4J3CA

Crystal structure of 16s ribosomal rna methyltransferase rsme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
Knots found
sequence length
239
structure length
232
Chain Sequence
MQRLFIENALHAGAKHEATREQFNVLRLGEGSSLLVFNGRDGEWRAEIAMPSRQAVLVAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQGKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGSQNPLPILEGIAERRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQATLGDWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 16S ribosomal RNA methyltransferase RsmE
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase E
total genus 55
structure length 232
sequence length 239
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 4j3cA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4j3cA02
1K3RA 4YVKA 3GYQA 2V3JA 4X3MA 4JAKA 5GM8A 5GMCA 2V3KA 1IPAA 4YQBA 4YQ0A 4YQJA 4J3CA 4YQ7A 4YQOA 4KGNA 4YVJA 5D9FA 4YQ5A 3BBDA 4YQPA 1V6ZA 4CNDA 3O7BA 3AXZA 3KNUA 1X7PA 3AI9X 4X3LA 2CX8A 1MXIA 4CNGA 3NK6A 4YQKA 4YQTA 3OIJA 2EGWA 3AIAA 3DCMX 3ONPA 1X7OA 4YVIA 4YQNA 4YQ6A 1OY5A 1NS5A 4XBOA 4YPZA 4E8BA 1Z85A 1O6DA 3L8UA 3OIIA 2HA8A 4JALA 2I6DA 2YY8A 1UAMA 3IEFA 4YQRA 4YQ3A 5CO4A 2O3AA 3NK7A 1VH0A 1UALA 1UAJA 4YQ4A 1VHYA 4YQ1A 3N4KA 2QMMA 4YPWA 2Z0YA 4CNFA 1GZ0A 2QWVA 1J85A 4YQCA 1TO0A 1P9PA 4YQAA 1NXZA 4CNEA 3ILKA 1VHKA 4MCBA 4L69A 4YQIA 3N4JA 4KDZA 1UAKA 4MCCA 3IC6A 3KW2A 4RG1A 4YQ8A 4YQ2A 3KTYA 4YVHA 3BBHA 4H3ZA 4YQQA 4YQSA 4YQGA 3QUVA 4YVGA 1V2XA 3KY7A 2NWAA 4YQLA 5FAIA 4MCDA 4YQ9A 2EGVA 4IG6A 3OINA 1ZJRA 3E5YA 4FAKA 5GMBA 4YPXA 3BBEA 4H3YA 4YPYA 4YQDA 4PZKA
chains in the Genus database with same CATH superfamily
4IOCS 1K3RA 1GTSA 2ZJPS 3GYQA 2V3JA 4YVKA 4X3MA 4JAKA 5GM8A 1QRUA 5GMCA 2V3KA 1IPAA 4YQBA 4YQ0A 4JWFA 4YQJA 5DM7S 2PNWA 5HL7S 4J3CA 4YQ7A 4YQOA 4KGNA 1EXDA 4WFBS 4YVJA 5D9FA 4YQ5A 2PICA 3BBDA 1QTQA 3AIIA 4JWJA 1V6ZA 4YQPA 3O7BA 3AXZA 4CNDA 3KNUA 1QRSA 1X7PA 3AI9X 1GTRA 4X3LA 2CX8A 5JVHS 3CZBA 4IO9S 1DFUP 1MXIA 4CNGA 2AE0X 3NK6A 4YQKA 4YQTA 5GAGW 3OIJA 2EGWA 1B75A 2RE8A 3AIAA 2G6GA 3DCMX 3ONPA 2PI8A 1X7OA 4YVIA 2ZJRS 