4J3CA

Crystal structure of 16s ribosomal rna methyltransferase rsme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
Knots found
sequence length
239
structure length
232
Chain Sequence
MQRLFIENALHAGAKHEATREQFNVLRLGEGSSLLVFNGRDGEWRAEIAMPSRQAVLVAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQGKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGSQNPLPILEGIAERRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQATLGDWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA small subunit methyltransferase E
publication title Crystal structure of 16S ribosomal RNA methyltransferase RsmE
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
total genus 55
structure length 232
sequence length 239
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 4j3cA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4j3cA02
4YQRA 3BBDA 3IC6A 5CO4A 2QWVA 4YPXA 4YQQA 5FAIA 3ILKA 3NK6A 4IG6A 1VHYA 3ONPA 1NXZA 4YQBA 4X3MA 4YVIA 3KW2A 1ZJRA 4YQ8A 1UAJA 4YQIA 3NK7A 4YQOA 1V2XA 4JAKA 3KY7A 4YQPA 4MCBA 1K3RA 5D9FA 3BBEA 2V3JA 4YQ2A 2HA8A 4YQ4A 4XBOA 1X7OA 2QMMA 2O3AA 1VHKA 1P9PA 2NWAA 4PZKA 1UAKA 4YQCA 4CNEA 1TO0A 3QUVA 4YPWA 3OIJA 3AIAA 4YQAA 4YQLA 3GYQA 3KNUA 4YVGA 5GMCA 4J3CA 2EGWA 4E8BA 4CNDA 1X7PA 3AI9X 5GMBA 4YQDA 4YVJA 4YQ3A 1IPAA 4YQGA 4YQJA 2Z0YA 4YPYA 5GM8A 3L8UA 4KGNA 1J85A 4YQSA 4YPZA 4H3ZA 3BBHA 1UAMA 3IEFA 4H3YA 4YQ5A 1V6ZA 4MCDA 4YQ0A 1UALA 4CNGA 4L69A 3DCMX 2CX8A 2YY8A 4FAKA 1NS5A 1Z85A 4YVKA 4RG1A 4KDZA 1OY5A 1MXIA 4MCCA 3O7BA 4YQ7A 4YQ9A 3E5YA 4X3LA 4YQNA 2V3KA 1GZ0A 4YQ6A 3OINA 4YVHA 4YQTA 4YQ1A 3OIIA 3AXZA 2I6DA 2EGVA 4CNFA 3N4JA 1VH0A 4YQKA 3N4KA 3KTYA 1O6DA 4JALA
chains in the Genus database with same CATH superfamily
2PJJA 1QRTA 4H4KA 4YQRA 3BBDA 4JWFA 3IC6A 5CO4A 2QWVA 4YPXA 4YQQA 5FAIA 2ZJPS 3AIIA 2G6GA 3ILKA 4JWJA 4WCES 3NK6A 4IG6A 1EUYA 2PI8A 1VHYA 4JXZA 3ONPA 1EXDA 1NXZA 4JYZA 4YQBA 4X3MA 1GTRA 4IOAS 1EUQA 4JWGA 4YVIA 3KW2A 1ZJRA 4YQ8A 1UAJA 4YQIA 3NK7A 4YQOA 1QRSA 1V2XA 4JAKA 5IZNA 3KY7A 4YQPA 5DM7S 5JVHS 4MCBA 1K3RA 5D9FA 2RD2A 1DFUP 1D6KA 3BBEA 2V3JA 4YQ2A 2HA8A 4YQ4A 5JVGS 