4J32B

Structure of the effector - immunity system tae4 / tai4 from salmonella typhimurium
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
100
Chain Sequence
b'QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Toxin/inhibitor
total genus 37
structure length 100
sequence length 101
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4j32B00
4HFFB 3ZIBA 4JURI 4J30B 4AX2A 4J32B 4B6IA 4HFKB
chains in the Genus database with same CATH superfamily
3AG1C 3EHMA 3C8ZA 2NUTA 3O10A 3DJUB 2WZFA 2GAQA 3LUTB 4C3DA 2R7QA 3MBGA 1RCPA 4N6CA 5DVWA 2YKZA 1V74B 3HNJA 2HFIA 1EQ1A 3GEHA 4XEVA 4J7YA 1CGME 4G7OF 1VK5A 4E7ZA 1L7CA 4J30B 3RH3A 1M56C 4Z9JA 1BDJB 2D5RB 3OWTA 5D92A 4MTGA 2QY9A 5E3AA 1ZHZA 2MHRA 3T9OA 1YJGA 3RQGA 4DBRA 4KNVA 3E70C 4EUKB 3EGXA 3C62A 1XZPA 3AGUA 4OINF 1QKRA 2LCHA 2O9XA 2G3KA 4BJ6C 2DI3A 2JPUA 4CS9C 4IJJA 3Q7LA 2CYDA 3T4RA 2I8BA 2YRFA 3JRTA 2Y3HA 5A6KA 1LM3B 1MNDA 2AU5A 4FWVA 5A6BD 5BUOA 3DZAA 1GM5A 3LLKA 1OCRC 1A0BA 5HV9A 1M6TA 2R25A 1I4YA 2EILC 5D91A 3UMKA 5EGYA 1KU2A 3Q7GA 2J0XA 5DS6A 1A7DA 3M4BA 1YLMA 2HSQA 5L0DA 2P7VA 1RJ9B 1V4AA 4XPYA 2YLDA 1NFNA 3EGDB 1MMDA 3RF3A 2WB7A 3GODA 3MLGA 1JRAA 2R7UA 4JIOA 2YL3A 3JTLO 3SXKA 3K1IC 2J7PA 1TQGA 3U5SA 2AVKA 4YJWA 2X51A 1S7ZA 1HW1A 1OR2A 3S27A 5L3VA 3S29A 4PFOA 3SNHA 4P6IC 2AP3A 1AUEA 1MMGA 1OXBA 3CAXA 3VM6A 1TKNA 4A2NB 5B3SC 1Y6DA 4D4NA 2M64A 4B6IA 5TJ5E 2Z15A 2DYRC 3B0PA 3V5ZA 2KK1A 1RXQA 5KYYA 3U3FA 1MMNA 4GEHA 4EIYA 3EG9B 3NYMA 5COMA 4EBJA 2W4MA 4OIPF 5DS4A 4Z9HA 4EBKA 4CDAA 4NTBA 1VMAA 4RDAA 3WODF 1E83A 3W8IA 1QQ3A 5DQTA 2MYSA 1JPNA 3OA1A 4O6MA 4Z9IA 1KTMA 4JW1A 1FFTC 2YL0A 3V7OA 1YYXA 3BRJA 2HKVA 2NSGA 3JYHA 3ZDLA 4U5HA 1WATA 2UUHA 4X0RA 1M2VA 4YN0B 2R7WA 4PFPA 5AC5A 2Y3BA 3RFYA 2H7BA 1BR4A 3C8GA 5BQGA 3B71A 1V55C 4U5CE 3ABKC 3SP1A 4R32A 3H2VA 4ZLCA 1TWGA 1L3PA 1LPEA 2J8WA 1U0BB 3F46A 5KYNA 2AWYA 3TOMA 1WGWA 1RMVA 2L7AA 3QW0A 2OG2A 4N4WA 1YZAA 5KYWA 4YK5A 2A6EF 1RKEA 1SYQA 2IBFA 2NUPB 3AG3C 3GM2A 1NLXA 4G0HA 4J32B 4O7GA 3VF0A 3ZQYA 4ANJA 1OW6A 2VB6A 2CCYA 3S90A 1TFKB 1RKCA 1BR2A 1ZHTA 2OKUA 3QTHA 1NG1A 1OCOC 2XL6A 2EPOA 3JSZA 4BJ5C 1LVKA 1MQVA 2GDCA 2OJQA 4DVZA 1G4US 3U2LA 3FAPB 4MW3A 4NQFA 4AE4A 3AG4C 4E0IA 2P61A 3J06A 1WN0A 1M2OA 3W4YA 3PHF2 1NU7D 2YVKA 1A7EA 5T1DB 1FMVA 3L1MA 2WZGA 3MX3A 3AQBA 3R7CA 1I5NA 1R4TA 3HKKA 2DYSC 1FR0A 2L6HA 2QUPA 5DLJA 1ORYA 1F1MA 3LLIA 4NY3A 4WJ0A 1T6QA 1WTYA 1ORSC 4GYTA 1QPUA 3T6BA 4CX9A 2RD9A 2VH3A 3EQLF 2LP4A 2VC9A 2CNWA 2VCAA 1OR3A 2YZSA 1O3UA 5GPGB 2HS5A 2YHSA 1QLEC 5BQHA 4OIQF 1PD1A 3SZRA 2LFDA 3A11A 3Q6NA 4MTFA 2FGYA 4YT2A 3DM9B 3K1HA 2XLMA 3KPHA 1J8MF 4U5EE 1LE2A 3W8HA 1SZIA 5L3QA 5KYXA 4BJ5A 3UMHA 3C7JA 4DXWA 1MNEA 1D0YA 2J9UA 4MVSA 4N06A 3OEOA 4CS8A 4LACB 5EK0A 1H6GA 1SMYF 1PV3A 2C03A 3HJCA 4YL0A 1NBBA 2ZPAA 3KH2A 4YL3A 1D1AA 1H7IA 3RIPA 3EZHA 4AL1A 2EIJC 4JVSA 3LS1A 4RBNA 5KYUB 4JTCB 4PR9A 1JPJA 5DQZA 4UDVA 3GEEA 3ITFA 3IPMO 3MFNA 3O39A 3EH2A 4P9FA 1Z5ZA 2OU6A 4DBQA 4MVZA 2OQMA 3PCVA 4MW8A 3DKAA 5JVEA 1TWAA 3ZC4A 3WAQA 3EJNA 2GWWA 3EFOA 4NTAA 1YVIA 3GWLA 3IQ5A 5CI9A 3RW0A 2PP4A 2W9YA 2YEVA 1SR2A 1GQAA 3ZQVA 2FFHA 4JURI 4PJJA 2VCCA 1D1BA 1E2XA 1FTSA 3A9CA 3M1CB 3T6GB 1ORJA 3QVYA 1I4ZA 4CSAA 3NMKA 4HFFB 2BL2A 2J9BA 1VTMP 2W4BA 2RSEB 1K05A 2G62A 2XSEA 4Q7CA 4HEAJ 1DOVA 1Q0GA 3M79A 1OQCA 1YA9A 2XL8A 4LDQA 1AVOB 2R03A 2R02A 2WL8A 4W8KA 4LERA 4G7ZF 2XXAA 3UGOA 2PNOA 3GORA 4PJLA 2WZLA 5L0JA 4BJTA 1JAFA 1HE9A 3QZCA 4K1OA 3DWWA 4C7OB 