2VRXA 1LP4A 2F9GA 2XVDA 3UQGA 1TZDA 1PXJA 2XF0A 3P5KA 4U40A 3D7ZA 4B4LA 1J1BA 1YKRA 2R5TA 3LFAA 4IWOA 4NUSA 3QA0A 4Q5HA 5LARA 3NEWA 2B9IA 3KRXA 2PPQA 1JVPP 3KMWA 5KMMA 2J51A 3NYXA 1REJA 1CKPA 3FXXA 3KFAA 3UZRA 2UW8A 2XNGA 3I81A 4ZTLA 2FSLX 4EI4A 3O0GA 2GTNA 4FTAA 4I92A 5CSHA 1G8SA 4EZ7A 4ZLYA 3R7UA 1REKA 4KIQA 1GIJA 1H24A 4LV7A 3RWQA 5HNIX 2FO0A 5H8EA 4DFZE 2PVHA 5FDPA 5JFWA 1OI9A 2WIPA 4RJ7A 2VNWA 2UZTA 2BTSA 5E8VA 4RIOA 1ZYLA 3D5VA 2JFMA 3HMMA 3D2IA 4J53A 4F6WA 5LVPA 3EQIA 3GU8A 4DLIA 3HAVA 3LFEA 2CLXA 1NT2A 4AQCA 4C36A 2PVNA 1NXKA 2NP8A 2B9JA 1R0PA 3QKLA 1KE7A 4JS8A 5B2KA 2IZSA 1G3NA 2YABA 1H08A 1Q5KA 4E5AX 5JMSA 1TFFA 3VS7A 3TZ8A 4BL1A 4FV1A 4QMMA 2R7IA 5IUHA 4D0XA 1Y8YA 4LG4A 3U51A 3V5JA 1OKWA 5ACBC 3TJDA 3W0PA 3JYAA 2R2PA 4G5JA 3F2RA 3AC8A 3IS5A 4KAOA 4MQ2A 3KC3A 2DS1A 4EOPA 1J7LA 3Q5ZA 1KV1A 2YIXA 3CS9A 4IFCA 2A98A 1W2CA 2JGZA 1ZOEA 1H1SA 2HCKA 3R63A 4FNYA 5EI8A 2I0YA 3Q9WA 3NW6A 3TI1A 3BELA 1F5QA 3LKMA 2JKKA 5CF8A 4ZS4A 1YQJA 4K2RA 4AOTA 2XKEA 4HVDA 5ANDA 4M3QA 4DEHA 3G2FA 5DN3A 2VWBA 4PTCA 2G2IA 5AA8A 5A9UA 3ZBFA 1YI4A 4F99A 2GNGA 4AACA 4M7IA 5HD4A 1GIIA 3GI3A 2O65A 4F9AA 5AAEA 4QQTA 4PPAA 3DXQA 4U80A 2J2IB 3RMFA 4OTIA 4L53A 4F0IA 3DTWA 3MTLA 4RWLA 1U54A 3DJ7A 1YXVA 2VTQA 3KN5A 4QQCA 3FSKA 4F1MA 3U8WA 3ORTA 4M12A 2XP2A 4ZSGA 1VEBA 4FJVA 2HXQA 3HL7A 1STCE 3R9NA 5A4QA 4HCVA 2OJFE 5A6OA 3NUNA 1YVJA 3DS6A 3IG7A 4UWCA 2RSVA 2XNNA 5AUYA 2QOLA 2LAVA 3ZBXA 2JBOA 4MWIA 3NNUA 4QYFA 4QP6A 5BX0A 5DWRA 4FSMA 2IPXA 3CGOA 5GIOE 1UNGA