4XBOA 4IOCS 1X7OA 2QMMA 1NYLA 2O3AA 3X1LB 1VHKA 5BNZA 2NWAA 1P9PA 3PIPS 4U67S 5GAEW 1O0CA 1UAKA 4PZKA 4YQCA 4CNEA 1TO0A 3QUVA 5GAHW 4YPWA 4UY88 3OIJA 3AIAA 1O0BA 4YQAA 4YQLA 3GYQA 3KNUA 4WF9S 4YVGA 5GMCA 4WFBS 3DLLS 5GADW 4J3CA 2EGWA 2PNWA 4E8BA 4JWHA 3J7ZV 4CNDA 4H3SA 3CF5S 1X7PA 5HL7S 3AI9X 5GMBA 4YQDA 4YVJA 4V194 1IPAA 4YQ3A 4YQGA 1GTSA 4WFNS 4JALA 4YQJA 2PICA 2G5DA 2Z0YA 3W2VB 3L8UA 4YPYA 4KGNA 5GM8A 1J85A 4YQSA 4YPZA 4H3ZA 2ZJRS 1UAMA 3BBHA 3IEFA 4H3YA 4YQ5A 1V6ZA 4MCDA 4YQ0A 1UALA 4CNGA 4L69A 2RE8A 3DCMX 2CX8A 3CZBA 2YY8A 3W2WB 4FAKA 2AE0X 1NS5A 2ZJQS 1Z85A 4YVKA 4RG1A 2HZ7A 4KDZA 1B75A 1OY5A 1MXIA 4WFAS 4P2BA 3O7BA 4MCCA 4YQ7A 4FMWA 4YQ9A 3E5YA 4JXXA 4X3LA 4YQNA 2V3KA 1GZ0A 4YQ6A 3OINA 5GAGW 1FEUA 4YVHA 4YQTA 4YQ1A 1QTQA 3OIIA 2GAEA 4IO9S 1ZJWA 3AXZA 2I6DA 2EGVA 1QRUA 4CNFA 3PIOS 3N4JA 1VH0A 4YQKA 3N4KA 3KTYA 1O6DA 1UDXA 5DM6S
chains in the Genus database with same CATH topology
4YQRA 3BBDA 4JWFA 3IC6A 5CO4A 2QWVA 4YPXA 4YQQA 5FAIA 3ILKA 4JWJA 3NK6A 4IG6A 1VHYA 3ONPA 1NXZA 4YQBA 4X3MA 4JWGA 4YVIA 3KW2A 1ZJRA 4YQ8A 1UAJA 4YQIA 3NK7A 4YQOA 1V2XA 4JAKA 3KY7A 4YQPA 4MCBA 1K3RA 5D9FA 3BBEA 2V3JA 4YQ2A 2HA8A 4YQ4A 4XBOA 1X7OA 2QMMA 2O3AA 1VHKA 1P9PA 2NWAA 4PZKA 1UAKA 4YQCA 4CNEA 1TO0A 3QUVA 4YPWA 3OIJA 3AIAA 4YQAA 4YQLA 3GYQA 3KNUA 4YVGA 5GMCA 4J3CA 2EGWA 4E8BA 4JWHA 4CNDA 1X7PA 3AI9X 5GMBA 4YQDA 4YVJA 4YQ3A 1IPAA 4YQGA 4YQJA 2Z0YA 4YPYA 5GM8A 3L8UA 4KGNA 1J85A 4YQSA 4YPZA 4H3ZA 3BBHA 1UAMA 3IEFA 4H3YA 4YQ5A 1V6ZA 4MCDA 4YQ0A 1UALA 4CNGA 4L69A 3DCMX 2CX8A 2YY8A 4FAKA 1NS5A 1Z85A 4YVKA 4RG1A 4KDZA 1OY5A 1MXIA 4MCCA 3O7BA 4YQ7A 4FMWA 4YQ9A 3E5YA 4X3LA 4YQNA 2V3KA 1GZ0A 4YQ6A 3OINA 4YVHA 4YQTA 4YQ1A 3OIIA 3AXZA 2I6DA 2EGVA 4CNFA 3N4JA 1VH0A 4YQKA 3N4KA 3KTYA 1O6DA 4JALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQR A;  3BBD A;  3IC6 A;  5CO4 A;  2QWV A;  4YPX A;  4YQQ A;  5FAI A;  3ILK A;  3NK6 A;  4IG6 A;  1VHY A;  3ONP A;  1NXZ A;  4YQB A;  4X3M A;  4YVI A;  3KW2 A;  1ZJR A;  4YQ8 A;  1UAJ A;  4YQI A;  3NK7 A;  4YQO A;  1V2X A;  4JAK A;  3KY7 A;  4YQP A;  4MCB A;  1K3R A;  5D9F A;  3BBE A;  2V3J A;  4YQ2 A;  2HA8 A;  4YQ4 A;  4XBO A;  1X7O A;  2QMM A;  2O3A A;  1VHK A;  1P9P A;  2NWA A;  4PZK A;  1UAK A;  4YQC A;  4CNE A;  1TO0 A;  3QUV A;  4YPW A;  3OIJ A;  3AIA A;  4YQA A;  4YQL A;  3GYQ A;  3KNU A;  4YVG A;  5GMC A;  4J3C A;  2EGW A;  4E8B A;  4CND A;  1X7P A;  3AI9 X;  5GMB A;  4YQD A;  4YVJ A;  4YQ3 A;  1IPA A;  4YQG A;  4YQJ A;  2Z0Y A;  4YPY A;  5GM8 A;  3L8U A;  4KGN A;  1J85 A;  4YQS A;  4YPZ A;  4H3Z A;  3BBH A;  1UAM A;  3IEF A;  4H3Y A;  4YQ5 A;  1V6Z A;  4MCD A;  4YQ0 A;  1UAL A;  4CNG A;  4L69 A;  3DCM X;  2CX8 A;  2YY8 A;  4FAK A;  1NS5 A;  1Z85 A;  4YVK A;  4RG1 A;  4KDZ A;  1OY5 A;  1MXI A;  4MCC A;  3O7B A;  4YQ7 A;  4YQ9 A;  3E5Y A;  4X3L A;  4YQN A;  2V3K A;  1GZ0 A;  4YQ6 A;  3OIN A;  4YVH A;  4YQT A;  4YQ1 A;  3OII A;  3AXZ A;  2I6D A;  2EGV A;  4CNF A;  3N4J A;  1VH0 A;  4YQK A;  3N4K A;  3KTY A;  1O6D A;  4JAL A; 
#chains in the Genus database with same CATH topology
 2PJJ A;  1QRT A;  4H4K A;  4YQR A;  3BBD A;  4JWF A;  3IC6 A;  5CO4 A;  2QWV A;  4YPX A;  4YQQ A;  5FAI A;  2ZJP S;  3AII A;  2G6G A;  3ILK A;  4JWJ A;  4WCE S;  3NK6 A;  4IG6 A;  1EUY A;  2PI8 A;  1VHY A;  4JXZ A;  3ONP A;  1EXD A;  1NXZ A;  4JYZ A;  4YQB A;  4X3M A;  1GTR A;  4IOA S;  1EUQ A;  4JWG A;  4YVI A;  3KW2 A;  1ZJR A;  4YQ8 A;  1UAJ A;  4YQI A;  3NK7 A;  4YQO A;  1QRS A;  1V2X A;  4JAK A;  5IZN A;  3KY7 A;  4YQP A;  5DM7 S;  5JVH S;  4MCB A;  1K3R A;  5D9F A;  2RD2 A;  1DFU P;  1D6K A;  3BBE A;  2V3J A;  4YQ2 A;  2HA8 A;  4YQ4 A;  5JVG S;  4XBO A;  4IOC S;  1X7O A;  2QMM A;  1NYL A;  2O3A A;  3X1L B;  1VHK A;  5BNZ A;  2NWA A;  1P9P A;  3PIP S;  4U67 S;  5GAE W;  1O0C A;  1UAK A;  4PZK A;  4YQC A;  4CNE A;  1TO0 A;  3QUV A;  5GAH W;  4YPW A;  4UY8 8;  3OIJ A;  3AIA A;  1O0B A;  4YQA A;  4YQL A;  3GYQ A;  3KNU A;  4WF9 S;  4YVG A;  5GMC A;  4WFB S;  3DLL S;  5GAD W;  4J3C A;  2EGW A;  2PNW A;  4E8B A;  4JWH A;  3J7Z V;  4CND A;  4H3S A;  3CF5 S;  1X7P A;  5HL7 S;  3AI9 X;  5GMB A;  4YQD A;  4YVJ A;  4V19 4;  1IPA A;  4YQ3 A;  4YQG A;  1GTS A;  4WFN S;  4JAL A;  4YQJ A;  2PIC