4J2KA

Crystal structure of a plant trypsin inhibitor ecti
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
168
Chain Sequence
KELLDSDGDILRNGGTYYILPALRGKGGGLELAKTGDETCPLNVVQARSETKRGRPAIIWTPPRIAILTPAFYLNIEFQTRDLPACLEEYSRLPWKVEGESQEVKIAPKEEEQHLFGSFKIKPYRDDYKLVYCESCKDLGISIDDENNRLLVVKDGDPLAVRFVKAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Plant Trypsin Inhibitor from Enterolobium contortisiliquum (EcTI) and of Its Complex with Bovine Trypsin.
pubmed doi rcsb
molecule keywords Trypsin inhibitor
molecule tags Hydrolase inhibitor
total genus 37
structure length 168
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4j2kA00
3UJ4A 3LTQA 2BFHA 1W3FA 3FJ8A 3FUQA 1G9BA 2D43A 3RMYA 3N7LA 2WRYA 5E24E 3O49A 4XKIA 1AXMA 3CA5A 3FJKA 2VSAA 4LO2C 1G9AA 3WMUA 3MALA 2VLCA 1EYLA 3I2AA 3UD8A 1IT0A 4D0ZA 3AJ6A 4ZFYB 1TWEA 4KBBA 2K4AB 2D20A 4DCKC 2IWTB 4LO1A 2AAIB 3VT1A 3NBNA 4EKXB 3IM5A 4Z8SB 1IOBA 3I29B 2D22A 4IZXA 5B2HA 1FV3A 1XYFA 4A7ZA 4XFSA 1JT4A 2ERMA 2XOAA 3OBRA 1M2TB 4I4UA 3AH2A 4QBCA 2RG9B 4KC3A 3BRDA 3FJAA 4IY9A 3FUOA 1JT3A 5EHAA 1T4QA 2IHOA 1ISVA 1FV2A 3VWCA 1FWUA 4ISQA 1V6VA 4HJJA 3AJ5A 3VUOA 4AN7B 4LO7C 2D44A 3N0KA 4GAIA 3H6RB 1JQZA 4L4IA 1HCEA 2FDBM 4G9NA 3ZC9A 3N7JA 2Z48A 3HOMA 2VXRA 2DS0A 1SZ6B 2Y9WC 1PC8B 4I4VA 3UDAA 4XFTA 3T8SA 3R4UA 3NJ5A 4J2YA 3V0BB 3TC2A 3Q7XA 9ILBA 5HPZA 1XZZA 4HA2A 1FN0A 2LIEA 1J0SA 2X2TA 1TP0A 3VSFA 3WMVA 1HKNA 2F2FC 1HCDA 3QR5A 4GP3A 3B9UA 4EEEB 3FJJA 3FJBA 3BAHA 3PG0A 2LIQA 2M49A 3BAVA 3P6JA 3FJIA 3W9TA 4Z9WB 3VEQA 2J3PA 3CQAA 3HN1A 1G82A 2FFUA 1DQGA 1P63A 4GOVA 2MIBA 1IRAX 4LO0C 2VUAA 3VT0A 4X38A 2NP0A 3O4AA 3IM6A 3LLPA 3ZX7A 4HR6C 3BRGC 5BQUA 4I4RA 4QKSA 3BTAA 3V0AA 3IIRA 2Q3NB 4JQ0A 1V6WA 2FFVA 4DENA 4OWLA 4P6AA 1RMLA 3O44A 4P0LA 1BFBA 4GAFA 1S0DA 4GP0A 4EFPA 3RTIB 2R9KB 1JTCA 1Z0HA 3OJ2A 3WA1A 2DREA 1A8DA 3CA6A 7I1BA 4P0JA 5FNWA 2GO2A 1GGPB 1AF9A 41BIA 4X3AA 1Q1UA 4EB2B 3OJMA 3JUTA 2D1ZA 5F8WA 1R8NA 1JT7A 5G00A 4D8HA 1BFCA 3FJCA 5EG6C 4F34A 4I6IA 4I2SA 3HMYA 1PUUB 4D0TA 1AVWB 4ISRA 2BEAA 3HALA 4LO1C 3A07A 4ZFUB 1MD6A 3O4CA 1HWOB 5GAQA 5BXSA 4I3NA 1I1EA 3UJ0A 2ET2A 1YXWA 1ITBA 3P6IA 1YTOA 3BB2A 4ENDA 1BFFA 3A23A 4I4YA 2DRYA 3UD9A 3IAGC 1E0OA 4J2KA 4A7YA 4I4PA 3BAGA 2FO1A 2MLLB 2KI4A 1EPWA 1K5VA 4IONA 1DZCA 4OUJA 2Q9XA 1NZKA 1DQOA 1I1BA 4JRAA 3O4BA 4IHZA 1W3AA 3AH4A 5BOWA 3FJFA 4II0A 3H6QA 1RZOB 4ZLBB 3KMVA 1K5UA 4LO2A 5FZYA 3OBTA 3OGGA 4JKQA 3ZXGA 1HIBA 1DIWA 4OWJA 5FZZA 1CVSA 1WD3A 3Q7YA 3QYDA 1Q04A 2BEBA 1YF8B 1IILA 1BLAA 3CA1A 3PUBA 4PC4A 3CA3A 3FJEA 4USOA 4Q91A 2NYYA 3PMEA 1G9CA 4OW4A 1FGAA 1DFQA 3BA4A 4JKXB 4LO7B 1ISYA 1FMMS 1DFCA 1QQLA 1KNMA 5F8SA 3Q7WA 3NBDA 1UPSA 4LO8B 4I8MA 1WBCA 1S0CA 1NUNA 2NTDA 3H6RA 4I0YA 4A7KA 1IJTA 4QALA 1V6UA 3FGMA 5JLVA 3UD7A 5F90A 4OEEA 1HWNB 2E4MA 1RG8A 3E8LC 4ZA3B 3WO3A 3V0BA 1AVAC 1BFGA 4ZFWB 5BQUC 1BLDA 4R6UB 4IQPA 1V6XA 3RMXA 1AFCA 1WBAA 4Q9PA 4EFRA 4I4XA 4G6JA 3N7KA 1QQKA 3OJVA 1IHKA 4XFUA 2KH2A 4KEIA 4QD2C 2P39A 1OQLB 3D7WB 1L2HA 3FJDA 3FJ9A 3WINA 2VXTI 1AVXB 1YBIA 2K8RA 3BAOA 3BAQA 3F1RA 3A21A 2HZ9A 4LO3C 3S8JA 2I1BA 1TOOA 4QBVA 2YUGA 3C9ZA 1S0BA 3K1XA 3VSZA 1R8OA 3POKA 4QC4A 5BP5A 4I4SA 8I1BA 4LO0A 4F83A 5EC5A 2D24A 3FFZA 2Z49A 4JAWA 1TFMB 4DEPA 2DRZA 3WO4A 4I96A 1Z2VA 4CJMA 3PHZA 1ISZA 2MC2A 1JLXA 2P23A 5I1BA 5BVPI 2L5XA 4G1RA 3CRHA 1IRPA 4IYBA 1JT5A 2KI6B 1EV2A 1Z4SA 4ZGRB 1DLLA 1SR4A 21BIA 4IY8A 2K43A 3N7MA 4IZEA 5F8YA 1RY7A 4EFQA 3IM7A 1G9DA 2NM1A 1DJSB 4QKRA 2GZBA 2ZQOA 1XG6A 2NVHA 3AKGA 5DZUA 3CA4A 1JY0A 4ZKTB 1W3GA 4QO3A 1TIEA 3O5WB 5D62A 4P0KA 1PWAA 1ISXA 5DSSB 3ILAA 4FGFA 1F31A 4AN6A 4ZOTA 1Q03A 2KKIA 2HWAA 2NZ9A 1D0HA 2QN4A 3A22A 1S0GA 1BARA 2Y9GA 3WO2A 1TWMA 2UUSA 4FVVA 4G9MA 3BX1C 3HSMA 4J2SA 3F62B 3NBEA 1HWPB 1HWMB 4X37A 3ZC8A 5BXRA 1XHBA 3SNVA 3OGFA 1ISWA 1ONKB 2ZQNA 3FJHA 4ZBVB 1AVUA 3CU1B 4TLPA 4KEJA 1CE7B 6I1BA 