2HZ7A 4YQNA 3W2WB 1UDXA 4YQ6A 1OY5A 3X1LB 1NS5A 4XBOA 1QRTA 4YPZA 4E8BA 1Z85A 1O6DA 3L8UA 2ZJQS 3OIIA 3J7ZV 2HA8A 3DLLS 4JXZA 4JALA 2I6DA 4FMWA 2YY8A 5GAHW 1UAMA 4WFAS 3IEFA 4U67S 3W2VB 4YQRA 4YQ3A 5CO4A 2O3AA 3NK7A 2PJJA 1VH0A 1UALA 1UAJA 1ZJWA 4YQ4A 1O0BA 1VHYA 4JWGA 4YQ1A 4P2BA 1O0CA 2GAEA 5BNZA 4IOAS 3N4KA 2QMMA 4YPWA 2Z0YA 4CNFA 3CF5S 1GZ0A 2QWVA 1J85A 4YQCA 1TO0A 1FEUA 1P9PA 1EUYA 4YQAA 1NXZA 4CNEA 3ILKA 2G5DA 3PIPS 1VHKA 4H3SA 4MCBA 5GADW 4H4KA 3PIOS 4L69A 4YQIA 3N4JA 4KDZA 1UAKA 4MCCA 3IC6A 4JXXA 3KW2A 4RG1A 4YQ8A 4YQ2A 3KTYA 4YVHA 5IZNA 4UY88 3BBHA 4H3ZA 4YQQA 4YQSA 4YQGA 1NYLA 3QUVA 4WF9S 4YVGA 1V2XA 3KY7A 5DM6S 2NWAA 4V194 4YQLA 5FAIA 5GAEW 4MCDA 2EGVA 4YQ9A 4IG6A 3OINA 1ZJRA 3E5YA 4FAKA 5GMBA 4WFNS 4YPXA 4JYZA 3BBEA 5JVGS 4H3YA 1D6KA 4YPYA 4JWHA 4WCES 4YQDA 2RD2A 4PZKA 1EUQA
chains in the Genus database with same CATH topology
1K3RA 4YVKA 3GYQA 2V3JA 4X3MA 4JAKA 5GM8A 5GMCA 2V3KA 1IPAA 4YQBA 4YQ0A 4JWFA 4YQJA 4J3CA 4YQ7A 4YQOA 4KGNA 4YVJA 5D9FA 4YQ5A 3BBDA 4JWJA 1V6ZA 4YQPA 3O7BA 3AXZA 4CNDA 3KNUA 1X7PA 3AI9X 4X3LA 2CX8A 1MXIA 4CNGA 3NK6A 4YQKA 4YQTA 3OIJA 2EGWA 3AIAA 3DCMX 3ONPA 1X7OA 4YVIA 4YQNA 4YQ6A 1OY5A 1NS5A 4XBOA 4YPZA 4E8BA 1Z85A 1O6DA 3L8UA 3OIIA 2HA8A 4JALA 2I6DA 4FMWA 2YY8A 1UAMA 3IEFA 4YQRA 4YQ3A 5CO4A 2O3AA 3NK7A 1VH0A 1UALA 1UAJA 4YQ4A 1VHYA 4JWGA 4YQ1A 3N4KA 2QMMA 4YPWA 2Z0YA 4CNFA 1GZ0A 2QWVA 1J85A 4YQCA 1TO0A 1P9PA 4YQAA 1NXZA 4CNEA 3ILKA 1VHKA 4MCBA 4L69A 4YQIA 3N4JA 4KDZA 1UAKA 4MCCA 3IC6A 3KW2A 4RG1A 4YQ8A 4YQ2A 3KTYA 4YVHA 3BBHA 4H3ZA 4YQQA 4YQSA 4YQGA 3QUVA 4YVGA 1V2XA 3KY7A 2NWAA 4YQLA 5FAIA 4MCDA 4YQ9A 2EGVA 4IG6A 3OINA 1ZJRA 3E5YA 4FAKA 5GMBA 4YPXA 3BBEA 4H3YA 4YPYA 4JWHA 4YQDA 4PZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  4YVK A;  3GYQ A;  2V3J A;  4X3M A;  4JAK A;  5GM8 A;  5GMC A;  2V3K A;  1IPA A;  4YQB A;  4YQ0 A;  4YQJ A;  4J3C A;  4YQ7 A;  4YQO A;  4KGN A;  4YVJ A;  5D9F A;  4YQ5 A;  3BBD A;  4YQP A;  1V6Z A;  4CND A;  3O7B A;  3AXZ A;  3KNU A;  1X7P A;  3AI9 X;  4X3L A;  2CX8 A;  1MXI A;  4CNG A;  3NK6 A;  4YQK A;  4YQT