4J3CA

Crystal structure of 16s ribosomal rna methyltransferase rsme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
Knots found
sequence length
239
structure length
232
Chain Sequence
b'MQRLFIENALHAGAKHEATREQFNVLRLGEGSSLLVFNGRDGEWRAEIAMPSRQAVLVAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQGKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGSQNPLPILEGIAERRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQATLGDWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA small subunit methyltransferase E
publication title Crystal structure of 16S ribosomal RNA methyltransferase RsmE
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
total genus 55
structure length 232
sequence length 239
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 4j3cA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4j3cA02
2CX8A 4YQOA 3BBHA 3KW2A 3O7BA 4YQGA 1VHYA 4X3MA 4YVHA 2Z0YA 3KTYA 4MCDA 3AIAA 1V2XA 4JAKA 4YQJA 5GMCA 4MCCA 1K3RA 1MXIA 1GZ0A 2HA8A 4XBOA 4YQTA 4YQ9A 3E5YA 4CNGA 4YQCA 3N4KA 1OY5A 4IG6A 1X7OA 4YQBA 4CNEA 4J3CA 4YQNA 4CNDA 1NS5A 1UAMA 2V3JA 4YQ1A 2NWAA 4YQ5A 4YPWA 3N4JA 4YQAA 2EGVA 5CO4A 3KY7A 4YQSA 5GMBA 4YQRA 4KDZA 1VH0A 4X3LA 3NK7A 1J85A 4YPYA 4L69A 3ONPA 5D9FA 2EGWA 3AI9X 4MCBA 1Z85A 1X7PA 4KGNA 3NK6A 4E8BA 1UAKA 3OIIA 4YQ0A 3IC6A 4YVIA 4JALA 2QWVA 4H3ZA 3L8UA 4YQ7A 3IEFA 3QUVA 4H3YA 1ZJRA 4YPZA 1UAJA 4YQ8A 4RG1A 1V6ZA 4YVGA 2I6DA 3OINA 4YQQA 1NXZA 4YQDA 3OIJA 3BBDA 2YY8A 3KNUA 4CNFA 4YQIA 1VHKA 4YQKA 1O6DA 4FAKA 3DCMX 4YVKA 3BBEA 3ILKA 4YVJA 1TO0A 4PZKA 4YQLA 5GM8A 3GYQA 4YQ3A 4YPXA 2V3KA 4YQPA 1UALA 2O3AA 4YQ2A 4YQ4A 4YQ6A 1P9PA 5FAIA 2QMMA 3AXZA 1IPAA
chains in the Genus database with same CATH superfamily
2G5DA 2CX8A 4YQOA 3BBHA 3KW2A 3X1LB 1GTSA 3O7BA 4YQGA 1VHYA 4X3MA 5BNZA 4JWGA 2PNWA 4YVHA 2Z0YA 3KTYA 1O0BA 4MCDA 3AIAA 1V2XA 4JAKA 4YQJA 5GMCA 4MCCA 1K3RA 1MXIA 2AE0X 3DLLS 1GZ0A 2HA8A 4XBOA 4YQTA 4YQ9A 2HZ7A 3CF5S 3E5YA 4CNGA 4YQCA 5GAHW 3PIPS 3N4KA 1OY5A 4IG6A 1ZJWA 2ZJPS 1X7OA 4YQBA 4CNEA 4JXXA 4J3CA 4YQNA 2ZJRS 1NS5A 4CNDA 1UAMA 2ZJQS 2V3JA 1GTRA 4YQ1A 4H4KA 