4I1BA 3AKFA 4OEFA 3AZWA 2E4MC 3RSJA 3V79C 5DVHA 1JLYA 4I7IA 4OEGA 1M16A 2ZR1B 1DZDA 1MC9A 4J23B 3AKHA 3O4DA 1BA7A 4USPA 2ESUA 4GOYA 3O4OA 31BIA 1S0FA 3BA5A 2AFGA 3RTJB 2D7RA 2AQZA 1S0LA 3WINC 4I1EA 5D63A 2RSTA 5JMCA 3CAHA 3CA0A 1BASA 3H6SE 3O3QA 4I4QA 4JPZA 2VSEA 3BA7A 4WBCA 4H04A 5FZUA 5FNXA 2RQ9A 4KEKA 3EF2A 4G6MA 3V0AB 2D23A 3JRRA 2HW9A 4J2XA 3ZXDA 5BXTA 4YOLA 2F2FA 1VCLA 5BP5C 5DUYA 1N4KA 2F8XC 1QXMA 5D61A 3MPPG 3HBWA 1FMZA 4QD2B 1EVTA 2FGFA 4I37A 1FQ9A 2HWMA 2Y9FA 1II4A 1PZZA 4OWKA 3S8KA 4Q9GA 2D7IA 1PUMB 3AKIA 4X39A 2AXMA 3BADA 5BXPA 2WBCA 1ILR1 3CRGA 4H9WA 1FWVA 3P53A 3AH1A 1TTUA 3BRFA 2X2SA 4L4HA 4I4OA 1WD4A 3I2XA 1S0EA 1T9FA 3CRIA 2Y9XE 2VU9A 1SR4C 3NBCA 3BAUA 2QYIB 1ABRB 3AZVA 2KLLA 3VT2A 4LO3A 3R4SA 4JP0A 1YYNA
chains in the Genus database with same CATH superfamily
3UJ4A 3LTQA 2BFHA 1W3FA 3FJ8A 3FUQA 1G9BA 2D43A 3RMYA 3N7LA 2WRYA 5E24E 3O49A 4XKIA 1AXMA 3CA5A 3FJKA 2VSAA 4LO2C 1G9AA 3WMUA 3MALA 2VLCA 1EYLA 3I2AA 3UD8A 1IT0A 4D0ZA 3AJ6A 4ZFYB 1TWEA 4KBBA 2K4AB 2D20A 4DCKC 2IWTB 4LO1A 2AAIB 3VT1A 3NBNA 4EKXB 3IM5A 4Z8SB 1IOBA 3I29B 2D22A 4IZXA 5B2HA 1FV3A 1XYFA 4A7ZA 4XFSA 1JT4A 2ERMA 2XOAA 3OBRA 1M2TB 4I4UA 3AH2A 4QBCA 2RG9B 4KC3A 3BRDA 3FJAA 4IY9A 3FUOA 1JT3A 5EHAA 1T4QA 2IHOA 1ISVA 1FV2A 3VWCA 1FWUA 4ISQA 1V6VA 4HJJA 3AJ5A 3VUOA 4AN7B 4LO7C 2D44A 3N0KA 4GAIA 3H6RB 1JQZA 4L4IA 1HCEA 2FDBM 4G9NA 3ZC9A 3N7JA 2Z48A 3HOMA 2VXRA 2DS0A 1SZ6B 2Y9WC 1PC8B 4I4VA 3UDAA 4XFTA 3T8SA 3R4UA 3NJ5A 4J2YA 3V0BB 3TC2A 3Q7XA 9ILBA 5HPZA 1XZZA 4HA2A 1FN0A 2LIEA 1J0SA 2X2TA 1TP0A 3VSFA 3WMVA 1HKNA 2F2FC 1HCDA 3QR5A 4GP3A 3B9UA 4EEEB 3FJJA 3FJBA 3BAHA 3PG0A 4H75A 2LIQA 2M49A 3BAVA 3P6JA 3FJIA 3W9TA 4Z9WB 3VEQA 2J3PA 3CQAA 3HN1A 1G82A 2FFUA 1DQGA 1P63A 4GOVA 2MIBA 1IRAX 4LO0C 2VUAA 3VT0A 4X38A 2NP0A 3O4AA 3IM6A 3LLPA 3ZX7A 4HR6C 3BRGC 5BQUA 4I4RA 4QKSA 3BTAA 3V0AA 3IIRA 2Q3NB 4JQ0A 1V6WA 2FFVA 4DENA 4OWLA 4P6AA 1RMLA 3O44A 4P0LA 1BFBA 4GAFA 1S0DA 4GP0A 4EFPA 3RTIB 2R9KB 1JTCA 1Z0HA 3OJ2A 3WA1A 2DREA 1A8DA 3CA6A 7I1BA 4P0JA 5FNWA 2GO2A 1GGPB 1AF9A 41BIA 4X3AA 1Q1UA 4EB2B 3OJMA 3JUTA 2D1ZA 4MZFB 5F8WA 1R8NA 1JT7A 5G00A 4D8HA 1BFCA 3FJCA 5EG6C 4F34A 4I6IA 4I2SA 3HMYA 1PUUB 4D0TA 1AVWB 4ISRA 2BEAA 3HALA 4LO1C 3A07A 4MZHA 4ZFUB 1MD6A 3O4CA 1HWOB 5GAQA 5BXSA 4I3NA 1I1EA 3UJ0A 2ET2A 1YXWA 1ITBA 3P6IA 1YTOA 3BB2A 4ENDA 1BFFA 3A23A 4I4YA 2DRYA 3UD9A 3IAGC 1E0OA 4J2KA 4A7YA 4I4PA 3BAGA 2FO1A 2MLLB 2KI4A 1EPWA 1K5VA 4IONA 1DZCA 4OUJA 2Q9XA 1NZKA 1DQOA 1I1BA 4JRAA 3O4BA 4IHZA 1W3AA 3AH4A 5BOWA 3FJFA 4II0A 3H6QA 1RZOB 4ZLBB 3KMVA 1K5UA 4LO2A 5FZYA 2NS2A 3OBTA 3OGGA 4JKQA 3ZXGA 1HIBA 1DIWA 4OWJA 5FZZA 1CVSA 1WD3A 3Q7YA 3QYDA 1Q04A 2BEBA 1YF8B 1IILA 1BLAA 3CA1A 3PUBA 4MZGB 4PC4A 3CA3A 3FJEA 4USOA 4Q91A 2NYYA 3PMEA 1G9CA 4OW4A 1FGAA 1DFQA 3BA4A 4JKXB 4LO7B 1ISYA 1FMMS 1DFCA 1QQLA 1KNMA 5F8SA 3Q7WA 3NBDA 1UPSA 4LO8B 4I8MA 1WBCA 1S0CA 1NUNA 2NTDA 3H6RA 4I0YA 4A7KA 1IJTA 4QALA 1V6UA 3FGMA 5JLVA 3UD7A 5F90A 4OEEA 1HWNB 2E4MA 1RG8A 3E8LC 4ZA3B 3WO3A 3V0BA 1AVAC 1BFGA 4ZFWB 5BQUC 1BLDA 4R6UB 4IQPA 1V6XA 3RMXA 1AFCA 1WBAA 4Q9PA 4EFRA 4I4XA 4G6JA 3N7KA 1QQKA 3OJVA 1IHKA 4XFUA 2KH2A 4KEIA 4QD2C 2P39A 1OQLB 3D7WB 1L2HA 3FJDA 3FJ9A 3WINA 2VXTI 1AVXB 1YBIA 2K8RA 3BAOA 3BAQA 3F1RA 3A21A 2HZ9A 4LO3C 3S8JA 2I1BA 1TOOA 4QBVA 4UY4A 2YUGA 3C9ZA 1S0BA 3K1XA 3VSZA 1R8OA 3POKA 4QC4A 5BP5A 4I4SA 8I1BA 4LO0A 4F83A 5EC5A 2D24A 3FFZA 2Z49A 4JAWA 1TFMB 4DEPA 2DRZA 3WO4A 4I96A 1Z2VA 4CJMA 3PHZA 1ISZA 2MC2A 1JLXA 2P23A 5I1BA 5BVPI 2L5XA 4G1RA 3CRHA 1IRPA 4IYBA 1JT5A 2KI6B 1EV2A 1Z4SA 4ZGRB 1DLLA 1SR4A 21BIA 4IY8A 2K43A 3N7MA 4IZEA 5F8YA 1RY7A 4EFQA 3IM7A 1G9DA 2NM1A 1DJSB 4QKRA 2GZBA 2ZQOA 1XG6A 2NVHA 3AKGA 5DZUA 3CA4A 1JY0A 4ZKTB 1W3GA 4QO3A 1TIEA 3O5WB 5D62A 4P0KA 1PWAA 1ISXA 5DSSB 3ILAA 4FGFA 1F31A 4AN6A 4ZOTA 1Q03A 2KKIA 2HWAA 2NZ9A 1D0HA 2QN4A 3A22A 1S0GA 