4J2OA

Crystal structure of nadp-bound wbjb from a. baumannii community strain d1279779
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
335
structure length
315
Chain Sequence
MFKDKVLLITGGTGSFGNAVLKRFLETDIKEIRIFSRDEKKQDDMRKKYHSAKLKFYIGDVRDYNSILNATRGVDYIYHAAALKQVPSCEFHPMEAVKTNVLGTENVLEAAIQNHVKRVVCLSTDKAVYPINAMGISKAMMEKVMVAKSRNLEGLDTVICGTRYGNVMASRGSVIPLFVDQIRQGKPLTITDPNMTRFMMTLEDAVDLVLYAFEHGENGDIFVQKAPAATIAVLAEALKQLLNVEDHPISIMGTRHGEKAFEALLSREEMVHAFDQGDYFRVPADQDYNSHNTTRLDVEGMKQLLLKLDFVRALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase
publication title Crystal structure of NADP-bound WbjB from A. baumannii community strain D1279779
rcsb
source organism Acinetobacter baumannii
total genus 101
structure length 315
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j2oA01
4CM9A 3WGTA 1SPXA 2IYPA 2QYSA 1WW8A 2Z5LA 3DBLA 3PFFA 4MJLA 2CDBA 4IDCA 5G0WA 4CV2A 4EJMA 4F6CA 1U7HA 3GA0A 5IZCA 1A7KA 2AW5A 1EFKA 2C5AA 2P9CA 4L74A 2H9IA 1U5AA 5JCJA 3H8VA 4Q9NA 4PG8A 2ZCVA 3WMXA 3WIDA 2P5UA 3JQAD 1YJ8A 3WGGA 4BGVA 1TA4A 3WS7A 1E3IA 2Q99A 1XQ6A 4PRLA 3ZWXA 4CLEA 1MXFA 4ONEA 5DOVA 3UICA 2GLXA 1WVGA 3U5TA 4KZPA 3U0BA 1WDMA 4KWIA 3RCBA 3ADOA 4WLFA 4FS3A 3DBHB 3W1VA 4FB5A 1LI4A 3W4IA 5JDCA 2PD4A 4CM8B 3LC2O 4J90A 4DBZA 1M76A 5DNAA 1BG6A 3TN7A 4L0QA 3VPXA 2DM6A 3CUKA 3HN2A 2GN6A 3GG2A 2X22A 4NG5A 4ROSA 4FBGA 1XHLA 4GPD1 4Q3EA 4ILKA 1VI2A 4IJVA 1HZJA 5I9NA 4XJSA 4RF2A 4OSOA 1QYDA 5GY7A 1XIVA 1HTBA 1C0KA 3FR8A 1QYWA 4LN1A 4YJFB 2JAHA 1XCBA 5CDUA 1YWGO 1BGVA 3I23A 4BOYA 1LRLA 1U3WA 2GUGA 2VZ0A 2NACA 3A9WA 4AJHA 3E03A 5B4UA 3GRKA 4AJ2A 1YJQA 1IUKA 1GYQA 4CL3A 2HMUA 3NGXA 3R3JA 2CDAA 3VPHA 3JYQA 1Z74A 4BV9A 1I24A 2EW2A 4CM6A 1GPJA 3C85A 3BMCA 4IUYA 4FGSA 3O8QA 1VE9A 3W6UA 2C0CA 4K9DA 2PK3A 2WTBA 1BW9B 3HUDA 4FFLA 1QORA 4ND1A 4PLTA 1Y1PA 3QY9A 3VKVA 1M6WA 3R1IA 5KKAA 1DRUA 2DTDA 3I52A 3GDGA 5JYDA 2WYUA 2DBQA 1JDJA 4J6FA 4CMCA 4IIUA 3F4LA 3NDJA 1QP8A 5CEJA 5IDXA 1SEVA 5HM8A 1TEHA 4JK3A 3E5MA 4CMEA 3WB9A 1QG6A 1DHRA 4WLEA 1YBMA 4NBRA 4PLGA 2PD6A 3AUSA 4GWGA 4GGPA 3CSDA 1MC4A 3JQ8A 4OO3A 2O3TA 2G82A 2X9NA 5JY1A 3K92A 4L4XA 4E6PA 3WGZA 3L4BC 1EVYA 4INAA 3RC1A 2ZK7A 1GYPA 3DHYA 1JAYA 4E2WA 4OM8A 5C7OO 1NQ5A 5B1YA 2YHUA 3TL2A 3ZHXA 4GX5A 1ISGA 1EK6A 3I9LA 1I32A 3NEPX 2AEJA 1ISFA 2BFOA 4YT4A 1GZ4A 5IZ4A 1HE4A 4PLPA 4R1UA 4HFNA 1GCUA 4NJMA 3SJ7A 3IKVA 3MJCA 4B3HA 2X5KO 2FR0A 3ADPA 3NDRA 4GMFA 5TSDA 2O3JA 3PP8A 4J4TA 3UGKA 3W8EA 3DZGA 3KZVA 1X0XA 5DCYA 5C5IA 5JW6A 2B0JA 1AXEA 3UF0A 3EK2A 2XAAA 4R68A 4Z6KA 4NFYA 3M1LA 1XKQA 4CQMA 2Q2QA 1PGJA 3NJ4A 4JGBA 4WNIA 3WR5A 2VWQA 4GX0A 4GH5A 4ITUA 4Q3CA 1ZJZA 2J3IA 3HFSA 4L76A 3GVHA 4D41A 3E82A 3HE3A 3NT4A 3ETDA 1I36A 4LGVA 3PFWO 4EUHA 4NDNE 4CM3A 1DC4A 2YDYA 3ZWAA 4CQLA 2OORA 3RFVA 4TRRA 2HJSA 3AWDA 4RF4A 1HSZA 2J3JA 4BNIA 3VPGA 4E21A 1C1XA 4YJHA 4OKIA 2JCYA 1YO6A 1IB6A 4FD3A 4GBJA 4P4NA 1O94A 2Q2WA 3DTTA 1R0LA 4NBTA 5BSGA 4NNJA 5COQA 4RVUA 3BMQB 3NV9A 1DIHA 1PWXA 3ZGYA 1MXHA 2PWZA 2Z1MA 3K2EA 4MVJD 4OMUA 1HDCA 3CMMA 4CM9D 2PNFA 2Y0CA 4U8GA 4E2YA 3QJ5A 1A27A 3ASVA 4FR5A 1LU9A 4BO3A 2J6IA 1B8UA 3UFXA 1EBUA 2NM0A 3DHNA 3AU8A 1KYQA 4NK5A 2DFVA 2CVOA 4O6VA 1E3EA 4Y9DA 1LLCA 5JCJD 3JYPA 3AFMA 3HG7A 5A9RA 1C0LA 1P1HA 1UJMA 2QRLA 4FQ8A 3DHEA 4U6SA 1Q1NA 1DIGA 4BUCA 4GI2A 1DFHA 1ULUA 4BHTA 3OIGA 1XG5A 4Z0TA 1X0VA 4C7KA 3V5NA 3H3JA 1B16A 2UYYA 3MCVA 2JHFA 3DFZA 1D4FA 1JWAB 1EE2A 5THQA 4RF3A 3ZV3A 3HB5X 4LISA 1K2WA 4XQCA 1NFRA 2YV1A 4E5PA 1ZH8A 4KTTE 3OA2A 5THKA 2GPTA 3T7EA 1HF3A 3VH1A 4TRJA 3CZMA 4RVHA 5H81A 4ZQFA 4AJEA 1UR5A 2P9EA 2GZ2A 4CJXA 3NTOA 4WCFC 2NQ8A 3AOEC 5A02A 1JQBA 1TB4A 2H6EA 2XOXA 2LDXA 5L4LA 4BNZA 5IXYA 1PGPA 4BNNA 3JQ7B 1Y8QB 4KOAA 1PS0A 4KMSA 4D79A 4A7PA 1BVRA 2GASA 3TRIA 3L07A 2V6BA 3C7CB 3T4XA 1Q0QA 1GUYA 5A05A 4KUHA 4S3MA 3X2EA 1DBVO 1PJBA 1K3TA 3DBRA 4D44A 4BNJA 4AICA 4XWYA 4Z0PA 2YY7A 1V35A 1PU2A 4JJIA 4RJTA 1U4OA 4RV9A 3KYCB 4ZGWA 1U5CA 3CZRA 1SCUA 2WJPA 2I76A 5GZ3A 4FW8A 3GF4A 1E1NA 1I0ZA 3RUDA 1MA0A 4PG6A 4I8XA 1BMDA 1W8DA 4UVEA 4GX2A 4RQTA 3AJRA 1J4AA 5AXDA 5G4KB 3JQEA 4W6ZA 4TWRA 4I5FA 1I01A 4OYRA 5L4SA 1GYRA 1YQGA 3WG9A 3GG9A 2QZZA 4P22A 4O5OA 1DJNA 5KOIA 2EP7A 3LC7O 1XYGA 1PJCA 2GN8A 2JFGA 4NR0A 1VLLA 2OP1A 3G3EA 4L9RA 4ZQGA 5IZCC 4IM7A 1PX0A 4YRDA 3VZPA 4E5NA 3UUWA 3KYDB 3P7MA 2D59A 3EY4A 4WJZA 1YH3A 1Z75A 4CLRA 4TRMA 1DDOA 3VH4A 4UULA 3WQSB 1PS8A 2PGLA 3TOZA 4PLYA 5AXBA 1TXGA 3I1JA 3WX0A 1NYTA 5GZ6A 4FOSA 1XQ1A 1V3VA 4JCOA 4Z9YA 3S2GA 3W4KA 2C5EA 2BGLA 5JE8A 4PIVA 1SB8A 2Q45A 4IDGA 2C20A 1UZNA 2HSDA 5DP2A 3V2GA 1LEHA 1AGNA 4DQUA 1G0NA 1VJ1A 1QV6A 3PQEA 3LT4A 2W98A 4U0JA 1LSOA 1P33A 5L4NA 5F1PA 4CLOB 4E2ZA 4D7AA 2ZJ1A 3I9KA 3JD2A 3UAGA 3WNQA 2Y0DA 5CG2A 4TMFA 1EVJA 1H2HA 1WPQA 5I7FA 3WGHA 1K6JA 4ND4A 3WYEA 1ZNQO 2AEMA 4RZIA 1LDYA 4EGFA 2AEFA 4FDAA 5BQFA 1FF9A 1HWYA 4AJKA 3OEWA 4MVJF 1T26A 3TJRA 5COBA 3KV3O 2OBYA 4J1TA 2Z1NA 4XRRA 5IDWA 2IXBA 2OOSA 4N18A 3BTVA 1NFQA 4OXNA 1P0FA 1PJLA 2ZTLA 3I9MA 2JKVA 2FHSA 2EKLA 4ND2A 2YFHA 3I3OA 4H15A 1OFGA 2CZCA 1OBFO 2NUAA 4BO6A 4MKRA 1EMDA 2YJZA 4HNGA 3RWBA 2TMGA 3RUCA 4G81A 4IQ8A 4J2HA 