4WFAS 2NWAA 4H3SA 4FMWA 5GADW 4YQ5A 1QTQA 2PJJA 4YPWA 3N4JA 4YQAA 2EGVA 3W2VB 3AIIA 5CO4A 3KY7A 4YQSA 5GMBA 4YQRA 1QRTA 1EUYA 4KDZA 1VH0A 4X3LA 3NK7A 1J85A 3J7ZV 4YPYA 5JVGS 4IOAS 4L69A 1FEUA 3ONPA 1UDXA 1O0CA 5D9FA 2EGWA 3AI9X 4JWFA 1Z85A 4MCBA 3CZBA 1X7PA 4KGNA 3NK6A 4E8BA 1UAKA 2GAEA 4JWJA 1EUQA 3OIIA 5DM6S 4YQ0A 3IC6A 4YVIA 4WCES 1EXDA 4JALA 2QWVA 1QRUA 5GAGW 1QRSA 4P2BA 4H3ZA 3L8UA 5JVHS 4WFBS 2PI8A 1DFUP 2RE8A 4YQ7A 4WF9S 3IEFA 4IO9S 3QUVA 1D6KA 5DM7S 4H3YA 5GAEW 1ZJRA 3W2WB 4YPZA 1UAJA 4YQ8A 2G6GA 3PIOS 1B75A 4RG1A 4WFNS 4UY88 1V6ZA 4YVGA 2I6DA 3OINA 1NYLA 4YQQA 1NXZA 5HL7S 4YQDA 3OIJA 3BBDA 2YY8A 4JYZA 3KNUA 4CNFA 4YQIA 1VHKA 4YQKA 1O6DA 4FAKA 3DCMX 4U67S 4YVKA 3BBEA 3ILKA 4YVJA 1TO0A 4PZKA 4YQLA 5GM8A 3GYQA 4JXZA 4YQ3A 4YPXA 2V3KA 4YQPA 1UALA 2O3AA 2RD2A 4YQ2A 4YQ4A 5IZNA 4YQ6A 1P9PA 4IOCS 2PICA 4JWHA 5FAIA 2QMMA 3AXZA 1IPAA 4V194
chains in the Genus database with same CATH topology
2CX8A 4YQOA 3BBHA 3KW2A 3O7BA 4YQGA 1VHYA 4X3MA 4JWGA 4YVHA 2Z0YA 3KTYA 4MCDA 3AIAA 1V2XA 4JAKA 4YQJA 5GMCA 4MCCA 1K3RA 1MXIA 1GZ0A 2HA8A 4XBOA 4YQTA 4YQ9A 3E5YA 4CNGA 4YQCA 3N4KA 1OY5A 4IG6A 1X7OA 4YQBA 4CNEA 4J3CA 4YQNA 4CNDA 1NS5A 1UAMA 2V3JA 4YQ1A 2NWAA 4FMWA 4YQ5A 4YPWA 3N4JA 4YQAA 2EGVA 5CO4A 3KY7A 4YQSA 5GMBA 4YQRA 4KDZA 1VH0A 4X3LA 3NK7A 1J85A 4YPYA 4L69A 3ONPA 5D9FA 2EGWA 3AI9X 4JWFA 1Z85A 4MCBA 1X7PA 4KGNA 3NK6A 4E8BA 1UAKA 4JWJA 3OIIA 4YQ0A 3IC6A 4YVIA 4JALA 2QWVA 4H3ZA 3L8UA 4YQ7A 3IEFA 3QUVA 4H3YA 1ZJRA 4YPZA 1UAJA 4YQ8A 4RG1A 1V6ZA 4YVGA 2I6DA 3OINA 4YQQA 1NXZA 4YQDA 3OIJA 3BBDA 2YY8A 3KNUA 4CNFA 4YQIA 1VHKA 4YQKA 1O6DA 4FAKA 3DCMX 4YVKA 3BBEA 3ILKA 4YVJA 1TO0A 4PZKA 4YQLA 5GM8A 3GYQA 4YQ3A 4YPXA 2V3KA 4YQPA 1UALA 2O3AA 4YQ2A 4YQ4A 4YQ6A 1P9PA 4JWHA 5FAIA 2QMMA 3AXZA 1IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX8 A;  4YQO A;  3BBH A;  3KW2 A;  3O7B A;  4YQG A;  1VHY A;  4X3M A;  4YVH A;  2Z0Y A;  3KTY A;  4MCD A;  3AIA A;  1V2X A;  4JAK A;  4YQJ A;  5GMC A;  4MCC A;  1K3R A;  1MXI A;  1GZ0 A;  2HA8 A;  4XBO A;  4YQT A;  4YQ9 A;  3E5Y A;  4CNG A;  4YQC A;  3N4K A;  1OY5 A;  4IG6 A;  