4J32B

Structure of the effector - immunity system tae4 / tai4 from salmonella typhimurium
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
100
Chain Sequence
QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Toxin/inhibitor
total genus 37
structure length 100
sequence length 101
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4j32B00
4AX2A 4J32B 4J30B 4B6IA 4HFKB 4HFFB 4JURI 3ZIBA
chains in the Genus database with same CATH superfamily
4U5GA 1VTMP 2WB7A 3RFYA 3FOOA 3T9OA 2TMVP 3LEOA 3T4RA 3MBGA 4JEAA 1ORYA 1VOMA 3AG2C 2R7VA 1LS1A 2XLOA 4JURI 3C8GA 2KK1A 4WJ0A 2ZXRA 2M4EA 1K05A 1UG7A 2KNHA 5KYNA 3ZC4A 3C62A 3CSKA 1OKKA 2XLVA 1CGOA 3ECSA 3X1OA 5COMA 1TQGA 1EQ1A 2J46A 3C8GB 4N06A 4P6IC 2OCCC 3EPVA 1YJGA 3SXMA 3KL4A 5CI8A 4R32A 3AG4C 3HNLA 3NKDA 4I1MA 3VM6A 5JP7A 2GDCA 2EPLX 2YZSA 2BE5F 3AQCA 5KYUA 2AU5A 1C03A 2Q00A 1JMWA 2XL8A 4CS7A 3AQBA 4Q5SF 3GM1A 4EIYA 4YT5A 1Q0KA 4NTBA 4XTKA 1TWGA 3K33A 3IQCA 1FNTc 1QSPA 2FAPB 2YLDA 3HNKA 1YZCA 1RXQA 3W2WA 3GWNA 4DRHB 2VC9A 5KYUB 1FAPB 4ANJA 4U5FE 3BEHA 5B3SC 2ICWG 2DI3A 2B0JA 3L34A 3TQOA 2Q9CA 5DLJA 1O3UA 1M2OA 4CDVA 2YL0A 2CYDA 2W4MA 5KYXA 1QKRA 2GWWA 1VYIA 2L9JA 3ASOC 4JIOA 4Z9JA 5HV9A 2PF4E 3PHF2 3B29A 4CDAA 4IB4A 3GM3A 4BJ5A 3F47A 3G4ZA 2H8AA 5JLIA 4CX9A 2NSFA 3KH2A 3SEOA 3LNRA 4O79A 3JCUQ 1UFBA 4FAPB 3RH3A 2NG1A 3L8IA 4XQ1A 4H4KC 2EPNA 2J7PD 3K1IA 5KYXB 2XM4A 1FMVA 4XEFA 3DKAA 3M4CA 4LDQA 3R7CA 3FOPA 3S0XA 3ITFA 3OEOA 3IQ6A 1LIHA 2D4UA 2A6EF 2DGJA 1WGWA 1VMAA 2OOCA 3EH1A 3C7JA 4YL0A 2CNWA 3GEIA 4JZAA 2OEXA 3WHNA 4HE8D 4BJ6C 4NCQA 3PCVA 4DRJB 3IEEA 5EHHA 5HSWA 3PDMP 2R7XA 2PBEA 4MTGA 3ZWIA 2RD9A 1ORSC 5AC4A 4OIPF 1C17M 3QW1A 3C8ZA 3GODA 1QPUA 1EKYA 3IQTA 2G3VA 2OJQA 2EIMC 1MQVA 1OQCA 2ZD9A 2A6HF 2R02A 3GM2A 3M15A 4JCHA 1ZU5A 3HJCA 3CEXA 1M6TA 2QUPA 3EJNA 2MWQA 4EBBA 4CS9A 4EWCA 1MNEA 1MNDA 4RD9A 2R7QA 5DQZA 3JSZA 1NU9C 5A6JA 5L0JA 1Y6DA 5AC5A 2XLDA 1KU2A 1U6HA 2QLAA 3J06A 1IW7F 1Z3IX 3N24A 3LNMB 1U89A 4IWBA 1OCZC 2CCYA 3QVZA 3CAXA 4JEBA 3N0TA 4NC3A 2DYSC 2LIGA 2J9BA 3KYJA 3VYWA 1Q0FA 4LERA 5FZTA 2NUPA 1XWJA 4CIPA 4J7TA 1K40A 2H7VC 2EPKX 3ZTZA 4O6NA 1RKEA 2R25A 4DBQA 4XLPF 1NFNA 3RKOF 3SYNA 1HE9A 3V5XA 4CJGA 2P61A 4A4AA 4O6YA 4QI0A 2J0XA 1YYJA 4BPMA 2NUPB 2EPMX 3LS1A 4C7OA 2XLMA 2Y39A 4RDAA 2YWAA 2ETSA 3T6GB 3U2MA 4AK9A 4BEMJ 1GQAA 1RKEB 4NQFA 1E2XA 3NYMA 4J32B 5D92A 3TJ5A 3EGDB 5T3TA 1YLMA 4OD5A 1OCOC 5B1AC 3U8PA 3W2VA 3K66A 1BR2A 1JOGA 3IQ5A 3FHDA 4MW8A 4DXWA 5JVEA 5A69A 3LUTB 1RMVA 1QVXA 2GA0A 2IXOA 3NMJA 4MVZA 4XWJA 3TULA 1YA9A 2IOQA 4IJJA 1WOLA 2R7OA 1F1MA 4YK5A 3DZAA 3L1MA 3VRCA 2LK4A 1M57C 2BC5A 1H7IA 1OR2A 1LI5A 2J45A 2YL3A 4NTFA 3AOUA 3H65A 4PFOA 1YAUO 2YVKA 1OW6A 2JX0A 1G4US 4BJTA 1NFOA 2XL6A 2Q9BA 2VCBA 5E3AA 2JD3A 2KSFA 2C04A 4J30B 1JRAA 1YVIA 1BBHA 1FMWA 1RCPA 4YWQA 2P1AA 3MX3A 1BR4A 3V5YA 2E87A 3FDQA 1RJ9A 2OJED 3HNJA 3UNGC 2JPUA 1CGNA 5E2QA 1MMAA 1KNYA 1EI7A 1V54C 1YA7O 2Y69C 4N6CA 4JJFA 2V26A 1G8XA 3B0PA 3EZHA 1BDJB 3FXHA 3L0IA 4UDVA 2F22A 1YARO 1NBBA 4IRUA 5BQHA 1O5HA 2Q7RA 3W4YA 2LP4A 2KC3A 2R03A 1BR1A 4G7OF 3M1CB 1RJ9B 4YN0B 5TJ5E 1ZHZA 1WASA 3Q6NA 1A41A 1NG1A 2L81A 2HV6A 2OKUA 1S7ZA 1NLXA 2KYHA 2WZLA 3EFOA 5D91A 3SXKA 1D0XA 1OXKA 1SZIA 2J0WA 3M79A 5E33A 4I1OB 5IY5C 4PACA 1VK5A 1E84A 2QTVA 2HS5A 3EG9A 4LLCA 3HLZA 2B0HA 3RQGA 2DYRC 2HJMA 3VF0A 3DAGA 4H54A 2LCHA 2LD6A 4IAQA 2P7VA 3DE8A 3EFOB 1V4AA 4CSAC 5T3WA 3UMIA 3LLIA 5A6KA 5DQTA 4QDLA 3F46A 1JPNA 4HEAJ 3B0VC 