1BARA 2Y9GA 3WO2A 1TWMA 2UUSA 4FVVA 4G9MA 3BX1C 3HSMA 4J2SA 3F62B 3NBEA 1HWPB 1HWMB 4X37A 3ZC8A 5BXRA 1XHBA 3SNVA 3OGFA 1ISWA 1ONKB 2ZQNA 3FJHA 4ZBVB 1AVUA 3CU1B 4TLPA 4KEJA 1CE7B 6I1BA 4I1BA 3AKFA 4OEFA 3AZWA 2E4MC 3RSJA 3V79C 5DVHA 1JLYA 4I7IA 4OEGA 1M16A 2ZR1B 1DZDA 1MC9A 4J23B 3AKHA 3O4DA 1BA7A 4USPA 2ESUA 4GOYA 3O4OA 31BIA 1S0FA 3BA5A 2AFGA 3RTJB 2D7RA 2AQZA 1S0LA 3WINC 4I1EA 5D63A 2RSTA 5JMCA 3CAHA 3CA0A 1BASA 3H6SE 3O3QA 4I4QA 4JPZA 2VSEA 3BA7A 4WBCA 4H04A 5FZUA 5FNXA 2RQ9A 4KEKA 3EF2A 4G6MA 3V0AB 2D23A 3JRRA 2HW9A 4J2XA 3ZXDA 5BXTA 4YOLA 2F2FA 1VCLA 5BP5C 5DUYA 1N4KA 2F8XC 1QXMA 5D61A 3MPPG 3HBWA 1FMZA 4QD2B 1EVTA 2FGFA 4I37A 1FQ9A 2HWMA 2Y9FA 1II4A 1PZZA 4OWKA 3S8KA 4Q9GA 2D7IA 1PUMB 3AKIA 4X39A 2AXMA 3BADA 5BXPA 2WBCA 1ILR1 3CRGA 4H9WA 1FWVA 3P53A 3AH1A 1TTUA 3BRFA 2X2SA 4L4HA 4I4OA 1WD4A 3I2XA 1S0EA 1T9FA 3CRIA 2Y9XE 2VU9A 1SR4C 3NBCA 3BAUA 2QYIB 1ABRB 3AZVA 2KLLA 3VT2A 4LO3A 3R4SA 4JP0A 1YYNA
chains in the Genus database with same CATH topology
3UJ4A 3LTQA 2BFHA 1W3FA 3FJ8A 3FUQA 1G9BA 2D43A 3RMYA 3N7LA 2WRYA 5E24E 3O49A 4XKIA 1AXMA 3CA5A 3FJKA 2VSAA 4LO2C 1G9AA 3WMUA 3MALA 2VLCA 1EYLA 3I2AA 3UD8A 1IT0A 4D0ZA 3AJ6A 4ZFYB 1TWEA 4KBBA 2K4AB 2D20A 4DCKC 2IWTB 4LO1A 2AAIB 3VT1A 3NBNA 4EKXB 3IM5A 4Z8SB 1IOBA 3I29B 2D22A 4IZXA 5B2HA 1FV3A 1XYFA 4A7ZA 4XFSA 1JT4A 2ERMA 2XOAA 3OBRA 1M2TB 4I4UA 3AH2A 4QBCA 2RG9B 4KC3A 3BRDA 3FJAA 4IY9A 3FUOA 1JT3A 5EHAA 1T4QA 2IHOA 1ISVA 1FV2A 3VWCA 1FWUA 4ISQA 1V6VA 4HJJA 3AJ5A 3VUOA 4AN7B 4LO7C 2D44A 3N0KA 4GAIA 3H6RB 1JQZA 4L4IA 1HCEA 2FDBM 4G9NA 3ZC9A 3N7JA 2Z48A 3HOMA 2VXRA 2DS0A 1SZ6B 2Y9WC 1PC8B 4I4VA 3UDAA 4XFTA 3T8SA 3R4UA 3NJ5A 4J2YA 3V0BB 3TC2A 3Q7XA 9ILBA 5HPZA 1XZZA 4HA2A 1FN0A 2LIEA 1J0SA 2X2TA 1TP0A 3VSFA 3WMVA 1HKNA 2F2FC 1HCDA 3QR5A 4GP3A 3B9UA 4EEEB 3FJJA 3FJBA 3BAHA 3PG0A 4H75A 2LIQA 2M49A 3BAVA 3P6JA 3FJIA 3W9TA 4Z9WB 3VEQA 2J3PA 3CQAA 3HN1A 1G82A 2FFUA 1DQGA 1P63A 4GOVA 2MIBA 1IRAX 4LO0C 2VUAA 3VT0A 4X38A 2NP0A 3O4AA 3IM6A 3LLPA 3ZX7A 4HR6C 3BRGC 5BQUA 4I4RA 4QKSA 3BTAA 3V0AA 3IIRA 2Q3NB 4JQ0A 1V6WA 2FFVA 4DENA 4OWLA 4P6AA 1RMLA 3O44A 4P0LA 1BFBA 4GAFA 1S0DA 4GP0A 4EFPA 3RTIB 2R9KB 1JTCA 1Z0HA 3OJ2A 3WA1A 2DREA 1A8DA 3CA6A 7I1BA 4P0JA 5FNWA 2GO2A 1GGPB 1AF9A 41BIA 4X3AA 1Q1UA 4EB2B 3OJMA 3JUTA 2D1ZA 4MZFB 5F8WA 1R8NA 1JT7A 5G00A 4D8HA 1BFCA 3FJCA 5EG6C 4F34A 4I6IA 4I2SA 3HMYA 1PUUB 4D0TA 1AVWB 4ISRA 2BEAA 3HALA 4LO1C 3A07A 4MZHA 4ZFUB 1MD6A 3O4CA 1HWOB 5GAQA 5BXSA 4I3NA 1I1EA 3UJ0A 2ET2A 1YXWA 1ITBA 3P6IA 1YTOA 3BB2A 4ENDA 1BFFA 3A23A 4I4YA 2DRYA 3UD9A 3IAGC 1E0OA 4J2KA 4A7YA 4I4PA 3BAGA 2FO1A 2MLLB 2KI4A 1EPWA 1K5VA 4IONA 1DZCA 4OUJA 2Q9XA 1NZKA 1DQOA 1I1BA 4JRAA 3O4BA 4IHZA 1W3AA 3AH4A 5BOWA 3FJFA 4II0A 3H6QA 1RZOB 4ZLBB 3KMVA 1K5UA 4LO2A 5FZYA 2NS2A 3OBTA 3OGGA 4JKQA 3ZXGA 1HIBA 1DIWA 4OWJA 5FZZA 1CVSA 1WD3A 3Q7YA 3QYDA 1Q04A 2BEBA 1YF8B 1IILA 1BLAA 3CA1A 3PUBA 4MZGB 4PC4A 3CA3A 3FJEA 4USOA 4Q91A 2NYYA 3PMEA 1G9CA 4OW4A 1FGAA 1DFQA 3BA4A 4JKXB 4LO7B 1ISYA 1FMMS 1DFCA 1QQLA 1KNMA 5F8SA 3Q7WA 3NBDA 1UPSA 4LO8B 4I8MA 1WBCA 1S0CA 1NUNA 2NTDA 3H6RA 4I0YA 4A7KA 1IJTA 4QALA 1V6UA 3FGMA 5JLVA 3UD7A 5F90A 4OEEA 1HWNB 2E4MA 1RG8A 3E8LC 4ZA3B 3WO3A 3V0BA 1AVAC 1BFGA 4ZFWB 5BQUC 1BLDA 4R6UB 4IQPA 1V6XA 3RMXA 1AFCA 1WBAA 4Q9PA 4EFRA 4I4XA 4G6JA 3N7KA 1QQKA 3OJVA 1IHKA 4XFUA 2KH2A 4KEIA 4QD2C 2P39A 1OQLB 3D7WB 1L2HA 3FJDA 3FJ9A 3WINA 2VXTI 1AVXB 1YBIA 2K8RA 3BAOA 3BAQA 3F1RA 3A21A 2HZ9A 4LO3C 3S8JA 2I1BA 1TOOA 4QBVA 4UY4A 2YUGA 3C9ZA 1S0BA 3K1XA 3VSZA 1R8OA 3POKA 4QC4A 5BP5A 4I4SA 8I1BA 4LO0A 4F83A 5EC5A 2D24A 3FFZA 2Z49A 4JAWA 1TFMB 4DEPA 2DRZA 3WO4A 4I96A 1Z2VA 4CJMA 3PHZA 1ISZA 2MC2A 1JLXA 2P23A 5I1BA 5BVPI 2L5XA 4G1RA 3CRHA 1IRPA 4IYBA 1JT5A 2KI6B 1EV2A 1Z4SA 4ZGRB 1DLLA 1SR4A 21BIA 4IY8A 2K43A 3N7MA 4IZEA 5F8YA 1RY7A 4EFQA 3IM7A 1G9DA 2NM1A 1DJSB 4QKRA 2GZBA 