4J1VA

Functional and structural studies of mobkl1b, a salvador/warts/hippo tumor suppressor pathway, in hcv replication
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
166
Chain Sequence
LRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOB kinase activator 1A
publication title Seed Sequence-Matched Controls Reveal Limitations of Small Interfering RNA Knockdown in Functional and Structural Studies of Hepatitis C Virus NS5A-MOBKL1B Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/viral protein
total genus 58
structure length 166
sequence length 172
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 4j1vA00
5B5WA 4LQQB 1R3BA 5BRMA 5B6BA 4J1VA 5B5VA 4LQSB 5BRKA 1PI1A 2HJNA 4JIZA
chains in the Genus database with same CATH superfamily
3TZ4A 5B5WA 1GJVA 4X28A 1K90A 2JBSA 2VF1A 4H7QA 3MKHA 3N0RA 4JIOA 1RP3A 4NXLA 2CJ7A 3SF6A 1Y8NA 3OWMA 2Q8FA 3TZ5A 2PNRA 4AI6A 2XQRB 3VADA 4P79A 4HKSA 1GKZA 3OIBA 4G5EA 4HR3A 2YYKA 3SCEA 2IX5A 1S26A 1XFUA 2VR0A 1UKWA 2YYMA 4P13A 3C46A 4AKIA 4L3ZA 2Q8IA 3Q0AA 4WJYA 3X29A 3KMLA 1XFZA 3MPIA 3BNGA 2BTZA 1IS2A 2E0AA 2OEVA 4IRNA 4H81A 2JBRA 2CJ5A 2YYIA 2ZDYA 3D1IA 3CE2A 4Q0TA 3TTBA 3AFEA 2C12A 4FF4A 4W9UA 1X91A 3BNJA 2D29A 4MP2A 1EGDA 1SIQA 2BU8A 2PO4A 4H85A 4OO2A 1Y8PA 2R03A 3LGQA 4V26A 2CJ6A 2YYLA 5B5VA 4E00A 5J71A 3SXQA 1K8TA 3EONA 4N5FA 2F6LA 2ZAFA 3BNHA 4FF1A 2QR4A 3MMOA 1T9GA 5BRMA 2OEXA 4ZXVA 1XFWA 1LVCA 1IVHA 2CJ8A 2BU2A 2EBAA 4L3XA 2UXWA 1X90A 4J1VA 4RM7A 3X0XA 4AKHA 3MXLA 1XG2B 1RJ1A 2DVLA 5GJVE 4FF2A 1K93A 5M4NA 4QICA 2E81A 3D9DA 5BRKA 1FS7A 4KCFA 5M4MA 4F0XA 4AKGA 3NF4A 2AO2A 2RF7A 2YYGA 2Z1QA 2DDHA 3GQTA 2J7AA 3D6BA 2A1TA 4Q5BA 2Q8GA 3TORA 1Y0VA 4DOYA 3Q22A 1XFYA 1EGCA 4LQQB 1SIRA 4L38A 1GKXA 4JEKA 2CX9A 3CRKA 1SC5A 4Q1OA 4LQSB 4FF3A 5J6AA 1FS8A 4U83A 4Q17A 1FS9A 3SWOA 1U8VA 2EBFX 4G97A 1XFVA 3HWCA 3F29A 3MPJA 1QDBA 2YYJA 2PG0A 4E02A 3L1TA 1OAHA 2BU5A 4MP7A 5GJWE 3TZ2A 3FO3A 2IX6A 4MPEA 2HJNA 3D9FA 4KSAA 2ZKJA 3PFDA 4MPCA 2JBTA 3S7WA 3M9VA 3Q23A 4KTOA 5K3GA 4V25A 3MDEA 2OR0A 3BNFA 3X0YA 1WS9A 1JM6A 2R0NA 3GNCA 2OT4A 2BU7A 2EC5A 2FP1A 4E01A 1R3BA 4ZYJA 5K3JA 2OJQA 3C3LA 4MPNA 5K3IA 2ZO5A 3FCJA 3II9A 2RFQA 4XVXA 3UU9A 2JIFA 2LFWA 1EGEA 4JIZA 5M4PA 3D9EA 4IV6A 2XS8A 2ZDXA 2R0MA 1JQIA 4KSFA 4Q4UA 3C2PA 1RX0A 1UDYA 5M4KA 3Q24A 2Q8HA 2WBIA 4HKRA 2BU6A 2FP2A 1GU6A 4KS9A 1R2JA 5B6BA 2FONA 2REHA 2XS1A 2YGWA 3RKHA 4FZ4A 4L1FA 1X8ZA 3LG1A 3MDDA 4L3YA 1RJ4A 3VKHA 3D9GA 2R02A 3B96A 1PI1A 1SK6A 2R05A 1PK0A 3D2RA 1W07A 3P4TA 3R7KA 1BUCA 4Q5CA 3CRLA 3OWAA 4X28C 2AZEA 3AFFA 2C0UA 4DZYA 5K3HA 3VKGA 2E80A 2VIGA 3EOMA 3TZ0A 2RDZA 4O5MA 1Y8OA 2CJ4A 2EBHX 2GBBA 1XFXA 3UBRA 3GM6A 4M9AA
chains in the Genus database with same CATH topology
5B5WA 4LQQB 1R3BA 5BRMA 5B6BA 4J1VA 5B5VA 4LQSB 5BRKA 1PI1A 2HJNA 4JIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5W A;  4LQQ B;  1R3B A;  5BRM A;  5B6B A;  4J1V A;  5B5V A;  4LQS B;  5BRK A;  1PI1 A;  2HJN A;  4JIZ A; 
#chains in the Genus database with same CATH topology