2IXMA 3EG9B 4GQHA 2KW3C 2XSEA 4HFKB 5BQGA 4EBKA 4LLEA 4P9FA 4EBJA 5GPGB 2HFIA 1IZMA 3ZQVA 2WVOA 2XS1A 4DVZA 3S27A 5KYYB 3RW0A 1AUEA 1R4TA 1M2VA 4JW1A 2LFFA 2M64A 2IBFA 4MS2A 4G78A 2QE9A 4WGYA 1A7DA 3RVZA 4MVMA 3B71A 1LKXA 2J9WA 3KMIA 3LESA 3ZG1A 3FMSA 5JRAA 4OIRF 5COGA 2VASA 5DVWA 5JT4A 1T6QA 2A0UA 4PFPA 1M2VB 3E70C 2YQYA 1OXBA 2EILC 4ULVA 4A2NB 1CPRA 1V55C 2CW0F 3LJBA 4E18A 3RYLA 4YT2A 5A6AA 1Z5ZA 3EHMA 3ZTMA 1OCRC 4MTOA 1TKNA 3SXZA 2P0NA 3O39A 3G50A 5A6BD 2HMZA 3JRMO 4BG0A 3WAQA 3NG1A 2J9VA 1VLSA 2KGOA 2J7PA 3RIPA 1LE4A 3U9MA 4OD4A 2R7SA 2CDQA 4W8KA 2G3KA 3DM5A 4DBRA 4PJJA 3KYIA 4E7ZA 4E0IA 3S9OA 1AVOB 2I8BA 3LLKA 1J8MF 2HV7A 3ABLC 5A6BA 3DMDA 5COFA 1PV3A 2ZXWC 2NSGA 2LQGA 3NDBB 4YL1A 3ABKC 4M63A 2YL1A 2R7TA 1T01A 4JTCB 3HNIA 4BJ6A 1HW2A 5KYWB 1RKCA 4BEJA 4MW3A 2R9RB 1LPEA 2ZXOA 3TOMA 3NMIA 3ZQYA 4KI2A 1WN0A 3S29A 3W8IA 5T1DB 2L6HA 3DM9B 4JCZA 1KTMA 1FTSA 5JUAA 3H2UA 5F5HA 4N4WA 1GGQA 3MFNA 3OA1A 4JC7A 4MVRA 5L0FA 2HSQA 1E86A 1T6UA 3GANA 4HFFB 4YL3A 3EGDA 2YLIA 4CS8C 2G62A 2FFHA 4QI2A 1ZHWA 2O9XA 3DE9A 2Q3TA 2HMQA 4E0HA 5F5FA 3Q7LA 4XPWA 4KNVA 2IXNA 2KQ9A 2A0BA 1LM3B 4JTAB 3W8HA 4LDKA 2OU6A 3FAJA 1J8YF 1MMGA 3LS0A 3RF3A 1U0BB 1OW7A 1I4YA 4PR9A 4K0DA 3C63A 5JSLA 5L0CA 1VB5A 3AJMA 4CJOA 1A0BA 3N2ZB 1HE1A 1T5OA 3DJNB 3U2LA 2Y3HA 3V5ZA 4DOZA 4YT4A 1ZHTA 2QY9A 3EQLF 3UGOA 1N1CA 5L0HA 2VB6A 3CZ6A 5B3IA 2MHRA 1Z23A 2YL7A 1TWHA 3EZIA 1GS9A 4W8PA 3TK0A 1D1AA 2L6FA 1ST6A 3JRTA 4GYTA 3US6A 4IGGA 4LACB 2XS8A 5DS6A 2YLGA 1JR8A 1QQ3A 2XRHA 3AGUA 2GFHA 1Q0MA 5EK0A 4MQ9F 4ZLDA 3T6BA 3CQZA 4U5CE 1ZW3A 3B0UX 1L7CA 2W45A 3B9QA 4O6MA 2YEVA 4EHPA 1QLEC 3MYFA 2WL8A 4E17A 3HTKC 1Y4CA 3UMKA 1ZHXA 1TR2A 5DS4A 4AL1A 1APCA 1L3PA 3C8GD 3DI5A 2CGEA 1TWCA 1XZPA 4C3EA 3ZSUA 2LSEA 3OWTA 2Y3BA 4JKVA 2ASRA 2R05A 1ZW2A 1HMOA 3MYIA 3E9VA 4MVUA 4Q7CA 4U9DA 4AL0A 1TFKB 3KKBA 1PCXA 2X0CA 2OQMA 2W4BA 3O55A 3PMRA 1OKKD 5B1BC 3U3BA 3ZIBA 3POVA 4L6RA 2AVKA 3R2PA 3S84A 3X2QC 4PJNA 1R5ID 2Z15A 3AGTA 2HSBA 3RQFA 3QVYA 1LI7A 3QZCA 4XPYA 1Q0DA 3NKEA 4CIHA 5KYYA 1SYQA 2AP3A 2PFDA 2EINC 1PD0A 1MMNA 2AWYA 3L8JA 4CBEA 3NYJA 1ZVZA 4JJGA 4C3BA 2UUHA 5BUOA 1O87A 3JZ0A 1OCCC 1OW8A 3A11A 4I44A 4K1OA 3K6BA 4N6HA 5BQIA 2V3CC 3I4UA 3K7DA 2NUTA 2P6VA 4X0RA 1BZ4A 2AWCA 2XXAA 2ZPAA 1CGME 2IYLD 3KPHA 2L6GA 3SNHA 3WODF 1E83A 1DOWA 5DS5A 1EA8A 4Z9HA 1K04A 1Z6AA 1Q0GA 3SP1A 3I5PA 2R7WA 2MYSA 1Z7Qc 2HUJA 4U5HA 4BJ5C 4KC9A 3UGPA 2ZXPA 1C02A 2FGYA 3QTHA 4PK4A 3TD7A 5L0GA 1QZXA 4CSAA 2NUTB 2XXAB 3IHUA 3GORA 4KNWA 4NY3A 3V7OA 1T6IA 2XLWA 3K1IC 1XZQA 1YZAA 3JSEO 3UMHA 3DWWA 2PX0A 3EGXA 4U9EA 1D1BA 1ORJA 4IAOA 4C3DA 4YJWA 3IPMO 2VCAA 4PJMA 2HZ8A 4XLNF 4FX5A 1WATA 2PP4A 4KBLA 1NU7D 3T6JA 2Q9AA 3DXJF 4I3MA 4DRIB 2DB4A 1H9TA 1D0YA 3WG7C 3EGXB 3Q6MA 2VCCA 2WVQA 3U5SA 3AG3C 2CNWD 2I15A 1A7VA 1TWAA 4WABA 4NTAA 3DAFA 4JRZA 4XPXA 2OEVA 4D4NA 5KYWA 1FFHA 5L0DA 3Q7GA 4Z9IA 3UR3C 1MMDA 1GM5A 2D5RB 2QNLA 4FESA 4WGZA 4CS9C 3U0CA 4MVSA 3I5QA 3EHNA 1NSGB 3FVYA 3O6XA 4DJ9A 4GEHA 5CIVA 3ASNC 3QW0A 2EPOA 1LE2A 3RQEA 3SZRA 1FR0A 1ZHYA 2VH3A 2XLHA 4JTDB 4XEKA 3LEVA 3U8VA 4LDRA 4CDYA 2IM8A 3BRJA 2R7RA 4ZLCA 3ATPA 4JVSA 3C18A 1S05A 3NMKA 2XLEA 3GEEA 1JAFA 3JTLO 2Y3GA 5FCLA 3S28A 1ZYRF 4EUKB 2NPUA 2PNOA 4DVYP 4B6IA 4OIQF 1YYXA 2YKZA 4MVQA 1VYKA 2LFDA 3GWLA 4FWVA 1M56C 4JE9A 1G5ZA 1FFTC 2WZFA 1T9KA 1AEPA 3S90A 1I5NA 2C03A 1G4WR 4G0HA 5L3QA 3QMKA 4OIOF 2H7OA 4XEVA 3ZVRA 2OG2A 1D1CA 4MVOA 1SMYF 3NRHA 3AG1C 2RSEB 5K0IA 3JYHA 