1JMWA 1TR2A 3WHNA 3L8IA 4U9EA 1VB5A 2NG1A 4XWJA 3VAYA 4Q4ZF 3R2PA 4DRJB 5L0CA 3IHUA 4YT5A 2QLAA 3TULA 1EI7A 2R7TA 4Q5SF 3FHDA 1D0ZA 4OD5A 1NU9C 2M4EA 2Y69C 3CSKA 3LNRA 1T5OA 3N24A 4FX5A 1Z7Qc 3US6A 3NMJA 1LS4A 1ZU5A 4C3BA 1YA7O 2P0NA 5K0IA 2Q4FA 2KJGA 1G5ZA 3VYWA 1Z6AA 1GGQA 1BBHA 4U5GA 3JRMO 2P1AA 2QNLA 3C18A 4BJ6A 5CI8A 1T9KA 3U9JA 4CS9A 2ETSA 2ZXPA 4LLCA 5JRAA 3GWNA 2XLEA 3NMIA 2KNHA 2LK4A 2XS8A 2WVOA 5KYWB 3DAGA 1Q0DA 2V26A 2Y3DA 1CPQA 3FOPA 2D4UA 2Q9AA 4O6NA 4JE9A 4K7BA 3S9OA 3U9MA 4E7SA 5L0IA 5COGA 3ZWIA 3W2VA 3FMSA 2J7PD 3AJMA 3GANA 2UUIA 3H65A 4ULWA 4JRZA 5L0GA 2YWAA 1T6UA 3EH1A 4L6RA 3WG7C 4E18A 1LS1A 2A69F 3S28A 1Q0FA 4KI2A 1ZVZA 2LFFA 4W8PA 1HY5A 3K1IA 3CQZA 5A6AA 4G78A 4K0DA 4KBLA 1K40A 4I3MA 4ULVA 2BC5A 1B68A 5JUAA 4RD9A 2XRHA 1O5HA 3K33A 1LIHA 1RJ9A 4DVYP 2MWQA 5IY5C 5L0FA 3O6XA 2R7XA 5F5FA 2H7OA 3UGPA 3DE8A 3EGDA 3JT1A 3MYIA 2EPLX 4DJ9A 2Y39A 2AWCA 4XLPF 3ZG1A 2A1DD 1ST6A 1S05A 3BEHA 4FESA 2NPUA 1OXKA 3FXHA 4FAPB 1OKKA 1FFHA 3U2MA 2IXOA 3C8GD 3G4XA 3NYLA 1GS9A 2CDQA 3GEIA 3NYJA 3AGTA 4PJMA 3SXZA 1WOLA 2IYLD 3SXMA 2R7VA 3JSEO 1IW7F 1BR1A 5L0HA 4QI2A 2ZXRA 2J46A 1HW2A 1BZ4A 2XL4A 3CZ6A 3LAYA 4NCQA 5AGFA 2HV7A 4JCHA 1OCZC 3LJBA 1QSPA 1UFBA 2Q9CA 3B9QA 4MVQA 1LI7A 4MVOA 4YL1A 4JJFA 3O55A 4XEKA 1PD0A 1LI5A 3LS0A 3TOLA 4XPXA 2NUTB 1XWJA 2KW3C 3NKEA 4E17A 1ZW3A 2KGOA 1C02A 2J45A 1HE1A 2XS1A 5AC4A 1YYJA 1ZHWA 3E9VA 2YL7A 4G7HF 2BE5F 2A68F 2WVQA 3SEOA 1YDIA 3LEOA 2R7OA 1O87A 4GQHA 4DRHB 4BG0A 4U5BE 2XM4A 2EIKC 4JCZA 3Q6MA 5JP7A 2NSFA 2L9JA 4AK9A 2OOCA 2DB4A 3EGXB 4XPWA 1VYKA 1LKXA 1PCXA 1Q0KA 3K6BA 3FDQA 3T6JA 2NUPA 2CW0F 3FVYA 4IB4A 3ABMC 3PDMP 2E87A 1VLSA 2DGJA 2CNWD 1A7VA 1K04A 1ZYRF 1VOMA 3DM5A 2TMVP 1EA8A 4I1MA 1Y4CA 4M63A 2XXAB 2XM0A 1LE4A 3V5YA 1JOGA 2XLDA 2Y3GA 1OCCC 4EKWA 4HFKB 2G3VA 2YLIA 2KSFA 2GFHA 2J0WA 1HMDA 2OJED 3V5XA 1H9TA 3I5QA 4BEJA 3ZTMA 2IXPA 4JTAB 4CIHA 3U3BA 3L8JA 4DRIB 2PX0A 2HJMA 3RQFA 1Z63A 4LDKA 2C04A 1G4WR 3EHNA 4LDRA 4YT8A 4CDYA 2CGEA 4MQ9F 4O6YA 3LNMB 3ATPA 4IRUA 3ZTZA 3EZIA 4EBBA 5E2QA 2JX0A 2HSBA 3SXYA 5B3IA 2EPMX 4MVMA 3U0CA 2R9RB 4MS2A 1ZU4A 2YL1A 1J8YF 4BJ1A 2OCCC 5A69A 4MTOA 5A6BA 1XZQA 3RKOF 2Q9BA 4BEMJ 2OEXA 1YAUO 4XQ1A 3CEXA 1Z3IX 5DS5A 2VCBA 2R7RA 1T6IA 3ZVRA 5KYYB 3FAJA 1JR8A 3JYYA 4QI0A 5JLIA 3POVA 2F22A 3UNGC 3KMIA 2B0JA 2XLHA 3K66A 5COFA 3NKDA 2X0CA 1G8XA 1TWHA 4IWBA 4OIOF 4I1OB 2XLWA 1FMWA 3JZ0A 1KNYA 2QTVA 3IQCA 1Q0MA 2EPKX 2OEVA 1M57C 1U89A 3IQ6A 4MVRA 3VRCA 3ZSUA 1A41A 2ZXWC 4EWCA 3HNKA 4H4KC 3S0XA 3KYJA 1M2VB 2HZ8A 5KYUA 4NC3A 3C8GB 4JZAA 2EINC 4NTFA 3AQCA 4DOZA 3F47A 2YLGA 2ZXOA 5T3TA 2WVNA 3RVYA 2IXNA 4CS7A 1CGOA 1YZCA 5FZTA 4MNDA 1YARO 4I44A 3W2WA 3UR3C 3DAFA 1APCA 2L81A 4WGYA 4BPMA 5HSWA 1TFOB 2ZD9A 4IAQA 2A0BA 4CJOA 1E86A 1UG7A 4IARA 2LSEA 3M4CA 1AEPA 1RKEB 3I5PA 5E33A 4IGGA 1C17M 2I15A 2A0UA 3ASOC 5B1AC 4ZLDA 1V54C 3DE9A 3QMKA 3M15A 3HNIA 2L6FA 3ABLC 2PBEA 4OIRF 3TJ6A 2H7VC 2HMZA 4OD4A 3GM3A 3AOUA 1WASA 4AE4B 2IXMA 1H9GA 2HV6A 3TQOA 4C7OA 4KNWA 3KKBA 5BQIA 3HNLA 5EHHA 4U5FE 1NSGB 2KQ9A 2LQGA 2PFDA 3C63A 4IAOA 2LIGA 3DMDA 3U8VA 4WABA 4CJGA 3GM1A 4JTDB 1EKYA 4E0HA 2PX3A 3NG1A 1W2WA 1D1CA 1WWPA 4P9TA 4U5DE 4O79A 5JSLA 4PACA 3X2QC 3HTKC 1FAPB 1MMAA 3RYLA 4AL0A 4N6HA 1C03A 1TWCA 4CBEA 1E84A 5CIVA 4YT4A 2Q7RA 4KC9A 2Q00A 4QDLA 3TK0A 3IEEA 2PF4E 2R7SA 4JKVA 1ZW2A 3DXJF 3DD7A 5F5HA 4HE8D 1R5ID 1Z23A 2B0HA 4CDVA 3I4UA 5KYXB 3DJNB 3KL4A 1QZXA 3H2UA 3QVZA 2VASA 3K7DA 3QW1A 5E3CA 3ECSA 