A;  3OIJ A;  2EGW A;  3AIA A;  3DCM X;  3ONP A;  1X7O A;  4YVI A;  4YQN A;  4YQ6 A;  1OY5 A;  1NS5 A;  4XBO A;  4YPZ A;  4E8B A;  1Z85 A;  1O6D A;  3L8U A;  3OII A;  2HA8 A;  4JAL A;  2I6D A;  2YY8 A;  1UAM A;  3IEF A;  4YQR A;  4YQ3 A;  5CO4 A;  2O3A A;  3NK7 A;  1VH0 A;  1UAL A;  1UAJ A;  4YQ4 A;  1VHY A;  4YQ1 A;  3N4K A;  2QMM A;  4YPW A;  2Z0Y A;  4CNF A;  1GZ0 A;  2QWV A;  1J85 A;  4YQC A;  1TO0 A;  1P9P A;  4YQA A;  1NXZ A;  4CNE A;  3ILK A;  1VHK A;  4MCB A;  4L69 A;  4YQI A;  3N4J A;  4KDZ A;  1UAK A;  4MCC A;  3IC6 A;  3KW2 A;  4RG1 A;  4YQ8 A;  4YQ2 A;  3KTY A;  4YVH A;  3BBH A;  4H3Z A;  4YQQ A;  4YQS A;  4YQG A;  3QUV A;  4YVG A;  1V2X A;  3KY7 A;  2NWA A;  4YQL A;  5FAI A;  4MCD A;  4YQ9 A;  2EGV A;  4IG6 A;  3OIN A;  1ZJR A;  3E5Y A;  4FAK A;  5GMB A;  4YPX A;  3BBE A;  4H3Y A;  4YPY A;  4YQD A;  4PZK A; 
#chains in the Genus database with same CATH topology
 4IOC S;  1K3R A;  1GTS A;  2ZJP S;  3GYQ A;  2V3J A;  4YVK A;  4X3M A;  4JAK A;  5GM8 A;  1QRU A;  5GMC A;  2V3K A;  1IPA A;  4YQB A;  4YQ0 A;  4JWF A;  4YQJ A;  5DM7 S;  2PNW A;  5HL7 S;  4J3C A;  4YQ7 A;  4YQO A;  4KGN A;  1EXD A;  4WFB S;  4YVJ A;  5D9F A;  4YQ5 A;  2PIC A;  3BBD A;  1QTQ A;  3AII A;  4JWJ A;  1V6Z A;  4YQP A;  3O7B A;  3AXZ A;  4CND A;  3KNU A;  1QRS A;  1X7P A;  3AI9 X;  1GTR A;  4X3L A;  2CX8 A;  5JVH S;  3CZB A;  4IO9 S;  1DFU P;  1MXI A;  4CNG A;  2AE0 X;  3NK6 A;  4YQK A;  4YQT A;  5GAG W;  3OIJ A;  2EGW A;  1B75 A;  2RE8 A;  3AIA A;  2G6G A;  3DCM X;  3ONP A;  2PI8 A;  1X7O A;  4YVI A;  2ZJR S;  2HZ7 A;  4YQN A;  3W2W B;  1UDX A;  4YQ6 A;  1OY5 A;  3X1L B;  1NS5 A;  4XBO A;  1QRT A;  4YPZ A;  4E8B A;  1Z85 A;  1O6D A;  3L8U A;  2ZJQ S;  3OII A;  3J7Z V;  2HA8 A;  3DLL S;  4JXZ A;  4JAL A;  2I6D A;  4FMW A;  2YY8 A;  5GAH W;  1UAM A;  4WFA S;  3IEF A;  4U67 S;  3W2V B;  4YQR A;  4YQ3 A;  5CO4 A;  2O3A A;  3NK7 A;  2PJJ A;  1VH0 A;  1UAL A;  1UAJ A;  1ZJW A;  4YQ4 A;  1O0B A;  1VHY A;  4JWG A;  4YQ1 A;  4P2B A;  1O0C A;  2GAE A;  5BNZ A;  4IOA S;  3N4K A;  2QMM A;  4YPW A;  2Z0Y