4YT8A 1W2WA 2J8WA 3HKKA 1PD1A 4IARA 1CPQA 2L7AA 2Q4FA 2XM0A 2YHSA 3ABMC 4ULWA 3VAYA 1OR3A 2EIJC 4EKWA 3LAYA 2H7BA 4E7SA 2GAQA 4BJ1A 1ZU4A 4U5BE 3FAPB 1Z63A 4MTFA 2UUIA 2W9YA 3MLGA 3NYLA 3RVYA 2A1DD 3TJ6A 3U3FA 2R7UA 5L0IA 3H2VA 2WVNA 4RBNA 1ZZPA 4CS8A 4K7BA 1DOVA 256BA 2KJGA 1B68A 5CI9A 4MNDA 2YRFA 1VLTA 1SR2A 2XL4A 4G7ZF 1H6GA 4O7GA 1I4ZA 2A69F 2A68F 4ER9A 5L3VA 2EIKC 2HKVA 4OINF 3G4XA 4AE4A 3O10A 5JS5A 1HMDA 2Y3DA 1JPJA 3TOLA 4F4BA 1HY5A 4D4XA 3DD7A 5EGYA 1E85A 4G7HF 3ZDLA 1YDIA 4Q4ZF 1WWPA 4J7YA 4U5DE 4C7OB 1WTYA 4PJLA 4AX2A 1HW1A 2PX3A 4U5EE 2BL2A 1LS4A 3DJUB 1SF8A 4AE4B 4P9TA 3EH2A 3GEHA 3JT1A 1TFOB 2HJ3A 5E3CA 3A9CA 3M4BA 4ONSA 2J9UA 2IXPA 3U9JA 1D0ZA 5AGFA 3K1HA 2X51A 1NZEA 3JYYA 1A7EA 2WZGA 3SXYA 1V74B 1H9GA 5F28E 1LVKA
chains in the Genus database with same CATH topology
4U5GA 2WB7A 3RFYA 3T4RA 2R7VA 1VOMA 1LS1A 4JURI 4WJ0A 2ZXRA 2M4EA 2KNHA 5KYNA 3ZC4A 3CSKA 1OKKA 3X1OA 3ECSA 2J46A 4N06A 4P6IC 2OCCC 3EPVA 3KL4A 5CI8A 3AG4C 3NKDA 4I1MA 2YZSA 2BE5F 3AQCA 5KYUA 4CS7A 3AQBA 4Q5SF 4YT5A 4XTKA 1TWGA 3K33A 3W2WA 5KYUB 4ANJA 4U5FE 5B3SC 2B0JA 3L34A 2Q9CA 5DLJA 1M2OA 2W4MA 5KYXA 3PHF2 1VYIA 2L9JA 3ASOC 2PF4E 4BJ5A 3F47A 3KH2A 3SEOA 3LNRA 4O79A 3JCUQ 3RH3A 2NG1A 4H4KC 2J7PD 5KYXB 1FMVA 3S0XA 3ITFA 3OEOA 2A6EF 2DGJA 1WGWA 1VMAA 3EH1A 4BJ6C 2CNWA 4JZAA 5EHHA 5HSWA 4HE8D 2R7XA 3IEEA 4OIPF 3GODA 2G3VA 2EIMC 2A6HF 4JCHA 1ZU5A 3HJCA 3EJNA 4EBBA 2MWQA 4CS9A 4EWCA 1MNEA 1MNDA 4RD9A 2R7QA 5DQZA 3JSZA 1NU9C 1KU2A 1IW7F 1Z3IX 3N24A 4IWBA 1OCZC 3N0TA 2DYSC 3VYWA 4LERA 2NUPA 2H7VC 4O6NA 4DBQA 4XLPF 3RKOF 3SYNA 4O6YA 4QI0A 2J0XA 2NUPB 3LS1A 4C7OA 2Y39A 4RDAA 4AK9A 4J32B 3NYMA 5D92A 3EGDB 5T3TA 4OD5A 5B1AC 1OCOC 3W2VA 3K66A 1BR2A 3FHDA 2IXOA 4XWJA 2IOQA 2WZGA 4IJJA 2R7OA 3DZAA 1M57C 2J45A 3H65A 4PFOA 4BJTA 2Q9BA 5E3AA 2JD3A 2C04A 4J30B 1FMWA 4YWQA 3MX3A 1BR4A 2E87A 1RJ9A 3UNGC 5E2QA 1MMAA 1V54C 2Y69C 4JJFA 2V26A 1G8XA 3B0PA 3EZHA 3L0IA 4IRUA 1O5HA 4G7OF 1BR1A 3M1CB 1RJ9B 4YN0B 1ZHZA 3Q6NA 2L81A 1NG1A 2HV6A 1S7ZA 2WZLA 3EFOA 3VAYA 5D91A 1D0XA 5E33A 1SZIA 2J0WA 5IY5C 4I1OB 1VK5A 2QTVA 3EG9A 4LLCA 3HLZA 2DYRC 3DAGA 2P7VA 3EFOB 4CSAC 5T3WA 3UMIA 3LLIA 5DQTA 4QDLA 3F46A 1JPNA 4HEAJ 3B0VC 2IXMA 3EG9B 2KW3C 2XSEA 4HFKB 4LLEA 1IZMA 2WVOA 4DVZA 3S27A 5KYYB 1M2VA 4JW1A 2J9WA 3KMIA 3LESA 3ZG1A 4OIRF 2VASA 5DVWA 4PFPA 1M2VB 3E70C 2EILC 4A2NB 1V55C 3LJBA 2CW0F 4YT2A 3RYLA 1Z5ZA 3EHMA 1OCRC 1TKNA 3O39A 4BG0A 3NG1A 2J9VA 2KGOA 2J7PA 3RIPA 4OD4A 2R7SA 2CDQA 4W8KA 2G3KA 3DM5A 4DBRA 4PJJA 4E7ZA 2I8BA 3LLKA 1J8MF 2HV7A 3ABLC 3DMDA 2ZXWC 3NDBB 3ABKC 4M63A 2R7TA 4BJ6A 5KYWB 4BEJA 2ZXOA 4KI2A 3S29A 3W8IA 5T1DB 3DM9B 1FTSA 5F5HA 3OA1A 3GANA 4HFFB 3EGDA 4CS8C 2G62A 2FFHA 4QI2A 1ZHWA 2O9XA 5F5FA 2Q3TA 3Q7LA 4KNVA 2IXNA 2KQ9A 3W8HA 3FAJA 1J8YF 1MMGA 3LS0A 4K0DA 3N2ZB 3DJNB 4YT4A 3FDQA 2Y3HA 3UGOA 4DOZA 1ZHTA 2QY9A 3EQLF 1N1CA 2VB6A 3CZ6A 1Z23A 1TWHA 3EZIA 1D1AA 1ST6A 3JRTA 4GYTA 4LACB 5DS6A 2XRHA 2GFHA 4MQ9F 4ZLDA 3T6BA 3CQZA 4U5CE 3B0UX 3B9QA 2W45A 4O6MA 2YEVA 1QLEC 2WL8A 3HTKC 3UMKA 1ZHXA 1TR2A 5DS4A 2CGEA 1TWCA 4C3EA 3ZSUA 2LSEA 3OWTA 2Y3BA 4Q7CA 3E9VA 3KKBA 1PCXA 2W4BA 3PMRA 5B1BC 1OKKD 3POVA 3ZIBA 3X2QC 4PJNA 2Z15A 3QZCA 3NKEA 4CIHA 5KYYA 2PFDA 2EINC 1PD0A 1MMNA 4CBEA 3NYJA 4JJGA 4C3BA 5BUOA 1O87A 1OCCC 4I44A 2V3CC 3K6BA 3I4UA 3K7DA 2NUTA 2P6VA 4X0RA 2XXAA 2ZPAA 2IYLD 3SNHA 3WODF 5DS5A 2R7WA 1Z6AA 3SP1A 3I5PA 2MYSA 4U5HA 4BJ5C 3UGPA 4KC9A 2ZXPA 2FGYA 4PK4A 3TD7A 1QZXA 