4J3OG

Crystal structure of the fimd usher traversed by the pilus tip complex assembly composed of fimc:fimf:fimg:fimh
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
144
Chain Sequence
ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimG
publication title Structural and energetic basis of folded-protein transport by the FimD usher.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion/chaperone/membrane protein
total genus 16
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oG00
1KLFB 2WMPB 4ATTA 4CSSA 2J2ZB 4XO9A 4X50A 4AVIA 5IQNA 4XODA 4AVKA 4AUJA 1KIUB 2VCOA 3RFZA 4AUUA 3JWNH 4AVJA 4LOVA 3JWNG 4BUQA 3BWUF 5AB1A 4AV5A 2JTYA 5F3FA 5LNGA 3ZL2A 4X5PA 4X5QA 2XG4B 2JMRA 1N12A 5AAPA 2W07B 4XOEA 3BFWA 2XG5B 4XOAA 3ZPDA 4AVHA 5FS5A 4CA4A 5F2FA 2UY7B 5LNEA 3ZL1A 3ME0B 1TR7A 5CGBA 4J3OF 2UY6B 5FX3A 4X5RA 4AUYA 5FWRA 5ABZA 4XOBA 1UWFA 4XOCA 3MCYA 5FLUA 1N0LB 3BFQG 1PDKB 3JWNE 4AV4A 5AALA 1ZE3H 1QUNB 3SQBB 4J3OH 4AV0A 5IQOA 4J3OG 4XO8A 5IQMA 5JQIB 4CSTA
chains in the Genus database with same CATH superfamily
2XKSA 1EAPA 4KHXL 1PZDA 1D9KC 3ZJAA 4FQCH 1SBSL 4LPTA 3BMWA 5CEZH 5CJOH 4W9FC 3T3PF 3BUPA 4N8UA 1YMMA 4TUJA 4FNLL 4BHUA 1H15A 4L0YA 1OSPL 1YNTF 5I75C 4PJ9C 1PZAA 4FQHA 2HCZX 3W5NA 4AVKA 2ADFL 1ITBB 5DDHA 5DQ9B 2Q10A 5GZND 1KPRB 3ZKNC 2XWBA 5JMOC 5IB3B 2L7EA 4OQ1A 5LLIC 3BXNA 12E8H 3RTQD 5ESAB 4HUVB 1BBDH 3HE7B 1S7VB 3L7FA 2OYKA 4R83A 1FORH 3UAJC 1XD0A 4WSKA 5D7KE 1OTTC 1V8HA 3TJPA 3V0HA 1MY7A 1JF1B 1FBIL 3HCVB 2NY4B 1HX0A 4Y9GA 5D4JA 1RUQL 1E3FA 2JIXB 1PBYA 1E4WL 2Z93A 5ICUA 3DYMA 2I69A 4LDCA 3HHRB 2TRYA 2CD0A 3QARA 4ODUB 1MH5A 2WSDA 3HNSL 2XZQL 1CXIA 4OKVA 4POZD 4XB3A 1IE4A 4ZFFB 1ITCA 3LV3B 1GPOH 3HI5H 3KS0H 4GQRA 2E75C 2HAZA 1JGIA 5KBDA 3P9LB 3CFEB 3Q3GB 5F7LB 4IEFB 2Y2YA 4IJ3C 1DQVA 2UY6B 3D0LA 3RWEB 1O7SA 