3SLKA 1Q0HA 4URFA 3QVWA 4HFRA 4EJ0A 4M86A 4RGBA 4BMVA 3AK4A 3E48A 4R9SA 1GU7A 3AI3A 3Q11A 2B5WA 1A71A 3JYNA 5TLSA 3IUPA 3TZHA 4OJNA 3VZSA 4BNUA 3H7AA 4AFNA 2QQ5A 3B1FA 3GC6A 2FP4A 4CMEC 1IL0A 2WE7A 1DB3A 2ZQYA 1VJ0A 3ZH2A 2QRKA 3K96A 4KUEA 5KJEA 1PJTA 1KVTA 2YHIA 2OMEA 3EDMA 3JD1A 1FMCA 3R0IA 4JIGA 1F17A 4OAQA 2XPCA 4WASA 2JD1A 3RUAA 3ZWCA 3CINA 5JPIA 4R5HA 4O0LA 3DEYX 4IDBA 1EBFA 4GKBA 3QV1A 4PLFA 1T4DA 4CMGA 1GEEA 4IXTA 1F8FA 4P4LA 4TQGA 3OEYA 5JFOA 3LSYA 3MJ4A 1ADGA 4B4VA 1EUCA 3RIHA 4M55A 1LDGA 4OHUA 3W4JA 3K6JA 4KWHA 2GR9A 1WLYA 4TRNA 1DOHA 3OSUA 2QIOA 4DC1A 2RIRA 2I3GA 2TMDA 3PQFA 5HBRA 1LLDA 1V8BA 1VKNA 4M54A 1YRLA 2H5LA 3E8XA 3HWRA 4R5MA 4ZD6A 3RQSA 3RC7A 3OJLA 4RCVA 3R3SA 1QXSA 1N2SA 2CDCA 2WMDA 3C7DB 3F3SA 3WNVA 3PHJA 2NU8A 5T8KA 3AOGA 3WGIA 3MJEA 4GAEA 1KVQA 2VHZA 1A5ZA 1X7DA 4GX1A 3WLEA 3C1TA 4YXFA 2EF1A 1CRWG 1GUFA 1FK8A 2POQX 3PJFA 5DP1A 1NWHA 2IDZA 1FDUA 4D45A 4Z3DA 3FI9A 1IE3A 4TKMA 4A10A 1XR3A 4MIOA 4BO4A 4J0FA 4PG4A 1K6IA 4UVGA 3GDFA 3ICPA 4JN6B 2QZ9A 1P31A 3ENNA 2JCXA 4J2OA 3LU1A 4CM5A 2AG8A 4R51A 2WD7B 2SCUA 4CR7A 2OZPA 4QECA 1Z82A 4BB6A 2AG5A 5JLAA 5B37A 4TSKA 4EI2A 2PGJA 2IEBA 1GUZA 1P1IA 2VHXA 4GKVA 1OOEA 1ZK1A 3RASA 5F3RA 1LBEA 1YOVB 4HUJA 1IULA 3WJ7A 3PIIA 2VHVA 1EEHA 2GZ1A 4B7CA 2HMWA 1EVIA 2QRJA 4JNKA 4B8WA 1U3VA 1EDZA 1I10A 7ADHA 3FPCA 1W73A 9LDBA 3INTA 1A9ZA 4WK6A 2R6JA 1UH5A 5L7YA 2BRUA 4F46A 1B2LA 3UCFA 2JD2A 4RL6A 3F47A 2Q3EA 5JAQA 3GZNA 5A1TA 3OQ6A 4DL9A 2HK9A 5T5QA 4FJ0A 2UAGA 2GGSA 3TZCA 4J49A 3NUGA 4QSMA 2VZ9A 4GGOA 4YJDA 4DXHA 2O2YA 4WE3A 4HFMA 1SNYA 4NIMA 1ORRA 1E3LA 5IJZA 1WDKA 4CM7A 2HJRA 4YRBA 4QT0A 4PVDA 2JHGA 1LDBA 2EKQA 1XLTA 3GUCA 1R4MB 3RKUA 2X5JO 1Q7BA 2DC1A 5JDIC 4BNVA 4XDZA 1E3SA 1NVTA 3CKYA 5DCUA 1H93A 3ZWOA 2ZB8A 1AE1A 5CDYA 3IMFA 2WM3A 1Q7CA 4YQYA 4AJ1A 1YDEA 3LC1O 4WNCA 4HBGA 3DZIA 3LVFO 4M49A 4E2XA 1GQ2A 3N74A 1P74A 4UUPA 1CYDA 1B3RA 1XELA 3BIOA 3PRJA 1ISJA 4MIYA 1N9GB 3C7AA 3PIDA 3KEOA 3UW3A 3VH2A 1HRDA 1TLTA 2AQKA 2DPGA 3GPDG 2B36A 3BTSA 4ALNA 2AQHA 2X58A 1O89A 3DO5A 4TKLA 1DAOA 1ZIDA 5ICMA 2I5PO 1B14A 5KVVA 2HK8A 1PZEA 3EW7A 3ITDA 4FJ1A 3B1JA 3TWOA 4XA8A 3D5QA 4ALMA 4GVLA 1HDXA 5F5NA 2I3AA 1P1KA 1HLDA 2I6TA 1F0YA 1O95A 3NAQA 2IZ0A 3PYLA 3COSA 3M2PA 3ANNA 3HADA 3G49A 3N7UA 4EDFA 2LDBA 2EW8A 1HYHA 3PPIA 4AVYA 3H9UA 1N1EA 4HFJA 5DBIA 5LCXA 1C14A 4CM1A 4HADA 2I66A 3FR7A 1P9LA 4XGKA 3DAPA 5EL0A 5G4LA 1RM3A 1UUFA 3PGXA 3EGOA 1UXGA 4AJJA 4BQPA 2CMDA 4UREA 5EQDA 3SBOA 1CF2O 4DIBA 4K6FA 1X1TA 3Q1LA 3KRTA 4BO7A 4RF5A 4B7UA 1NXQA 2PH3A 3NX4A 2VRCD 1M67A 2B83A 5JXWA 3WMWA 3M6IA 4NU6A 3JQGB 1ZEMA 1DIBA 3HQ4O 3UVEA 4ND3A 3DZKA 3NT5A 1EFLA 2Z95A 4CUJA 2NVUA 3OETA 3AM5A 3IS3A 4J1SA 3WBBA 1EUZA 1NVGA 1RJWA 4XDYA 1LDEA 2AA3A 5F21A 2GRAA 1F12A 3A28A 5DBFA 2X6TA 5KWEA 1R4NB 3S2IA 1Y8RB 3TFOA 3ZNNA 4PGFA 2FN7A 2X9VA 3WYBA 3GEDA 4QX6A 1M6HA 4R9RA 2Q4BA 4LCJA 3PVZA 4FSHA 4BNYA 4DPMA 2BI8A 1OI7A 1HZZA 4YJGB 2ZTUA 1J6UA 3FD8A 4R1NA 1G0OA 3PHGA 4X54A 1NPDA 1CEQA 2DTXA 3DMYA 1E3WA 4E30A 1E6UA 3DR3A 1ZSNA 3EZYA 4R16A 3U4CA 2DBZA 3PEFA 5KJFA 1I3KA 1PQPA 1PR3A 1X7GA 1I3NA 1U3TA 2V65A 2Q46A 1EDOA 2FSVA 5FFFA 4C4OA 2B4TO 3VDQA 4PZCA 2F1KA 1KEWA 3A4VA 3QVTA 2O3QA 1HDZA 1NPYA 3MJSA 5A3VA 5TX7A 2J5KA 4IQGA 2RCYA 4CUZA 4DC0A 1U1IA 4DGSA 3PGJA 5JMPA 3VPFA 2R2GA 5KJCA 4Q3NA 2RHRA 1BXGA 4CMIB 3CEAA 4YEDA 3M1AA 3U4IA 3GDOA 3D7LA 3WGOA 1U2GA 3OQ1A 4LK3A 4MVJM 4XIJA 5K6AC 4J7CA 1IY8A 3QHAA 3NYWA 3PLNA 4R3WA 1KVRA 4Y6PA 1HDOA 1JKFA 3UCEA 2NSDA 1S7CA 2ZJ0A 3MTGA 4NK4A 4Q3BA 3WGYA 4A2CA 4BGUA 4FGWA 3TZKA 3KSZO 3H9JA 4R41A 1E3JA 4KQWA 1R0SA 3BTUA 4GL4A 3PYXA 1R0KA 4CV1A 4PLHA 3PWSA 4YR9A 4QFDA 3GR6A 3QVSA 4R3NA 4TZTA 4W9NA 5A06A 3G79A 5IG2A 3NT2A 2X8LA 1ZJYA 1ARZA 1I5RA 4NBUA 1L1FA 1C0PA 1KBZA 1NAHA 5EMHA 1WAMA 2YQ4A 2UDPA 5G0SA 1ADBA 4CL8A 2WWRA 4D3DA 4K26A 4DTIA 3OJEA 1OMOA 1YBAA 2W2KB 5HS4A 4RLSA 3Q9UA 4E33A 3ZHYA 3ZU4A 1PJQA 1MB4A 3JV7A 2Y67A 2NU7A 3KSUA 4ALKA 4OQYA 2EEZA 3A1NA 3D4PA 3ONDA 3BHIA 3RC9A 1SEPA 2DBRA 2GCGA 3UKOA 5BSHA 3QVOA 3BAZA 3JYLA 4OL9A 3AI2A 2BKAA 4IJUA 5U4QA 4OSPA 3V1TC 1I3MA 3WDSA 2X1HA 3FBGA 5IN5A 3NGLA 2B35A 3A14A 4IDDA 5T8KC 1SO8A 3KTDA 4YT2A 3WFJA 2OL4A 2ZB4A 4CM8A 5AXCA 1LQUA 3PWZA 3U62A 4LRSB 1OC2A 1JN0A 1Q2XA 1E6WA 4CMAA 2V6FA 4RVDA 5EESA 3IAHA 4J0EA 4NH4A 3VDRA 3OIDA 1UDAA 3PQDA 2FPPA 3AUTA 2DVMA 3VKUA 1I33A 1JLLA 2PTGA 3PZBA 4YJFA 5LDGA 4KQXA 2OFPA 1NQTA 1F8GA 4XEHA 4YVFA 3DL2A 3DAFA 3H5RA 1NWCA 1TT7A 5JC1A 3KO8A 4JLWA 2E49A 3WWYA 4A5OA 2I65A 1E1LA 3FBTA 4DQVA 4AG3A 1YONA 5LDHA 1VSVA 2X0JA 1XU9A 1AXGA 1KIFA 2JFHA 4XYBA 2UVDA 2EG9A 1LLQA 1BVUA 4RVSA 3S2FA 3ZWBA 4DREA 5AQ1A 4MDHA 3DOOA 1ISIA 1UP6A 5BT9A 1BW9A 1O6ZA 5CAEA 2HQ1A 4Y98A 1BTOA 4LCEA 2UUPA 1GD1O 2NU6A 2JD0A 3IDSA 2WDZA 5TRTA 3LQFA 4Z9XA 2Y1FA 4J4BA 1QRRA 2E82A 4R69A 3QWIA 4TROA 4XX0A 4J1QA 1FXSA 4NHEA 4NJOA 5I7EA 4YAIA 2VRBA 1H6AA 5I8WA 5H83A 3RUFA 1A4UA 1GEGA 3BMOA 4UUNA 3JQDA 5JNLA 3G1UA 4J3FA 1ENOA 4RDIA 4BKPA 1H9BA 1B8PA 1ISMA 2HRZA 1LX6A 5FWNA 3FSRA 1E7QA 4G5HA 1N5DA 1V9LA 1VKOA 3ICCA 4S1VA 3GY0A 3ZN2A 4YRAA 1UZMA 2O50A 3OF2A 2D5AA 3JQFC 4A27A 4ALIA 4RVGA 