4CSAA 2NUTB 2XXAB 4KNWA 4NY3A 3V7OA 3K1IC 3UMHA 2PX0A 3EGXA 1D1BA 4IAOA 4C3DA 4YJWA 4PJMA 4XLNF 4FX5A 2PP4A 4KBLA 1NU7D 3T6JA 2Q9AA 3DXJF 4I3MA 1D0YA 3WG7C 3EGXB 3Q6MA 2WVQA 3AG3C 2CNWD 1TWAA 3DAFA 5KYWA 1FFHA 3Q7GA 3UR3C 1MMDA 2D5RB 4FESA 4CS9C 3I5QA 3EHNA 3FVYA 3O6XA 4GEHA 3ASNC 3SZRA 1ZHYA 2VH3A 3LEVA 2R7RA 4ZLCA 4JVSA 5FCLA 2Y3GA 3S28A 1ZYRF 4DVYP 4B6IA 4OIQF 1VYKA 4FWVA 1M56C 1FFTC 2WZFA 2C03A 4G0HA 5L3QA 3QMKA 4OIOF 2H7OA 3ZVRA 2OG2A 1D1CA 1SMYF 3NRHA 3AG1C 3JYHA 4YT8A 1W2WA 1PD1A 3ABMC 2YHSA 4ULWA 2EIJC 3LAYA 2H7BA 4E7SA 4BJ1A 1ZU4A 4U5BE 1Z63A 2W9YA 3NYLA 3MLGA 2A1DD 2R7UA 2WVNA 4RBNA 4CS8A 4K7BA 2KJGA 5CI9A 4MNDA 2XL4A 4G7ZF 4O7GA 2A69F 2A68F 5L3VA 2EIKC 4OINF 4AE4A 4F4BA 2Y3DA 1JPJA 4G7HF 3DD7A 5EGYA 4Q4ZF 4U5DE 4C7OB 4PJLA 4AX2A 2PX3A 4U5EE 3DJUB 1SF8A 4AE4B 3EH2A 3JT1A 5E3CA 2J9UA 2IXPA 1D0ZA 3K1HA 2X51A 1NZEA 3AG2C 1LKXA 1LVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AX2 A;  4J32 B;  4J30 B;  4B6I A;  4HFK B;  4HFF B;  4JUR I;  3ZIB A; 
#chains in the Genus database with same CATH topology
 4U5G A;  1VTM P;  2WB7 A;  3RFY A;  3FOO A;  3T9O A;  2TMV P;  3LEO A;  3T4R A;  3MBG A;  4JEA A;  1ORY A;  1VOM A;  3AG2 C;  2R7V A;  1LS1 A;  2XLO A;  4JUR I;  3C8G A;  2KK1 A;  4WJ0 A;  2ZXR A;  2M4E A;  1K05 A;  1UG7 A;  2KNH A;  5KYN A;  3ZC4 A;  3C62 A;  3CSK A;  1OKK A;  2XLV A;  1CGO A;  3ECS A;  3X1O A;  5COM A;  1TQG A;  1EQ1 A;  2J46 A;  3C8G B;  4N06 A;  4P6I C;  2OCC C;  3EPV A;  1YJG A;  3SXM A;  3KL4 A;  5CI8 A;  4R32 A;  3AG4 C;  3HNL A;  3NKD A;  4I1M A;  3VM6 A;  5JP7 A;  2GDC A;  2EPL X;  2YZS A;  2BE5 F;  3AQC A;  5KYU A;  2AU5 A;  1C03 A;  2Q00 A;  1JMW A;  2XL8 A;  4CS7 A;  3AQB A;  4Q5S F;  3GM1 A;  4EIY A;  4YT5 A;  1Q0K A;  4NTB A;  4XTK A;  1TWG A;  3K33 A;  3IQC A;  1FNT c;  1QSP A;  2FAP B;  2YLD A;  3HNK A;  1YZC A;  1RXQ A;  3W2W A;  3GWN A;  4DRH B;  2VC9 A;  5KYU B;  1FAP B;  4ANJ A;  4U5F E;  3BEH A;  5B3S C;  2ICW G;  2DI3 A;  2B0J A;  3L34 A;  3TQO A;  2Q9C A;  5DLJ A;  1O3U A;  1M2O A;  4CDV A;  2YL0 A;  2CYD A;  2W4M A;  5KYX A;  1QKR A;  2GWW A;  1VYI A;  2L9J A;  3ASO C;  4JIO A;  4Z9J A;  5HV9 A;  2PF4 E;  3PHF 2;  3B29 A;  4CDA A;  4IB4 A;  3GM3 A;  4BJ5 A;  3F47 A;  3G4Z A;  2H8A A;  5JLI A;  4CX9 A;  2NSF A;  3KH2 A;  3SEO A;  3LNR A;  4O79 A;  3JCU Q;  1UFB A;  4FAP B;  3RH3 A;  2NG1 A;  3L8I A;  4XQ1 A;  4H4K C;  2EPN A;  2J7P D;  3K1I A;  5KYX B;  2XM4 A;  1FMV A;  4XEF A;  3DKA A;  3M4C A;  4LDQ A;  3R7C A;  3FOP A;  3S0X A;  3ITF A;  3OEO A;  3IQ6 A;  1LIH A;  2D4U A;  2A6E F;  2DGJ A;  1WGW A;  1VMA A;  2OOC A;  3EH1 A;  3C7J A;  4YL0 A;  2CNW A;  3GEI A;  4JZA A;  2OEX A;  3WHN A;  4HE8 D;  4BJ6 C;  4NCQ A;  3PCV A;  4DRJ B;  3IEE A;  5EHH A;  5HSW A;  3PDM P;  2R7X A;  2PBE A;  4MTG A;  3ZWI A;  2RD9 A;  1ORS C;  5AC4 A;  4OIP F;  1C17 M;  3QW1 A;  3C8Z A;  3GOD A;  1QPU A;  1EKY A;  3IQT A;  2G3V A;  2OJQ A;  2EIM C;  1MQV A;  1OQC A;  2ZD9 A;  2A6H F;  2R02 A;  3GM2 A;  3M15 A;  4JCH A;  1ZU5 A;  3HJC A;  3CEX A;  1M6T A;  2QUP A;  3EJN A;  2MWQ A;  4EBB A;  4CS9 A;  4EWC A;  1MNE A;  1MND A;  4RD9 A;  2R7Q A;  5DQZ A;  3JSZ A;  1NU9 C;  5A6J A;  5L0J A;  1Y6D A;  5AC5 A;  2XLD A;  1KU2 A;  1U6H A;  2QLA A;  3J06 A;  1IW7 F;  1Z3I X;  3N24 A;  3LNM B;  1U89 A;  4IWB A;  1OCZ C;  2CCY A;  3QVZ A;  3CAX A;  4JEB A;  3N0T A;  4NC3 A;  2DYS C;  2LIG A;  2J9B A;  3KYJ A;  3VYW