256BA 2H8AA 3NDBB 3LESA 3EG9A 2P6VA 1T01A 3NRHA 2KC3A 2HUJA 1D0XA 1DOWA 1OW7A 2W45A 5T3WA 2XLVA 5B1BC 3B29A 4PK4A 4XEFA 2ICWG 1OKKD 2A6HF 4J7TA 2ASRA 4D4XA 4CIPA 1N1CA 4JEBA 1U6HA 2LD6A 2YQYA 3G4ZA 4XLNF 5JS5A 3EPVA 4JEAA 4U9DA 3LEVA 1ZZPA 3UMIA 4CS8C 4XTKA 1E85A 4AX2A 2Q3TA 3EFOB 3U8PA 1OW8A 3L34A 3HLZA 5FCLA 5F28E 4ONSA 3N2ZB 3KYIA 2J9WA 3MYFA 3SYNA 1IZMA 1ZHYA 2EPNA 1CGNA 2FAPB 3AG2C 3TD7A 2GA0A 3JCUQ 3ASNC 3DI5A 1QVXA 3G50A 1HMOA 2IM8A 1FNTc 4H54A 4PJNA 3L0IA 2HMQA 2KYHA 2XLOA 1VLTA 3IQTA 3N0TA 2HJ3A 4F4BA 3S84A 5JT4A 1ZHXA 4ER9A 4EHPA 3B0VC 2L6GA 3B0UX 3FOOA 3PMRA 3TJ5A 4A4AA 3RQEA 5A6JA 3X1OA 4LLEA 4CSAC 1NZEA 4C3EA 2EIMC 2IOQA 2R05A 2QE9A 4MVUA 4WGZA 3RVZA 1CPRA 2JD3A 4JC7A 1SF8A 2V3CC 3ZIBA 1VYIA 4JJGA 1NFOA 4YWQA 2J9VA
chains in the Genus database with same CATH topology
3AG1C 3EHMA 2NUTA 3DJUB 2WZFA 4C3DA 2R7QA 5DVWA 4G7OF 1VK5A 4E7ZA 4J30B 3RH3A 1M56C 5D92A 2D5RB 3OWTA 5E3AA 2QY9A 1ZHZA 4DBRA 4KNVA 3E70C 3EGXA 4OINF 2O9XA 2G3KA 4BJ6C 4CS9C 4IJJA 3Q7LA 3T4RA 2I8BA 3JRTA 2Y3HA 1MNDA 4FWVA 5BUOA 3DZAA 3LLKA 1OCRC 2EILC 5D91A 3UMKA 5EGYA 1KU2A 3Q7GA 2J0XA 5DS6A 2P7VA 1RJ9B 3EGDB 1MMDA 2WB7A 3GODA 3MLGA 2R7UA 3K1IC 2J7PA 4YJWA 2X51A 1S7ZA 3S27A 5L3VA 3S29A 4PFOA 3SNHA 4P6IC 1MMGA 4A2NB 1TKNA 5B3SC 4B6IA 2Z15A 2DYRC 3B0PA 5KYYA 1MMNA 4GEHA 3EG9B 3NYMA 4OIPF 2W4MA 5DS4A 3WODF 1VMAA 4RDAA 3W8IA 5DQTA 2MYSA 1JPNA 3OA1A 4O6MA 4JW1A 1FFTC 3V7OA 3JYHA 4U5HA 4X0RA 1M2VA 4YN0B 2R7WA 4PFPA 2Y3BA 3RFYA 2H7BA 1BR4A 1V55C 4U5CE 3ABKC 3SP1A 4ZLCA 1TWGA 3F46A 5KYNA 1WGWA 2OG2A 5KYWA 2A6EF 3AG3C 2NUPB 4G0HA 4O7GA 4ANJA 4J32B 2VB6A 1BR2A 1ZHTA 1NG1A 1OCOC 3JSZA 4BJ5C 1LVKA 4DVZA 4AE4A 3AG4C 1M2OA 3PHF2 1NU7D 5T1DB 1FMVA 2WZGA 3MX3A 3AQBA 2DYSC 5DLJA 3LLIA 4NY3A 4WJ0A 4GYTA 3T6BA 2VH3A 3EQLF 2CNWA 2YZSA 2YHSA 1QLEC 4OIQF 1PD1A 3SZRA 3Q6NA 2FGYA 4YT2A 3DM9B 3K1HA 3W8HA 4U5EE 1J8MF 1SZIA 5L3QA 5KYXA 4BJ5A 3UMHA 1MNEA 1D0YA 2J9UA 4N06A 3OEOA 4CS8A 4LACB 1SMYF 2C03A 3HJCA 2ZPAA 3KH2A 1D1AA 3RIPA 5KYUB 3EZHA 2EIJC 4JVSA 3LS1A 4RBNA 1JPJA 5DQZA 3ITFA 3O39A 3EH2A 1Z5ZA 4DBQA 1TWAA 3ZC4A 3EJNA 3EFOA 5CI9A 2PP4A 2W9YA 2YEVA 2FFHA 4JURI 4PJJA 1D1BA 1FTSA 3M1CB 4CSAA 4HFFB 2W4BA 2XSEA 2G62A 4Q7CA 4HEAJ 2WL8A 2XXAA 4W8KA 4G7ZF 4LERA 3UGOA 4PJLA 2WZLA 4BJTA 3QZCA 4C7OB 1TR2A 3VAYA 4Q4ZF 2NG1A 4XWJA 4YT5A 2R7TA 4Q5SF 3FHDA 1D0ZA 4OD5A 1NU9C 2M4EA 2Y69C 3CSKA 3LNRA 3N24A 4FX5A 1ZU5A 4C3BA 2KJGA 3VYWA 1Z6AA 4U5GA 4BJ6A 5CI8A 4CS9A 2ZXPA 4LLCA 2KNHA 2WVOA 5KYWB 3DAGA 2Y3DA 2V26A 4O6NA 2Q9AA 4E7SA 4K7BA 3W2VA 2J7PD 3GANA 3H65A 4ULWA 3EH1A 3WG7C 1LS1A 2A69F 3S28A 4KI2A 3CQZA 4K0DA 4KBLA 4I3MA 4RD9A 2XRHA 1O5HA 3K33A 1RJ9A 4DVYP 2MWQA 5IY5C 5F5FA 3O6XA 2R7XA 2H7OA 3UGPA 3EGDA 4XLPF 3JT1A 2Y39A 3ZG1A 2A1DD 1ST6A 4FESA 1OKKA 1FFHA 2IXOA 3NYLA 2CDQA 3NYJA 4PJMA 2R7VA 2IYLD 1IW7F 1BR1A 4QI2A 2ZXRA 2J46A 2XL4A 3LAYA 3CZ6A 2HV7A 4JCHA 1OCZC 3LJBA 2Q9CA 3B9QA 4JJFA 1PD0A 3LS0A 2NUTB 2KW3C 3NKEA 2KGOA 2J45A 4G7HF 1ZHWA 3E9VA 2BE5F 2A68F 2WVQA 3SEOA 2R7OA 1O87A 4BG0A 4U5BE 2EIKC 3Q6MA 2L9JA 4AK9A 3EGXB 1VYKA 1LKXA 1PCXA 3K6BA 3FDQA 3T6JA 2NUPA 2CW0F 3FVYA 3ABMC 2E87A 2DGJA 2CNWD 1ZYRF 3DM5A 1VOMA 4I1MA 4M63A 2XXAB 2Y3GA 1OCCC 4HFKB 2G3VA 2GFHA 2J0WA 3I5QA 4BEJA 2IXPA 4CIHA 2PX0A 1Z63A 2C04A 4YT8A 3EHNA 2CGEA 4MQ9F 4O6YA 4IRUA 4EBBA 3EZIA 5E2QA 1ZU4A 1J8YF 4BJ1A 2OCCC 3RKOF 2Q9BA 1Z3IX 5DS5A 2R7RA 5KYYB 3ZVRA 3POVA 3FAJA 4QI0A 3UNGC 3KMIA 2B0JA 3K66A 3NKDA 1G8XA 1TWHA 4IWBA 