4XVSL 3EJSA 5F7WC 4WFGD 4HWNA 3T2QA 2CAKA 2X9WA 5J13B 1GJUA 4WI8A 3IU4H 2YPLB 2DWDA 3RNKB 3FO1B 3KYMA 2OFQA 2OMVA 3OSVA 1AZVA 4WFHD 3KXFA 2VGLM 3V9CA 3OWRA 3VCLA 1FUNA 1UASA 2CO6A 4OD3H 4PWGA 4ZO7A 4DKTA 1S7QB 4L3ED 3ESOA 4PWIA 1W8EA 4Q58C 1AO7D 2ICWA 1R47A 1QBAA 3A67L 4HF5L 4TVPL 5DD5L 4CVZB 3GBNL 4PWKA 1NAMH 2VM3A 2JKIS 3PXLA 5C08B 2JV6A 4A2EA 3AREA 1YQVL 1N64H 5DJYA 3VFNA 4X7CC 2HLFC 1KTCA 3CBRA 2AAAA 3MVSA 3Q06A 3DSFH 3T8VA 1NM9A 3QEHB 4LSSL 4AEHL 5MEOA 4B7LA 2VWEC 3FT0A 1NIDA 3IGAB 4NO3A 5CINH 2FRGP 3S5YA 1CE1L 2XWJA 1AIFB 2OYMA 5BXFA 2DLHA 5D1XC 2ZUYA 4QRTB 3D3VA 1A7PL 5C09E 2Y06H 3VA2C 2IXQB 3KLAB 3QZMA 4NO0D 3OHXC 3IMVA 3L4YA 3NJJA 4UV4H 1VFBA 3ORJA 1AI1H 5CGTA 3B83A 4NERA 1DBAH 2HMIC 1KCSH 1A3RH 1T1ZB 1L3NA 4CKVX 3RAJL 1NL0L 5GGTA 2K8QA 3SGJA 1BA9A 4PG2C 4Y9CA 2GJRA 3BAEH 3NABH 4K7PY 2CO7B 1PD6A 5A6MA 4NNPL 1TDQA 4KKAD 2H5UA 2YRLA 2GG1A 3PGDA 1N4XL 2QPSA 4IJTA 1JUFA 3NJMA 5AZEH 1OSZB 1VADA 3RPIA 2Y36L 4R4ND 3X13B 5SX5H 3KCWA 2ENYA 4L8SC 1IL1B 1NC4D 2VDKH 1UQSA 1W0WB 5DZ9A 3IJEA 4ETQB 1FG9C 3BEWA 3PP4L 2Z35A 5DMIH 2Y72A 4BBWA 3QXDA 3QH3A 1G94A 4ACPA 3K3QA 2F18A 3UC0L 1T5XA 3EDJA 5DJZB 1U4EA 4DAGH 3B2MA 3ATFA 4QWWD 5BO1L 4ZFOA 2QPFA 2FHCA 2N59A 4X6DF 3ULUE 3QAZC 3WIHH 3GSXB 1EZUA 3NSCA 1X7QA 3IDYC 4TQPA 3EFOA 3W39A 1FFQA 2XFXA 3QJFA 4PRHD 5CSBA 5IT2L 1VFMA 4WW2B 4N2FA 3RWDB 3AWGA 1OM9A 3KGSA 1TJIH 1YEIL 3VG0H 1SDDA 1S46A 4K3JH 3WNKA 4FJZA 8FABB 4NRZA 2QLVB 5F44A 3DVGA 4L9LB 3T3PB 2C9QA 3GXFA 3MLVL 5HYJB 4V1DE 4HWBL 5LN8A 1QPXA 1CS6A 4N0FA 1MFDH 1YNTB 2VQ1B 1AQKH 2YWZA 1TLKA 4ILDA 5IJVA 1NINA 5A2CA 2MFNA 3OJDB 2A9DA 2QBWA 3UBXG 1J8KA 5DJXB 4UT6L 3SKMB 5ICYA 1KFAH 2BSDA 4JY6B 4OLEA 2AGJH 3VO0A 5C6TL 3O9WA 4P4KA 3MRGA 5AYQA 1TZHA 3MV7D 3H55A 2NR6C 3QDJE 1CF1A 4MXVE 3STZA 3UDWC 2WBWB 3FKUS 5F7FA 2Z7UA 1CBJA 5GGUA 3VAEA 3TTSA 