A;  1Q0F A;  4LER A;  5FZT A;  2NUP A;  1XWJ A;  4CIP A;  4J7T A;  1K40 A;  2H7V C;  2EPK X;  3ZTZ A;  4O6N A;  1RKE A;  2R25 A;  4DBQ A;  4XLP F;  1NFN A;  3RKO F;  3SYN A;  1HE9 A;  3V5X A;  4CJG A;  2P61 A;  4A4A A;  4O6Y A;  4QI0 A;  2J0X A;  1YYJ A;  4BPM A;  2NUP B;  2EPM X;  3LS1 A;  4C7O A;  2XLM A;  2Y39 A;  4RDA A;  2YWA A;  2ETS A;  3T6G B;  3U2M A;  4AK9 A;  4BEM J;  1GQA A;  1RKE B;  4NQF A;  1E2X A;  3NYM A;  4J32 B;  5D92 A;  3TJ5 A;  3EGD B;  5T3T A;  1YLM A;  4OD5 A;  1OCO C;  5B1A C;  3U8P A;  3W2V A;  3K66 A;  1BR2 A;  1JOG A;  3IQ5 A;  3FHD A;  4MW8 A;  4DXW A;  5JVE A;  5A69 A;  3LUT B;  1RMV A;  1QVX A;  2GA0 A;  2IXO A;  3NMJ A;  4MVZ A;  4XWJ A;  3TUL A;  1YA9 A;  2IOQ A;  4IJJ A;  1WOL A;  2R7O A;  1F1M A;  4YK5 A;  3DZA A;  3L1M A;  3VRC A;  2LK4 A;  1M57 C;  2BC5 A;  1H7I A;  1OR2 A;  1LI5 A;  2J45 A;  2YL3 A;  4NTF A;  3AOU A;  3H65 A;  4PFO A;  1YAU O;  2YVK A;  1OW6 A;  2JX0 A;  1G4U S;  4BJT A;  1NFO A;  2XL6 A;  2Q9B A;  2VCB A;  5E3A A;  2JD3 A;  2KSF A;  2C04 A;  4J30 B;  1JRA A;  1YVI A;  1BBH A;  1FMW A;  1RCP A;  4YWQ A;  2P1A A;  3MX3 A;  1BR4 A;  3V5Y A;  2E87 A;  3FDQ A;  1RJ9 A;  2OJE D;  3HNJ A;  3UNG C;  2JPU A;  1CGN A;  5E2Q A;  1MMA A;  1KNY A;  1EI7 A;  1V54 C;  1YA7 O;  2Y69 C;  4N6C A;  4JJF A;  2V26 A;  1G8X A;  3B0P A;  3EZH A;  1BDJ B;  3FXH A;  3L0I A;  4UDV A;  2F22 A;  1YAR O;  1NBB A;  4IRU A;  5BQH A;  1O5H A;  2Q7R A;  3W4Y A;  2LP4 A;  2KC3 A;  2R03 A;  1BR1 A;  4G7O F;  3M1C B;  1RJ9 B;  4YN0 B;  5TJ5 E;  1ZHZ A;  1WAS A;  3Q6N A;  1A41 A;  1NG1 A;  2L81 A;  2HV6 A;  2OKU A;  1S7Z A;  1NLX A;  2KYH A;  2WZL A;  3EFO A;  5D91 A;  3SXK A;  1D0X A;  1OXK A;  1SZI A;  2J0W A;  3M79 A;  5E33 A;  4I1O B;  5IY5 C;  4PAC A;  1VK5 A;  1E84 A;  2QTV A;  2HS5 A;  3EG9 A;  4LLC A;  3HLZ A;  2B0H A;  3RQG A;  2DYR C;  2HJM A;  3VF0 A;  3DAG A;  4H54 A;  2LCH A;  2LD6 A;  4IAQ A;  2P7V A;  3DE8 A;  3EFO B;  1V4A A;  4CSA C;  5T3W A;  3UMI A;  3LLI A;  5A6K A;  5DQT A;  4QDL A;  3F46 A;  1JPN A;  4HEA J;  3B0V C;  2IXM A;  3EG9 B;  4GQH A;  2KW3 C;  2XSE A;  4HFK B;  5BQG A;  4EBK A;  4LLE A;  4P9F A;  4EBJ A;  5GPG B;  2HFI A;  1IZM A;  3ZQV A;  2WVO A;  2XS1 A;  4DVZ A;  3S27 A;  5KYY B;  3RW0 A;  1AUE A;  1R4T A;  1M2V A;  4JW1 A;  2LFF A;  2M64 A;  2IBF A;  4MS2 A;  4G78 A;  2QE9 A;  4WGY A;  1A7D A;  3RVZ A;  4MVM A;  3B71 A;  1LKX A;  2J9W A;  3KMI A;  3LES A;  3ZG1 A;  3FMS A;  5JRA A;  4OIR F;  5COG A;  2VAS A;  5DVW A;  5JT4 A;  1T6Q A;  2A0U A;  4PFP A;  1M2V B;  3E70 C;  2YQY A;  1OXB A;  2EIL C;  4ULV A;  4A2N B;  1CPR A;  1V55 C;  2CW0 F;  3LJB A;  4E18 A;  3RYL A;  4YT2 A;  5A6A A;  1Z5Z A;  3EHM A;  3ZTM A;  1OCR C;  4MTO A;  1TKN A;  3SXZ A;  2P0N A;  3O39 A;  3G50 A;  5A6B D;  2HMZ A;  3JRM O;  4BG0 A;  3WAQ A;  3NG1 A;  2J9V A;  1VLS A;  2KGO A;  2J7P A;  3RIP A;  1LE4 A;  3U9M A;  4OD4 A;  2R7S A;  2CDQ A;  4W8K A;  2G3K A;  3DM5 A;  4DBR A;  4PJJ A;  3KYI A;  4E7Z A;  4E0I A;  3S9O A;  1AVO B;  2I8B A;  3LLK A;  1J8M F;  2HV7 A;  3ABL C;  5A6B A;  3DMD A;  5COF A;  1PV3 A;  2ZXW C;  2NSG A;  2LQG A;  3NDB B;  4YL1 A;  3ABK C;  4M63 A;  2YL1 A;  2R7T A;  1T01 A;  4JTC B;  3HNI A;  4BJ6 A;  1HW2 A;  5KYW B;  1RKC A;  4BEJ A;  4MW3 A;  2R9R B;  1LPE A;  2ZXO A;  3TOM A;  3NMI A;  3ZQY A;  4KI2 A;  1WN0 A;  3S29 A;  3W8I A;  5T1D B;  2L6H A;  3DM9 B;  4JCZ A;  1KTM A;  1FTS