4OIOF 4I1OB 1FMWA 2QTVA 3ZSUA 1M57C 4EWCA 3S0XA 2ZXWC 4H4KC 1M2VB 5KYUA 4JZAA 4DOZA 2EINC 3AQCA 3F47A 2ZXOA 5T3TA 2WVNA 2IXNA 4CS7A 4MNDA 4I44A 3W2WA 3UR3C 3DAFA 2L81A 5HSWA 2LSEA 3I5PA 5E33A 3ASOC 5B1AC 4ZLDA 1V54C 3QMKA 3ABLC 4OIRF 2H7VC 4OD4A 4AE4B 2IXMA 2HV6A 4C7OA 4KNWA 3KKBA 5EHHA 4U5FE 2KQ9A 2PFDA 4IAOA 3DMDA 2PX3A 3NG1A 1W2WA 1D1CA 4U5DE 4O79A 3X2QC 3HTKC 3RYLA 1MMAA 1TWCA 4CBEA 4YT4A 4KC9A 4QDLA 2R7SA 3IEEA 2PF4E 3DXJF 3DD7A 5F5HA 4HE8D 1Z23A 3I4UA 5KYXB 3DJNB 3KL4A 1QZXA 2VASA 3K7DA 5E3CA 3ECSA 3NDBB 3LESA 3EG9A 2P6VA 3NRHA 1D0XA 2W45A 5T3WA 5B1BC 4PK4A 1OKKD 2A6HF 1N1CA 4XLNF 3EPVA 3UMIA 3LEVA 4CS8C 4XTKA 4AX2A 2Q3TA 3EFOB 3L34A 3HLZA 5FCLA 3N2ZB 2J9WA 3SYNA 1IZMA 1ZHYA 3AG2C 3TD7A 3JCUQ 3ASNC 4PJNA 3L0IA 3N0TA 4F4BA 1ZHXA 3B0VC 3B0UX 3PMRA 3X1OA 4LLEA 4CSAC 1NZEA 4C3EA 2EIMC 2IOQA 2JD3A 1SF8A 2V3CC 3ZIBA 1VYIA 4JJGA 4YWQA 2J9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFF B;  3ZIB A;  4JUR I;  4J30 B;  4AX2 A;  4J32 B;  4B6I A;  4HFK B; 
#chains in the Genus database with same CATH topology
 3AG1 C;  3EHM A;  3C8Z A;  2NUT A;  3O10 A;  3DJU B;  2WZF A;  2GAQ A;  3LUT B;  4C3D A;  2R7Q A;  3MBG A;  1RCP A;  4N6C A;  5DVW A;  2YKZ A;  1V74 B;  3HNJ A;  2HFI A;  1EQ1 A;  3GEH A;  4XEV A;  4J7Y A;  1CGM E;  4G7O F;  1VK5 A;  4E7Z A;  1L7C A;  4J30 B;  3RH3 A;  1M56 C;  4Z9J A;  1BDJ B;  2D5R B;  3OWT A;  5D92 A;  4MTG A;  2QY9 A;  5E3A A;  1ZHZ A;  2MHR A;  3T9O A;  1YJG A;  3RQG A;  4DBR A;  4KNV A;  3E70 C;  4EUK B;  3EGX A;  3C62 A;  1XZP A;  3AGU A;  4OIN F;  1QKR A;  2LCH A;  2O9X A;  2G3K A;  4BJ6 C;  2DI3 A;  2JPU A;  4CS9 C;  4IJJ A;  3Q7L A;  2CYD A;  3T4R A;  2I8B A;  2YRF A;  3JRT A;  2Y3H A;  5A6K A;  1LM3 B;  1MND A;  2AU5 A;  4FWV A;  5A6B D;  5BUO A;  3DZA A;  1GM5 A;  3LLK A;  1OCR C;  1A0B A;  5HV9 A;  1M6T A;  2R25 A;  1I4Y A;  2EIL C;  5D91 A;  3UMK A;  5EGY A;  1KU2 A;  3Q7G A;  2J0X A;  5DS6 A;  1A7D A;  3M4B A;  1YLM A;  2HSQ A;  5L0D A;  2P7V A;  1RJ9 B;  1V4A A;  4XPY A;  2YLD A;  1NFN A;  3EGD B;  1MMD A;  3RF3 A;  2WB7 A;  3GOD A;  3MLG A;  1JRA A;  2R7U A;  4JIO A;  2YL3 A;  3JTL O;  3SXK A;  3K1I C;  2J7P A;  1TQG A;  3U5S A;  2AVK A;  4YJW A;  2X51 A;  1S7Z A;  1HW1 A;  1OR2 A;  3S27 A;  5L3V A;  3S29 A;  4PFO A;  3SNH A;  4P6I C;  2AP3 A;  1AUE A;  1MMG A;  1OXB A;  3CAX A;  3VM6 A;  1TKN A;  4A2N B;  5B3S C;  1Y6D A;  4D4N A;  2M64 A;  4B6I A;  5TJ5 E;  2Z15 A;  2DYR C;  3B0P A;  3V5Z A;  2KK1 A;  1RXQ A;  5KYY A;  3U3F A;  1MMN A;  4GEH A;  4EIY A;  3EG9 B;  3NYM A;  5COM A;  4EBJ A;  2W4M A;  4OIP F;  5DS4 A;  4Z9H A;  4EBK A;  4CDA A;  4NTB A;  1VMA A;  4RDA A;  3WOD F;  1E83 A;  3W8I A;  1QQ3 A;  5DQT A;  2MYS A;  1JPN A;  3OA1 A;  4O6M A;  4Z9I A;  1KTM A;  4JW1 A;  1FFT C;  2YL0 A;  3V7O A;  1YYX A;  3BRJ A;  2HKV A;  2NSG A;  3JYH A;  3ZDL A;  4U5H A;  1WAT A;  2UUH A;  4X0R A;  1M2V A;  4YN0 B;  2R7W A;  4PFP A;  5AC5 A;  2Y3B A;  3RFY A;  2H7B A;  1BR4 A;  3C8G A;  5BQG A;  3B71 A;  1V55 C;  4U5C E;  3ABK C;  3SP1 A;  4R32 A;  3H2V A;  4ZLC A;  1TWG A;  1L3P A;  1LPE A;  2J8W A;  1U0B B;  3F46 A;  5KYN A;  2AWY A;  3TOM A;  1WGW A;  1RMV A;  2L7A A;  3QW0 A;  2OG2 A;  4N4W A;  1YZA A;  5KYW A;  4YK5 A;  2A6E F;  1RKE A;  1SYQ A;  2IBF A;  2NUP B;  3AG3 C;  3GM2 A;  1NLX A;  4G0H A;  4J32 B;  4O7G A;  3VF0 A;  3ZQY A;  4ANJ A;  1OW6 A;  2VB6 A;  2CCY A;  3S90 A;  1TFK B;  1RKC