1QNZH 1KXVC 3TM6A 3WUWG 2QKIC 3CFCL 1Z9MA 4L37B 4MZIA 5FYKU 3W82A 1R9FA 3GO1H 2CPUA 2RTTA 3VFTB 3HB3C 1PZBA 4W1TA 3W9EB 5EC2B 2A74A 4GKNB 5LWYL 1FLTX 2OMWA 5EFIB 4K4KA 2QELA 4QRBA 4CMMB 1I8IA 4ZOCA 3ARQA 4OF5A 2UZIL 2BNQE 3T0AA 3FRPB 2OLDA 1XD1A 1Q0XL 3MRQB 4NBXB 3MLTB 4ZUSB 1MCFA 4RMVA 2CJUL 1OAUL 2H6UA 1TFHA 4FHBD 5IMOB 3V4UH 4HBCL 4BEIA 3BVUA 5ERWA 4HUKB 1SOQA 3D69A 2XQ0A 3HPJB 5FDYA 1A14L 2KERA 1EO5A 4JBSA 4NKOA 5HDLA 2F8XC 4BKSC 4MAUL 1YHPA 4UILL 4ZODA 3D2UA 4AT6A 4LP8A 1P7BA 2H41A 4H8HA 4XCFL 2EXSA 4V11A 2I25N 4JX0A 3UGXA 2WLLB 1YECH 3MNVB 1YMMD 4ODBD 4CJ1A 3PGCA 3LKPA 3RI5F 5AW3B 2F74B 3G5YA 3ARWA 1PY0A 1FVEB 1GZQA 3ARVA 3PUUA 2WTOA 3PJNA 3QXUA 4OM0H 4FQ1L 3RIFF 4YHLL 4JQXC 4J39A 4YXKL 3SDXE 1QFHA 4PJ5A 1VA9A 4YBQC 4A2LA 4EOWH 2NDGA 3FZUC 1ZVSA 3NCFB 4M8QA 3NZHL 1D6VH 2EDKA 1TJXA 4OVUA 2D73A 2IO5A 4FQIH 1MAKA 1JZDC 2IG2H 3ES6A 5HDWA 4MA7L 3KPLB 4TMPA 1Q0EA 1U3ZA 3FU7A 4U1KB 4Y5XA 5I1GH 4RMUA 4GG8B 4RFNC 3GSNB 4HKJB 2X4OA 5EO1B 1CR9L 4IMLA 1XF2B 1FNGA 4GS7C 1KF9B 4X8XA 4M1DH 4KXAA 2GJ6A 2WINA 3QIBD 3O2WH 4F58L 3QUYB 2CBOA 4Y16B 1T83C 5AUMB 4CC1A 2MMXA 5IVZA 1EXHA 1W72B 2IMNA 3NFSL 1ML0A 1A8ZA 1OCWL 1PZ5A 5HGDB 5T3XD 2VLME 2SEBB 3KCPB 5F0LB 2YMTA 4HJUA 1FHGA 1IVLA 1GHFH 2Z31B 1J8RA 3NTCH 4TUOA 1HHHA 1RIVL 1LDPL 1JGLH 4R4BA 4LLDB 3ULUH 3KXFD 1PJWA 1CFNA 3PWPE 3ZKMD 2AJZB 2ZCKH 1YAZA 2DI9A 4OLUH 3BP6B 2YPLE 4KX9A 4NRYA 3RQ3A 3AT9A 3RZCC 3BAYA 1I7UA 1G7IA 4LZKA 4QI3A 5CILL 3TBVA 4Z76B 2OR9H 4BGLA 4JCLA 1NUDA 1SY6H 3ARED 4X6DB 4AC4A 2A9NH 2GEEA 5I6MA 2XVKA 3EYVA 5FCUH 3SKOA 3T71A 1GY2A 4EBQL 2J3SA 3BUBA 2X7LB 3S3PA 5DMKA 3FULA 2O61B 5JORB 3WHE1 4FA7B 4ZPTA 5BS0E 3D3VD 1FNAA 3RX5A 1U3NA 5DHYB 4LGSB 5E9DB 5HHQA 4YHOL 4OLXL 4XO9A 4WAFA 3WKNA 4G5ZL 1FO0B 2VL5B 2C3HA 2ENPA 3R0MA 4BQCA 2FX9H 4U1LB 3VMNA 3MOAH 1M4KA 3RFZA 4OSUL 