1X7O A;  4YQB A;  4CNE A;  4J3C A;  4YQN A;  4CND A;  1NS5 A;  1UAM A;  2V3J A;  4YQ1 A;  2NWA A;  4YQ5 A;  4YPW A;  3N4J A;  4YQA A;  2EGV A;  5CO4 A;  3KY7 A;  4YQS A;  5GMB A;  4YQR A;  4KDZ A;  1VH0 A;  4X3L A;  3NK7 A;  1J85 A;  4YPY A;  4L69 A;  3ONP A;  5D9F A;  2EGW A;  3AI9 X;  4MCB A;  1Z85 A;  1X7P A;  4KGN A;  3NK6 A;  4E8B A;  1UAK A;  3OII A;  4YQ0 A;  3IC6 A;  4YVI A;  4JAL A;  2QWV A;  4H3Z A;  3L8U A;  4YQ7 A;  3IEF A;  3QUV A;  4H3Y A;  1ZJR A;  4YPZ A;  1UAJ A;  4YQ8 A;  4RG1 A;  1V6Z A;  4YVG A;  2I6D A;  3OIN A;  4YQQ A;  1NXZ A;  4YQD A;  3OIJ A;  3BBD A;  2YY8 A;  3KNU A;  4CNF A;  4YQI A;  1VHK A;  4YQK A;  1O6D A;  4FAK A;  3DCM X;  4YVK A;  3BBE A;  3ILK A;  4YVJ A;  1TO0 A;  4PZK A;  4YQL A;  5GM8 A;  3GYQ A;  4YQ3 A;  4YPX A;  2V3K A;  4YQP A;  1UAL A;  2O3A A;  4YQ2 A;  4YQ4 A;  4YQ6 A;  1P9P A;  5FAI A;  2QMM A;  3AXZ A;  1IPA A; 
#chains in the Genus database with same CATH topology
 2G5D A;  2CX8 A;  4YQO A;  3BBH A;  3KW2 A;  3X1L B;  1GTS A;  3O7B A;  4YQG A;  1VHY A;  4X3M A;  5BNZ A;  4JWG A;  2PNW A;  4YVH A;  2Z0Y A;  3KTY A;  1O0B A;  4MCD A;  3AIA A;  1V2X A;  4JAK A;  4YQJ A;  5GMC A;  4MCC A;  1K3R A;  1MXI A;  2AE0 X;  3DLL S;  1GZ0 A;  2HA8 A;  4XBO A;  4YQT A;  4YQ9 A;  2HZ7 A;  3CF5 S;  3E5Y A;  4CNG A;  4YQC A;  5GAH W;  3PIP S;  3N4K A;  1OY5 A;  4IG6 A;  1ZJW A;  2ZJP S;  1X7O A;  4YQB A;  4CNE A;  4JXX A;  4J3C A;  4YQN A;  2ZJR S;  1NS5 A;  4CND A;  1UAM A;  2ZJQ S;  2V3J A;  1GTR A;  4YQ1 A;  4H4K A;  4WFA S;  2NWA A;  4H3S A;  4FMW A;  5GAD W;  4YQ5 A;  1QTQ A;  2PJJ A;  4YPW A;  3N4J A;  4YQA A;  2EGV A;  3W2V B;  3AII A;  5CO4 A;  3KY7 A;  4YQS A;  5GMB A;  4YQR A;  1QRT A;  1EUY A;  4KDZ A;  1VH0 A;  4X3L A;  3NK7 A;  1J85 A;  3J7Z V;  4YPY A;  5JVG S;  4IOA S;  4L69 A;  1FEU A;  3ONP A;  1UDX A;  1O0C A;  5D9F A;  2EGW A;  3AI9 X;  4JWF A;  1Z85 A;  4MCB A;  3CZB A;  1X7P A;  4KGN A;  3NK6 A;  4E8B A;  1UAK A;  2GAE A;  4JWJ A;  1EUQ A;  3OII A;  5DM6 S;  4YQ0 A;  3IC6 A;  4YVI A;  4WCE S;  1EXD A;  4JAL A;  2QWV A;  1QRU A;  5GAG W;  