4U6QA 3Q0EA 3QQPA 1NHGA 4XIYA 4ZVVA 3D4OA 4B4OA 1TVEA 1DAPA 3LT0A 4L73A 5JCXA 4DLLA 2YUTA 3O9ZA 2P2SA 4YDRA 3KOUA 2GD1O 3H9GA 3KETA 3HZZA 4QEDA 2VQ3A 4XZ3A 4EEZA 1VM6A 3F46A 1U28A 5K9ZA 2BMAA 5G0UA 3HN7A 1ZXLA 1HETA 4PLVA 3DBRB 4BV8A 4QUKA 1UP7A 4B3IA 4I5DA 4MKZA 1LSUA 4WECA 4ZA2A 4EZBA 4XR9A 1MG5A 1H9AA 3KYBA 3ZU3A 1VPDA 2GYYA 3BA1A 1X13A 1YQXA 3K2BA 3Q6IA 4UUOA 5IAAA 3RUEA 4UEJA 1ID1A 1RM0A 1CETA 2VUSA 3WXBA 3IQDB 4E12A 3ZU5A 1ZMOA 2ZB7A 3KM0A 2E48A 1QLHA 5ENVA 2NVWA 4OQZA 3EYWA 1LSJA 1J0XO 1GAEO 3GT0A 1B3BA 1ZBQA 3AFNA 1NFFA 4PCVA 2A94A 4BB5A 4BQRA 4BNHA 1N1GA 1ADCA 3BHMA 4IS3A 3O38A 3DMTC 3BMQA 1DO8A 2HRBA 1KC1A 1ZW1A 2OXIA 4MVJE 2A9FA 4JBIA 2OBNA 1KY4A 1F14A 1K89A 4IBOA 3TPCA 1O5IA 2DT5A 3NTQA 1L7EA 3BZUA 1B26A 2FSSA 2O2SA 3SX2A 5U1PA 4NPCA 4AJLA 2FPIA 4RPGA 4E0BA 4PRKA 5CDSA 1IOLA 3LT1A 4IMRA 4IJKA 2Q1TA 3WWZA 3SJUA 3OJFA 1EE9A 5EQFA 1IPFA 1SZJG 4QO8A 4Y67A 5HWSA 4PLWA 1JTVA 3GQVA 1ZXBA 4LMPA 2HAEA 2HK7A 3GN2A 2Q1SA 3OQBA 4RVFA 4XYGA 4CMBA 3TNLA 1P1JA 4HX5A 4YA6A 1UXJA 5B12A 5ICSA 1SAYA 5KTKA 2A92A 4IS2A 2PFGA 4D0RA 2EP5A 2ZTMA 1V3TA 3E1KA 3OA0A 4CM4A 4BNMA 5U9CA 4RPLA 2JCVA 1KVSA 5ILGA 3V1YA 3D1LA 2AE2A 4BNGA 3F1LA 3OM9A 4N5MA 3ZWMA 4LW8A 3AY6A 2HU2A 1D1SA 1VL0A 2PY6A 3JQ7A 1Y8QA 3FHLA 1B8VA 1U8FO 5ADHA 3IP3A 4IJWA 5DULA 5FYDA 2X0NA 2EJWA 4UVDA 4OOEA 1Z7EA 1YB5A 5C7LO 2O4UX 3D3WB 4Q3DA 2NNLD 5JDCC 2D1YA 4WOJA 3PTZA 3BMNB 1GQQA 3FNHA 4M1QA 4FFOA 4A73A 1DC3A 3KYCA 1PJ2A 1PJSA 4YAGA 3VHRA 2ZB3A 4RPJA 3DZFA 1P1RA 2VWGA 2J3HA 3ITKA 5DT9A 4NFSA 2DAPA 2D5CA 8LDHA 3G1TA 3QWBA 5G0TA 4BNXA 4JBHA 3HSKA 3JQCA 4BO2A 1SBYA 1NP3A 1U3UA 5G4KA 2W4QA 3RJ9A 3JQBA 4I5EA 1HDGO 2P5YA 5DZSA 4J1NA 4MO2A 4W9NC 4PG5A 3D0OA 3GHYA 3O03A 4YBZA 3SXPA 1I2CA 3TZ6A 2NQTA 4GWKA 5CPFA 1DRWA 2X0RA 4JX8A 1NQAO 1YL7A 3OECA 1H6BA 2PH5A 2J8ZA 4KDFA 1WNTA 3DZBA 2CY0A 3ZV6A 2G0TA 5ILOA 4JXKA 3X2FA 3KYDA 3WYCA 1YE3A 2P91A 5KVQA 3H4VA 3WJAA 5LC1A 3SEFA 5J23A 3S1LA 3CPSA 4Q3AA 1ZCJA 1XU7A 2G5CA 3GVPA 3STHA 5CEEA 1Y6JA 4P8RA 2EGGA 2HUNA 3GGGA 2EXXA 4YAJA 1SOWA 4KDEA 2HDHA 5HA5A 1C1DA 3QE3A 5A9SB 3GNQA 2FOIA 3I9OA 5L95A 4WEQA 3ROPA 5FF9A 1LC0A 3TL3A 2OO5A 4MVJG 3G17A 2VRCA 1UXIA 3PHLA 4PLCA 3L9XA 5KKCA 1V3UA 3P2YA 4Q39A 5BNFA 5MGBA 2CUKA 3WFIA 3ZWWA 4AL4A 1ZSVA 3H6KA 4MOWA 3IUSA 3JQAB 3NRCA 5A9TA 3RC2A 2Y1CA 4E13A 3I9NA 4KUGA 2WE8A 5DOZA 1PJ3A 3UCXA 4BO9A 2C7GA 2ZYGA 3U3XA 1E7YA 4ZQHA 3RROA 3TQHA 1LXCA 4D42A 4FFMA 1PIWA 1HE2A 2QX7A 3JQ6A 1K6XA 1XGKA 1KERA 2NV6A 3B70A 3C3XA 3QP9A 3VZRA 5FEUA 4XGIA 3QRWA 2GN9A 3UH1A 1D1TA 2PV7A 4BNKA 1ZZEA 4E3ZA 3H2ZA 3OJ0A 3K5PA 4QXMA 1DFGA 3JYOA 3H2SA 2NU9A 1HEUA 2IE0A 3E5RA 3S8MA 1PGNA 4YT8A 2ET6A 1CWUA 4D3SA 1PSDA 2DFDA 3VTFA 3WSVA 2Q2VA 3MWDB 4DQXA 1A7AA 2VYNA 4BKRA 1IZ9A 4ZRMA 5BR7A 4RPKA 2HO5A 2Q4EA 3FRJA 2ZATA 3GUYA 3WTCA 4W7HA 5H82A 1DFIA 3GHHA 4XJTA 2X4GA 3H5AA 3PYMA 3F1KA 1G1AA 1Z7BA 1DEHA 2AQ8A 3M2TA 1Y81A 3I4FA 5KCZA 2X86A 1T1RA 4PG7A 1E6EA 3RJ5A 3HJAA 3TDKA 1EVZA 4CMKA 5IFLA 4FCCA 5KVSA 5BNTA 1U7TA 3KXDA 3VZQA 5BSEA 5C7IO 5JBIA 3F5QA 1F06A 3PJDA 3AW9A 1LLUA 1JVSA 1X14A 2YV2A 1PGQA 1XEAA 1NQOA 3VVCA 4K28A 3F9IA 5T6BA 1N92A 1GPDG 1B0AA 1NHWA 3WQRA 2IODA 4RORA 4Y8VA 2BFAA 3HDYA 3E18A 2DUWA 3RU9A 4M8SA 1EQUA 1TT5B 2H1SA 2ILTA 1LJ8A 3JQ9A 4ZQEA 5CFZA 1KEPA 4D43A 3IOYA 4MIEA 2G17A 4WUVA 1E1KA 4PFJA 1ZK2A 1I2ZA 4ZRNA 1H0KA 4L75A 4J9UE 1T2EA 4FIZA 5A4DA 2Y93A 3GGPA 3K30A 3K31A 2X23A 4WCFB 2D3TA 2WD7A 1LSSA 1QKIA 4E32A 4ZQBA 3S55A 4Y6SA 5CHEA 2NLOA 4BO0A 4II3A 1ENZA 2P9GA 2EHDA 1QLJA 4XQEA 4KP7A 3AUAA 3EAGA 1YOVA 3PXXA 3LF2A 4B7XA 1QYXA 2D2IA 3L4SO 2NVBA 2OUIA 3UXYA 3KLMX 1JW9B 4J43A 1JU9A 3WLFA 4DVJA 1Q0LA 4BGEA 3IJRA 2CVQA 3DB2A 1PL8A 2XXJA 4WGGA 2Y99A 4B3JA 5L45A 5C37A 4ID9A 4UVIA 3DBVO 4HV4A 1EK5A 3ZWYA 3WTBA 2DQ4A 4N7RA 1Y9AA 4YPOA 4L4RA 4R4JA 2E37A 2QYTA 2Y66A 5KNLA 4FFNA 3ON5A 4FN4A 1R4MA 2YQ5A 4MP3A 5BNIA 1AUPA 3C1OA 1E92A 1XDWA 3E9MA 5DN9A 4ZJUA 1VJTA 3DBLB 1CDOA 1AN9A 3AY7A 1HSOA 1E1MA 1YVEI 3ZWNA 3KBOA 1T2FA 1J49A 3FWZA 5EN4A 3EMKA 2O23A 1LRJA 1PJ4A 2WSBA 5TQVA 4ALLA 5AVOA 3AY3A 2VOEA 4WLOA 4XYMA 3GFGA 3FCOA 2DLDA 2RAFA 3GEMA 4I9HA 5IF3A 1W6UA 1N9GA 2ZCUA 4NQZA 4P38A 1I30A 3PJEA 3ZZNA 1ZUD1 1T4BA 3GNSA 5JS6A 2VOJA 3ONFA 3I5MA 5JAMA 2PZLA 4IZIA 1ONPA 4B8ZA 1YKFA 4I5GA 3QW2A 1ZO8A 3B1KA 2BGMA 2IRWA 2B5VA 3WICA 1BXZA 1ONOA 3LLSA 2VTDA 3DFUA 1DJQA 2DUUA 3PDUA 3ZNOA 4BKQA 1UDBA 1I8TA 3RI3A 4BKUA 4YAEA 2ZYAA 1HYGA 4DIOA 4DPLA 1Q7GA 1YB4A 3DQPA 1JVBA 2H63A 3JQBC 3LYLA 5HTOA 1K5HA 4C7JA 3ROMA 1ZKMA 2B69A 3QA9A 5GZ1A 1K0UA 4L8VA 4EITA 4F3YA 5DBGA 4BO8A 4IXWA 4PLZA 3OHSX 3HFGA 1MP0A 2VYND 1XWFA 2EJVA 1PR9A 1JKJA 2G76A 2V6GA 3BMCB 5AOVA 3O8QB 5T67A 3W8DA 3WSWA 2VCYA 2HMVA 3H9QA 1O0SA 2B4RO 1QYCA 3DC2A 1Y7TA 4J4HA 5ES3A 4D46A 2I67A 4U5QA 1HLPA 4UUMA 3QLJA 4BVAA 2RBEA 1H5QA 3JQGA 3I9JA 3CIFA 1PZFA 2A35A 2RHCA 3ZHBA 3Q2KA 4B79A 3ZNQA 2UV8A 3ZU2A 2Q50A 1HXHA 3DAGA 4A0SA 4GVXA 1GTMA 3ORFA 3O4RA 2HCTA 4KTVE 1GFSA 1O9BA 1DRVA 1R4NA 3P2OA 3G0OA 5KIAA 1Y8RA 4ZU3A 3GOHA 1QV7A 3ST7A 3JQ8B 2C7VA 1R6DA 4WPGA 5DDIP 2P4HX 1XSEA 2ZIZA 1X1EA 3ROKA 3MWEB 2B4QA 4HWKA 3WIEA 4BNLA 1KVUA 