4J3CA

Crystal structure of 16s ribosomal rna methyltransferase rsme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
Knots found
sequence length
239
structure length
232
Chain Sequence
MQRLFIENALHAGAKHEATREQFNVLRLGEGSSLLVFNGRDGEWRAEIAMPSRQAVLVAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQGKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGSQNPLPILEGIAERRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQATLGDWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 16S ribosomal RNA methyltransferase RsmE
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase E
total genus 55
structure length 232
sequence length 239
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 4j3cA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4j3cA02
3L8UA 4CNGA 5GMBA 4IG6A 3KY7A 3KNUA 4YQGA 3DCMX 4MCDA 4L69A 4JALA 4YQSA 4FAKA 4YQ9A 1VHYA 4YPWA 3O7BA 1OY5A 1UAKA 4XBOA 1V6ZA 4YPXA 1UALA 4YQLA 3ILKA 3IEFA 1GZ0A 4CNFA 4H3YA 4MCCA 1TO0A 4YQIA 2EGWA 4MCBA 4H3ZA 1J85A 4YQ3A 4YVKA 4PZKA 1O6DA 2EGVA 1P9PA 4YQ2A 3NK7A 5FAIA 1V2XA 4YQOA 3IC6A 4YVHA 3N4KA 3NK6A 3QUVA 3KW2A 2Z0YA 3AIAA 4YQ4A 2NWAA 4YQQA 4YQPA 4YQ5A 1Z85A 3OIIA 2QMMA 4YPYA 2YY8A 2HA8A 3BBDA 4YQJA 1IPAA 3AXZA 4YVJA 2V3KA 1X7PA 2I6DA 1ZJRA 4YPZA 1X7OA 3BBHA 3E5YA 4YQ7A 4YQAA 4YQCA 4YQRA 4JAKA 5D9FA 3BBEA 1VHKA 3OINA 2CX8A 4RG1A 4J3CA 1NS5A 4YQKA 1UAJA 4YQ1A 4YQ8A 5GM8A 1UAMA 1VH0A 3OIJA 4E8BA 4YVIA 4KGNA 4YQDA 1MXIA 4CNEA 4YQ0A 5CO4A 4YQNA 4X3MA 1NXZA 1K3RA 2O3AA 2V3JA 3KTYA 4KDZA 4YVGA 4YQ6A 3GYQA 5GMCA 4YQBA 3AI9X 4YQTA 2QWVA 4X3LA 4CNDA 3N4JA 3ONPA
chains in the Genus database with same CATH superfamily
3L8UA 5GADW 4UY88 4CNGA 5GMBA 2RE8A 1QRSA 3KY7A 4IG6A 3KNUA 4YQGA 1QTQA 5HL7S 1EUQA 4H3SA 1O0CA 3DCMX 4MCDA 4L69A 4JALA 4YQSA 4FAKA 4V194 4YQ9A 1VHYA 3PIOS 4JWHA 4YPWA 3O7BA 4JXZA 5GAHW 1OY5A 1UAKA 4XBOA 1V6ZA 4P2BA 1EXDA 1UALA 4YPXA 4YQLA 2G6GA 3ILKA 3IEFA 1GZ0A 4CNFA 4H3YA 5DM6S 4MCCA 1TO0A 4YQIA 4JWFA 2EGWA 4MCBA 1O0BA 4H3ZA 1J85A 4YQ3A 4YVKA 3J7ZV 4PZKA 1O6DA 2EGVA 1P9PA 1NYLA 4YQ2A 3NK7A 5FAIA 1V2XA 2AE0X 3PIPS 