1QRS A;  4P2B A;  4H3Z A;  3L8U A;  5JVH S;  4WFB S;  2PI8 A;  1DFU P;  2RE8 A;  4YQ7 A;  4WF9 S;  3IEF A;  4IO9 S;  3QUV A;  1D6K A;  5DM7 S;  4H3Y A;  5GAE W;  1ZJR A;  3W2W B;  4YPZ A;  1UAJ A;  4YQ8 A;  2G6G A;  3PIO S;  1B75 A;  4RG1 A;  4WFN S;  4UY8 8;  1V6Z A;  4YVG A;  2I6D A;  3OIN A;  1NYL A;  4YQQ A;  1NXZ A;  5HL7 S;  4YQD A;  3OIJ A;  3BBD A;  2YY8 A;  4JYZ A;  3KNU A;  4CNF A;  4YQI A;  1VHK A;  4YQK A;  1O6D A;  4FAK A;  3DCM X;  4U67 S;  4YVK A;  3BBE A;  3ILK A;  4YVJ A;  1TO0 A;  4PZK A;  4YQL A;  5GM8 A;  3GYQ A;  4JXZ A;  4YQ3 A;  4YPX A;  2V3K A;  4YQP A;  1UAL A;  2O3A A;  2RD2 A;  4YQ2 A;  4YQ4 A;  5IZN A;  4YQ6 A;  1P9P A;  4IOC S;  2PIC A;  4JWH A;  5FAI A;  2QMM A;  3AXZ A;  1IPA A;  4V19 4; 
#chains in the Genus database with same CATH homology
 2CX8 A;  4YQO A;  3BBH A;  3KW2 A;  3O7B A;  4YQG A;  1VHY A;  4X3M A;  4JWG A;  4YVH A;  2Z0Y A;  3KTY A;  4MCD A;  3AIA A;  1V2X A;  4JAK A;  4YQJ A;  5GMC A;  4MCC A;  1K3R A;  1MXI A;  1GZ0 A;  2HA8 A;  4XBO A;  4YQT A;  4YQ9 A;  3E5Y A;  4CNG A;  4YQC A;  3N4K A;  1OY5 A;  4IG6 A;  1X7O A;  4YQB A;  4CNE A;  4J3C A;  4YQN A;  4CND A;  1NS5 A;  1UAM A;  2V3J A;  4YQ1 A;  2NWA A;  4FMW A;  4YQ5 A;  4YPW A;  3N4J A;  4YQA A;  2EGV A;  5CO4 A;  3KY7 A;  4YQS A;  5GMB A;  4YQR A;  4KDZ A;  1VH0 A;  4X3L A;  3NK7 A;  1J85 A;  4YPY A;  4L69 A;  3ONP A;  5D9F A;  2EGW A;  3AI9 X;  4JWF A;  1Z85 A;  4MCB A;  1X7P A;  4KGN A;  3NK6 A;  4E8B A;  1UAK A;  4JWJ A;  3OII A;  4YQ0 A;  3IC6 A;  4YVI A;  4JAL A;  2QWV A;  4H3Z A;  3L8U A;  4YQ7 A;  3IEF A;  3QUV A;  4H3Y A;  1ZJR A;  4YPZ A;  1UAJ A;  4YQ8 A;  4RG1 A;  1V6Z A;  4YVG A;  2I6D A;  3OIN A;  4YQQ A;  1NXZ A;  4YQD A;  3OIJ A;  3BBD A;  2YY8 A;  3KNU A;  4CNF A;  4YQI A;  1VHK A;  4YQK A;  1O6D A;  4FAK A;  3DCM X;  4YVK A;  3BBE A;  3ILK A;  4YVJ A;  1TO0 A;  4PZK A;  4YQL A;  5GM8 A;  3GYQ A;  4YQ3 A;  4YPX A;  2V3K A;  4YQP A;  1UAL A;  2O3A A;  4YQ2 A;  4YQ4 A;  4YQ6 A;  1P9P A;  4JWH A;  5FAI A;  2QMM A;  3AXZ A;  1IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...