A;  1BR2 A;  1ZHT A;  2OKU A;  3QTH A;  1NG1 A;  1OCO C;  2XL6 A;  2EPO A;  3JSZ A;  4BJ5 C;  1LVK A;  1MQV A;  2GDC A;  2OJQ A;  4DVZ A;  1G4U S;  3U2L A;  3FAP B;  4MW3 A;  4NQF A;  4AE4 A;  3AG4 C;  4E0I A;  2P61 A;  3J06 A;  1WN0 A;  1M2O A;  3W4Y A;  3PHF 2;  1NU7 D;  2YVK A;  1A7E A;  5T1D B;  1FMV A;  3L1M A;  2WZG A;  3MX3 A;  3AQB A;  3R7C A;  1I5N A;  1R4T A;  3HKK A;  2DYS C;  1FR0 A;  2L6H A;  2QUP A;  5DLJ A;  1ORY A;  1F1M A;  3LLI A;  4NY3 A;  4WJ0 A;  1T6Q A;  1WTY A;  1ORS C;  4GYT A;  1QPU A;  3T6B A;  4CX9 A;  2RD9 A;  2VH3 A;  3EQL F;  2LP4 A;  2VC9 A;  2CNW A;  2VCA A;  1OR3 A;  2YZS A;  1O3U A;  5GPG B;  2HS5 A;  2YHS A;  1QLE C;  5BQH A;  4OIQ F;  1PD1 A;  3SZR A;  2LFD A;  3A11 A;  3Q6N A;  4MTF A;  2FGY A;  4YT2 A;  3DM9 B;  3K1H A;  2XLM A;  3KPH A;  1J8M F;  4U5E E;  1LE2 A;  3W8H A;  1SZI A;  5L3Q A;  5KYX A;  4BJ5 A;  3UMH A;  3C7J A;  4DXW A;  1MNE A;  1D0Y A;  2J9U A;  4MVS A;  4N06 A;  3OEO A;  4CS8 A;  4LAC B;  5EK0 A;  1H6G A;  1SMY F;  1PV3 A;  2C03 A;  3HJC A;  4YL0 A;  1NBB A;  2ZPA A;  3KH2 A;  4YL3 A;  1D1A A;  1H7I A;  3RIP A;  3EZH A;  4AL1 A;  2EIJ C;  4JVS A;  3LS1 A;  4RBN A;  5KYU B;  4JTC B;  4PR9 A;  1JPJ A;  5DQZ A;  4UDV A;  3GEE A;  3ITF A;  3IPM O;  3MFN A;  3O39 A;  3EH2 A;  4P9F A;  1Z5Z A;  2OU6 A;  4DBQ A;  4MVZ A;  2OQM A;  3PCV A;  4MW8 A;  3DKA A;  5JVE A;  1TWA A;  3ZC4 A;  3WAQ A;  3EJN A;  2GWW A;  3EFO A;  4NTA A;  1YVI A;  3GWL A;  3IQ5 A;  5CI9 A;  3RW0 A;  2PP4 A;  2W9Y A;  2YEV A;  1SR2 A;  1GQA A;  3ZQV A;  2FFH A;  4JUR I;  4PJJ A;  2VCC A;  1D1B A;  1E2X A;  1FTS A;  3A9C A;  3M1C B;  3T6G B;  1ORJ A;  3QVY A;  1I4Z A;  4CSA A;  3NMK A;  4HFF B;  2BL2 A;  2J9B A;  1VTM P;  2W4B A;  2RSE B;  1K05 A;  2G62 A;  2XSE A;  4Q7C A;  4HEA J;  1DOV A;  1Q0G A;  3M79 A;  1OQC A;  1YA9 A;  2XL8 A;  4LDQ A;  1AVO B;  2R03 A;  2R02 A;  2WL8 A;  4W8K A;  4LER A;  4G7Z F;  2XXA A;  3UGO A;  2PNO A;  3GOR A;  4PJL A;  2WZL A;  5L0J A;  4BJT A;  1JAF A;  1HE9 A;  3QZC A;  4K1O A;  3DWW A;  4C7O B;  1JMW A;  1TR2 A;  3WHN A;  3L8I A;  4U9E A;  1VB5 A;  2NG1 A;  4XWJ A;  3VAY A;  4Q4Z F;  3R2P A;  4DRJ B;  5L0C A;  3IHU A;  4YT5 A;  2QLA A;  3TUL A;  1EI7 A;  2R7T A;  4Q5S F;  3FHD A;  1D0Z A;  4OD5 A;  1NU9 C;  2M4E A;  2Y69 C;  3CSK A;  3LNR A;  1T5O A;  3N24 A;  4FX5 A;  1Z7Q c;  3US6 A;  3NMJ A;  1LS4 A;  1ZU5 A;  4C3B A;  1YA7 O;  2P0N A;  5K0I A;  2Q4F A;  2KJG A;  1G5Z A;  3VYW A;  1Z6A A;  1GGQ A;  1BBH A;  4U5G A;  3JRM O;  2P1A A;  2QNL A;  3C18 A;  4BJ6 A;  5CI8 A;  1T9K A;  3U9J A;  4CS9 A;  2ETS A;  2ZXP A;  4LLC A;  5JRA A;  3GWN A;  2XLE A;  3NMI A;  2KNH A;  2LK4 A;  2XS8 A;  2WVO A;  5KYW B;  3DAG A;  1Q0D A;  2V26 A;  2Y3D A;  1CPQ A;  3FOP A;  2D4U A;  2Q9A A;  4O6N A;  4JE9 A;  4K7B A;  3S9O A;  3U9M A;  4E7S A;  5L0I A;  5COG A;  3ZWI A;  3W2V A;  3FMS A;  2J7P D;  3AJM A;  3GAN A;  2UUI A;  3H65 A;  4ULW A;  4JRZ A;  5L0G A;  2YWA A;  1T6U A;  3EH1 A;  4L6R A;  3WG7 C;  4E18 A;  1LS1 A;  2A69 F;  3S28 A;  1Q0F A;  4KI2 A;  1ZVZ A;  2LFF A;  4W8P A;  1HY5 A;  3K1I A;  3CQZ A;  5A6A A;  4G78 A;  4K0D A;  4KBL A;  1K40 A;  4I3M A;  4ULV A;  2BC5 A;  1B68 A;  5JUA A;  4RD9 A;  2XRH A;  1O5H A;  3K33 A;  1LIH A;  1RJ9 A;  4DVY P;  2MWQ A;  5IY5 C;  5L0F A;  3O6X A;  2R7X A;  5F5F A;  2H7O A;  3UGP A;  3DE8 A;  3EGD A;  3JT1 A;  3MYI A;  2EPL X;  4DJ9 A;  2Y39 A;  2AWC