5ENDA 1JA9A 5CDGA 5B4TA 1R12A 4YJGA 5L7WA 3U09A 4N5LA 2Q1UA 4WLVA 2C59A 2CVZA 3IL2A 1C3VA 5CPBA 3H3FA 2JL1A 1ZK3A 2BF7A 3QVXA 1BWSA 4UEKA 1N8KA 3FTPA 3HNPA 1E7SA 4JP2A 1DIRA 3V2UA 2VT2A 1OC4A 2XF8A 4NJMB 5CEFA 3AI1A 2YYYA 4RLHA 1P3DA 2BFPA 4W82A 4JP3A 2BHLA 2CSUA 3INRA 3CTMA 5DCWA 2W2LD 3C8MA 2J5QA 2FRDA 1PS9A 1G6KA 2BLLA 4MINA 5IDQA 1WXDA 4IINA 3DBHA 3GFBA 4I9NA 4ZN6A 4CQMB 3OICA 1NBOA 1GR0A 1O8CA 4H16A 4J7XA 3BHJA 1HL3A 4CMIA 3KLPX 5EINA 3DONA 5F1KA 4XR4A 3GN1A 3MZ0A 4W99A 4OXKA 3RVDA 1E7WA 4HKTA 3LK7A 4R54A 2D4AA 3JD3A 4DBVO 3DDNA 4OH1A 4PZEA 3FNGA 3E9NA 1GY8A 4CQLB 3HHPA 4J91A 2FR1A 2JJYA 1R37A 1C1XB 4JJGA 4YJHB 3BMOB 1M2WA 4E4YA 5HS6A 5I9MA 4DMMA 3VH3A 1X15A 4NBWA 3RFTA 4YWJA 2QG4A 3I6QA 4I08A 3K9QO 1OZAA 4AJ4A 4DIFA 3ABIA 2PR2A 3W6ZA 5BSFA 7MDHA 1QYVA 3ZWVA 1V0JA 4RO0A 3ONEA 2PGDA 4XB2A 4FC7A 3INGA 2G1UA 4U7WA 4YT5A 1BDBA 2W2KA 2BH9A 3F5SA 2BFMA 5TNXA 1IHXA 1P77A 1OAAA 1FDWA 4AJNA 2JAPA 2AMFA 4R1TA 4EUEA 4AJOA 1ULSA 1D3AA 2CFCA 4UAGA 2UUOA 5JMWA 3QIVA 3QWHA 1IHYA 5L9AA 2HLPA 5ER6A 2AXQA 2RH8A 1Y5MA 5JO0A 5ITWA 3GLQA 5I9LA 3B20A 4BO1A 2GSDA 1N7GA 1E5QA 4AJPA 4RDHA 1A4IA 3JQ9C 1WMBA 2W90A 4NMHA 1PEDA 2X5OA 5JSFA 3JCZA 1PWZA 4R1SA 5EJ2A 1I2BA 3SC4A 5L53A 4J9VA 1UXKA 2VN8A 2VT3A 1Z73A 3ZDFA 5I7VA 2VTEA 3ETEA 3RFXA 3FTNA 2C54A 1BRMA 2GO1A 4E5MA 2YFQA 4IZHA 1A72A 3WGQA 4A26A 1U9JA 3TSCA 1ZEJA 3CH6A 3K73O 5COAA 1EZ4A 2VZ8A 3OFSA 3ZCXA 4OXYA 3EVTA 3SC6A 2ZYDA 3GVXA 4JBGA 2O48X 1DPGA 3MJTA 3FPLA 1H94A 3C1AA 2P68A 2C07A 3HDJA 1XA0A 5I7SA 1ENPA 1V6AA 4CV3A 1YBVA 1Y5RA 5TT1A 2X7HA 2O3UA 2HMTA 5A5FA 1NNUA 5AYVA 4B4UA 3TZQA 5K0ZA 1VL6A 4HY3A 4HP8A 5AXAA 4XQ9A 1L7DA 1GQYA 2PD3A 3IP1A 2YV3A 3L9WA 4Z0HO 1DC5A 4DPKA 2YW9A 4DA9A 1RM4A 3ZHZA 1WP4A 1CJCA 2X9GA 1T25A 2DPHA 2O7QA 1RYEA 4GLLA 1M66A 4MKXA 5TIIA 4QQRA 1ZSYA 4WCDA 3LZ6A 2EWMA 4UEOA 4U0KA 2ZKLA 5JYEA 1VL8A 1R15A 4MPDA 4EUFA 3QSGA 1KC3A 2IEDA 1N7HA 3GMDA 4IQ0A 2EGHA 5JDIA 1ADFA 1GL3A 4QFCA 3L6DA 4Z9FA 4EEXA 1HKUA 5TF4A 4CM4B 3VVBA 1BSVA 1SOVA 2CF5A 4CLRB 1NR7A 4J16A 4PN3A 3RUIA 1E7MA 4OIMA 3FF4A 4WKGA 5TGDA 1MV8A 4YCAA 3T7CA 2PZKA 2Q49A 1PZGA 2I9PA 4IGFA 3V1UA 3E6AA 4RZHA 4LVUA 4IDEA 4RQUA 2GF2A 3ZW8A 4XD2A 5EIOA 2F00A 2DTEA 4MP6A 1H6DA 3OBBA 3JD4A 1R16A 5T64A 3WBFA 2AE1A 3OJOA 3PLRA 1W0CA 5L7TA 1GDHA 2IZZA 3DTYA 4G2NA 4BMNA 4RPHA 4D0SA 4XYLA 4GSLA 2DKNA 3QWAA 1PTJA 4OKNA 1LUAA 4II2A 5C3MA 3ZW9A 3RAJA 1LDMA 4LRTB 2Y1GA 1D7OA 3MEQA 1DIAA 1GV0A 2O4CA 3B6ZA 3EC7A 3OIFA 1E77A 3N58A 4O63O 2R00A 4W7IA 3P19A 1VSUA 2D8AA 2O3SA 5TC4A 1W4ZA 4K6CA 1C0IA 1AHIA 2GN4A 2PKRA 4CMJA 1BXKA 1ONNA 1FJHA 4MVJP 1MFZA 1RYDA 1H6CA 3ROQA 3FN4A 4LMRA 1M75A 2EV9A 2J3KA 3EZLA 3H65A 3Q2IA 3KSDO 2IZ1A 3L77A 3TOXA 1DLJA 5ITVA 1UP4A 2FPGA 2GERA 5EPOA 3GH3A 4FC6A 1P45A 5GMOA 3AM3A 3L6OO 3MOGA 3HB4X 4IDFA 5TT0A 1RWBA 4MVJH 2PKQP 1UDCA 4JQCA 1NM5A 3OMLA 3WQQA 4WOKA 2VUTA 4BGIA 2O3RA 3AM4A 5CG1A 3L6EA 1CQJA 1PQUA 3DZJA 1C1DB 4TVOA 4YQZA 3F6YA 4OOFA 3OP4A 1Z45A 3RBVA 2BD0A 2NTNA 1KS9A 4YACA 2YHIB 1AHHA 3U4HA 1B15A 2EIHA 2I99A 2BELA 5T57A 5KVCA 3PZRA 3BYZA 4D3FA 3BXXA 4XKJA 4L4SA 1FDTA 4JJFA 5L51A 5L40A 1PGOA 3VC7A 5DF1A 3AU9A 1LC3A 1A9YA 3RD5A 2C29D 4CQMD 3JSAA 2NTJA 4R01A 2DBVO 4DYDA 3GVIA 5KJ1A 2Q1WA 3ETGA 4FFPA 4CLXA 3IKTA 3BTOA 3ZI0A 1VC2A 3CXRA 3W8FA 5FI3A 4N5NA 4CR6A 2FR8A 3I4CA 1JWBB 1E5LA 2WYVA 4H7PA 1GADO 4PZDA 4I1IA 1NPTO 5JC8A 1HE3A 3LT2A 5HRUA 2VYVA 3GAFA 4CLHA 4FOOA 1UAGA 4NBVA 4QO7A 3R6DA 9LDTA 4DRYA 1P44A 2YDXA 4MP8A 3VOSA 2OHXA 3D3WA 4PVCA 3D64A 4FJ2A 1E0DA 4CLOA 4WLNA 4EBFA 1RM5A 2DU8A 1EUDA 2NADA 5L3ZA 3BMNA 2VHYA 3O26A 3CMCO 1E7RA 4XCVA 1NR1A 1T24A 3U49A 5K6AA 1SMKA 2ZQZA 3ENKA 4A03A 1HDYA 2Y1DA 3RSHA 4YAKA 3HDHA 4IMPA 3IIEA 1SC6A 4WLUA 3GPIA 5IN4A 3TF5A 2FMUA 1ISHA 2IYOA 5A5EA 5JY6A 1D8AA 1WZEA 4N54A 1KEUA 1BHSA 3UHAA 2FZEA 1JAXA 2C2YA 5IXSA 4BNTA 5CP8A 3EHEA 5I8ZA 2E4AA 3IJPA 3UOGA 1NAIA 1YL6A 1Z6ZA 4CR8A 3PK0A 1LNQA 4DYVA 2D0IA 5ER9A 5JO9A 1TI7A 3FNFA 5F5LA 3ZNPA 4Y6RA 1X7HA 1LRKA 1UZLA 1KEVA 4NI5A 5JAIA 6LDHA 3GRPA 1ML3A 4XRGA 3GZNB 1PQWA 1WDLA 3I6IA 1LA2A 3PJGA 4YTEA 1DXYA 2WD8A 2YZ7A 4CV0A 2HKIA 5A9SA 3PI7A 5G2OA 4DUPA 4BNFA 4ZICA 4F45A 4EYEA 2HMSA 2CF6A 5JAZA 4GQAA 1PZHA 4IDAA 3WOHA 3DZHA 4E31A 1J5PA 1UXHA 4YB8A 3RBZA 2BGKA 3KVOA 2AQIA 3H9EO 3L4BA 4BKOA 3NDIA 4CUKA 4E5KA 3JQAA 3U4DA 1H2BA 1YB1A 2PLAA 4WEOA 1YL5A 1HT0A 1GV1A 1QR6A 3EVNA 4FPXA 3DOCA 1IPEA 4IGEA 4W4TA 3ZV4A 1NASA 2Y05A 2W8ZA 4DMLA 2J5RA 3KB6A 3CE6A 3KEQA 4M89A 2E6UX 1KOLA 4BO5A 1HYEA 1LTHR 2NWQA 2VNAA 3MJVA 3T4EA 2VUUA 3SVTA 1QSGA 3PWKA 2VWPA 3ANLA 4LSWA 5B4VA 3LDHA 6ADHA 3GZ4A 4DLAA 1YQDA 1WMAA 1EQ2A 3QWFA 4XGNA 3RBXA 4Z3KA 2V6MA 1P0CA 1Y9EA 2WEKA 1FDVA 1ZMTA 3NTRA 2RH4A 4G65A 3S2EA 1MFPA 1ZK0A 2OP0A 4LSMA 1LDNA 2X0IA 3P5SA 4IY1A 3PHIA 1YGYA 3H5NA 4CODB 1HDRA 4CMHA 4XB1A 1WWKA 2PZMA 1S6YA 4GLOA 2W2LA 4OGWA 1MLDA 1ZVMA 1LQTA 1HE5A 1SB9A 4EW6A 2OGUA 1IYZA 1KY5A 2GNAA 3ZWPA 4I9UA 3ASUA 5F1OA 4CPDA 1DHTA 3Q3CA 1KETA 4K1LA 4BIIA 1CQIA 3F4BA 3DWFA 3MOIA 4NFHA 3TFQA 1YS4A 5TS3A 3AUUA 1BDMA 4TVBA 1MG0A 5MDHA 4XYEA 3JQFA 5G0VA 3FWNA 3DXFA 3A06A 1QMGA 3D3EA 5IDYA 3JTMA 5TJ9A 