2ZQOA 1XG6A 2NVHA 3AKGA 5DZUA 3CA4A 1JY0A 4ZKTB 1W3GA 4QO3A 1TIEA 3O5WB 5D62A 4P0KA 1PWAA 1ISXA 5DSSB 3ILAA 4FGFA 1F31A 4AN6A 4ZOTA 1Q03A 2KKIA 2HWAA 2NZ9A 1D0HA 2QN4A 3A22A 1S0GA 1BARA 2Y9GA 3WO2A 1TWMA 2UUSA 4FVVA 4G9MA 3BX1C 3HSMA 4J2SA 3F62B 3NBEA 1HWPB 1HWMB 4X37A 3ZC8A 5BXRA 1XHBA 3SNVA 3OGFA 1ISWA 1ONKB 2ZQNA 3FJHA 4ZBVB 1AVUA 3CU1B 4TLPA 4KEJA 1CE7B 6I1BA 4I1BA 3AKFA 4OEFA 3AZWA 2E4MC 3RSJA 3V79C 5DVHA 1JLYA 4I7IA 4OEGA 1M16A 2ZR1B 1DZDA 1MC9A 4J23B 3AKHA 3O4DA 1BA7A 4USPA 2ESUA 4GOYA 3O4OA 31BIA 1S0FA 3BA5A 2AFGA 3RTJB 2D7RA 2AQZA 1S0LA 3WINC 4I1EA 5D63A 2RSTA 5JMCA 3CAHA 3CA0A 1BASA 3H6SE 3O3QA 4I4QA 4JPZA 2VSEA 3BA7A 4WBCA 4H04A 5FZUA 5FNXA 2RQ9A 4KEKA 3EF2A 4G6MA 3V0AB 2D23A 3JRRA 2HW9A 4J2XA 3ZXDA 5BXTA 4YOLA 2F2FA 1VCLA 5BP5C 5DUYA 1N4KA 2F8XC 1QXMA 5D61A 3MPPG 3HBWA 1FMZA 4QD2B 1EVTA 2FGFA 4I37A 1FQ9A 2HWMA 2Y9FA 1II4A 1PZZA 4OWKA 3S8KA 4Q9GA 2D7IA 1PUMB 3AKIA 4X39A 2AXMA 3BADA 5BXPA 2WBCA 1ILR1 3CRGA 4H9WA 1FWVA 3P53A 3AH1A 1TTUA 3BRFA 2X2SA 4L4HA 4I4OA 1WD4A 3I2XA 1S0EA 1T9FA 3CRIA 2Y9XE 2VU9A 1SR4C 3NBCA 3BAUA 2QYIB 1ABRB 3AZVA 2KLLA 3VT2A 4LO3A 3R4SA 4JP0A 1YYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UJ4 A;  3LTQ A;  2BFH A;  1W3F A;  3FJ8 A;  3FUQ A;  1G9B A;  2D43 A;  3RMY A;  3N7L A;  2WRY A;  5E24 E;  3O49 A;  4XKI A;  1AXM A;  3CA5 A;  3FJK A;  2VSA A;  4LO2 C;  1G9A A;  3WMU A;  3MAL A;  2VLC A;  1EYL A;  3I2A A;  3UD8 A;  1IT0 A;  4D0Z A;  3AJ6 A;  4ZFY B;  1TWE A;  4KBB A;  2K4A B;  2D20 A;  4DCK C;  2IWT B;  4LO1 A;  2AAI B;  3VT1 A;  3NBN A;  4EKX B;  3IM5 A;  4Z8S B;  1IOB A;  3I29 B;  2D22 A;  4IZX A;  5B2H A;  1FV3 A;  1XYF A;  4A7Z A;  4XFS A;  1JT4 A;  2ERM A;  2XOA A;  3OBR A;  1M2T B;  4I4U A;  3AH2 A;  4QBC A;  2RG9 B;  4KC3 A;  3BRD A;  3FJA A;  4IY9 A;  3FUO A;  1JT3 A;  5EHA A;  1T4Q A;  2IHO A;  1ISV A;  1FV2 A;  3VWC A;  1FWU A;  4ISQ A;  1V6V A;  4HJJ A;  3AJ5 A;  3VUO A;  4AN7 B;  4LO7 C;  2D44 A;  3N0K A;  4GAI A;  3H6R B;  1JQZ A;  4L4I A;  1HCE A;  2FDB M;  4G9N A;  3ZC9 A;  3N7J A;  2Z48 A;  3HOM A;  2VXR A;  2DS0 A;  1SZ6 B;  2Y9W C;  1PC8 B;  4I4V A;  3UDA A;  4XFT A;  3T8S A;  3R4U A;  3NJ5 A;  4J2Y A;  3V0B B;  3TC2 A;  3Q7X A;  9ILB A;  5HPZ A;  1XZZ A;  4HA2 A;  1FN0 A;  2LIE A;  1J0S A;  2X2T A;  1TP0 A;  3VSF A;  3WMV A;  1HKN A;  2F2F C;  1HCD A;  3QR5 A;  4GP3 A;  3B9U A;  4EEE B;  3FJJ A;  3FJB A;  3BAH A;  3PG0 A;  2LIQ A;  2M49 A;  3BAV A;  3P6J A;  3FJI A;  3W9T A;  4Z9W B;  3VEQ A;  2J3P A;  3CQA A;  3HN1 A;  1G82 A;  2FFU A;  1DQG A;  1P63 A;  4GOV A;  2MIB A;  1IRA X;  4LO0 C;  2VUA A;  3VT0 A;  4X38 A;  2NP0 A;  3O4A A;  3IM6 A;  3LLP A;  3ZX7 A;  4HR6 C;  3BRG C;  5BQU A;  4I4R A;  4QKS A;  3BTA A;  3V0A A;  3IIR A;  2Q3N B;  4JQ0 A;  1V6W A;  2FFV A;  4DEN A;  4OWL A;  4P6A A;  1RML A;  3O44 A;  4P0L A;  1BFB A;  4GAF A;  1S0D A;  4GP0 A;  4EFP A;  3RTI B;  2R9K B;  1JTC A;  1Z0H A;  3OJ2 A;  3WA1 A;  2DRE A;  1A8D A;  3CA6 A;  7I1B A;  4P0J A;  5FNW A;  2GO2 A;  1GGP B;  1AF9 A;  41BI A;  4X3A A;  1Q1U A;  4EB2 B;  3OJM A;  3JUT A;  2D1Z A;  5F8W A;  1R8N A;  1JT7 A;  5G00 A;  4D8H A;  1BFC A;  3FJC A;  5EG6 C;  4F34 A;  4I6I A;  4I2S A;  3HMY A;  1PUU B;  4D0T A;  1AVW B;  4ISR A;  2BEA A;  3HAL A;  4LO1 C;  3A07 A;  4ZFU B;  1MD6 A;  3O4C A;  1HWO B;  5GAQ A;  5BXS A;  4I3N A;  1I1E A;  3UJ0 A;  2ET2 A;  1YXW A;  1ITB A;  3P6I A;  1YTO A;  3BB2 A;  4END A;  1BFF A;  3A23 A;  4I4Y A;  2DRY A;  3UD9 A;  3IAG C;  1E0O A;  4J2K A;  4A7Y A;  4I4P A;  3BAG A;  2FO1 A;  2MLL B;  2KI4 A;  1EPW A;  1K5V A;  4ION A;  1DZC A;  4OUJ A;  2Q9X A;  1NZK A;  1DQO A;  1I1B A;  4JRA A;  3O4B A;  4IHZ A;  1W3A A;  3AH4 A;  5BOW A;  3FJF A;  4II0 A;  3H6Q A;  1RZO B;  4ZLB B;  3KMV A;  1K5U A;  4LO2 A;  5FZY A;  3OBT A;  3OGG A;  4JKQ A;  3ZXG