A;  4CNF A;  3CF5 S;  1GZ0 A;  2QWV A;  1J85 A;  4YQC A;  1TO0 A;  1FEU A;  1P9P A;  1EUY A;  4YQA A;  1NXZ A;  4CNE A;  3ILK A;  2G5D A;  3PIP S;  1VHK A;  4H3S A;  4MCB A;  5GAD W;  4H4K A;  3PIO S;  4L69 A;  4YQI A;  3N4J A;  4KDZ A;  1UAK A;  4MCC A;  3IC6 A;  4JXX A;  3KW2 A;  4RG1 A;  4YQ8 A;  4YQ2 A;  3KTY A;  4YVH A;  5IZN A;  4UY8 8;  3BBH A;  4H3Z A;  4YQQ A;  4YQS A;  4YQG A;  1NYL A;  3QUV A;  4WF9 S;  4YVG A;  1V2X A;  3KY7 A;  5DM6 S;  2NWA A;  4V19 4;  4YQL A;  5FAI A;  5GAE W;  4MCD A;  2EGV A;  4YQ9 A;  4IG6 A;  3OIN A;  1ZJR A;  3E5Y A;  4FAK A;  5GMB A;  4WFN S;  4YPX A;  4JYZ A;  3BBE A;  5JVG S;  4H3Y A;  1D6K A;  4YPY A;  4JWH A;  4WCE S;  4YQD A;  2RD2 A;  4PZK A;  1EUQ A; 
#chains in the Genus database with same CATH homology
 1K3R A;  4YVK A;  3GYQ A;  2V3J A;  4X3M A;  4JAK A;  5GM8 A;  5GMC A;  2V3K A;  1IPA A;  4YQB A;  4YQ0 A;  4JWF A;  4YQJ A;  4J3C A;  4YQ7 A;  4YQO A;  4KGN A;  4YVJ A;  5D9F A;  4YQ5 A;  3BBD A;  4JWJ A;  1V6Z A;  4YQP A;  3O7B A;  3AXZ A;  4CND A;  3KNU A;  1X7P A;  3AI9 X;  4X3L A;  2CX8 A;  1MXI A;  4CNG A;  3NK6 A;  4YQK A;  4YQT A;  3OIJ A;  2EGW A;  3AIA A;  3DCM X;  3ONP A;  1X7O A;  4YVI A;  4YQN A;  4YQ6 A;  1OY5 A;  1NS5 A;  4XBO A;  4YPZ A;  4E8B A;  1Z85 A;  1O6D A;  3L8U A;  3OII A;  2HA8 A;  4JAL A;  2I6D A;  4FMW A;  2YY8 A;  1UAM A;  3IEF A;  4YQR A;  4YQ3 A;  5CO4 A;  2O3A A;  3NK7 A;  1VH0 A;  1UAL A;  1UAJ A;  4YQ4 A;  1VHY A;  4JWG A;  4YQ1 A;  3N4K A;  2QMM A;  4YPW A;  2Z0Y A;  4CNF A;  1GZ0 A;  2QWV A;  1J85 A;  4YQC A;  1TO0 A;  1P9P A;  4YQA A;  1NXZ A;  4CNE A;  3ILK A;  1VHK A;  4MCB A;  4L69 A;  4YQI A;  3N4J A;  4KDZ A;  1UAK A;  4MCC A;  3IC6 A;  3KW2 A;  4RG1 A;  4YQ8 A;  4YQ2 A;  3KTY A;  4YVH A;  3BBH A;  4H3Z A;  4YQQ A;  4YQS A;  4YQG A;  3QUV A;  4YVG A;  1V2X A;  3KY7 A;  2NWA A;  4YQL A;  5FAI A;  4MCD A;  4YQ9 A;  2EGV A;  4IG6 A;  3OIN A;  1ZJR A;  3E5Y A;  4FAK A;  5GMB A;  4YPX A;  3BBE A;  4H3Y A;  4YPY A;  4JWH A;  4YQD A;  4PZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...