4B4WA 1PL7A 1U8XX 3EUWA 4MVJI 3VPSA 5KJ6A 2NVUB 1MC5A 1WZIA 5A03A 2CD9A 1GZ3A 4QTZA 5TJHA 2PZJA 1P1FA 3KUXA 1CIVA 4O1MA 2A4KA 3SLGA 1NX6A 4XQGA 2B37A 4ALJA 2EERA 2PKQO 1GZ6A 2EKPA 1MGOA 2V7PA 1R66A 3KHUA 4GMGA 3NKLA 4TZKA 2JFFA 2VWHA 1ZFNA 4H3VA 2VYVD 1T2CA 2IXAA 4NU5A 1YXMA 3D4NA 4M87A 1DC6A 1U2DA 1U4SA 2FY8A 3V8BA 8ADHA 1TT5A 2QHXA 2FZWA 1T1SA 3L0DA 3NJ8A 2AHRA 4DLBA 2FWMX 3PHHA 1E3WB 3LLVA 1RKXA 1UAYA 1YDWA 1DLIA 4IPTA 4LVCA 5CDTA 3PDJA 2R00C 4ESOA 1B7GO 2C2XA 3D5TA 2VNSA 1NVMB 3ZV5A 3GVCA 3GNTA 4BNWA 3RU7A 4J7UA 4HXYA 4WCFA 4AJIA 3AOEA 3GAZA 1T2AA 1JKIA 4BL5A 4IIVA 2O7SA 3LF1A 3JD0A 5FI5A 3VAZA 2C82A 4CLDA 4JROA 2Y1EA 1I3LA 2VHWA 3K8ZA 5A3JA 4HNHA 4BS9A 3U9LA 2Y0EA 2Y68A 3DMTA 3ULKA 3I83A 2PA3A 2QW8A 3OH8A 1FDSA 4GSKA 2WYWA 4YYZA 3C24A 3IC5A 1ENYA 5EERA 2GZ3A 1BXGB 3VTZA 4F6LA 1VRWA 2NTVA 2ZTVA 4EJ6A 3GGOA 3DOJA 3GMSA 3RUHA 1NTOA 2XXBA 3GK3A 3FNEA 4ND5A 4P4GA 4NZ9A 4ZHSA 1T2DA 1MUUA 5A04A 3Q9NA 1GCOA 2Y1OA 1IZ0A 2CNBA 3V2HA 1DSSG 3HDQA 3ANMA 3MTJA 3GEGA 2P4QA 1MX3A 3RKRA 3UN1A 1CERA 4UVHA 4BMSA 2BI7A 3E9QA 4E5YA 2GDZA 1RPNA 1PL6A 4DWVA 4MVJA 1ZK4A 4O59O 4FFRA
chains in the Genus database with same CATH superfamily
3VSBA 3WGTA 2FQWA 2RH9B 1SPXA 2IYPA 2RK3A 3G2JA 3BRSA 4CV2A 1P8AA 3LQ2A 2CDBA 1CUIA 1ORDA 4IDCA 3H1GA 4BX9A 3GJRA 4I1VA 2J7PA 3KFLA 4KCGA 2WHPB 1EFKA 1KS2A 1U0SY 5CBPB 3VNBA 1WPGA 4LHSA 5JCJA 3VKHA 2WABA 2FR8C 2ZGVA 3H8VA 1LPMA 4AG6A 1NF8A 3ILSA 2P5UA 4AY3A 4JHLA 4F8JA 1KO5A 3ZXUB 4LE2A 4DBLE 3RT9A 2PUJA 5JJKA 3IIMA 4BMPB 1XZFA 3ZWXA 3DG9A 4WZAA 3TYXA 3HBFA 1OVGA 4LNHA 1MXFA 1DWUA 2HDNB 1M6VB 5AJWA 4Q1BA 5D85A 4TMWA 4AUKA 5AO9A 4LZOA 4EATA 2AR7A 3W1VA 1LI4A 2GPSA 4QU5A 4EUNA 3EPPA 1BJKA 3CT4A 3T7JA 3LC2O 3TZLA 4JYBA 5FWDA 1OH7A 5J2UA 2JPDA 4Q7KA 5K99A 1VI6A 3THXA 3CUKA 5FBKA 3D43A 1KYVA 2XADA 4NG5A 2BSXA 4JSYA 3Q5DA 4ILKA 4DCJA 1Y4ZA 4I1RA 1JLRA 2HY7A 2XW6A 3AERA 2B8JA 3FPGA 1YU6A 4TVSA 5LQUA 1AZTA 4KRYA 4MEAA 1P7ZA 5IKPA 3BGDA 1QYDA 1XIVA 3LTNC 2DHCA 3FR8A 1QYWA 2WJYA 1DT3A 4NYJQ 2WHEA 4QNRA 4Y2TA 4B80A 1ZISA 5M7EA 2ACVA 5ECYA 2WRZA 1LRLA 1T6ZA 2ZSAA 1U3WA 2GUGA 3A9WA 3BJMA 3BREA 3GFQA 3KUKA 2ZPUA 3R3VA 1QDLB 1R27A 1Y9DA 1YJQA 1IUKA 2XTAA 4CL3A 5F4BA 1WBBA 3D31A 4LHWA 4RKRA 2O6HA 4INJA 3STYA 1GZHB 1PF7E 4EH1A 4EY4A 5AHXA 4JT8A 4N8DA 2AMLA 4WK0B 3EXFB 4CM6A 2I6FA 2R1VA 1OCEA 1DUIA 4MUYA 3BSWA 2HF8A 4REMA 3SGLA 2ZAGA 4OHKA 1P4HA 4K9DA 4B8YA 3O1JC 1BW9B 3OUZA 4RTKA 3HUDA 1A0OA 4FFLA 5EA2A 1R5NA 4WY2A 4GRAA 3CH4B 1UPTA 3QY9A 2O8EA 1M6WA 1XP8A 2YOFA 5KKAA 7AT1A 3UJ7A 4K05A 2DTDA 1ID8A 2WYUA 3URKA 2O8VA 1BO6A 3ZUPA 4XSVA 2C2OA 2G04A 1SEVA 4EGAA 5I9BA 4JK3A 1TJPB 4EHBA 2HQOA 2ECQA 3COZA 1JXMA 4ZVTA 3WB9A 4I3HA 4XVCA 1C9JA 1XD8A 1DHRA 3TSAA 4QPZA 4NBRA 4F4CA 4FMDF 4PLGA 1CUBA 4GWGA 3COYA 4GGPA 4N6NA 3RPEA 5F3WB 2O3TA 1Z39A 2OAGA 1JHRA 3K92A 1E0JA 4KXWA 5KU1A 1ISPA 3MWEA 2PYIA 3O4IA 3L7JA 3PF9A 3NGMA 3KYJB 4IKPA 2XQVA 4INAA 5TVKA 3WRXC 1KOGA 1WL8A 4CKCB 3DHYA 1JAYA 4TPKA 2FZGA 5LNK1 1NV8A 3M3HA 4HYEA 1VB5A 4AG5A 1D7AA 2GZAA 4PHCA 5EHNA 2ZYSA 3NP9A 4GX5A 1YKSA 2Q21A 1JB1A 2ZJOA 3CJQA 3EVGA 1EK6A 3GLHE 3KYIB 1I32A 3L8CA 3MQ4A 3VR5D 1FLDA 2AEJA 2QMUA 1JGTA 3NEPX 4FHEA 4YT4A 2H65A 4FLMA 3RTEA 2Q5IA 5LXTA 4PLPA 3V1NA 1C9NA 1GCUA 1Z28A 3AX6A 3C16C 3MJCA 3RSGA 4C1NA 4IOKA 1Z15A 2FR0A 3NDRA 4YR7A 2GEJA 4HN2A 1J1UA 2QP9X 3G82C 4N6GA 2JC3A 2O3JA 3A4IA 4QTXA 4AAYA 2QZ4A 4U7TB 1X0XA 5DCYA 1KAQA 5C5IA 2JJ8A 3MXTA 3HXKA 3UF0A 2H54A 3EK2A 1I1NA 2XAAA 4KG7A 3CS3A 3L7LA 1T36B 4LRYA 3PR1A 4ZV7A 1XKQA 2Q4TA 4BX2A 1PGJA 4YCNA 2ASVA 2IPLA 2VWQA 3E1GA 4GX0A 1P0PA 4AZSA 4JL8A 3OPNA 4YP9A 4PFQA 3GVHA 4D41A 3G02A 3HE3A 3CB4A 4LGVA 1Q14A 1E6CA 4NCHA 3MGKA 1VMEA 2DFKB 4MW9A 4CM3A 2FPKA 4UDYX 4PQRA 1PK7A 1PX2A 2YDYA 2DWQA 1CNEA 2OM6A 2WSIA 3F96A 4PINA 3SNHA 4EFMA 2HEIA 2UXDB 1H22A 2UUAB 4ZYYA 5ALKA 4I19A 5K3BA 3SX0A 1BD3A 1Q84A 3E3MA 4OKIA 2OY0A 1SWWA 5HZKA 3T3EA 5LP6C 4K3UA 2Q2WA 4C7XA 1RI5A 4B40A 4NNJA 5COQA 3ZZUA 2ID4A 1DIHA 4EFKA 4R8SA 2AC2A 4A23A 2PWZA 3JQPA 2Z98A 3VR0A 1WB9A 1X7YA 3I3SR 2Q6TA 3ELBA 4DLNA 3S1SA 2QAJA 3QGMA 3DJYA 1N5LA 2CLFB 3CMMA 1BGXT 1RQLA 3FYDA 4RFLA 4CM9D 2YQZA 4R0VA 1NXWA 3AL2A 3EIFA 3QJ5A 4CKWB 1ZMRA 4BCDA 1OFIA 4FR5A 4BO3A 3LYAA 4XVUA 1B8UA 1EBUA 2FPIB 1ZVVA 5KYGA 3PC6A 4LRXA 4NK5A 3CZCA 3GJSA 3SS7X 5DX1A 2I8CA 1O5TA 5FL3A 3ZIAD 3JYPA 3F6PA 2ZAYA 3L79A 3JSXA 3FCSB 4L4ZA 5GM2A 3F7OA 3Q8KA 4TLEA 2QRLA 1N1MA 2JKZA 1DIGA 1WXHA 4GI2A 3DLBA 1DFHA 1OBCA 1G5HA 1L8QA 3JQRA 3CRZA 4QOJA 5B3JC 4LA4A 2G7MC 3PF8A 1MQSA 3FHTA 5GJCA 3PLAE 3FVQA 1B16A 2UYYA 3MCVA 3D8HA 2JHFA 3DFZA 5FOVA 1WM1A 1R0XA 3PC4A 4XVHA 1JWAB 4V24A 4EG7A 3HB5X 3MUFA 4KQ6A 1QH1B 1CY8A 1ND5A 2NGRA 1OLSB 3H16A 2FZCA 1ZH8A 4KTTE 4RH1A 4TXHA 3H8JA 2GPTA 3L6BA 4OEHA 3T7EA 3AEXA 4A91A 3G85A 1B42A 4EVQA 3EG5A 1U2PA 1Z83A 5H81A 2MSCB 3UGTA 5JMTA 4JV5B 4BWFB 1RTTA 1XTZA 2ZPAA 2P9EA 2PUFA 1P4SA 3CV3A 3NTOA 1QM5A 5A02A 4ZAVA 2H6EA 5KQPA 5KNCD 2IS4A 1SUPA 3MMNA 1R2QA 5L4LA 2XZPA 2QJWA 1G98A 2C96A 2IE8A 3G13A 4KSYA 4BNNA 2MSEB 3JRXA 3JQ7B 1Y8QB 4ZDIA 5IXYA 2VC2B 4HQ0A 3DOEA 3SHWA 4KMSA 4TKVA 4DV6B 4R98A 2IH2A 1Z22A 