A;  5JUA A;  3H2U A;  5F5H A;  4N4W A;  1GGQ A;  3MFN A;  3OA1 A;  4JC7 A;  4MVR A;  5L0F A;  2HSQ A;  1E86 A;  1T6U A;  3GAN A;  4HFF B;  4YL3 A;  3EGD A;  2YLI A;  4CS8 C;  2G62 A;  2FFH A;  4QI2 A;  1ZHW A;  2O9X A;  3DE9 A;  2Q3T A;  2HMQ A;  4E0H A;  5F5F A;  3Q7L A;  4XPW A;  4KNV A;  2IXN A;  2KQ9 A;  2A0B A;  1LM3 B;  4JTA B;  3W8H A;  4LDK A;  2OU6 A;  3FAJ A;  1J8Y F;  1MMG A;  3LS0 A;  3RF3 A;  1U0B B;  1OW7 A;  1I4Y A;  4PR9 A;  4K0D A;  3C63 A;  5JSL A;  5L0C A;  1VB5 A;  3AJM A;  4CJO A;  1A0B A;  3N2Z B;  1HE1 A;  1T5O A;  3DJN B;  3U2L A;  2Y3H A;  3V5Z A;  4DOZ A;  4YT4 A;  1ZHT A;  2QY9 A;  3EQL F;  3UGO A;  1N1C A;  5L0H A;  2VB6 A;  3CZ6 A;  5B3I A;  2MHR A;  1Z23 A;  2YL7 A;  1TWH A;  3EZI A;  1GS9 A;  4W8P A;  3TK0 A;  1D1A A;  2L6F A;  1ST6 A;  3JRT A;  4GYT A;  3US6 A;  4IGG A;  4LAC B;  2XS8 A;  5DS6 A;  2YLG A;  1JR8 A;  1QQ3 A;  2XRH A;  3AGU A;  2GFH A;  1Q0M A;  5EK0 A;  4MQ9 F;  4ZLD A;  3T6B A;  3CQZ A;  4U5C E;  1ZW3 A;  3B0U X;  1L7C A;  2W45 A;  3B9Q A;  4O6M A;  2YEV A;  4EHP A;  1QLE C;  3MYF A;  2WL8 A;  4E17 A;  3HTK C;  1Y4C A;  3UMK A;  1ZHX A;  1TR2 A;  5DS4 A;  4AL1 A;  1APC A;  1L3P A;  3C8G D;  3DI5 A;  2CGE A;  1TWC A;  1XZP A;  4C3E A;  3ZSU A;  2LSE A;  3OWT A;  2Y3B A;  4JKV A;  2ASR A;  2R05 A;  1ZW2 A;  1HMO A;  3MYI A;  3E9V A;  4MVU A;  4Q7C A;  4U9D A;  4AL0 A;  1TFK B;  3KKB A;  1PCX A;  2X0C A;  2OQM A;  2W4B A;  3O55 A;  3PMR A;  1OKK D;  5B1B C;  3U3B A;  3ZIB A;  3POV A;  4L6R A;  2AVK A;  3R2P A;  3S84 A;  3X2Q C;  4PJN A;  1R5I D;  2Z15 A;  3AGT A;  2HSB A;  3RQF A;  3QVY A;  1LI7 A;  3QZC A;  4XPY A;  1Q0D A;  3NKE A;  4CIH A;  5KYY A;  1SYQ A;  2AP3 A;  2PFD A;  2EIN C;  1PD0 A;  1MMN A;  2AWY A;  3L8J A;  4CBE A;  3NYJ A;  1ZVZ A;  4JJG A;  4C3B A;  2UUH A;  5BUO A;  1O87 A;  3JZ0 A;  1OCC C;  1OW8 A;  3A11 A;  4I44 A;  4K1O A;  3K6B A;  4N6H A;  5BQI A;  2V3C C;  3I4U A;  3K7D A;  2NUT A;  2P6V A;  4X0R A;  1BZ4 A;  2AWC A;  2XXA A;  2ZPA A;  1CGM E;  2IYL D;  3KPH A;  2L6G A;  3SNH A;  3WOD F;  1E83 A;  1DOW A;  5DS5 A;  1EA8 A;  4Z9H A;  1K04 A;  1Z6A A;  1Q0G A;  3SP1 A;  3I5P A;  2R7W A;  2MYS A;  1Z7Q c;  2HUJ A;  4U5H A;  4BJ5 C;  4KC9 A;  3UGP A;  2ZXP A;  1C02 A;  2FGY A;  3QTH A;  4PK4 A;  3TD7 A;  5L0G A;  1QZX A;  4CSA A;  2NUT B;  2XXA B;  3IHU A;  3GOR A;  4KNW A;  4NY3 A;  3V7O A;  1T6I A;  2XLW A;  3K1I C;  1XZQ A;  1YZA A;  3JSE O;  3UMH A;  3DWW A;  2PX0 A;  3EGX A;  4U9E A;  1D1B A;  1ORJ A;  4IAO A;  4C3D A;  4YJW A;  3IPM O;  2VCA A;  4PJM A;  2HZ8 A;  4XLN F;  4FX5 A;  1WAT A;  2PP4 A;  4KBL A;  1NU7 D;  3T6J A;  2Q9A A;  3DXJ F;  4I3M A;  4DRI B;  2DB4 A;  1H9T A;  1D0Y A;  3WG7 C;  3EGX B;  3Q6M A;  2VCC A;  2WVQ A;  3U5S A;  3AG3 C;  2CNW D;  2I15 A;  1A7V A;  1TWA A;  4WAB A;  4NTA A;  3DAF A;  4JRZ A;  4XPX A;  2OEV A;  4D4N A;  5KYW A;  1FFH A;  5L0D A;  3Q7G A;  4Z9I A;  3UR3 C;  1MMD A;  1GM5 A;  2D5R B;  2QNL A;  4FES A;  4WGZ A;  4CS9 C;  3U0C A;  4MVS A;  3I5Q A;  3EHN A;  1NSG B;  3FVY A;  3O6X A;  4DJ9 A;  4GEH A;  5CIV A;  3ASN C;  3QW0 A;  2EPO A;  1LE2 A;  3RQE A;  3SZR A;  1FR0 A;  1ZHY A;  2VH3 A;  2XLH A;  4JTD B;  4XEK A;  3LEV A;  3U8V A;  4LDR A;  4CDY A;  2IM8 A;  3BRJ A;  2R7R A;  4ZLC A;  3ATP A;  4JVS A;  3C18 A;  1S05 A;  3NMK A;  2XLE A;  3GEE A;  1JAF A;  3JTL O;  2Y3G A;  5FCL A;  3S28 A;  1ZYR F;  4EUK B;  2NPU A;  