A;  1HIB A;  1DIW A;  4OWJ A;  5FZZ A;  1CVS A;  1WD3 A;  3Q7Y A;  3QYD A;  1Q04 A;  2BEB A;  1YF8 B;  1IIL A;  1BLA A;  3CA1 A;  3PUB A;  4PC4 A;  3CA3 A;  3FJE A;  4USO A;  4Q91 A;  2NYY A;  3PME A;  1G9C A;  4OW4 A;  1FGA A;  1DFQ A;  3BA4 A;  4JKX B;  4LO7 B;  1ISY A;  1FMM S;  1DFC A;  1QQL A;  1KNM A;  5F8S A;  3Q7W A;  3NBD A;  1UPS A;  4LO8 B;  4I8M A;  1WBC A;  1S0C A;  1NUN A;  2NTD A;  3H6R A;  4I0Y A;  4A7K A;  1IJT A;  4QAL A;  1V6U A;  3FGM A;  5JLV A;  3UD7 A;  5F90 A;  4OEE A;  1HWN B;  2E4M A;  1RG8 A;  3E8L C;  4ZA3 B;  3WO3 A;  3V0B A;  1AVA C;  1BFG A;  4ZFW B;  5BQU C;  1BLD A;  4R6U B;  4IQP A;  1V6X A;  3RMX A;  1AFC A;  1WBA A;  4Q9P A;  4EFR A;  4I4X A;  4G6J A;  3N7K A;  1QQK A;  3OJV A;  1IHK A;  4XFU A;  2KH2 A;  4KEI A;  4QD2 C;  2P39 A;  1OQL B;  3D7W B;  1L2H A;  3FJD A;  3FJ9 A;  3WIN A;  2VXT I;  1AVX B;  1YBI A;  2K8R A;  3BAO A;  3BAQ A;  3F1R A;  3A21 A;  2HZ9 A;  4LO3 C;  3S8J A;  2I1B A;  1TOO A;  4QBV A;  2YUG A;  3C9Z A;  1S0B A;  3K1X A;  3VSZ A;  1R8O A;  3POK A;  4QC4 A;  5BP5 A;  4I4S A;  8I1B A;  4LO0 A;  4F83 A;  5EC5 A;  2D24 A;  3FFZ A;  2Z49 A;  4JAW A;  1TFM B;  4DEP A;  2DRZ A;  3WO4 A;  4I96 A;  1Z2V A;  4CJM A;  3PHZ A;  1ISZ A;  2MC2 A;  1JLX A;  2P23 A;  5I1B A;  5BVP I;  2L5X A;  4G1R A;  3CRH A;  1IRP A;  4IYB A;  1JT5 A;  2KI6 B;  1EV2 A;  1Z4S A;  4ZGR B;  1DLL A;  1SR4 A;  21BI A;  4IY8 A;  2K43 A;  3N7M A;  4IZE A;  5F8Y A;  1RY7 A;  4EFQ A;  3IM7 A;  1G9D A;  2NM1 A;  1DJS B;  4QKR A;  2GZB A;  2ZQO A;  1XG6 A;  2NVH A;  3AKG A;  5DZU A;  3CA4 A;  1JY0 A;  4ZKT B;  1W3G A;  4QO3 A;  1TIE A;  3O5W B;  5D62 A;  4P0K A;  1PWA A;  1ISX A;  5DSS B;  3ILA A;  4FGF A;  1F31 A;  4AN6 A;  4ZOT A;  1Q03 A;  2KKI A;  2HWA A;  2NZ9 A;  1D0H A;  2QN4 A;  3A22 A;  1S0G A;  1BAR A;  2Y9G A;  3WO2 A;  1TWM A;  2UUS A;  4FVV A;  4G9M A;  3BX1 C;  3HSM A;  4J2S A;  3F62 B;  3NBE A;  1HWP B;  1HWM B;  4X37 A;  3ZC8 A;  5BXR A;  1XHB A;  3SNV A;  3OGF A;  1ISW A;  1ONK B;  2ZQN A;  3FJH A;  4ZBV B;  1AVU A;  3CU1 B;  4TLP A;  4KEJ A;  1CE7 B;  6I1B A;  4I1B A;  3AKF A;  4OEF A;  3AZW A;  2E4M C;  3RSJ A;  3V79 C;  5DVH A;  1JLY A;  4I7I A;  4OEG A;  1M16 A;  2ZR1 B;  1DZD A;  1MC9 A;  4J23 B;  3AKH A;  3O4D A;  1BA7 A;  4USP A;  2ESU A;  4GOY A;  3O4O A;  31BI A;  1S0F A;  3BA5 A;  2AFG A;  3RTJ B;  2D7R A;  2AQZ A;  1S0L A;  3WIN C;  4I1E A;  5D63 A;  2RST A;  5JMC A;  3CAH A;  3CA0 A;  1BAS A;  3H6S E;  3O3Q A;  4I4Q A;  4JPZ A;  2VSE A;  3BA7 A;  4WBC A;  4H04 A;  5FZU A;  5FNX A;  2RQ9 A;  4KEK A;  3EF2 A;  4G6M A;  3V0A B;  2D23 A;  3JRR A;  2HW9 A;  4J2X A;  3ZXD A;  5BXT A;  4YOL A;  2F2F A;  1VCL A;  5BP5 C;  5DUY A;  1N4K A;  2F8X C;  1QXM A;  5D61 A;  3MPP G;  3HBW A;  1FMZ A;  4QD2 B;  1EVT A;  2FGF A;  4I37 A;  1FQ9 A;  2HWM A;  2Y9F A;  1II4 A;  1PZZ A;  4OWK A;  3S8K A;  4Q9G A;  2D7I A;  1PUM B;  3AKI A;  4X39 A;  2AXM A;  3BAD A;  5BXP A;  2WBC A;  1ILR 1;  3CRG A;  4H9W A;  1FWV A;  3P53 A;  3AH1 A;  1TTU A;  3BRF A;  2X2S A;  4L4H A;  4I4O A;  1WD4 A;  3I2X A;  1S0E A;  1T9F A;  3CRI A;  2Y9X E;  2VU9 A;  1SR4 C;  3NBC A;  3BAU A;  2QYI B;  1ABR B;  3AZV A;  2KLL A;  3VT2 A;  4LO3 A;  3R4S A;  4JP0 A;  1YYN A; 
#chains in the Genus database with same CATH topology