2GASA 3MHTA 2C4HA 2H92A 3RVQA 5IRCD 5ALYA 1GQRA 4B3XA 5CK4A 2ODTX 3T9AA 2XCUA 4LYJA 4KUHA 1BWPA 2PUBA 2JBHA 4ZEXA 3KZKA 1DBVO 1DZIA 4V2IA 2WAOA 3A2NA 3VHLB 1G8YA 2GHIA 4GVPA 2FVXA 3F78A 3OFNA 1S9DA 4BNJA 4E4TA 2C7QA 1XV5A 4M99A 4YPFA 4LOHA 1IU9A 4G4SP 3N9IA 4EHDA 3EC2A 4RV9A 1W1UA 1Z5GA 1BAPA 3H17A 2VQEB 4FYHA 1NY6A 3TNFA 1U5CA 3CZRA 2E0IA 2ZJFA 2HWYA 1T8UA 1V3QE 3LD9A 5GZ3A 3RUDA 1E1NA 2VK4A 1K9SA 3EQ7A 5FAKA 2NP6A 4UVEA 3UMSA 4P3NA 3AJRA 1PK8A 5AXDA 1MEEA 3R7FA 4UNSA 1U2QA 4TWRA 5EIBD 4X7PA 3UGJA 5EYPA 4P2GA 3OZGA 4WZAE 4K40A 3TSZA 2X8BA 2QZZA 4P22A 1M1YB 3FPFA 4O5OA 3RF7A 4BB0A 5BMVB 1AH2A 3UC5A 4TS4A 3GNLA 1P7YA 1NW5A 4HAOA 3KE9A 3KIPA 3AKEA 3BCSA 2OP1A 3H0EA 3R5JA 4L9RA 2RAVA 2VDPB 3FX2A 5FA8A 4REQB 4YIHA 3ENVA 4DCCA 3KEGA 1XZNA 4E5NA 2ZUWA 3P7MA 2PMDA 4DILA 5HIAA 3F6RA 3EY4A 4LBYA 1J8YF 1Z75A 3PDIB 4JFRA 4CEIB 1DI0A 2P9YA 3OOYA 3Q7IA 4YH1A 2Q5CA 1DDOA 2Z3VA 1CQWA 3EGXB 5K3AA 4XOUA 1BZYA 4X94A 1PS8A 2GH1A 1QVWA 4FXOA 4BLWA 2B1GA 2JGLA 3L0PA 1J2RA 4QGBA 4RESA 1NYTA 2VSQA 1SN7A 1ZGHA 3KAQA 2ZDGA 3IPXA 4GRIA 1RLUA 5ABPA 2C5EA 2ERCA 3WDLA 1Z56C 4K86A 2D5LA 4PIVA 1SVWA 1UC4B 2Q45A 4EECA 2OV4A 5IARA 3L8EA 1A2KC 3WZLA 5K09A 4DQUA 1DAFA 3GLIA 5LU9A 2Q8NA 2W98A 1TRKA 5LBIA 1LSOA 1M6YA 2A5LA 2P41A 1VE3A 1Z29A 4TXLA 2XLCA 3SHOA 1M1NB 3I9KA 3UOAB 3WNQA 3U4MA 2E7ZA 1DV1A 4HMPA 3A1EA 3K0CC 2C9ZA 2YV4A 4DSTA 1LB1B 3HU5A 3R5XA 1FFBA 3KQNA 3EVZA 5IYZB 2UZ1A 1ZNQO 3HH8A 3ZJUA 2CUTA 1WKVA 4MYCA 5A0FA 5I5GA 3N6RA 4E14A 1FF9A 1AZWA 4AJKA 1JI3A 1XNRB 1PEAA 1KZ1A 3OEWA 2HTEA 4MVJF 2AN1A 4KO8A 3TJRA 3IOEA 1N8TA 2R1UA 3LX8A 3K71B 4JLDA 3T3DA 2XECA 4ILEA 5IDWA 4CCSA 1DAMA 2Q7DA 1VSTA 3UAZA 4UOZA 5K20A 1XNQB 3WLOA 4PYIA 1OX4A 4CT5A 2OAQ1 1NFQA 4OXNA 2M6RA 5AJYA 3EAFA 2A9RA 2JKVA 2QVXX 4BN4A 1Z25A 1PR1A 1E2HA 1TECE 3UGQA 3UMCA 1ZDMA 1M3SA 3OEHA 3I3OA 4JEIA 5ED0A 1OFGA 2XCTB 5EIXA 1OBFO 4WZBA 1P18A 1EMDA 4MKRA 4HNGA 2INGX 2VK8A 3C7TA 3EWIA 3RUCA 3OTWA 4IQ8A 5C3UA 3IQFA 5GQSA 4AMZA 1G8FA 4HVCA 1Y34E 4EJ0A 5LR6A 5C0OE 1KDZA 4BMVA 2GEKA 4HJXA 3C3PA 2LVBA 5HF9A 3IV9A 3R7SA 3X1MA 1BHJA 2GKOA 2XHEA 3Q11A 5AUNB 4LHEA 5KDLA 1GLNA 3JYNA 4JP5A 3ZX5A 3EPKA 2XBMA 2NU9B 3KQTA 1J06A 2ILVA 2POCA 1TM1E 5IJAA 4C14A 1ZITA 3UY4A 3AR5A 2QQ5A 1H3NA 3VRHA 1DCKA 1JDBC 3CNLA 4WFQA 4AXXA 3MMPA 5JWOA 1SXHA 4CMEC 4D4JA 3JXEA 5J2UF 2XX3A 5LP1A 3M89A 5FBQB 4MW1A 4GZ6A 3PEWA 1KEEA 5F2KA 2BZSA 4KUEA 5DGTA 2W2VA 5CM9C 2OGZA 3IIKA 4DIDA 3U37A 2P4EA 4JIGA 3RUAA 4RFSA 4WASA 4C0HA 1QQTA 2XPCA 4KNVA 2XUFA 3B2EA 1BQ4A 2WBLC 5TVGA 3D6JA 5M3BA 3NXSA 2ZI4A 4PLFA 3V6MA 3N86A 5K6RA 1QQ5A 2WJAA 4CMGA 1RRVA 3ZJVA 2FN3A 1F8FA 1Z13A 3H8SA 4P4LA 2IPAB 4TQGA 3OEYA 5BOVA 3NETA 4UTNA 4IZ6A 1N6PA 5EJMA 4B4VA 1Z2DA 3RIHA 4M55A 3W4JA 2FG7C 2ISSD 3K6JA 4MRPA 2GR9A 1NVVQ 4GC9A 4QVGA 2A3NA 3SAJA 5LQAA 5KTMA 4H17A 2DP4E 2RIRA 1OH8A 2PJRA 2IYEA 1VKNA 1A2BA 4M54A 3QMPA 3KOOA 3IUJA 3SCZA 4C0XA 1RWNA 3FVTA 5ECWA 1ZVQA 3UT5A 3HGMA 4RCVA 3N1UA 3VYSB 1QXSA 3QE2A 1WPXA 1Z0ZA 3LYHA 1CR2A 2CDCA 3O1HB 4M1YA 2MCFA 5TQ0B 3V8MA 4B6FA 5JBQA 3RR2A 3AEQA 3HXQA 2UVPA 2QKYA 5T8KA 2C57A 2VHZA 3KVVA 3S7TA 1A5ZA 2HRCA 1D04A 4MGEA 5IVHA 3WLEA 1Y48E 3ZDDA 1E3QA 1M5UA 5FPSA 1Z6AA 3EXAA 3R6LA 1GUFA 3S68A 1UBLS 3LBAA 3PPYA 1MH1A 3SC2B 3D6UA 1B93A 1ZOLA 2IDZA 1GGJA 1MQ9A 4DQLA 7MHTA 4RA6A 4Z3DA 1EFTA 4Y2VA 1Y89A 1NJ6A 2ZTHA 4EP1A 1XR3A 5J2TB 1DIOB 2JLAA 4J0FA 4BV2A 2I7TA 3TUZC 3GDFA 4BRSA 5KYXB 3ENNA 1P2DA 2O5VA 4IL5A 1G6HA 4V03A 2W6PA 4DM4A 4CM5A 2J41A 4L0MA 4BLSA 2SCUA 4RCYA 3G0BA 2ZP1A 3KLNA 1UFRA 3GROA 1SHZA 4I46A 3VU9A 8AT1A 2H5JA 4A0FA 2AG5A 3AONB 4R1MA 4TSKA 1ELOA 4KGDA 3FOAA 1ECBA 3ZPXA 3WA7A 1GUZA 2W0MA 4ID3A 4TYPA 3RASA 1QFJA 2FW6A 3EQ9A 1Z6QA 2IQIA 3A36A 1HC7A 3VUFA 5KTNA 3LCMA 1G8GA 5HF5A 3TLYA 1E4EA 1EEHA 3V8NA 2HMWA 4RDXA 3M82A 2A88A 4D02A 1U3VA 1OU0A 7ADHA 2W71A 3LQRA 1NQVA 1W73A 3RRFA 5LDDC 1J39A 2V55B 3INTA 3MNFA 2R6JA 5FBWB 5L7YA 2OG1A 2M1XA 3ZCPA 1S2DA 2UVQA 2B7LA 4DUYB 3D9QX 1MZVA 4FX2A 4GW3A 1EB9A 2CNWD 3ADBA 1ZI6A 1YCFA 3GZNA 3OQ6A 2B1IA 3E23A 2HK9A 4KVZA 4DL9A 4RY9A 2OVFA 2OEPA 4G5RA 4H7DA 3VNQA 3K8OE 2PBFA 4J49A 2VZ9A 4GGOA 2G25A 4DXHA 1SU6A 3K9CA 1XVVA 4R9NA 2FK8A 4WE3A 5IW8A 5BR1A 2FEKA 1P5ZB 1YDMA 1UODA 5IJZA 4QRIA 1ST2A 3QSYA 3E7FA 4DCPA 3W04A 1N2IA 1LDBA 1SBNE 1UFKA 3MCTA 4B81A 5EKTA 1MC1A 5TV2A 2CMGA 3P9ZA 2BR3A 4BNVA 2FPUA 5DCUA 1Z5VA 4RHTA 1YCDA 5CDYA 5C4MA 3IMFA 4FMPA 4AYXA 2XY4A 4G0PA 3B6KA 3OPYB 4FI3F 3H84A 3LC1O 4JOBA 1QFSA 4PICA 4E2XA 1I7SB 3A4LA 4ND6A 3N74A 5D7BA 4OI4A 5AVQA 2CV2A 1XELA 2ATVA 3VYTB 1GGKA 4QUJA 4WK2B 3NWBA 5FO0A 3RRJA 1N9GB 2Q4OA 3C7AA 1E0SA 3DKPA 3E7XA 4LWZA 3KEOA 5F23A 3G8DA 4JUBA 2YNMA 3QG5A 2DPGA 1CULC 2IGBA 2Z2JA 5AVJA 5JPCA 4ALNA 4OHXA 1H8EA 1YK1A 5DTEA 2X58A 5CFQA 1O89A 2MDTA 1KFBB 3DO5A 5PGMA 2IY7A 3DFMA 2B7CA 4RW0A 2CXXA 4XSHA 1Z0JA 1RMTA 1XDDA 4NWIA 4Y1GA 7YASA 1DU4A 2XDYA 2H1LA 3ITDA 3RVSA 3B1JA 1JSCA 2IEIA 3EA5A 3D7NA 3D5QA 3ABQB 1T8PA 1AQUA 1HDXA 1RXWA 1NRXA 4L9AA 1P1KA 1H1LB 2F3UA 4JUDX 1F0YA 4Y18A 4BWGA 4ERNA 2BJWA 4FYYA 1VIYA 2IZ0A 1W5FA 4B46A 1JEAA 1ONBA 4EDFA 1JZTA 4Q7LA 4GDMA 3UJAA 3E4CA 1XZLA 2C58A 