2FL5B 1FZOA 2ISDA 3WOVA 3WYRA 5D93C 3US0A 4KZEL 3LNIA 1JXDA 4IRSB 2ZONA 5DZLA 2UZYB 1D6EB 2XNAB 3K8KA 4QRPE 3KJ4B 1A7RL 5HVHB 4S10A 1U95B 1JNLL 2D3LA 3QPQD 3EJZD 2YXMA 1B4JL 5J9PA 4LSRL 4K71B 4NM8L 2BOCB 5DFTA 4YSCA 3VXRA 5B3JE 2VR8A 1AXSB 1LLAA 2AJYL 1NDGB 2W65B 1MAJA 4F80A 1R0AL 1F11A 4OFIA 1TPXB 2FWLB 4M5YH 3FUKA 1DSFH 2R7EA 1ZVYA 1F4HA 3ZDZE 1XAUA 3ECUA 2AQRA 3UH8A 4QHLA 1YY8A 3CLFL 4QTHA 3I9IA 1ND0B 4DK5A 2PXYA 3UX9B 3HOGA 3N9GL 5D70L 2ORBL 2OSLB 4YE4H 4YDKH 4Y4KA 1JV5B 4YSOA 1S7WB 1HEJC 2BVEA 1FYTB 2YEVB 4QRUA 1R19A 2YC1A 5T5FA 5ITFA 3AS0A 1N6QL 3FB7A 5E00B 4XH2A 5LAXA 4I5BB 1VB9A 4P3DB 4ZXBC 1UVQB 9CGTA 2Y24A 5B1BB 5EH1A 5F97E 1BPVA 4FFWD 3M7FB 1WAAE 3ARDC 4G8IB 3C5ZB 5DZJA 1SLVA 1LO3H 2P24B 2R0WL 3TBSB 4DEWA 1MCKA 1TQSA 3BPLB 4WNQA 3O0RH 4U3XA 4I3SH 3C5JB 3FONA 2R56H 4PJGA 2ZKHL 4QTIL 1FVDB 4WF7A 4P4KD 5CLYA 1U33A 3EO9L 1EZVX 4XRCB 2CZNA 1IAII 3P30H 2XA3A 4QHKJ 3AY4A 1KCBA 3BUQA 3VXMA 4YSAA 1IC5H 1KY6A 4MSWB 1LL1A 5C0RH 4HK3N 4RDQF 1B6UA 3P4OB 4JDTH 3VH8G 3WL9A 4AITA 1IFHH 4NHUA 2EDQA 3EXJA 4N2KA 4LAQH 3GNML 3KL5A 2J1KA 3N43F 3MLUL 2EO1A 2FT8A 5EO9A 2A1WH 2MCG1 1OKEA 3RY6C 1J0JA 2QVKA 1BFOA 2DWYA 4A6YL 1E30A 4ORGA 4XPBL 5L9DL 4PB0H 2H2SC 1MCLA 1B0WA 1S9KC 2MHAA 2QKSA 1AGFB 1E4XI 5FO2A 5KSAA 3VXSE 1QHOA 1NLDL 4PGBA 4B9YA 3BPNB 4R3SB 4WKXA 2PPEA 3F7QA 3D2UD 1U2YA 2QSCH 3WJJA 2FYYB 1NCAL 1NH6A 4FJ6A 4WW1A 3V9EA 1XWVA 1BXXA 4A2FA 4JRFA 5H37G 4Y4FB 1NEZG 3BVXA 4QXTA 1TJHH 3D4CA 3LDBC 1MDAA 3TV3H 5I6XB 5AOKA 4XNZB 4QHMA 3ALWA 5JA8B 4G59C 2FJGB 3WNMA 3KZ8A 4PJ5D 1NCWL 5TDOB 4YDLB 2NY6D 4LIQL 4UYQA 1JVLA 3VWJC 3QJTB 5I8OL 1IAMA 2N0KA 4QRSA 5SWZA 1A25A 2A9MH 5HGHB 4WHTA 3N1MC 5EF2A 2ZOTA 3OJ2C 4U05A 1INEH 1K2DB 4KK6D 5E9AA 1QZNA 4HGWB 1JYNA 3BFOA 2K0RA 3F83A 1D5IL 1EFQA 4B50A 1AQMA 4N8VA 5IQ9B 1QI3A 1T7VA 2ATKB 2Y6SC 3EG9A 