2PNO A;  4DVY P;  4B6I A;  4OIQ F;  1YYX A;  2YKZ A;  4MVQ A;  1VYK A;  2LFD A;  3GWL A;  4FWV A;  1M56 C;  4JE9 A;  1G5Z A;  1FFT C;  2WZF A;  1T9K A;  1AEP A;  3S90 A;  1I5N A;  2C03 A;  1G4W R;  4G0H A;  5L3Q A;  3QMK A;  4OIO F;  2H7O A;  4XEV A;  3ZVR A;  2OG2 A;  1D1C A;  4MVO A;  1SMY F;  3NRH A;  3AG1 C;  2RSE B;  5K0I A;  3JYH A;  4YT8 A;  1W2W A;  2J8W A;  3HKK A;  1PD1 A;  4IAR A;  1CPQ A;  2L7A A;  2Q4F A;  2XM0 A;  2YHS A;  3ABM C;  4ULW A;  3VAY A;  1OR3 A;  2EIJ C;  4EKW A;  3LAY A;  2H7B A;  4E7S A;  2GAQ A;  4BJ1 A;  1ZU4 A;  4U5B E;  3FAP B;  1Z63 A;  4MTF A;  2UUI A;  2W9Y A;  3MLG A;  3NYL A;  3RVY A;  2A1D D;  3TJ6 A;  3U3F A;  2R7U A;  5L0I A;  3H2V A;  2WVN A;  4RBN A;  1ZZP A;  4CS8 A;  4K7B A;  1DOV A;  256B A;  2KJG A;  1B68 A;  5CI9 A;  4MND A;  2YRF A;  1VLT A;  1SR2 A;  2XL4 A;  4G7Z F;  1H6G A;  4O7G A;  1I4Z A;  2A69 F;  2A68 F;  4ER9 A;  5L3V A;  2EIK C;  2HKV A;  4OIN F;  3G4X A;  4AE4 A;  3O10 A;  5JS5 A;  1HMD A;  2Y3D A;  1JPJ A;  3TOL A;  4F4B A;  1HY5 A;  4D4X A;  3DD7 A;  5EGY A;  1E85 A;  4G7H F;  3ZDL A;  1YDI A;  4Q4Z F;  1WWP A;  4J7Y A;  4U5D E;  4C7O B;  1WTY A;  4PJL A;  4AX2 A;  1HW1 A;  2PX3 A;  4U5E E;  2BL2 A;  1LS4 A;  3DJU B;  1SF8 A;  4AE4 B;  4P9T A;  3EH2 A;  3GEH A;  3JT1 A;  1TFO B;  2HJ3 A;  5E3C A;  3A9C A;  3M4B A;  4ONS A;  2J9U A;  2IXP A;  3U9J A;  1D0Z A;  5AGF A;  3K1H A;  2X51 A;  1NZE A;  3JYY A;  1A7E A;  2WZG A;  3SXY A;  1V74 B;  1H9G A;  5F28 E;  1LVK A; 
#chains in the Genus database with same CATH homology
 4U5G A;  2WB7 A;  3RFY A;  3T4R A;  2R7V A;  1VOM A;  1LS1 A;  4JUR I;  4WJ0 A;  2ZXR A;  2M4E A;  2KNH A;  5KYN A;  3ZC4 A;  3CSK A;  1OKK A;  3X1O A;  3ECS A;  2J46 A;  4N06 A;  4P6I C;  2OCC C;  3EPV A;  3KL4 A;  5CI8 A;  3AG4 C;  3NKD A;  4I1M A;  2YZS A;  2BE5 F;  3AQC A;  5KYU A;  4CS7 A;  3AQB A;  4Q5S F;  4YT5 A;  4XTK A;  1TWG A;  3K33 A;  3W2W A;  5KYU B;  4ANJ A;  4U5F E;  5B3S C;  2B0J A;  3L34 A;  2Q9C A;  5DLJ A;  1M2O A;  2W4M A;  5KYX A;  3PHF 2;  1VYI A;  2L9J A;  3ASO C;  2PF4 E;  4BJ5 A;  3F47 A;  3KH2 A;  3SEO A;  3LNR A;  4O79 A;  3JCU Q;  3RH3 A;  2NG1 A;  4H4K C;  2J7P D;  5KYX B;  1FMV A;  3S0X A;  3ITF A;  3OEO A;  2A6E F;  2DGJ A;  1WGW A;  1VMA A;  3EH1 A;  4BJ6 C;  2CNW A;  4JZA A;  5EHH A;  5HSW A;  4HE8 D;  2R7X A;  3IEE A;  4OIP F;  3GOD A;  2G3V A;  2EIM C;  2A6H F;  4JCH A;  1ZU5 A;  3HJC A;  3EJN A;  4EBB A;  2MWQ A;  4CS9 A;  4EWC A;  1MNE A;  1MND A;  4RD9 A;  2R7Q A;  5DQZ A;  3JSZ A;  1NU9 C;  1KU2 A;  1IW7 F;  1Z3I X;  3N24 A;  4IWB A;  1OCZ C;  3N0T A;  2DYS C;  3VYW A;  4LER A;  2NUP A;  2H7V C;  4O6N A;  4DBQ A;  4XLP F;  3RKO F;  3SYN A;  4O6Y A;  4QI0 A;  2J0X A;  2NUP B;  3LS1 A;  4C7O A;  2Y39 A;  4RDA A;  4AK9 A;  4J32 B;  3NYM A;  5D92 A;  3EGD B;  5T3T A;  4OD5 A;  5B1A C;  1OCO C;  3W2V A;  3K66 A;  1BR2 A;  3FHD A;  2IXO A;  4XWJ A;  2IOQ A;  2WZG A;  4IJJ A;  2R7O A;  3DZA A;  1M57 C;  2J45 A;  3H65 A;  4PFO A;  4BJT A;  2Q9B A;  5E3A A;  2JD3 A;  2C04 A;  4J30 B;  1FMW A;  4YWQ A;  3MX3 A;  1BR4 A;  2E87 A;  1RJ9 A;  3UNG C;  5E2Q A;  1MMA A;  1V54 C;  2Y69 C;  4JJF A;  2V26 A;  1G8X A;  3B0P A;  3EZH A;  3L0I A;  4IRU A;  1O5H A;  4G7O F;  1BR1 A;  3M1C B;  1RJ9 B;  4YN0 B;  1ZHZ A;  3Q6N A;  2L81 A;  1NG1 A;  2HV6 A;  1S7Z A;  2WZL A;  3EFO A;  3VAY A;  5D91 A;  1D0X A;  5E33 A;  1SZI A;  2J0W A;  5IY5 C;  