 3UJ4 A;  3LTQ A;  2BFH A;  1W3F A;  3FJ8 A;  3FUQ A;  1G9B A;  2D43 A;  3RMY A;  3N7L A;  2WRY A;  5E24 E;  3O49 A;  4XKI A;  1AXM A;  3CA5 A;  3FJK A;  2VSA A;  4LO2 C;  1G9A A;  3WMU A;  3MAL A;  2VLC A;  1EYL A;  3I2A A;  3UD8 A;  1IT0 A;  4D0Z A;  3AJ6 A;  4ZFY B;  1TWE A;  4KBB A;  2K4A B;  2D20 A;  4DCK C;  2IWT B;  4LO1 A;  2AAI B;  3VT1 A;  3NBN A;  4EKX B;  3IM5 A;  4Z8S B;  1IOB A;  3I29 B;  2D22 A;  4IZX A;  5B2H A;  1FV3 A;  1XYF A;  4A7Z A;  4XFS A;  1JT4 A;  2ERM A;  2XOA A;  3OBR A;  1M2T B;  4I4U A;  3AH2 A;  4QBC A;  2RG9 B;  4KC3 A;  3BRD A;  3FJA A;  4IY9 A;  3FUO A;  1JT3 A;  5EHA A;  1T4Q A;  2IHO A;  1ISV A;  1FV2 A;  3VWC A;  1FWU A;  4ISQ A;  1V6V A;  4HJJ A;  3AJ5 A;  3VUO A;  4AN7 B;  4LO7 C;  2D44 A;  3N0K A;  4GAI A;  3H6R B;  1JQZ A;  4L4I A;  1HCE A;  2FDB M;  4G9N A;  3ZC9 A;  3N7J A;  2Z48 A;  3HOM A;  2VXR A;  2DS0 A;  1SZ6 B;  2Y9W C;  1PC8 B;  4I4V A;  3UDA A;  4XFT A;  3T8S A;  3R4U A;  3NJ5 A;  4J2Y A;  3V0B B;  3TC2 A;  3Q7X A;  9ILB A;  5HPZ A;  1XZZ A;  4HA2 A;  1FN0 A;  2LIE A;  1J0S A;  2X2T A;  1TP0 A;  3VSF A;  3WMV A;  1HKN A;  2F2F C;  1HCD A;  3QR5 A;  4GP3 A;  3B9U A;  4EEE B;  3FJJ A;  3FJB A;  3BAH A;  3PG0 A;  4H75 A;  2LIQ A;  2M49 A;  3BAV A;  3P6J A;  3FJI A;  3W9T A;  4Z9W B;  3VEQ A;  2J3P A;  3CQA A;  3HN1 A;  1G82 A;  2FFU A;  1DQG A;  1P63 A;  4GOV A;  2MIB A;  1IRA X;  4LO0 C;  2VUA A;  3VT0 A;  4X38 A;  2NP0 A;  3O4A A;  3IM6 A;  3LLP A;  3ZX7 A;  4HR6 C;  3BRG C;  5BQU A;  4I4R A;  4QKS A;  3BTA A;  3V0A A;  3IIR A;  2Q3N B;  4JQ0 A;  1V6W A;  2FFV A;  4DEN A;  4OWL A;  4P6A A;  1RML A;  3O44 A;  4P0L A;  1BFB A;  4GAF A;  1S0D A;  4GP0 A;  4EFP A;  3RTI B;  2R9K B;  1JTC A;  1Z0H A;  3OJ2 A;  3WA1 A;  2DRE A;  1A8D A;  3CA6 A;  7I1B A;  4P0J A;  5FNW A;  2GO2 A;  1GGP B;  1AF9 A;  41BI A;  4X3A A;  1Q1U A;  4EB2 B;  3OJM A;  3JUT A;  2D1Z A;  4MZF B;  5F8W A;  1R8N A;  1JT7 A;  5G00 A;  4D8H A;  1BFC A;  3FJC A;  5EG6 C;  4F34 A;  4I6I A;  4I2S A;  3HMY A;  1PUU B;  4D0T A;  1AVW B;  4ISR A;  2BEA A;  3HAL A;  4LO1 C;  3A07 A;  4MZH A;  4ZFU B;  1MD6 A;  3O4C A;  1HWO B;  5GAQ A;  5BXS A;  4I3N A;  1I1E A;  3UJ0 A;  2ET2 A;  1YXW A;  1ITB A;  3P6I A;  1YTO A;  3BB2 A;  4END A;  1BFF A;  3A23 A;  4I4Y A;  2DRY A;  3UD9 A;  3IAG C;  1E0O A;  4J2K A;  4A7Y A;  4I4P A;  3BAG A;  2FO1 A;  2MLL B;  2KI4 A;  1EPW A;  1K5V A;  4ION A;  1DZC A;  4OUJ A;  2Q9X A;  1NZK A;  1DQO A;  1I1B A;  4JRA A;  3O4B A;  4IHZ A;  1W3A A;  3AH4 A;  5BOW A;  3FJF A;  4II0 A;  3H6Q A;  1RZO B;  4ZLB B;  3KMV A;  1K5U A;  4LO2 A;  5FZY A;  2NS2 A;  3OBT A;  3OGG A;  4JKQ A;  3ZXG A;  1HIB A;  1DIW A;  4OWJ A;  5FZZ A;  1CVS A;  1WD3 A;  3Q7Y A;  3QYD A;  1Q04 A;  2BEB A;  1YF8 B;  1IIL A;  1BLA A;  3CA1 A;  3PUB A;  4MZG B;  4PC4 A;  3CA3 A;  3FJE A;  4USO A;  4Q91 A;  2NYY A;  3PME A;  1G9C A;  4OW4 A;  1FGA A;  1DFQ A;  3BA4 A;  4JKX B;  4LO7 B;  1ISY A;  1FMM S;  1DFC A;  1QQL A;  1KNM A;  5F8S A;  3Q7W A;  3NBD A;  1UPS A;  4LO8 B;  4I8M A;  1WBC A;  1S0C A;  1NUN A;  2NTD A;  3H6R A;  4I0Y A;  4A7K A;  1IJT A;  4QAL A;  1V6U A;  3FGM A;  5JLV A;  3UD7 A;  5F90 A;  4OEE A;  1HWN B;  2E4M A;  1RG8 A;  3E8L C;  4ZA3 B;  3WO3 A;  3V0B A;  1AVA C;  1BFG A;  4ZFW B;  5BQU C;  1BLD A;  4R6U B;  4IQP A;  1V6X A;  3RMX A;  1AFC A;  1WBA A;  4Q9P A;  4EFR A;  4I4X A;  4G6J A;  3N7K A;  1QQK A;  3OJV A;  1IHK A;  4XFU A;  2KH2 A;  4KEI A;  4QD2 C;  2P39 A;  1OQL B;  3D7W B;  1L2H A;  3FJD A;  3FJ9 A;  3WIN A;  2VXT I;  1AVX B;  1YBI A;  2K8R A;  3BAO A;  3BAQ A;  3F1R A;  3A21 A;  2HZ9 A;  4LO3 C;  3S8J A;  2I1B A;  1TOO A;  4QBV A;  4UY4 A;  2YUG A;  3C9Z A;  1S0B A;  3K1X A;  3VSZ A;  1R8O A;  3POK A;  4QC4 A;  5BP5 A;  4I4S A;  8I1B A;  4LO0 A;  4F83 A;  5EC5 A;  2D24 A;  3FFZ A;  2Z49 A;  4JAW A;  1TFM B;  4DEP A;  2DRZ A;  3WO4 A;  4I96 A;  1Z2V A;  4CJM A;  3PHZ A;  1ISZ A;  2MC2 A;  1JLX A;  2P23 A;  5I1B A;  5BVP I;  2L5X A;  4G1R A;  3CRH A;  1IRP A;  4IYB A;  1JT5 A;  2KI6 B;  1EV2 A;  1Z4S A;  4ZGR B;  1DLL A;  1SR4 A;  21BI A;  4IY8 A;  2K43 A;  3N7M A;  4IZE A;  5F8Y A;  1RY7 A;  4EFQ A;  3IM7 A;  1G9D A;  2NM1 A;  1DJS B;  4QKR A;  2GZB A;  2ZQO A;  1XG6 A;  2NVH A;  3AKG A;  5DZU A;  3CA4 A;  1JY0 A;  4ZKT B;  1W3G A;  4QO3 A;  1TIE A;  3O5W B;  