4P4RB 4WFEE 5DHEA 5A2IH 3LKQA 1AP2A 1S2EA 1RZKH 2VT0A 2DQCL 3GK8L 2DRUA 3Q0HA 5MI0B 2GJ6D 4K7PH 3CN2A 2FH8A 4LHUG 1BIIB 1H3PH 3IFLL 3T3MF 5L2JB 5L7XL 3BWZA 4CADA 1X3DA 4MA3A 1BJMA 5AFAA 1QLFA 1RFDH 5LBVA 5D71H 4F8OA 3FC8A 5BJTB 4DP0X 3VQMA 4RDBA 3VFMA 4GNKB 4ZS7L 4K8RL 1QSEE 1XZ0B 4LLUB 3RPKA 4HXBH 1ZA3B 2JCCA 3IDUA 3BKYH 2W60A 3VD3A 2IBZX 2WLMA 3ILQC 2NRDA 4NFDA 5D4QA 5KYUA 3NAAH 5HJBA 4IHBA 4ADGA 5C1MB 3MFFB 1FV1B 2V9RA 3VWKB 1F42A 5K9OA 4KXDA 5KZCB 4G82A 2OMBA 3VJ6A 1UA7A 1XGTA 2OL3L 4GRLA 3QEQA 5HDQH 2B4CC 4ZUVA 1RUKH 5C0BB 3WE6B 4PJDA 4R9HA 3ZDXE 3F85A 4OGYL 5AL8A 4EUPH 4M6NH 1G7MB 2DTSA 2YUWA 1W0VA 3TNMB 1CDYA 3F7RA 3SE9H 4QRAA 5G4MA 3DRTB 2KI6A 3L3JB 1NFDF 3L13A 1MKFA 3RWHA 3KNBB 1JJUA 3BGFC 2ADYA 2VN7A 1OGTB 3K81A 2FEEI 2WVVB 1MNUL 4NIKB 1XIWC 1RURL 1I7TB 1URLA 4UT9L 5CP7B 3JV5A 3HMWL 3I3BA 4DGUA 4LCCB 5LQBL 2CA4A 1A4KA 1NPJA 3SDCA 2QDVA 4OF3A 3ZT7A 4I48B 1H3UA 4GXVH 1AR1C 2XICA 3WO4B 2OMXB 2O6EA 3MUY1 2RCSL 1DBJL 1RSYA 2FJHA 5FECA 1G0XA 5HD8C 2WWMD 1KTLA 5I8EA 4ABUA 3MJ9L 3TS8A 4QT5B 2EIZB 2O1AA 4MMXA 1DQQB 4LSVH 3D05A 4JPWL 3U6RB 2CMRL 3S96B 3FCGA 2O5YH 3I6LE 4M5ZL 3W0WA 4C4KO 3VXRD 4NJAH 5I0VA 1S7SA 3PQYD 4K3EH 4KRLB 5KANI 1EVUA 5CHNB 1E6JL 1X7TA 2YA2A 4G80A 5DEGB 3CQPA 4XC1L 1Z5LB 3N43B 4IIQC 4M6OH 5L0QB 1LVEA 4NSKB 3B1TA 1DANU 4C58B 1E2ZA 2GFBB 3EYOA 3NJFA 1FZMB 2PXYD 2BNUB 3HZMB 4ONHB 4MCZB 2JI3A 4Y4KD 4MBRA 2ERJC 3KW7A 3MACH 1J1OL 3FSVA 1AMXA 4CW1B 1J5OH 3WIHA 1O6SA 1A6TA 1KCRH 5AYUL 1N6VA 4XWOC 2LABA 2FD6L 2VLLB 4JKPL 3VXOB 4HLEA 1Z9PA 2RMNA 4P04A 4BXVA 1MCNA 4GSUA 3U2JA 4YHIB 4YEFA 4EPSA 4MXQD 2NYKA 2HN7A 3FU8A 3W9DB 4C47A 3MO1A 1C1EH 4Z77A 3AJ7A 1DANT 2R1XA 4UQEA 2Q87A 2XVLA 2PO6C 2AABL 5H4YA 2WLJA 2B1AL 3CZKA 3SOTA 5ID0B 5TDPB 3ALPA 4I13B 1N0LA 2ZOLA 4GI6A 4WO4B 1I1AB 4XPHL 1A7BA 3KHOA 4OGAD 1JDCA 4P23A 