A;  4XLP F;  3ZG1 A;  2A1D D;  1ST6 A;  1S05 A;  3BEH A;  4FES A;  2NPU A;  1OXK A;  3FXH A;  4FAP B;  1OKK A;  1FFH A;  3U2M A;  2IXO A;  3C8G D;  3G4X A;  3NYL A;  1GS9 A;  2CDQ A;  3GEI A;  3NYJ A;  3AGT A;  4PJM A;  3SXZ A;  1WOL A;  2IYL D;  3SXM A;  2R7V A;  3JSE O;  1IW7 F;  1BR1 A;  5L0H A;  4QI2 A;  2ZXR A;  2J46 A;  1HW2 A;  1BZ4 A;  2XL4 A;  3CZ6 A;  3LAY A;  4NCQ A;  5AGF A;  2HV7 A;  4JCH A;  1OCZ C;  3LJB A;  1QSP A;  1UFB A;  2Q9C A;  3B9Q A;  4MVQ A;  1LI7 A;  4MVO A;  4YL1 A;  4JJF A;  3O55 A;  4XEK A;  1PD0 A;  1LI5 A;  3LS0 A;  3TOL A;  4XPX A;  2NUT B;  1XWJ A;  2KW3 C;  3NKE A;  4E17 A;  1ZW3 A;  2KGO A;  1C02 A;  2J45 A;  1HE1 A;  2XS1 A;  5AC4 A;  1YYJ A;  1ZHW A;  3E9V A;  2YL7 A;  4G7H F;  2BE5 F;  2A68 F;  2WVQ A;  3SEO A;  1YDI A;  3LEO A;  2R7O A;  1O87 A;  4GQH A;  4DRH B;  4BG0 A;  4U5B E;  2XM4 A;  2EIK C;  4JCZ A;  3Q6M A;  5JP7 A;  2NSF A;  2L9J A;  4AK9 A;  2OOC A;  2DB4 A;  3EGX B;  4XPW A;  1VYK A;  1LKX A;  1PCX A;  1Q0K A;  3K6B A;  3FDQ A;  3T6J A;  2NUP A;  2CW0 F;  3FVY A;  4IB4 A;  3ABM C;  3PDM P;  2E87 A;  1VLS A;  2DGJ A;  2CNW D;  1A7V A;  1K04 A;  1ZYR F;  1VOM A;  3DM5 A;  2TMV P;  1EA8 A;  4I1M A;  1Y4C A;  4M63 A;  2XXA B;  2XM0 A;  1LE4 A;  3V5Y A;  1JOG A;  2XLD A;  2Y3G A;  1OCC C;  4EKW A;  4HFK B;  2G3V A;  2YLI A;  2KSF A;  2GFH A;  2J0W A;  1HMD A;  2OJE D;  3V5X A;  1H9T A;  3I5Q A;  4BEJ A;  3ZTM A;  2IXP A;  4JTA B;  4CIH A;  3U3B A;  3L8J A;  4DRI B;  2PX0 A;  2HJM A;  3RQF A;  1Z63 A;  4LDK A;  2C04 A;  1G4W R;  3EHN A;  4LDR A;  4YT8 A;  4CDY A;  2CGE A;  4MQ9 F;  4O6Y A;  3LNM B;  3ATP A;  4IRU A;  3ZTZ A;  3EZI A;  4EBB A;  5E2Q A;  2JX0 A;  2HSB A;  3SXY A;  5B3I A;  2EPM X;  4MVM A;  3U0C A;  2R9R B;  4MS2 A;  1ZU4 A;  2YL1 A;  1J8Y F;  4BJ1 A;  2OCC C;  5A69 A;  4MTO A;  5A6B A;  1XZQ A;  3RKO F;  2Q9B A;  4BEM J;  2OEX A;  1YAU O;  4XQ1 A;  3CEX A;  1Z3I X;  5DS5 A;  2VCB A;  2R7R A;  1T6I A;  3ZVR A;  5KYY B;  3FAJ A;  1JR8 A;  3JYY A;  4QI0 A;  5JLI A;  3POV A;  2F22 A;  3UNG C;  3KMI A;  2B0J A;  2XLH A;  3K66 A;  5COF A;  3NKD A;  2X0C A;  1G8X A;  1TWH A;  4IWB A;  4OIO F;  4I1O B;  2XLW A;  1FMW A;  3JZ0 A;  1KNY A;  2QTV A;  3IQC A;  1Q0M A;  2EPK X;  2OEV A;  1M57 C;  1U89 A;  3IQ6 A;  4MVR A;  3VRC A;  3ZSU A;  1A41 A;  2ZXW C;  4EWC A;  3HNK A;  4H4K C;  3S0X A;  3KYJ A;  1M2V B;  2HZ8 A;  5KYU A;  4NC3 A;  3C8G B;  4JZA A;  2EIN C;  4NTF A;  3AQC A;  4DOZ A;  3F47 A;  2YLG A;  2ZXO A;  5T3T A;  2WVN A;  3RVY A;  2IXN A;  4CS7 A;  1CGO A;  1YZC A;  5FZT A;  4MND A;  1YAR O;  4I44 A;  3W2W A;  3UR3 C;  3DAF A;  1APC A;  2L81 A;  4WGY A;  4BPM A;  5HSW A;  1TFO B;  2ZD9 A;  4IAQ A;  2A0B A;  4CJO A;  1E86 A;  1UG7 A;  4IAR A;  2LSE A;  3M4C A;  1AEP A;  1RKE B;  3I5P A;  5E33 A;  4IGG A;  1C17 M;  2I15 A;  2A0U A;  3ASO C;  5B1A C;  4ZLD A;  1V54 C;  3DE9 A;  3QMK A;  3M15 A;  3HNI A;  2L6F A;  3ABL C;  2PBE A;  4OIR F;  3TJ6 A;  2H7V C;  2HMZ A;  4OD4 A;  3GM3 A;  3AOU A;  1WAS A;  4AE4 B;  2IXM A;  1H9G A;  2HV6 A;  3TQO A;  4C7O A;  4KNW A;  3KKB A;  5BQI A;  3HNL A;  5EHH A;  4U5F E;  1NSG B;  2KQ9 A;  2LQG A;  2PFD A;  3C63 A;  4IAO A;  2LIG A;  3DMD A;  3U8V A;  4WAB A;  4CJG A;  3GM1 A;  4JTD B;  1EKY A;  4E0H A;  2PX3 A;  3NG1 A;  1W2W A;  1D1C A;  1WWP A;  4P9T A;  4U5D E;  4O79 A;  5JSL A;  4PAC A;  3X2Q C;  3HTK C;  1FAP B;  1MMA A;  3RYL A;  