4J1VA

Functional and structural studies of mobkl1b, a salvador/warts/hippo tumor suppressor pathway, in hcv replication
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
166
Chain Sequence
LRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOB kinase activator 1A
publication title Seed Sequence-Matched Controls Reveal Limitations of Small Interfering RNA Knockdown in Functional and Structural Studies of Hepatitis C Virus NS5A-MOBKL1B Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/viral protein
total genus 58
structure length 166
sequence length 172
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 4j1vA00
4LQQB 5BRKA 5B5WA 4J1VA 4LQSB 5B6BA 5BRMA 1R3BA 4JIZA 5B5VA 2HJNA 1PI1A
chains in the Genus database with same CATH superfamily
1PK0A 3VKGA 4Q5BA 3OIBA 2OEVA 2BTZA 5GJVE 3UBRA 3FCJA 1XFWA 4KCFA 1Y8PA 4L38A 3D9FA 5K3GA 4Q17A 3RKHA 4IRNA 1SIQA 2YYLA 3D6BA 3II9A 2YYKA 4HKSA 3BNFA 1QDBA 3TZ0A 4DZYA 3OWMA 5BRKA 3M9VA 4KSFA 2Q8HA 3P4TA 2CJ4A 3TTBA 1PI1A 2BU6A 2XS8A 2PNRA 3GM6A 3SWOA 3KMLA 4V25A 1IVHA 2RF7A 2YYGA 3GQTA 4DOYA 5M4MA 1FS8A 2JBRA 1XFVA 1UDYA 3MMOA 3MKHA 3N0RA 3MPJA 3MXLA 2CJ7A 2E81A 1S26A 2CJ5A 2LFWA 4FZ4A 4KSAA 1WS9A 3LG1A 2HJNA 2Q8FA 4QICA 1X8ZA 2FP1A 4E02A 1SC5A 4FF2A 3LGQA 4JEKA 1X90A 1RJ1A 1RP3A 4MP2A 3S7WA 3VADA 1LVCA 3BNGA 3TZ5A 1FS9A 1Y8NA 3CRKA 4X28C 1K93A 4J1VA 2EBHX 2OR0A 1XG2B 2REHA 1SIRA 1GJVA 2OJQA 4L3XA 4MPCA 1Y8OA 3C3LA 2RDZA 4H7QA 3SF6A 4JIOA 4AKIA 3EOMA 3MPIA 2CJ8A 3TORA 4WJYA 4FF3A 4FF1A 2FP2A 3SXQA 3TZ4A 1XFUA 1SK6A 3X29A 4L3YA 3VKHA 2R0MA 2VIGA 2DVLA 1FS7A 2A1TA 2BU2A 2EC5A 4OO2A 3AFEA 2OEXA 5M4KA 3CE2A 4W9UA 4O5MA 3HWCA 2E80A 2AZEA 4LQQB 4KTOA 3SCEA 2ZAFA 1IS2A 4LQSB 4E00A 2R0NA 2R02A 5J6AA 2VF1A 3D9GA 2Q8GA 5B6BA 3Q22A 1JQIA 4HR3A 2ZO5A 2C12A 3TZ2A 4F0XA 4ZYJA 2XS1A 5K3HA 2YYJA 2VR0A 3B96A 4KS9A 4M9AA 3Q24A 3MDEA 3BNJA 1W07A 2ZDYA 3GNCA 4JIZA 3BNHA 1EGCA 3PFDA 2J7AA 4IV6A 5K3JA 4MPNA 2OT4A 2JBSA 2PO4A 5B5WA 1T9GA 2CX9A 2IX5A 2PG0A 4X28A 1X91A 2YYIA 1GKZA 3F29A 4V26A 2QR4A 1GKXA 2XQRB 3OWAA 1K8TA 4G5EA 3C2PA 4AKHA 5K3IA 4MP7A 3CRLA 4P13A 2E0AA 1R2JA 1RJ4A 1U8VA 3D1IA 4L1FA 2YYMA 4Q0TA 2BU5A 2JBTA 3UU9A 2AO2A 1JM6A 2R03A 4HKRA 4AI6A 4L3ZA 3R7KA 3AFFA 4H85A 2C0UA 2GBBA 4U83A 5M4NA 5BRMA 2ZDXA 4ZXVA 3FO3A 2Z1QA 1XFXA 2F6LA 3X0XA 4E01A 1GU6A 4Q4UA 4RM7A 3Q0AA 1EGDA 4N5FA 4Q5CA 1OAHA 3L1TA 4H81A 2UXWA 3NF4A 2BU7A 4MPEA 2EBAA 2EBFX 1XFYA 3EONA 3X0YA 2DDHA 3MDDA 2IX6A 2R05A 2FONA 2WBIA 2ZKJA 4G97A 3D2RA 1EGEA 1K90A 5J71A 2CJ6A 4P79A 1R3BA 5M4PA 1UKWA 2D29A 1Y0VA 2RFQA 2YGWA 4Q1OA 1XFZA 4XVXA 3Q23A 4AKGA 2Q8IA 2BU8A 3C46A 1RX0A 5GJWE 3D9EA 4NXLA 4FF4A 2JIFA 5B5VA 1BUCA 3D9DA
chains in the Genus database with same CATH topology
4LQQB 5BRKA 5B5WA 4J1VA 4LQSB 5B6BA 5BRMA 1R3BA 4JIZA 5B5VA 2HJNA 1PI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQQ B;  5BRK A;  5B5W A;  4J1V A;  4LQS B;  5B6B A;  5BRM A;  1R3B A;  4JIZ A;  5B5V A;  2HJN A;  1PI1 A; 
#chains in the Genus database with same CATH topology