5D62 A;  4P0K A;  1PWA A;  1ISX A;  5DSS B;  3ILA A;  4FGF A;  1F31 A;  4AN6 A;  4ZOT A;  1Q03 A;  2KKI A;  2HWA A;  2NZ9 A;  1D0H A;  2QN4 A;  3A22 A;  1S0G A;  1BAR A;  2Y9G A;  3WO2 A;  1TWM A;  2UUS A;  4FVV A;  4G9M A;  3BX1 C;  3HSM A;  4J2S A;  3F62 B;  3NBE A;  1HWP B;  1HWM B;  4X37 A;  3ZC8 A;  5BXR A;  1XHB A;  3SNV A;  3OGF A;  1ISW A;  1ONK B;  2ZQN A;  3FJH A;  4ZBV B;  1AVU A;  3CU1 B;  4TLP A;  4KEJ A;  1CE7 B;  6I1B A;  4I1B A;  3AKF A;  4OEF A;  3AZW A;  2E4M C;  3RSJ A;  3V79 C;  5DVH A;  1JLY A;  4I7I A;  4OEG A;  1M16 A;  2ZR1 B;  1DZD A;  1MC9 A;  4J23 B;  3AKH A;  3O4D A;  1BA7 A;  4USP A;  2ESU A;  4GOY A;  3O4O A;  31BI A;  1S0F A;  3BA5 A;  2AFG A;  3RTJ B;  2D7R A;  2AQZ A;  1S0L A;  3WIN C;  4I1E A;  5D63 A;  2RST A;  5JMC A;  3CAH A;  3CA0 A;  1BAS A;  3H6S E;  3O3Q A;  4I4Q A;  4JPZ A;  2VSE A;  3BA7 A;  4WBC A;  4H04 A;  5FZU A;  5FNX A;  2RQ9 A;  4KEK A;  3EF2 A;  4G6M A;  3V0A B;  2D23 A;  3JRR A;  2HW9 A;  4J2X A;  3ZXD A;  5BXT A;  4YOL A;  2F2F A;  1VCL A;  5BP5 C;  5DUY A;  1N4K A;  2F8X C;  1QXM A;  5D61 A;  3MPP G;  3HBW A;  1FMZ A;  4QD2 B;  1EVT A;  2FGF A;  4I37 A;  1FQ9 A;  2HWM A;  2Y9F A;  1II4 A;  1PZZ A;  4OWK A;  3S8K A;  4Q9G A;  2D7I A;  1PUM B;  3AKI A;  4X39 A;  2AXM A;  3BAD A;  5BXP A;  2WBC A;  1ILR 1;  3CRG A;  4H9W A;  1FWV A;  3P53 A;  3AH1 A;  1TTU A;  3BRF A;  2X2S A;  4L4H A;  4I4O A;  1WD4 A;  3I2X A;  1S0E A;  1T9F A;  3CRI A;  2Y9X E;  2VU9 A;  1SR4 C;  3NBC A;  3BAU A;  2QYI B;  1ABR B;  3AZV A;  2KLL A;  3VT2 A;  4LO3 A;  3R4S A;  4JP0 A;  1YYN A; 
#chains in the Genus database with same CATH homology
 3UJ4 A;  3LTQ A;  2BFH A;  1W3F A;  3FJ8 A;  3FUQ A;  1G9B A;  2D43 A;  3RMY A;  3N7L A;  2WRY A;  5E24 E;  3O49 A;  4XKI A;  1AXM A;  3CA5 A;  3FJK A;  2VSA A;  4LO2 C;  1G9A A;  3WMU A;  3MAL A;  2VLC A;  1EYL A;  3I2A A;  3UD8 A;  1IT0 A;  4D0Z A;  3AJ6 A;  4ZFY B;  1TWE A;  4KBB A;  2K4A B;  2D20 A;  4DCK C;  2IWT B;  4LO1 A;  2AAI B;  3VT1 A;  3NBN A;  4EKX B;  3IM5 A;  4Z8S B;  1IOB A;  3I29 B;  2D22 A;  4IZX A;  5B2H A;  1FV3 A;  1XYF A;  4A7Z A;  4XFS A;  1JT4 A;  2ERM A;  2XOA A;  3OBR A;  1M2T B;  4I4U A;  3AH2 A;  4QBC A;  2RG9 B;  4KC3 A;  3BRD A;  3FJA A;  4IY9 A;  3FUO A;  1JT3 A;  5EHA A;  1T4Q A;  2IHO A;  1ISV A;  1FV2 A;  3VWC A;  1FWU A;  4ISQ A;  1V6V A;  4HJJ A;  3AJ5 A;  3VUO A;  4AN7 B;  4LO7 C;  2D44 A;  3N0K A;  4GAI A;  3H6R B;  1JQZ A;  4L4I A;  1HCE A;  2FDB M;  4G9N A;  3ZC9 A;  3N7J A;  2Z48 A;  3HOM A;  2VXR A;  2DS0 A;  1SZ6 B;  2Y9W C;  1PC8 B;  4I4V A;  3UDA A;  4XFT A;  3T8S A;  3R4U A;  3NJ5 A;  4J2Y A;  3V0B B;  3TC2 A;  3Q7X A;  9ILB A;  5HPZ A;  1XZZ A;  4HA2 A;  1FN0 A;  2LIE A;  1J0S A;  2X2T A;  1TP0 A;  3VSF A;  3WMV A;  1HKN A;  2F2F C;  1HCD A;  3QR5 A;  4GP3 A;  3B9U A;  4EEE B;  3FJJ A;  3FJB A;  3BAH A;  3PG0 A;  4H75 A;  2LIQ A;  2M49 A;  3BAV A;  3P6J A;  3FJI A;  3W9T A;  4Z9W B;  3VEQ A;  2J3P A;  3CQA A;  3HN1 A;  1G82 A;  2FFU A;  1DQG A;  1P63 A;  4GOV A;  2MIB A;  1IRA X;  4LO0 C;  2VUA A;  3VT0 A;  4X38 A;  2NP0 A;  3O4A A;  3IM6 A;  3LLP A;  3ZX7 A;  4HR6 C;  3BRG C;  5BQU A;  4I4R A;  4QKS A;  3BTA A;  3V0A A;  3IIR A;  2Q3N B;  4JQ0 A;  1V6W A;  2FFV A;  4DEN A;  4OWL A;  4P6A A;  1RML A;  3O44 A;  4P0L A;  1BFB A;  4GAF A;  1S0D A;  4GP0 A;  4EFP A;  3RTI B;  2R9K B;  1JTC A;  1Z0H A;  3OJ2 A;  3WA1 A;  2DRE A;  1A8D A;  3CA6 A;  7I1B A;  4P0J A;  5FNW A;  2GO2 A;  1GGP B;  1AF9 A;  41BI A;  4X3A A;  1Q1U A;  4EB2 B;  3OJM A;  3JUT A;  2D1Z A;  4MZF B;  5F8W A;  1R8N A;  1JT7 A;  5G00 A;  4D8H A;  1BFC A;  3FJC A;  5EG6 C;  4F34 A;  4I6I A;  4I2S A;  3HMY A;  1PUU B;  4D0T A;  1AVW B;  4ISR A;  2BEA A;  3HAL A;  4LO1 C;  3A07 A;  4MZH A;  4ZFU B;  1MD6 A;  3O4C A;  1HWO B;  5GAQ A;  