4YQOA 1B75A 3IC6A 5GAGW 4YVHA 5DM7S 2RD2A 2HZ7A 4JWJA 3N4KA 3NK6A 3W2VB 3QUVA 3KW2A 4WFNS 2Z0YA 3AIAA 2PI8A 4YQ4A 2NWAA 4YQQA 4YQPA 3CZBA 4WFBS 4YQ5A 3X1LB 1Z85A 4U67S 5JVHS 3OIIA 4IOCS 2QMMA 4YPYA 1QRTA 2HA8A 2YY8A 3BBDA 2ZJQS 3CF5S 4YQJA 3W2WB 1IPAA 3AXZA 4YVJA 1GTRA 2V3KA 1X7PA 2I6DA 1ZJRA 2G5DA 3AIIA 4YPZA 5GAEW 4IOAS 2PJJA 1X7OA 2ZJPS 3BBHA 3E5YA 4YQ7A 4YQAA 4YQCA 4YQRA 4JAKA 5D9FA 2ZJRS 3BBEA 1VHKA 4JWGA 3OINA 2CX8A 4RG1A 2PICA 4J3CA 4WCES 1NS5A 4YQKA 1QRUA 5IZNA 1UAJA 4YQ1A 4YQ8A 5GM8A 1UAMA 2PNWA 1VH0A 3OIJA 4E8BA 4YVIA 4KGNA 4YQDA 1MXIA 4CNEA 4JYZA 4YQ0A 3DLLS 1UDXA 4WFAS 5JVGS 5CO4A 4YQNA 4JXXA 1NXZA 1K3RA 4X3MA 2GAEA 4WF9S 2O3AA 2V3JA 3KTYA 1ZJWA 4KDZA 1GTSA 4YVGA 4YQ6A 1EUYA 1FEUA 3GYQA 5GMCA 4YQBA 3AI9X 1DFUP 4YQTA 4IO9S 2QWVA 4X3LA 4CNDA 4FMWA 3N4JA 4H4KA 3ONPA 1D6KA 5BNZA
chains in the Genus database with same CATH topology
3L8UA 4CNGA 5GMBA 4IG6A 3KY7A 3KNUA 4YQGA 3DCMX 4MCDA 4L69A 4JALA 4YQSA 4FAKA 4YQ9A 1VHYA 4JWHA 4YPWA 3O7BA 1OY5A 1UAKA 4XBOA 1V6ZA 4YPXA 1UALA 4YQLA 3ILKA 3IEFA 1GZ0A 4CNFA 4H3YA 4MCCA 1TO0A 4YQIA 4JWFA 2EGWA 4MCBA 4H3ZA 1J85A 4YQ3A 4YVKA 4PZKA 1O6DA 2EGVA 1P9PA 4YQ2A 3NK7A 5FAIA 1V2XA 4YQOA 3IC6A 4YVHA 4JWJA 3N4KA 3NK6A 3QUVA 3KW2A 2Z0YA 3AIAA 4YQ4A 2NWAA 4YQQA 4YQPA 4YQ5A 1Z85A 3OIIA 2QMMA 4YPYA 2YY8A 2HA8A 3BBDA 4YQJA 1IPAA 3AXZA 4YVJA 2V3KA 1X7PA 2I6DA 1ZJRA 4YPZA 1X7OA 3BBHA 3E5YA 4YQ7A 4YQAA 4YQCA 4YQRA 4JAKA 5D9FA 3BBEA 1VHKA 4JWGA 3OINA 2CX8A 4RG1A 4J3CA 1NS5A 4YQKA 1UAJA 4YQ1A 4YQ8A 5GM8A 1UAMA 1VH0A 3OIJA 4E8BA 4YVIA 4KGNA 4YQDA 1MXIA 4CNEA 4YQ0A 5CO4A 4YQNA 4X3MA 1NXZA 1K3RA 2O3AA 2V3JA 3KTYA 4KDZA 4YVGA 4YQ6A 3GYQA 5GMCA 4YQBA 3AI9X 4YQTA 2QWVA 4X3LA 4CNDA 4FMWA 3N4JA 3ONPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8U A;  4CNG A;  5GMB A;  4IG6 A;  3KY7 A;  3KNU A;  4YQG A;  3DCM X;  4MCD A;  4L69 A;  4JAL A;  4YQS A;  4FAK A;  4YQ9 A;  1VHY A;  4YPW A;  3O7B A;  1OY5 A;  1UAK A;  4XBO A;  1V6Z A;  4YPX A;  1UAL A;  4YQL A;  3ILK A;  3IEF A;  1GZ0 A;  4CNF A;  4H3Y A;  4MCC A;  1TO0 A;  4YQI A;  2EGW A;  4MCB A;  4H3Z A;  