A;  2G5D A;  2Z0Y A;  3W2V B;  3L8U A;  4YPY A;  4KGN A;  5GM8 A;  1J85 A;  4YQS A;  4YPZ A;  4H3Z A;  2ZJR S;  1UAM A;  3BBH A;  3IEF A;  4H3Y A;  4YQ5 A;  1V6Z A;  4MCD A;  4YQ0 A;  1UAL A;  4CNG A;  4L69 A;  2RE8 A;  3DCM X;  2CX8 A;  3CZB A;  2YY8 A;  3W2W B;  4FAK A;  2AE0 X;  1NS5 A;  2ZJQ S;  1Z85 A;  4YVK A;  4RG1 A;  2HZ7 A;  4KDZ A;  1B75 A;  1OY5 A;  1MXI A;  4WFA S;  4P2B A;  3O7B A;  4MCC A;  4YQ7 A;  4FMW A;  4YQ9 A;  3E5Y A;  4JXX A;  4X3L A;  4YQN A;  2V3K A;  1GZ0 A;  4YQ6 A;  3OIN A;  5GAG W;  1FEU A;  4YVH A;  4YQT A;  4YQ1 A;  1QTQ A;  3OII A;  2GAE A;  4IO9 S;  1ZJW A;  3AXZ A;  2I6D A;  2EGV A;  1QRU A;  4CNF A;  3PIO S;  3N4J A;  1VH0 A;  4YQK A;  3N4K A;  3KTY A;  1O6D A;  1UDX A;  5DM6 S; 
#chains in the Genus database with same CATH homology
 4YQR A;  3BBD A;  4JWF A;  3IC6 A;  5CO4 A;  2QWV A;  4YPX A;  4YQQ A;  5FAI A;  3ILK A;  4JWJ A;  3NK6 A;  4IG6 A;  1VHY A;  3ONP A;  1NXZ A;  4YQB A;  4X3M A;  4JWG A;  4YVI A;  3KW2 A;  1ZJR A;  4YQ8 A;  1UAJ A;  4YQI A;  3NK7 A;  4YQO A;  1V2X A;  4JAK A;  3KY7 A;  4YQP A;  4MCB A;  1K3R A;  5D9F A;  3BBE A;  2V3J A;  4YQ2 A;  2HA8 A;  4YQ4 A;  4XBO A;  1X7O A;  2QMM A;  2O3A A;  1VHK A;  1P9P A;  2NWA A;  4PZK A;  1UAK A;  4YQC A;  4CNE A;  1TO0 A;  3QUV A;  4YPW A;  3OIJ A;  3AIA A;  4YQA A;  4YQL A;  3GYQ A;  3KNU A;  4YVG A;  5GMC A;  4J3C A;  2EGW A;  4E8B A;  4JWH A;  4CND A;  1X7P A;  3AI9 X;  5GMB A;  4YQD A;  4YVJ A;  4YQ3 A;  1IPA A;  4YQG A;  4YQJ A;  2Z0Y A;  4YPY A;  5GM8 A;  3L8U A;  4KGN A;  1J85 A;  4YQS A;  4YPZ A;  4H3Z A;  3BBH A;  1UAM A;  3IEF A;  4H3Y A;  4YQ5 A;  1V6Z A;  4MCD A;  4YQ0 A;  1UAL A;  4CNG A;  4L69 A;  3DCM X;  2CX8 A;  2YY8 A;  4FAK A;  1NS5 A;  1Z85 A;  4YVK A;  4RG1 A;  4KDZ A;  1OY5 A;  1MXI A;  4MCC A;  3O7B A;  4YQ7 A;  4FMW A;  4YQ9 A;  3E5Y A;  4X3L A;  4YQN A;  2V3K A;  1GZ0 A;  4YQ6 A;  3OIN A;  4YVH A;  4YQT A;  4YQ1 A;  3OII A;  3AXZ A;  2I6D A;  2EGV A;  4CNF A;  3N4J A;  1VH0 A;  4YQK A;  3N4K A;  3KTY A;  1O6D A;  4JAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...