5BXS A;  4I3N A;  1I1E A;  3UJ0 A;  2ET2 A;  1YXW A;  1ITB A;  3P6I A;  1YTO A;  3BB2 A;  4END A;  1BFF A;  3A23 A;  4I4Y A;  2DRY A;  3UD9 A;  3IAG C;  1E0O A;  4J2K A;  4A7Y A;  4I4P A;  3BAG A;  2FO1 A;  2MLL B;  2KI4 A;  1EPW A;  1K5V A;  4ION A;  1DZC A;  4OUJ A;  2Q9X A;  1NZK A;  1DQO A;  1I1B A;  4JRA A;  3O4B A;  4IHZ A;  1W3A A;  3AH4 A;  5BOW A;  3FJF A;  4II0 A;  3H6Q A;  1RZO B;  4ZLB B;  3KMV A;  1K5U A;  4LO2 A;  5FZY A;  2NS2 A;  3OBT A;  3OGG A;  4JKQ A;  3ZXG A;  1HIB A;  1DIW A;  4OWJ A;  5FZZ A;  1CVS A;  1WD3 A;  3Q7Y A;  3QYD A;  1Q04 A;  2BEB A;  1YF8 B;  1IIL A;  1BLA A;  3CA1 A;  3PUB A;  4MZG B;  4PC4 A;  3CA3 A;  3FJE A;  4USO A;  4Q91 A;  2NYY A;  3PME A;  1G9C A;  4OW4 A;  1FGA A;  1DFQ A;  3BA4 A;  4JKX B;  4LO7 B;  1ISY A;  1FMM S;  1DFC A;  1QQL A;  1KNM A;  5F8S A;  3Q7W A;  3NBD A;  1UPS A;  4LO8 B;  4I8M A;  1WBC A;  1S0C A;  1NUN A;  2NTD A;  3H6R A;  4I0Y A;  4A7K A;  1IJT A;  4QAL A;  1V6U A;  3FGM A;  5JLV A;  3UD7 A;  5F90 A;  4OEE A;  1HWN B;  2E4M A;  1RG8 A;  3E8L C;  4ZA3 B;  3WO3 A;  3V0B A;  1AVA C;  1BFG A;  4ZFW B;  5BQU C;  1BLD A;  4R6U B;  4IQP A;  1V6X A;  3RMX A;  1AFC A;  1WBA A;  4Q9P A;  4EFR A;  4I4X A;  4G6J A;  3N7K A;  1QQK A;  3OJV A;  1IHK A;  4XFU A;  2KH2 A;  4KEI A;  4QD2 C;  2P39 A;  1OQL B;  3D7W B;  1L2H A;  3FJD A;  3FJ9 A;  3WIN A;  2VXT I;  1AVX B;  1YBI A;  2K8R A;  3BAO A;  3BAQ A;  3F1R A;  3A21 A;  2HZ9 A;  4LO3 C;  3S8J A;  2I1B A;  1TOO A;  4QBV A;  4UY4 A;  2YUG A;  3C9Z A;  1S0B A;  3K1X A;  3VSZ A;  1R8O A;  3POK A;  4QC4 A;  5BP5 A;  4I4S A;  8I1B A;  4LO0 A;  4F83 A;  5EC5 A;  2D24 A;  3FFZ A;  2Z49 A;  4JAW A;  1TFM B;  4DEP A;  2DRZ A;  3WO4 A;  4I96 A;  1Z2V A;  4CJM A;  3PHZ A;  1ISZ A;  2MC2 A;  1JLX A;  2P23 A;  5I1B A;  5BVP I;  2L5X A;  4G1R A;  3CRH A;  1IRP A;  4IYB A;  1JT5 A;  2KI6 B;  1EV2 A;  1Z4S A;  4ZGR B;  1DLL A;  1SR4 A;  21BI A;  4IY8 A;  2K43 A;  3N7M A;  4IZE A;  5F8Y A;  1RY7 A;  4EFQ A;  3IM7 A;  1G9D A;  2NM1 A;  1DJS B;  4QKR A;  2GZB A;  2ZQO A;  1XG6 A;  2NVH A;  3AKG A;  5DZU A;  3CA4 A;  1JY0 A;  4ZKT B;  1W3G A;  4QO3 A;  1TIE A;  3O5W B;  5D62 A;  4P0K A;  1PWA A;  1ISX A;  5DSS B;  3ILA A;  4FGF A;  1F31 A;  4AN6 A;  4ZOT A;  1Q03 A;  2KKI A;  2HWA A;  2NZ9 A;  1D0H A;  2QN4 A;  3A22 A;  1S0G A;  1BAR A;  2Y9G A;  3WO2 A;  1TWM A;  2UUS A;  4FVV A;  4G9M A;  3BX1 C;  3HSM A;  4J2S A;  3F62 B;  3NBE A;  1HWP B;  1HWM B;  4X37 A;  3ZC8 A;  5BXR A;  1XHB A;  3SNV A;  3OGF A;  1ISW A;  1ONK B;  2ZQN A;  3FJH A;  4ZBV B;  1AVU A;  3CU1 B;  4TLP A;  4KEJ A;  1CE7 B;  6I1B A;  4I1B A;  3AKF A;  4OEF A;  3AZW A;  2E4M C;  3RSJ A;  3V79 C;  5DVH A;  1JLY A;  4I7I A;  4OEG A;  1M16 A;  2ZR1 B;  1DZD A;  1MC9 A;  4J23 B;  3AKH A;  3O4D A;  1BA7 A;  4USP A;  2ESU A;  4GOY A;  3O4O A;  31BI A;  1S0F A;  3BA5 A;  2AFG A;  3RTJ B;  2D7R A;  2AQZ A;  1S0L A;  3WIN C;  4I1E A;  5D63 A;  2RST A;  5JMC A;  3CAH A;  3CA0 A;  1BAS A;  3H6S E;  3O3Q A;  4I4Q A;  4JPZ A;  2VSE A;  3BA7 A;  4WBC A;  4H04 A;  5FZU A;  5FNX A;  2RQ9 A;  4KEK A;  3EF2 A;  4G6M A;  3V0A B;  2D23 A;  3JRR A;  2HW9 A;  4J2X A;  3ZXD A;  5BXT A;  4YOL A;  2F2F A;  1VCL A;  5BP5 C;  5DUY A;  1N4K A;  2F8X C;  1QXM A;  5D61 A;  3MPP G;  3HBW A;  1FMZ A;  4QD2 B;  1EVT A;  2FGF A;  4I37 A;  1FQ9 A;  2HWM A;  2Y9F A;  1II4 A;  1PZZ A;  4OWK A;  3S8K A;  4Q9G A;  2D7I A;  1PUM B;  3AKI A;  4X39 A;  2AXM A;  3BAD A;  5BXP A;  2WBC A;  1ILR 1;  3CRG A;  4H9W A;  1FWV A;  3P53 A;  3AH1 A;  1TTU A;  3BRF A;  2X2S A;  4L4H A;  4I4O A;  1WD4 A;  3I2X A;  1S0E A;  1T9F A;  3CRI A;  2Y9X E;  2VU9 A;  1SR4 C;  3NBC A;  3BAU A;  2QYI B;  1ABR B;  3AZV A;  2KLL A;  3VT2 A;  4LO3 A;  3R4S A;  4JP0 A;  1YYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...