4I1O B;  1VK5 A;  2QTV A;  3EG9 A;  4LLC A;  3HLZ A;  2DYR C;  3DAG A;  2P7V A;  3EFO B;  4CSA C;  5T3W A;  3UMI A;  3LLI A;  5DQT A;  4QDL A;  3F46 A;  1JPN A;  4HEA J;  3B0V C;  2IXM A;  3EG9 B;  2KW3 C;  2XSE A;  4HFK B;  4LLE A;  1IZM A;  2WVO A;  4DVZ A;  3S27 A;  5KYY B;  1M2V A;  4JW1 A;  2J9W A;  3KMI A;  3LES A;  3ZG1 A;  4OIR F;  2VAS A;  5DVW A;  4PFP A;  1M2V B;  3E70 C;  2EIL C;  4A2N B;  1V55 C;  3LJB A;  2CW0 F;  4YT2 A;  3RYL A;  1Z5Z A;  3EHM A;  1OCR C;  1TKN A;  3O39 A;  4BG0 A;  3NG1 A;  2J9V A;  2KGO A;  2J7P A;  3RIP A;  4OD4 A;  2R7S A;  2CDQ A;  4W8K A;  2G3K A;  3DM5 A;  4DBR A;  4PJJ A;  4E7Z A;  2I8B A;  3LLK A;  1J8M F;  2HV7 A;  3ABL C;  3DMD A;  2ZXW C;  3NDB B;  3ABK C;  4M63 A;  2R7T A;  4BJ6 A;  5KYW B;  4BEJ A;  2ZXO A;  4KI2 A;  3S29 A;  3W8I A;  5T1D B;  3DM9 B;  1FTS A;  5F5H A;  3OA1 A;  3GAN A;  4HFF B;  3EGD A;  4CS8 C;  2G62 A;  2FFH A;  4QI2 A;  1ZHW A;  2O9X A;  5F5F A;  2Q3T A;  3Q7L A;  4KNV A;  2IXN A;  2KQ9 A;  3W8H A;  3FAJ A;  1J8Y F;  1MMG A;  3LS0 A;  4K0D A;  3N2Z B;  3DJN B;  4YT4 A;  3FDQ A;  2Y3H A;  3UGO A;  4DOZ A;  1ZHT A;  2QY9 A;  3EQL F;  1N1C A;  2VB6 A;  3CZ6 A;  1Z23 A;  1TWH A;  3EZI A;  1D1A A;  1ST6 A;  3JRT A;  4GYT A;  4LAC B;  5DS6 A;  2XRH A;  2GFH A;  4MQ9 F;  4ZLD A;  3T6B A;  3CQZ A;  4U5C E;  3B0U X;  3B9Q A;  2W45 A;  4O6M A;  2YEV A;  1QLE C;  2WL8 A;  3HTK C;  3UMK A;  1ZHX A;  1TR2 A;  5DS4 A;  2CGE A;  1TWC A;  4C3E A;  3ZSU A;  2LSE A;  3OWT A;  2Y3B A;  4Q7C A;  3E9V A;  3KKB A;  1PCX A;  2W4B A;  3PMR A;  5B1B C;  1OKK D;  3POV A;  3ZIB A;  3X2Q C;  4PJN A;  2Z15 A;  3QZC A;  3NKE A;  4CIH A;  5KYY A;  2PFD A;  2EIN C;  1PD0 A;  1MMN A;  4CBE A;  3NYJ A;  4JJG A;  4C3B A;  5BUO A;  1O87 A;  1OCC C;  4I44 A;  2V3C C;  3K6B A;  3I4U A;  3K7D A;  2NUT A;  2P6V A;  4X0R A;  2XXA A;  2ZPA A;  2IYL D;  3SNH A;  3WOD F;  5DS5 A;  2R7W A;  1Z6A A;  3SP1 A;  3I5P A;  2MYS A;  4U5H A;  4BJ5 C;  3UGP A;  4KC9 A;  2ZXP A;  2FGY A;  4PK4 A;  3TD7 A;  1QZX A;  4CSA A;  2NUT B;  2XXA B;  4KNW A;  4NY3 A;  3V7O A;  3K1I C;  3UMH A;  2PX0 A;  3EGX A;  1D1B A;  4IAO A;  4C3D A;  4YJW A;  4PJM A;  4XLN F;  4FX5 A;  2PP4 A;  4KBL A;  1NU7 D;  3T6J A;  2Q9A A;  3DXJ F;  4I3M A;  1D0Y A;  3WG7 C;  3EGX B;  3Q6M A;  2WVQ A;  3AG3 C;  2CNW D;  1TWA A;  3DAF A;  5KYW A;  1FFH A;  3Q7G A;  3UR3 C;  1MMD A;  2D5R B;  4FES A;  4CS9 C;  3I5Q A;  3EHN A;  3FVY A;  3O6X A;  4GEH A;  3ASN C;  3SZR A;  1ZHY A;  2VH3 A;  3LEV A;  2R7R A;  4ZLC A;  4JVS A;  5FCL A;  2Y3G A;  3S28 A;  1ZYR F;  4DVY P;  4B6I A;  4OIQ F;  1VYK A;  4FWV A;  1M56 C;  1FFT C;  2WZF A;  2C03 A;  4G0H A;  5L3Q A;  3QMK A;  4OIO F;  2H7O A;  3ZVR A;  2OG2 A;  1D1C A;  1SMY F;  3NRH A;  3AG1 C;  3JYH A;  4YT8 A;  1W2W A;  1PD1 A;  3ABM C;  2YHS A;  4ULW A;  2EIJ C;  3LAY A;  2H7B A;  4E7S A;  4BJ1 A;  1ZU4 A;  4U5B E;  1Z63 A;  2W9Y A;  3NYL A;  3MLG A;  2A1D D;  2R7U A;  2WVN A;  4RBN A;  4CS8 A;  4K7B A;  2KJG A;  5CI9 A;  4MND A;  2XL4 A;  4G7Z F;  4O7G A;  2A69 F;  2A68 F;  5L3V A;  2EIK C;  4OIN F;  4AE4 A;  4F4B A;  2Y3D A;  1JPJ A;  4G7H F;  3DD7 A;  5EGY A;  4Q4Z F;  4U5D E;  4C7O B;  4PJL A;  4AX2 A;  2PX3 A;  4U5E E;  3DJU B;  1SF8 A;  4AE4 B;  3EH2 A;  3JT1 A;  5E3C A;  2J9U A;  2IXP A;  1D0Z A;  3K1H A;  2X51 A;  1NZE A;  3AG2 C;  1LKX A;  1LVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...