1AKUA 1W59A 1HYHA 1WG8A 2EHJA 2QRMA 3ILHA 3PPIA 4Q1FA 3TBFA 4AVYA 5LCXA 3DFKA 2IHNA 4HADA 4UTXA 2IKSA 1D5CA 1P9LA 3FR7A 5EL0A 1OKKD 3DAPA 5G4LA 1RM3A 4AI6A 1E9EA 3EGOA 4EMBA 2H7CA 2CMDA 1SA0A 1WCXA 2ACKA 2Z04A 5EJ5A 3RO7A 2HSZA 4PZYA 5EHQA 1UFQA 1CF2O 3OFVA 1T1JA 3GLIE 4MHTA 2VRWA 3AEKA 4TYYA 2C2GA 1X1TA 1TQHA 1GPBA 1J0AA 1R8XA 1JKJB 1RABA 2JFZA 3KRTA 3S70A 2FFAA 4C4YA 2G3YA 2JARA 2N0SA 4M9QA 3ENQA 3NLLA 2V7VA 4FX5A 3AP3A 2QN8A 3N7AA 5FBLB 1JPJA 1OU4A 5HOEA 2OR3A 3P97A 4PAWA 5FHRA 5D7NA 5AVUA 4ZYWA 5ENZA 3UPTA 1EFLA 1ESNA 1Q0PA 2FW0A 2L69A 2YASA 4LPSA 4AZ0A 5DM70 2VJMB 2WWHA 4LYFA 4URZR 4EQZA 4RD0A 3DE2X 2WMNB 1QYRA 5DBFA 5IM4A 1CZHA 2D2FA 5JCOA 2QL9A 2Z56A 4YC7A 4JNCA 2HYIC 1E8DA 3S2IA 3BM5A 3TFOA 2QJOA 4LYHA 5E3IA 4PGFA 3ZNNA 4AKEA 1GNLA 1RHJA 2KHZA 2P75A 4N65A 3TNYA 3DH0A 5KC9A 3VISA 5KCMA 1DCTA 4CWAA 4UM7A 2Q4BA 1C3XA 4DJAA 2CKMA 2HM7A 4WZBE 4YRJA 3EZ6A 1HFWA 4C2UA 1XVLA 1HZZA 1NVAA 2ZS8A 3FD8A 1V47A 3A31A 4BX8A 2AUNA 5B7PA 1NPDA 2CL6X 1OWOA 2QROA 3UATA 4CHGA 5C8DA 2R6AA 3P9CA 4OP3A 3HSSA 1VLJA 1IZ8A 4LBWA 2BGRA 3CURA 5DRTA 2QYOA 1LZLA 2FLKA 2VF7A 1L5SA 3HMQA 5GIPE 1JHPA 2FTKE 4RANA 3NTXA 2X0DA 1CS0A 4KQIA 2P6NA 2WF8A 1CNFA 2PNJA 2FSVA 4BUZA 4EELA 1XAIA 2HRRA 4KQGA 3ZLUA 2PL3A 2XYPA 3A4VA 4BGDA 3QVTA 1UK9A 4PR0A 4JVOA 1VE1A 4IQGA 1J0BA 2YJ6A 1L4KA 4OF4A 2HSJA 4RU1A 2A9KA 2R2GA 4YP7A 5HGXA 2Y71A 3AR8A 1K63A 1SUDA 2PJZA 4IH9A 2VI5A 4LK2A 5J59A 5JSHA 3HACA 3KHKA 2V54A 2CJYA 4JB3A 3TJMA 2HDOA 4GOJA 4OQDA 3WGOA 4RTMA 2OCAA 2EDAA 2WZDA 4Z2YA 3E4DA 3DV2A 1WZCA 4MUFA 5KO2A 2ZJ2A 1HDOA 1JKFA 4DBLC 1KI3A 1S7CA 5EUMA 4A2CA 4BVBA 1B4DA 1AKEA 1QFMA 5JLJA 5KQLA 3TZKA 3V4RA 2G9RA 1U8ZA 3CSSA 2YVQA 3MD9A 4C0LA 1E9CA 1BOOA 3A04A 3I9V1 3IRVA 3PYXA 2KX7A 4CV1A 3PWSA 4EHHA 3GR6A 5A06A 2WD9A 3NBZC 1ESZA 3AB3A 3JY6A 1ZJYA 2BM9A 5IG2A 3KSMA 1I5RA 1C0PA 2VA9A 4DCMA 3BX1A 1NAHA 1PR5A 1WUYA 1MORA 3B1XA 1KI1A 3BXEA 2YQ4A 1E4VA 3CRRA 3MUNA 1KRXA 4PXYA 3B53X 3RAPR 1TTPB 1J8DA 5DMXA 3VBCA 3MFQA 1GT91 3ZCTA 1ABEA 4QE3A 1ADBA 2BFBB 2PVPA 1J0DA 4K26A 4C0WA 5KB3A 2BR4A 1BEUB 2DY0A 4PS0A 4B74A 5J4LA 4P7BA 1XD2B 3QNWA 4TN1A 1CUEA 4YJ2B 1XMOB 4HK4A 2Y67A 1NONA 5JNUA 4OQYA 1FP2A 3A1NA 1YQWA 1O1YA 5CNMA 4UEQA 3BHIA 3VGPA 1SEPA 2I7XA 4GZ5A 2GCGA 5CA1B 1FFDA 3Q12A 3BAZA 2H0RA 5B36A 5YASA 4DF3A 5E1BA 2IITA 2VCHA 5EZYA 3DCIA 2HHJA 1KQPA 5ALZA 1NNLA 1R0CA 3ECAA 5FOQA 3NGLA 1WUJS 3WLLA 2BBSA 3IUYA 3KTDA 2RG1A 3IMEA 1LK7A 4FWIB 2FRVA 2PSEA 3WFJA 4B17A 4CM8A 4G5FA 1HYBA 4EIWA 3I0MA 4KFUA 1P2SA 4WFJA 3GJYA 1GPWB 3DLTA 3PWZA 1WU7A 2JDIA 5ARCA 1R4AA 3U62A 1KL7A 5FWYA 4KOEC 2V6FA 5TPZD 3DM9B 3T9EA 3KKPA 2G8NA 4J0EA 5T7BA 3VPAA 1Z7YA 4AB1A 4TLLB 3KEFA 3PQDA 4X1KB 5CVCA 2FPPA 3AUTA 2DVMA 3VKUA 4U2EA 5IUKC 4N48A 3QVVA 5CX1A 4HAUA 2PTGA 3C3BA 3PZBA 5LDGA 4KQXA 1I4EB 1Q6YA 1W2HA 4HRAA 3ZCVA 4US2R 4UQPA 4XEHA 2DHRA 3HJNA 4MQEB 4PU0A 2R11A 3DAFA 1D09A 3GUVA 2WSSA 1I9GA 2E49A 2Z2YA 4JLWA 3D2BA 1GZ7A 4MV8A 5EXSA 4EY8A 4RZSA 1AXGA 1X1AA 3OLQA 2FXIA 4PGHA 4XYBA 3PT5A 2GI4A 2UVDA 2FUKA 3A27A 4EJSA 4B32A 5BURA 4ASUD 4FKMA 4QG3A 4UHEA 3ZWBA 3EEQA 3FROA 4MDHA 3C5EA 1XPOA 2OC4A 3V4OA 2UYHA 3I30X 1XZDA 2RHLA 2PCJA 2HBRA 3P0RA 4G24A 1O6ZA 1CJUC 2OAP1 5CAEA 1UQUA 4HPXB 2JIZD 2YCLA 2HQ1A 2QRQA 3C14C 5KEIA 3D8NA 3PGMA 5TLSA 3VNUA 2WTUA 3G2OA 4LCEA 2AL7A 5IMBA 5DNCA 3NU1A 1WV1A 1LJLA 3IHLA 2WDZA 3L43A 1RJGA 3LQFA 4RY2A 4UARA 4Z9XA 3KXKA 2E82A 5B2ZA 2G5GX 2ZUBA 3JR3A 4F06A 2DCUA 1HR0B 2GK3A 2RKBA 1D6SA 4UNIA 3ZJYA 1PNRA 4YAIA 1K92A 1PHRA 4QVKA 5AK0A 2G4LA 5H83A 3AUKA 4C7OA 1GEGA 3BMOA 3E2IA 3HPQA 1GVNB 4YMVA 2CDNA 3L41A 3N28A 4J3FA 5KZMB 4NLLA 1ENOA 1E9VA 3PFKA 4P1ZA 3TXAA 1H9BA 4GM0A 1Y33E 4LG1A 1ITZA 2F3QA 1II8B 4NMWA 4UZSA 5CCDA 3SOPA 1UPUA 4OGGA 3UHFA 5EIFA 2NAPA 4G5HA 1VKOA 4NHOA 3SJAA 1WOYA 5FR2A 1FE8A 1NVVR 4UUAA 3EQ6A 4YMGA 4A10A 3HP4A 4L15A 4RTJA 2I3BA 2BEVB 3JQFC 3FUVA 3KQPA 4L3WA 4LOLA 1ABBA 2AEEA 1YZQA 3N0VA 3OZ7A 2FZLA 3ZGOA 1ULAA 3FMOB 1IBLB 2EG5A 4U6QA 5DXJA 2WFLB 2GKGA 5E6RA 4LWPA 2R6GA 1Q0TA 3EY9A 4B4OA 1QGED 4P3YA 5ARBA 4PQFA 2Z6AA 1D2NA 2IW3A 2YN0A 4DLLA 5K8CA 4GR4A 2P2SA 1SVNA 4XXHA 3KOUA 3AF6A 3H9GA 1J8FA 3KETA 1XKTA 4BN0A 1E2DA 4QEDA 4XZ3A 1PFQA 1AKMA 3MJRA 4JOQA 5DE3A 3AUFA 4PC3A 2O5EA 1U28A 5K9ZA 5G0UA 2K5UA 5IT0A 3HN7A 1N57A 3TIFA 5KOHA 1XZIA 1E3MA 2PYZA 4V0SA 2ZJ5A 1M2HA 4JLOA 2P77A 1BHO1 2LNDA 4HGYA 5HDBB 3LWDA 4PYRA 8ATCA 1WXFA 3FOBA 3TBKA 221PA 3RTAA 5LJIA 1O95C 2WU0A 1LNSA 4I1UA 2GYYA 1RIFA 1MIHA 1SVLA 1G8MA 3FCAA 3Q6IA 4LJ6A 4ZO6A 3PI6A 5IAAA 1ID1A 1WU8A 1Z4MA 3FZEA 4DRXB 4HQKA 3A3PA 1THGA 4N12A 4R3UC 3ZU5A 1J7KA 3C39A 4HLCA 1IWOA 3KM0A 2B4KA 4XPIA 3K1YA 1QLHA 3H11A 3M6WA 2NVWA 3NYRA 4OQZA 5DMHA 4HO1X 2C3UA 1I7DA 3ETLA 2WY2D 5K3DA 4EBBA 3V8EA 5KTYA 4TKUB 3T7SA 1GAEO 2PZFA 4H7JA 1B3BA 1ZBQA 5DYGA 4FONA 5ECGC 1CUDA 1AQYA 3CUVA 3HKBA 4PCVA 1WLSA 3ELDA 2W6IA 5H4GA 3SXJA 4FFWA 4M53A 3BMQA 1DO8A 2O0KA 4X63A 4YUAA 3PRYA 3EGVA 3L49A 3PL1A 2FF5A 4FU0A 2VAXA 3KDSE 2A9FA 3M6XA 4JBIA 2QN9A 4MQFB 1DT5A 1KY4A 2O06A 4MLPA 3VSAA 4D6PA 4AT1A 5F78A 3R23A 4Q37A 3OLWA 3Q41A 4UQOA 5CD1A 2WU3A 1SELA 2CFOA 4KHZA 4Q5IA 1DBIA 