4AL0 A;  4N6H A;  1C03 A;  1TWC A;  4CBE A;  1E84 A;  5CIV A;  4YT4 A;  2Q7R A;  4KC9 A;  2Q00 A;  4QDL A;  3TK0 A;  3IEE A;  2PF4 E;  2R7S A;  4JKV A;  1ZW2 A;  3DXJ F;  3DD7 A;  5F5H A;  4HE8 D;  1R5I D;  1Z23 A;  2B0H A;  4CDV A;  3I4U A;  5KYX B;  3DJN B;  3KL4 A;  1QZX A;  3H2U A;  3QVZ A;  2VAS A;  3K7D A;  3QW1 A;  5E3C A;  3ECS A;  256B A;  2H8A A;  3NDB B;  3LES A;  3EG9 A;  2P6V A;  1T01 A;  3NRH A;  2KC3 A;  2HUJ A;  1D0X A;  1DOW A;  1OW7 A;  2W45 A;  5T3W A;  2XLV A;  5B1B C;  3B29 A;  4PK4 A;  4XEF A;  2ICW G;  1OKK D;  2A6H F;  4J7T A;  2ASR A;  4D4X A;  4CIP A;  1N1C A;  4JEB A;  1U6H A;  2LD6 A;  2YQY A;  3G4Z A;  4XLN F;  5JS5 A;  3EPV A;  4JEA A;  4U9D A;  3LEV A;  1ZZP A;  3UMI A;  4CS8 C;  4XTK A;  1E85 A;  4AX2 A;  2Q3T A;  3EFO B;  3U8P A;  1OW8 A;  3L34 A;  3HLZ A;  5FCL A;  5F28 E;  4ONS A;  3N2Z B;  3KYI A;  2J9W A;  3MYF A;  3SYN A;  1IZM A;  1ZHY A;  2EPN A;  1CGN A;  2FAP B;  3AG2 C;  3TD7 A;  2GA0 A;  3JCU Q;  3ASN C;  3DI5 A;  1QVX A;  3G50 A;  1HMO A;  2IM8 A;  1FNT c;  4H54 A;  4PJN A;  3L0I A;  2HMQ A;  2KYH A;  2XLO A;  1VLT A;  3IQT A;  3N0T A;  2HJ3 A;  4F4B A;  3S84 A;  5JT4 A;  1ZHX A;  4ER9 A;  4EHP A;  3B0V C;  2L6G A;  3B0U X;  3FOO A;  3PMR A;  3TJ5 A;  4A4A A;  3RQE A;  5A6J A;  3X1O A;  4LLE A;  4CSA C;  1NZE A;  4C3E A;  2EIM C;  2IOQ A;  2R05 A;  2QE9 A;  4MVU A;  4WGZ A;  3RVZ A;  1CPR A;  2JD3 A;  4JC7 A;  1SF8 A;  2V3C C;  3ZIB A;  1VYI A;  4JJG A;  1NFO A;  4YWQ A;  2J9V A; 
#chains in the Genus database with same CATH homology
 3AG1 C;  3EHM A;  2NUT A;  3DJU B;  2WZF A;  4C3D A;  2R7Q A;  5DVW A;  4G7O F;  1VK5 A;  4E7Z A;  4J30 B;  3RH3 A;  1M56 C;  5D92 A;  2D5R B;  3OWT A;  5E3A A;  2QY9 A;  1ZHZ A;  4DBR A;  4KNV A;  3E70 C;  3EGX A;  4OIN F;  2O9X A;  2G3K A;  4BJ6 C;  4CS9 C;  4IJJ A;  3Q7L A;  3T4R A;  2I8B A;  3JRT A;  2Y3H A;  1MND A;  4FWV A;  5BUO A;  3DZA A;  3LLK A;  1OCR C;  2EIL C;  5D91 A;  3UMK A;  5EGY A;  1KU2 A;  3Q7G A;  2J0X A;  5DS6 A;  2P7V A;  1RJ9 B;  3EGD B;  1MMD A;  2WB7 A;  3GOD A;  3MLG A;  2R7U A;  3K1I C;  2J7P A;  4YJW A;  2X51 A;  1S7Z A;  3S27 A;  5L3V A;  3S29 A;  4PFO A;  3SNH A;  4P6I C;  1MMG A;  4A2N B;  1TKN A;  5B3S C;  4B6I A;  2Z15 A;  2DYR C;  3B0P A;  5KYY A;  1MMN A;  4GEH A;  3EG9 B;  3NYM A;  4OIP F;  2W4M A;  5DS4 A;  3WOD F;  1VMA A;  4RDA A;  3W8I A;  5DQT A;  2MYS A;  1JPN A;  3OA1 A;  4O6M A;  4JW1 A;  1FFT C;  3V7O A;  3JYH A;  4U5H A;  4X0R A;  1M2V A;  4YN0 B;  2R7W A;  4PFP A;  2Y3B A;  3RFY A;  2H7B A;  1BR4 A;  1V55 C;  4U5C E;  3ABK C;  3SP1 A;  4ZLC A;  1TWG A;  3F46 A;  5KYN A;  1WGW A;  2OG2 A;  5KYW A;  2A6E F;  3AG3 C;  2NUP B;  4G0H A;  4O7G A;  4ANJ A;  4J32 B;  2VB6 A;  1BR2 A;  1ZHT A;  1NG1 A;  1OCO C;  3JSZ A;  4BJ5 C;  1LVK A;  4DVZ A;  4AE4 A;  3AG4 C;  1M2O A;  3PHF 2;  1NU7 D;  5T1D B;  1FMV A;  2WZG A;  3MX3 A;  3AQB A;  2DYS C;  5DLJ A;  3LLI A;  4NY3 A;  4WJ0 A;  4GYT A;  3T6B A;  2VH3 A;  3EQL F;  2CNW A;  2YZS A;  2YHS A;  1QLE C;  4OIQ F;  1PD1 A;  3SZR A;  3Q6N A;  2FGY A;  4YT2 A;  3DM9 B;  3K1H A;  3W8H A;  4U5E E;  1J8M F;  1SZI A;  5L3Q A;  5KYX A;  4BJ5 A;  3UMH A;  1MNE A;  1D0Y A;  2J9U A;  4N06 A;  3OEO A;  4CS8 A;  4LAC B;  1SMY F;  2C03 A;  3HJC A;  2ZPA A;  3KH2 A;  1D1A A;  3RIP A;  5KYU B;  3EZH A;  2EIJ C;  4JVS A;  3LS1 A;  4RBN A;  1JPJ A;  5DQZ A;  3ITF A;  3O39 A;  3EH2 A;  1Z5Z A;  