 1PK0 A;  3VKG A;  4Q5B A;  3OIB A;  2OEV A;  2BTZ A;  5GJV E;  3UBR A;  3FCJ A;  1XFW A;  4KCF A;  1Y8P A;  4L38 A;  3D9F A;  5K3G A;  4Q17 A;  3RKH A;  4IRN A;  1SIQ A;  2YYL A;  3D6B A;  3II9 A;  2YYK A;  4HKS A;  3BNF A;  1QDB A;  3TZ0 A;  4DZY A;  3OWM A;  5BRK A;  3M9V A;  4KSF A;  2Q8H A;  3P4T A;  2CJ4 A;  3TTB A;  1PI1 A;  2BU6 A;  2XS8 A;  2PNR A;  3GM6 A;  3SWO A;  3KML A;  4V25 A;  1IVH A;  2RF7 A;  2YYG A;  3GQT A;  4DOY A;  5M4M A;  1FS8 A;  2JBR A;  1XFV A;  1UDY A;  3MMO A;  3MKH A;  3N0R A;  3MPJ A;  3MXL A;  2CJ7 A;  2E81 A;  1S26 A;  2CJ5 A;  2LFW A;  4FZ4 A;  4KSA A;  1WS9 A;  3LG1 A;  2HJN A;  2Q8F A;  4QIC A;  1X8Z A;  2FP1 A;  4E02 A;  1SC5 A;  4FF2 A;  3LGQ A;  4JEK A;  1X90 A;  1RJ1 A;  1RP3 A;  4MP2 A;  3S7W A;  3VAD A;  1LVC A;  3BNG A;  3TZ5 A;  1FS9 A;  1Y8N A;  3CRK A;  4X28 C;  1K93 A;  4J1V A;  2EBH X;  2OR0 A;  1XG2 B;  2REH A;  1SIR A;  1GJV A;  2OJQ A;  4L3X A;  4MPC A;  1Y8O A;  3C3L A;  2RDZ A;  4H7Q A;  3SF6 A;  4JIO A;  4AKI A;  3EOM A;  3MPI A;  2CJ8 A;  3TOR A;  4WJY A;  4FF3 A;  4FF1 A;  2FP2 A;  3SXQ A;  3TZ4 A;  1XFU A;  1SK6 A;  3X29 A;  4L3Y A;  3VKH A;  2R0M A;  2VIG A;  2DVL A;  1FS7 A;  2A1T A;  2BU2 A;  2EC5 A;  4OO2 A;  3AFE A;  2OEX A;  5M4K A;  3CE2 A;  4W9U A;  4O5M A;  3HWC A;  2E80 A;  2AZE A;  4LQQ B;  4KTO A;  3SCE A;  2ZAF A;  1IS2 A;  4LQS B;  4E00 A;  2R0N A;  2R02 A;  5J6A A;  2VF1 A;  3D9G A;  2Q8G A;  5B6B A;  3Q22 A;  1JQI A;  4HR3 A;  2ZO5 A;  2C12 A;  3TZ2 A;  4F0X A;  4ZYJ A;  2XS1 A;  5K3H A;  2YYJ A;  2VR0 A;  3B96 A;  4KS9 A;  4M9A A;  3Q24 A;  3MDE A;  3BNJ A;  1W07 A;  2ZDY A;  3GNC A;  4JIZ A;  3BNH A;  1EGC A;  3PFD A;  2J7A A;  4IV6 A;  5K3J A;  4MPN A;  2OT4 A;  2JBS A;  2PO4 A;  5B5W A;  1T9G A;  2CX9 A;  2IX5 A;  2PG0 A;  4X28 A;  1X91 A;  2YYI A;  1GKZ A;  3F29 A;  4V26 A;  2QR4 A;  1GKX A;  2XQR B;  3OWA A;  1K8T A;  4G5E A;  3C2P A;  4AKH A;  5K3I A;  4MP7 A;  3CRL A;  4P13 A;  2E0A A;  1R2J A;  1RJ4 A;  1U8V A;  3D1I A;  4L1F A;  2YYM A;  4Q0T A;  2BU5 A;  2JBT A;  3UU9 A;  2AO2 A;  1JM6 A;  2R03 A;  4HKR A;  4AI6 A;  4L3Z A;  3R7K A;  3AFF A;  4H85 A;  2C0U A;  2GBB A;  4U83 A;  5M4N A;  5BRM A;  2ZDX A;  4ZXV A;  3FO3 A;  2Z1Q A;  1XFX A;  2F6L A;  3X0X A;  4E01 A;  1GU6 A;  4Q4U A;  4RM7 A;  3Q0A A;  1EGD A;  4N5F A;  4Q5C A;  1OAH A;  3L1T A;  4H81 A;  2UXW A;  3NF4 A;  2BU7 A;  4MPE A;  2EBA A;  2EBF X;  1XFY A;  3EON A;  3X0Y A;  2DDH A;  3MDD A;  2IX6 A;  2R05 A;  2FON A;  2WBI A;  2ZKJ A;  4G97 A;  3D2R A;  1EGE A;  1K90 A;  5J71 A;  2CJ6 A;  4P79 A;  1R3B A;  5M4P A;  1UKW A;  2D29 A;  1Y0V A;  2RFQ A;  2YGW A;  4Q1O A;  1XFZ A;  4XVX A;  3Q23 A;  4AKG A;  2Q8I A;  2BU8 A;  3C46 A;  1RX0 A;  5GJW E;  3D9E A;  4NXL A;  4FF4 A;  2JIF A;  5B5V A;  1BUC A;  3D9D A; 
#chains in the Genus database with same CATH homology
 4LQQ B;  5BRK A;  5B5W A;  4J1V A;  4LQS B;  5B6B A;  5BRM A;  1R3B A;  4JIZ A;  5B5V A;  2HJN A;  1PI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...