1J85 A;  4YQ3 A;  4YVK A;  4PZK A;  1O6D A;  2EGV A;  1P9P A;  4YQ2 A;  3NK7 A;  5FAI A;  1V2X A;  4YQO A;  3IC6 A;  4YVH A;  3N4K A;  3NK6 A;  3QUV A;  3KW2 A;  2Z0Y A;  3AIA A;  4YQ4 A;  2NWA A;  4YQQ A;  4YQP A;  4YQ5 A;  1Z85 A;  3OII A;  2QMM A;  4YPY A;  2YY8 A;  2HA8 A;  3BBD A;  4YQJ A;  1IPA A;  3AXZ A;  4YVJ A;  2V3K A;  1X7P A;  2I6D A;  1ZJR A;  4YPZ A;  1X7O A;  3BBH A;  3E5Y A;  4YQ7 A;  4YQA A;  4YQC A;  4YQR A;  4JAK A;  5D9F A;  3BBE A;  1VHK A;  3OIN A;  2CX8 A;  4RG1 A;  4J3C A;  1NS5 A;  4YQK A;  1UAJ A;  4YQ1 A;  4YQ8 A;  5GM8 A;  1UAM A;  1VH0 A;  3OIJ A;  4E8B A;  4YVI A;  4KGN A;  4YQD A;  1MXI A;  4CNE A;  4YQ0 A;  5CO4 A;  4YQN A;  4X3M A;  1NXZ A;  1K3R A;  2O3A A;  2V3J A;  3KTY A;  4KDZ A;  4YVG A;  4YQ6 A;  3GYQ A;  5GMC A;  4YQB A;  3AI9 X;  4YQT A;  2QWV A;  4X3L A;  4CND A;  3N4J A;  3ONP A; 
#chains in the Genus database with same CATH topology
 3L8U A;  5GAD W;  4UY8 8;  4CNG A;  5GMB A;  2RE8 A;  1QRS A;  3KY7 A;  4IG6 A;  3KNU A;  4YQG A;  1QTQ A;  5HL7 S;  1EUQ A;  4H3S A;  1O0C A;  3DCM X;  4MCD A;  4L69 A;  4JAL A;  4YQS A;  4FAK A;  4V19 4;  4YQ9 A;  1VHY A;  3PIO S;  4JWH A;  4YPW A;  3O7B A;  4JXZ A;  5GAH W;  1OY5 A;  1UAK A;  4XBO A;  1V6Z A;  4P2B A;  1EXD A;  1UAL A;  4YPX A;  4YQL A;  2G6G A;  3ILK A;  3IEF A;  1GZ0 A;  4CNF A;  4H3Y A;  5DM6 S;  4MCC A;  1TO0 A;  4YQI A;  4JWF A;  2EGW A;  4MCB A;  1O0B A;  4H3Z A;  1J85 A;  4YQ3 A;  4YVK A;  3J7Z V;  4PZK A;  1O6D A;  2EGV A;  1P9P A;  1NYL A;  4YQ2 A;  3NK7 A;  5FAI A;  1V2X A;  2AE0 X;  3PIP S;  4YQO A;  1B75 A;  3IC6 A;  5GAG W;  4YVH A;  5DM7 S;  2RD2 A;  2HZ7 A;  4JWJ A;  3N4K A;  3NK6 A;  3W2V B;  3QUV A;  3KW2 A;  4WFN S;  2Z0Y A;  3AIA A;  2PI8 A;  4YQ4 A;  2NWA A;  4YQQ A;  4YQP A;  3CZB A;  4WFB S;  4YQ5 A;  3X1L B;  1Z85 A;  4U67 S;  5JVH S;  3OII A;  4IOC S;  2QMM A;  4YPY A;  1QRT A;  2HA8 A;  2YY8 A;  3BBD A;  2ZJQ S;  3CF5 S;  4YQJ A;  3W2W B;  1IPA A;  3AXZ A;  4YVJ A;  1GTR A;  2V3K A;  1X7P A;  2I6D A;  1ZJR A;  2G5D A;  3AII A;  4YPZ A;  5GAE W;  4IOA S;  2PJJ A;  1X7O A;  2ZJP S;  3BBH A;  3E5Y A;  4YQ7 A;  4YQA A;  4YQC A;  4YQR A;  4JAK A;  5D9F A;  2ZJR S;  3BBE A;  1VHK A;  4JWG A;  3OIN A;  2CX8 A;  4RG1 A;  2PIC A;  4J3C A;  4WCE S;  1NS5 A;  4YQK A;  1QRU A;  5IZN A;  1UAJ A;  4YQ1 A;  4YQ8 A;  5GM8 A;  1UAM A;  2PNW A;  1VH0 A;  3OIJ A;  4E8B A;  4YVI A;  4KGN A;  4YQD A;  1MXI A;  4CNE A;  4JYZ A;  4YQ0 A;  3DLL S;  1UDX A;  4WFA S;  5JVG S;  5CO4 A;  4YQN A;  4JXX A;  1NXZ A;  1K3R A;  4X3M A;  2GAE A;  4WF9 S;  2O3A A;  2V3J A;  3KTY A;  1ZJW A;  4KDZ A;  1GTS A;  4YVG A;  4YQ6 A;  1EUY A;  1FEU A;  3GYQ A;  5GMC A;  4YQB A;  3AI9 X;  1DFU P;  4YQT A;  4IO9 S;  2QWV A;  4X3L A;  4CND A;  4FMW A;  3N4J A;  4H4K A;  3ONP A;  1D6K A;  5BNZ A; 
#chains in the Genus database with same CATH homology
 3L8U A;  4CNG A;  5GMB A;  4IG6 A;  3KY7 A;  3KNU A;  4YQG A;  3DCM X;  4MCD A;  4L69 A;  4JAL A;  4YQS A;  4FAK A;  4YQ9 A;  1VHY A;  4JWH A;  4YPW A;  3O7B A;  1OY5 A;  1UAK A;  4XBO A;  1V6Z A;  4YPX A;  1UAL A;  4YQL A;  3ILK A;  3IEF A;  1GZ0 A;  4CNF A;  4H3Y A;  4MCC A;  1TO0 A;  4YQI A;  4JWF A;  2EGW A;  4MCB A;  4H3Z A;  1J85 A;  4YQ3 A;  4YVK A;  4PZK A;  1O6D A;  2EGV A;  1P9P A;  4YQ2 A;  3NK7 A;  5FAI A;  1V2X A;  4YQO A;  3IC6 A;  4YVH A;  4JWJ A;  3N4K A;  3NK6 A;  3QUV A;  3KW2 A;  2Z0Y A;  3AIA A;  4YQ4 A;  2NWA A;  4YQQ A;  4YQP A;  4YQ5 A;  1Z85 A;  3OII A;  2QMM A;  4YPY A;  2YY8 A;  2HA8 A;  3BBD A;  4YQJ A;  1IPA A;  3AXZ A;  4YVJ A;  2V3K A;  1X7P A;  2I6D A;  1ZJR A;  4YPZ A;  1X7O A;  3BBH A;  3E5Y A;  4YQ7 A;  4YQA A;  4YQC A;  4YQR A;  4JAK A;  5D9F A;  3BBE A;  1VHK A;  4JWG A;  3OIN A;  2CX8 A;  4RG1 A;  4J3C A;  1NS5 A;  4YQK A;  1UAJ A;  4YQ1 A;  4YQ8 A;  5GM8 A;  1UAM A;  1VH0 A;  3OIJ A;  4E8B A;  4YVI A;  4KGN A;  4YQD A;  1MXI A;  4CNE A;  4YQ0 A;  5CO4 A;  4YQN A;  4X3M A;  1NXZ A;  1K3R A;  2O3A A;  2V3J A;  3KTY A;  4KDZ A;  4YVG A;  4YQ6 A;  3GYQ A;  5GMC A;  4YQB A;  3AI9 X;  4YQT A;  2QWV A;  4X3L A;  4CND A;  4FMW A;  3N4J A;  3ONP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...