3SX2A 2DR0A 4N5IX 4YUZA 4NPCA 1KRHA 3BBPA 5FULA 4G0WA 3TD2A 4PRKA 3U6BA 4LCBA 2XLBA 4F2WA 1LCIA 5F5XA 1P81A 3FOFC 2XB2A 2C88A 1QG4A 3P2JA 4Q1DA 1QH9A 4ER3A 4M1KA 3VO8A 1PVOA 3DB1A 4G56A 4RGVA 1LPAB 4G5OA 3P8ZA 2GM3A 3MPUA 4IYRA 5DN6A 1BKSB 4WDQA 1SZJG 3LVRE 3KQMA 4Y67A 5JUWA 3DDUA 3ZTTA 5D01A 3FG9A 4AN4A 4KRGA 4NZOA 2Z57A 1GL7A 4C2BA 3LFUA 1Y5IA 3B1ZA 4RTSA 2JIOA 3JZDA 4ON9A 1XDUA 4QDUA 1UXJA 3T0GA 5CFOA 3NYQA 3JWJA 2ZTMA 3E1KA 1TD1A 3OA0A 4I81A 3HLTA 2ID9A 4BNMA 5ILGA 1KVSA 4FFBA 5C8ZA 3A70A 2GO7A 3Q6MA 4URHA 1Q19A 4ER7A 1YRHA 2AE2A 4BNGA 4LDQA 3IA2A 2ZM6B 4WT7A 3ICOA 2RB5A 3O8NA 1MO5A 4KX3A 4N5MA 1QH8B 2QK4A 2CXNA 3CYFA 2W6ZA 4DT1B 3F5FA 3FY4A 3GRAA 2X13A 2XD4A 1YMQA 1VL0A 4K0KB 4NARA 5E38A 4G5QA 1FSFA 2W2OA 2YBEA 1G20A 2I7VA 3FHLA 2WINI 3O9MA 3CW2A 4S1WA 1AQJA 1RYHA 4LJ4A 3ZK7A 4Z7NB 1PG5A 1GKUB 3IP3A 1MCZA 1SVMA 4MA5A 2EJWA 2I4TA 4QEZA 4H7KA 4DLRA 1PWHA 3TW8B 4RXMA 2DY1A 1YB5A 4CKZA 2NX2A 3TGPA 3GAMA 4ZCMA 1KTVA 4Q3DA 2NNLD 3ORRA 1UT5A 4H1TA 1KY3A 2W6JA 5B30A 2FX5A 2L19A 4KMRA 2TECE 1EUDB 4G0XA 4GOLD 4ZIRA 3BG5A 3BMNB 4F2GA 5JSZA 1RXVA 1SCAA 4M1QA 1SOUA 1FRVA 1PJ2A 4FMDB 2H29A 1IG3A 1JG4A 2A0KA 1S96A 2ZJ7A 4RMGA 3CSUA 2QM0A 1QO0D 1EFRD 4M0LA 1DXQA 3R0ZA 5FBRB 1P1RA 2VWGA 2J3HA 3ONVA 1CR1A 2DKOA 3FTDA 4I9GA 5DT9A 2QD4A 3SE7A 4DXDA 1N2BA 1RHQA 8LDHA 1J0EA 2OSVA 1RKBA 1WTCA 2C97A 1WZ2A 1SBYA 4ZMSA 4A6EA 2NPFA 1KSJA 3DMNA 4XIGS 4FXPA 3A9RA 3JQBA 4OQQA 5FLYA 3ZWQA 1HDGO 4GR9A 1Z4PX 5E2BA 1XF9A 4J1NA 4BXOB 3CRMA 3I2GA 3NANA 1KMIY 4NEQA 4D4KA 1I2CA 3TZ6A 1UM8A 3G0DA 3IPYA 1DRWA 3ZBUA 2AJ8A 3U3JA 1X8KA 2X0RA 2MMCA 2WYIA 3V8QA 4XUEA 3ZV6A 1WNTA 1KGSA 5TXGA 1I2MA 4JXKA 4IH4A 3L7OA 3GEEA 4EHKA 3KYDA 3WYCA 5ADVA 4NAHA 1IAVA 2P9FA 1F2UB 3BERA 3ZE2B 4RHYA 1YS1X 3IURA 4ZCSA 5LC1A 2BKUA 4OHCA 3WJAA 1Q0SA 5EGSA 4A16A 3TJZA 1PVVA 4H60A 4MV9A 4F4HA 3CPSA 5CEEA 1Z0FA 2OHFA 3QKSB 4LRWA 5ALNA 4Q16A 3T3HA 4ENRA 4H6VA 1E6LA 4XGRA 2HGSA 2HUNA 3SOZA 2FOXA 5LFAA 1ESMA 2V7XA 4YAJA 3KTOA 3PG5A 2HDHA 2W00A 2YMQA 1EXNA 1L4GA 1W46A 1ZJWA 3QE3A 2VK1A 1RFLA 5A9SB 2GFQA 2FOIA 3I9OA 5CA0F 1QKJA 3BZBA 2VP0A 5H0IA 5K45A 2X6RA 3W77A 3QFHA 2KSQA 3GFVA 3TL3A 4OMFG 2RI1A 5JXIA 1BU5A 1H5UA 3HL0A 4NV3A 4YALA 3LO8A 3Q2OA 5J1TB 4GPBA 3PHLA 3FYUA 5E2IA 4CTOA 1XTRA 1JFRA 1KE1A 5HP4A 1I3OA 2OCPA 4ABYA 2CUKA 2JLXA 1T8TA 2BUAA 2WPDA 3GV0A 3KKQA 2AOVA 3ZWWA 1JHAA 5FLEX 3GZJA 3IXLA 2WDPA 1YDHA 4E13A 3AINA 3O2QB 1RE0A 1K3UB 1B74A 3HJUA 4N3GA 5CURA 1SVKA 3T9CA 4O1HA 4L07A 4QYWA 2RK4A 3QKIA 3THYB 1IBKB 1SY7A 1OYYA 2PS0A 3QPDA 4OQLA 4ZQHA 1U8UA 4MYRA 1K4MA 4D42A 5HF8A 3GFFA 4FEGA 2W11A 3G0HA 1XGKA 4ZCRA 3KT3A 4KE8A 2NV6A 1ZCZA 3PR3A 3B70A 2XTZA 3VZRA 1CUYA 3SP1A 3TX2A 3SQWA 4FCVA 2IGTA 4ZALA 3CLUC 3F3YA 2VP5A 1W47A 2CNLA 4UEKA 1T5BA 1SXQA 1S1CA 1T8SA 4E3ZA 1V96A 4JI5B 5BRJA 3A6GA 1SQSA 3TOCA 5EZYF 1EVQA 5GONA 5IUJC 2P11A 5AJTA 1DXOA 3H2SA 3O7WA 1QUEA 2WUDA 4FGLA 2AX4A 3ZIUA 3WSTA 4PQGA 1VPTA 1D2GA 3WWDA 4C21A 1A9RA 4KXFB 1F2DA 3F6SA 4JR0A 1K6EA 3TRJA 2I2FA 1JIXA 3L6CA 3IR5A 1XMQB 3HTXA 5A6SA 1GPUA 4YMWA 3JVIA 3VGJA 5BR7A 1KZYC 3RRNA 3GCZA 3UMJA 1H2EA 4FI3C 1P5RA 3P26A 4EZEA 3LXRA 1H65A 3GHHA 3L0YA 4G97A 3I2KA 3KT6A 1ONSA 3PYMA 5FL7D 1G1AA 1DEHA 1XVAA 2F1OA 3ICEA 4JZYA 3S8EA 3LLCA 1QTIA 1QK3A 1Y81A 3I4FA 3HGQA 4YMHA 3LI2A 1E6EA 1QPBA 2KWIA 1I4LD 2EGUA 3HJAA 3TDKA 2WOOA 5D87A 4EB8A 2LE0A 4RA9A 5JWHA 3I39X 4LX8A 3JRNA 2JK0A 3DWIA 3KXDA 2J1LA 4MPJA 3SZOA 1SK9A 3II6X 3QTLA 3AKZA 2BBTA 5DLYA 2GXUA 2HXGA 1PGQA 2IBTA 1TO1E 3KJNA 5A62A 3L0IB 1XRMA 2OFFA 2GBLA 2Q6VA 1C7FA 1JEEA 3IULA 4Q3LA 1N92A 4MVYA 4GEGA 4ZQIA 1B0AA 3QKWA 3WQRA 2IODA 4Y8VA 4Q66C 2XH8A 4YMSA 1DDGA 1CUSA 2BFAA 1TZ2A 3HBAA 1JF8A 3E18A 3W05A 4JC8A 7ABPA 4A36A 1EQUA 1TT5B 2H1SA 1M2VA 1XRSB 2ILTA 3O1LA 4D1YA 5KNBD 1Q3KA 1JSZA 3B1WA 3IT0A 3R8XA 2YKGA 2IF2A 5FTWA 1PZXA 4N0MA 1DTSA 4ZKDA 3WKDA 2YZ2A 4MIEA 2YZNA 3IE0A 3ACBA 3UJCA 1KFJB 4FDMA 1BKDR 4UZEA 3CLSC 2A9QA 2DE0X 3ZBQA 1Z6TA 4J9UE 1F0NA 2BGIA 1T2EA 3E0QA 4ER0A 4YUYA 5A4DA 3GGPA 2C8LA 4CE6A 4M76B 2X23A 2O07A 4WCFB 1DQNA 2VJKA 2WD7A 3SHFA 1CZRA 4KPEC 5FADA 3JWIA 5HKKD 5LQMA 4CKBA 2P6PA 4XWGA 5CHEA 5JTTA 3NHJA 1NBMA 1O54A 2YJ4A 3RC8A 1ENZA 3AUJB 2FEWB 1Y3HA 4TV9B 4GI5A 2I54A 1F4LA 1KNXA 1JHOA 1YOVA 1WZNA 3DOFA 4B7XA 2ONCA 1QYXA 3IEKA 5KKNB 2OB2A 2W6OA 1JW9B 5E9WA 5B3LA 1VYUA 3WLFA 1UAAA 1Q0LA 4BGEA 2FW9A 1BS1A 2WC1A 3HR7A 3IJRA 5DJ5A 4E11A 2Q7XA 4CF7A 2CVQA 3I01A 2N3ZA 2I6SA 1XRJA 4ZP1A 2HK6A 3RVRA 4CT4B 10MHA 2XXJA 3FHJA 2Y99A 5EXEA 3U6KA 4FOTA 2WJIA 4ZZ0A 4UVIA 5JRDS 5LQJA 2AJCA 4GS5A 4KX5A 3JWEA 5TPWB 2CB9A 2N46A 2CHEA 1VHQA 2Y1LA 4JVSB 4UDOA 2PUDA 3KKLA 1OFHA 3DTVA 3L7YA 4NPHA 3OTOB 5LQDA 1Y9AA 3A1UA 2D06A 4L4RA 4RTPA 1DKRA 3ILXA 4ZWNA 5KOYA 5KNLA 1G20E 1TYZA 2MINA 4OJQA 3IEVA 4RMNA 1NW3A 2JJ1D 1REQA 3OJCA 2CL0X 2OZVA 4G5SA 8ABPA 3HR8A 4NECA 1VKHA 4WBXC 5C1IA 5C7IO 1J70A 3KL4A 1PSWA 1YVEI 4R1OA 3IEIA 2B99A 2GBFA 1KQOA 4K6GA 5G1OA 1J49A 2PLRA 2ORED 4HLUA 1L4UA 2NSLA 3EE6A 3O8BA 2PX4A 2YINC 1JA0A 1NXTA 4EMTA 1ILEA 4YRLA 1RQNA 1CBUA 5CRIA 1CUHA 4KQJA 4ALLA 3V8RA 4XYMA 1U1FA 4WUTA 3W9BA 3FCOA 2H0AA 2RAFA 1UWVA