4DBQ A;  1TWA A;  3ZC4 A;  3EJN A;  3EFO A;  5CI9 A;  2PP4 A;  2W9Y A;  2YEV A;  2FFH A;  4JUR I;  4PJJ A;  1D1B A;  1FTS A;  3M1C B;  4CSA A;  4HFF B;  2W4B A;  2XSE A;  2G62 A;  4Q7C A;  4HEA J;  2WL8 A;  2XXA A;  4W8K A;  4G7Z F;  4LER A;  3UGO A;  4PJL A;  2WZL A;  4BJT A;  3QZC A;  4C7O B;  1TR2 A;  3VAY A;  4Q4Z F;  2NG1 A;  4XWJ A;  4YT5 A;  2R7T A;  4Q5S F;  3FHD A;  1D0Z A;  4OD5 A;  1NU9 C;  2M4E A;  2Y69 C;  3CSK A;  3LNR A;  3N24 A;  4FX5 A;  1ZU5 A;  4C3B A;  2KJG A;  3VYW A;  1Z6A A;  4U5G A;  4BJ6 A;  5CI8 A;  4CS9 A;  2ZXP A;  4LLC A;  2KNH A;  2WVO A;  5KYW B;  3DAG A;  2Y3D A;  2V26 A;  4O6N A;  2Q9A A;  4E7S A;  4K7B A;  3W2V A;  2J7P D;  3GAN A;  3H65 A;  4ULW A;  3EH1 A;  3WG7 C;  1LS1 A;  2A69 F;  3S28 A;  4KI2 A;  3CQZ A;  4K0D A;  4KBL A;  4I3M A;  4RD9 A;  2XRH A;  1O5H A;  3K33 A;  1RJ9 A;  4DVY P;  2MWQ A;  5IY5 C;  5F5F A;  3O6X A;  2R7X A;  2H7O A;  3UGP A;  3EGD A;  4XLP F;  3JT1 A;  2Y39 A;  3ZG1 A;  2A1D D;  1ST6 A;  4FES A;  1OKK A;  1FFH A;  2IXO A;  3NYL A;  2CDQ A;  3NYJ A;  4PJM A;  2R7V A;  2IYL D;  1IW7 F;  1BR1 A;  4QI2 A;  2ZXR A;  2J46 A;  2XL4 A;  3LAY A;  3CZ6 A;  2HV7 A;  4JCH A;  1OCZ C;  3LJB A;  2Q9C A;  3B9Q A;  4JJF A;  1PD0 A;  3LS0 A;  2NUT B;  2KW3 C;  3NKE A;  2KGO A;  2J45 A;  4G7H F;  1ZHW A;  3E9V A;  2BE5 F;  2A68 F;  2WVQ A;  3SEO A;  2R7O A;  1O87 A;  4BG0 A;  4U5B E;  2EIK C;  3Q6M A;  2L9J A;  4AK9 A;  3EGX B;  1VYK A;  1LKX A;  1PCX A;  3K6B A;  3FDQ A;  3T6J A;  2NUP A;  2CW0 F;  3FVY A;  3ABM C;  2E87 A;  2DGJ A;  2CNW D;  1ZYR F;  3DM5 A;  1VOM A;  4I1M A;  4M63 A;  2XXA B;  2Y3G A;  1OCC C;  4HFK B;  2G3V A;  2GFH A;  2J0W A;  3I5Q A;  4BEJ A;  2IXP A;  4CIH A;  2PX0 A;  1Z63 A;  2C04 A;  4YT8 A;  3EHN A;  2CGE A;  4MQ9 F;  4O6Y A;  4IRU A;  4EBB A;  3EZI A;  5E2Q A;  1ZU4 A;  1J8Y F;  4BJ1 A;  2OCC C;  3RKO F;  2Q9B A;  1Z3I X;  5DS5 A;  2R7R A;  5KYY B;  3ZVR A;  3POV A;  3FAJ A;  4QI0 A;  3UNG C;  3KMI A;  2B0J A;  3K66 A;  3NKD A;  1G8X A;  1TWH A;  4IWB A;  4OIO F;  4I1O B;  1FMW A;  2QTV A;  3ZSU A;  1M57 C;  4EWC A;  3S0X A;  2ZXW C;  4H4K C;  1M2V B;  5KYU A;  4JZA A;  4DOZ A;  2EIN C;  3AQC A;  3F47 A;  2ZXO A;  5T3T A;  2WVN A;  2IXN A;  4CS7 A;  4MND A;  4I44 A;  3W2W A;  3UR3 C;  3DAF A;  2L81 A;  5HSW A;  2LSE A;  3I5P A;  5E33 A;  3ASO C;  5B1A C;  4ZLD A;  1V54 C;  3QMK A;  3ABL C;  4OIR F;  2H7V C;  4OD4 A;  4AE4 B;  2IXM A;  2HV6 A;  4C7O A;  4KNW A;  3KKB A;  5EHH A;  4U5F E;  2KQ9 A;  2PFD A;  4IAO A;  3DMD A;  2PX3 A;  3NG1 A;  1W2W A;  1D1C A;  4U5D E;  4O79 A;  3X2Q C;  3HTK C;  3RYL A;  1MMA A;  1TWC A;  4CBE A;  4YT4 A;  4KC9 A;  4QDL A;  2R7S A;  3IEE A;  2PF4 E;  3DXJ F;  3DD7 A;  5F5H A;  4HE8 D;  1Z23 A;  3I4U A;  5KYX B;  3DJN B;  3KL4 A;  1QZX A;  2VAS A;  3K7D A;  5E3C A;  3ECS A;  3NDB B;  3LES A;  3EG9 A;  2P6V A;  3NRH A;  1D0X A;  2W45 A;  5T3W A;  5B1B C;  4PK4 A;  1OKK D;  2A6H F;  1N1C A;  4XLN F;  3EPV A;  3UMI A;  3LEV A;  4CS8 C;  4XTK A;  4AX2 A;  2Q3T A;  3EFO B;  3L34 A;  3HLZ A;  5FCL A;  3N2Z B;  2J9W A;  3SYN A;  1IZM A;  1ZHY A;  3AG2 C;  3TD7 A;  3JCU Q;  3ASN C;  4PJN A;  3L0I A;  3N0T A;  4F4B A;  1ZHX A;  3B0V C;  3B0U X;  3PMR A;  3X1O A;  4LLE A;  4CSA C;  1NZE A;  4C3E A;  2EIM C;  2IOQ A;  2JD3 A;  1SF8 A;  2V3C C;  3ZIB A;  1VYI A;  4JJG A;  4YWQ A;  2J9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...