 3TZ4 A;  5B5W A;  1GJV A;  4X28 A;  1K90 A;  2JBS A;  2VF1 A;  4H7Q A;  3MKH A;  3N0R A;  4JIO A;  1RP3 A;  4NXL A;  2CJ7 A;  3SF6 A;  1Y8N A;  3OWM A;  2Q8F A;  3TZ5 A;  2PNR A;  4AI6 A;  2XQR B;  3VAD A;  4P79 A;  4HKS A;  1GKZ A;  3OIB A;  4G5E A;  4HR3 A;  2YYK A;  3SCE A;  2IX5 A;  1S26 A;  1XFU A;  2VR0 A;  1UKW A;  2YYM A;  4P13 A;  3C46 A;  4AKI A;  4L3Z A;  2Q8I A;  3Q0A A;  4WJY A;  3X29 A;  3KML A;  1XFZ A;  3MPI A;  3BNG A;  2BTZ A;  1IS2 A;  2E0A A;  2OEV A;  4IRN A;  4H81 A;  2JBR A;  2CJ5 A;  2YYI A;  2ZDY A;  3D1I A;  3CE2 A;  4Q0T A;  3TTB A;  3AFE A;  2C12 A;  4FF4 A;  4W9U A;  1X91 A;  3BNJ A;  2D29 A;  4MP2 A;  1EGD A;  1SIQ A;  2BU8 A;  2PO4 A;  4H85 A;  4OO2 A;  1Y8P A;  2R03 A;  3LGQ A;  4V26 A;  2CJ6 A;  2YYL A;  5B5V A;  4E00 A;  5J71 A;  3SXQ A;  1K8T A;  3EON A;  4N5F A;  2F6L A;  2ZAF A;  3BNH A;  4FF1 A;  2QR4 A;  3MMO A;  1T9G A;  5BRM A;  2OEX A;  4ZXV A;  1XFW A;  1LVC A;  1IVH A;  2CJ8 A;  2BU2 A;  2EBA A;  4L3X A;  2UXW A;  1X90 A;  4J1V A;  4RM7 A;  3X0X A;  4AKH A;  3MXL A;  1XG2 B;  1RJ1 A;  2DVL A;  5GJV E;  4FF2 A;  1K93 A;  5M4N A;  4QIC A;  2E81 A;  3D9D A;  5BRK A;  1FS7 A;  4KCF A;  5M4M A;  4F0X A;  4AKG A;  3NF4 A;  2AO2 A;  2RF7 A;  2YYG A;  2Z1Q A;  2DDH A;  3GQT A;  2J7A A;  3D6B A;  2A1T A;  4Q5B A;  2Q8G A;  3TOR A;  1Y0V A;  4DOY A;  3Q22 A;  1XFY A;  1EGC A;  4LQQ B;  1SIR A;  4L38 A;  1GKX A;  4JEK A;  2CX9 A;  3CRK A;  1SC5 A;  4Q1O A;  4LQS B;  4FF3 A;  5J6A A;  1FS8 A;  4U83 A;  4Q17 A;  1FS9 A;  3SWO A;  1U8V A;  2EBF X;  4G97 A;  1XFV A;  3HWC A;  3F29 A;  3MPJ A;  1QDB A;  2YYJ A;  2PG0 A;  4E02 A;  3L1T A;  1OAH A;  2BU5 A;  4MP7 A;  5GJW E;  3TZ2 A;  3FO3 A;  2IX6 A;  4MPE A;  2HJN A;  3D9F A;  4KSA A;  2ZKJ A;  3PFD A;  4MPC A;  2JBT A;  3S7W A;  3M9V A;  3Q23 A;  4KTO A;  5K3G A;  4V25 A;  3MDE A;  2OR0 A;  3BNF A;  3X0Y A;  1WS9 A;  1JM6 A;  2R0N A;  3GNC A;  2OT4 A;  2BU7 A;  2EC5 A;  2FP1 A;  4E01 A;  1R3B A;  4ZYJ A;  5K3J A;  2OJQ A;  3C3L A;  4MPN A;  5K3I A;  2ZO5 A;  3FCJ A;  3II9 A;  2RFQ A;  4XVX A;  3UU9 A;  2JIF A;  2LFW A;  1EGE A;  4JIZ A;  5M4P A;  3D9E A;  4IV6 A;  2XS8 A;  2ZDX A;  2R0M A;  1JQI A;  4KSF A;  4Q4U A;  3C2P A;  1RX0 A;  1UDY A;  5M4K A;  3Q24 A;  2Q8H A;  2WBI A;  4HKR A;  2BU6 A;  2FP2 A;  1GU6 A;  4KS9 A;  1R2J A;  5B6B A;  2FON A;  2REH A;  2XS1 A;  2YGW A;  3RKH A;  4FZ4 A;  4L1F A;  1X8Z A;  3LG1 A;  3MDD A;  4L3Y A;  1RJ4 A;  3VKH A;  3D9G A;  2R02 A;  3B96 A;  1PI1 A;  1SK6 A;  2R05 A;  1PK0 A;  3D2R A;  1W07 A;  3P4T A;  3R7K A;  1BUC A;  4Q5C A;  3CRL A;  3OWA A;  4X28 C;  2AZE A;  3AFF A;  2C0U A;  4DZY A;  5K3H A;  3VKG A;  2E80 A;  2VIG A;  3EOM A;  3TZ0 A;  2RDZ A;  4O5M A;  1Y8O A;  2CJ4 A;  2EBH X;  2GBB A;  1XFX A;  3UBR A;  3GM6 A;  4M9A A; 
#chains in the Genus database with same CATH homology
 5B5W A;  4LQQ B;  1R3B A;  5BRM A;  5B6B A;  4J1V A;  5B5V A;  4LQS B;  5BRK A;  1PI1 A;  2HJN A;  4JIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...