4AEFA 4XHJD 1PU0A 1CD0A 4OGXH 5HHVH 1A0QL 4MA1C 3PL6B 5DUPL 2FATH 3R8BB 3L1OL 3VXMD 1A1MB 2C3GA 3T6WA 1BOGA 5K5YA 3ZW3A 2OMTA 2FBJH 4RWYH 1JHKL 1KB5L 3L4UA 5FUOH 25C8L 3I9GL 1IAKA 2DQIH 2R0ZH 2VISB 1XR8B 2X6BA 2HVJA 4UNTA 4YHZL 4HS3B 1RZFH 3ZKQD 4HK3J 1ASQA 5J0BA 5KN5B 3BN9D 3ZQ9A 3NRPA 3PDOB 3VFGL 2D7QA 5GIRB 2VUKA 5DC0A 5L6YL 1W72H 1JNNH 5EEYA 1QW9A 3G6JE 4PJIA 1TMQA 2XY1A 3H2WA 3FQYA 1IC1A 3T3MB 3QXTA 4FXGB 1S9VB 2WO4A 2EYSB 2CALA 4KNTA 2AEPH 4LLYA 4HCRH 3FN9A 3IMRA 2EECA 2XJLA 4H0HB 2IEPA 5F88B 2HG0A 1JK8B 3L3OC 5KSAD 4X7EC 4L0ZA 4DOHB 2XN9B 4JO5A 1FNSL 2Z7WA 1GC1C 2Z4QA 5DZPA 4A04A 2ZPKL 1UOKA 5CCJA 4ODXA 4U1GB 4JFHE 1S7TA 1KG0A 3CK0H 3VSQA 5FO9B 3ULVD 3AM8A 1BEYH 1H8LA 3VM7A 4QCIB 3CG8A 4PP2A 5T3ZE 2DJ4A 4LPYA 1CGUA 2CUMA 4NDMB 5K9KB 5LCVL 1U36A 1N0XH 4G8GE 5KSBA 3RWIB 3K5RA 4Y5YA 2C4XA 2VKWA 1Y6NR 3EUUA 1AHWA 4OM1H 5E2WL 4NQTA 5C09A 3QUXA 5SWZD 1A2YA 5ITBH 3UJIH 3FFDA 3T0EB 1MOEA 3LKSB 2BC4A 2A4ZA 3EF7A 1G43A 3EO1A 1AG0A 3JWDL 1NFDB 2IH9A 4P9ML 2IGTA 4JFUA 3K72B 2H7WA 5DMYA 2Q5BA 2QZ5A 1KZQA 3EKCA 3D0AA 1D5XB 4ZG1A 1LJMA 3VDBA 3X11A 5CCKH 2COVD 4XPTH 2X4UB 1DQJB 2BPBA 3MRIB 2XIDA 5EPMB 1PDKB 1XGYL 2WHVA 3TPUB 2OJ1A 4J8QA 4YDVB 2C26A 1OWRM 3C5SA 1THAA 2AJSH 5H8DA 4YSUA 2F1BA 4KO7A 3B9KA 3P69A 7FABL 4KK9C 1KUMA 1N19A 5JHAA 1PKOA 4O51B 5CR8A 3H1ZA 2QMKA 2PWDA 4ONGL 4WI0A 4K2UL 1NOFA 3EHBC 5HHMB 4K23L 1V7ML 1BD2B 2UVFA 3IN2A 2CK0H 4XCEB 3MRJA 2HKHL 3BP7A 3MRBB 4N0YL 4L0PB 3UO8B 3KLKA 4M6ML 3CVCA 4AM0Q 1S9XA 2EAEA 2IBZY 2VZ3A 2WMPB 4LASH 5CN2A 3BP4B 2Z7ZA 3LQZA 5AAMC 2E3VA 2FNWA 4QJ4B 4P57B 3DX7B 3NCCB 1WBXA 2P3YA 3MQIA 4ZSOB 3E2HC 4K3HA 1JHTB 4IU3B 2YD6A 3CH1B 4J3WA 4XC3L 1T03L 4A2HA 2K8MA 4GRLD 4XTRD 3QEQD 1WTLA 2WGNB 4G6KH 2WGXA 5FB8A 4WEEA 4TL5A 2Y7MA 1KV7A 5EU6B 4F27A 3D51A 4I3RH 4U1NA 4WUKL 3JWOL 4PS4H 1SY6A 4RQQA 4UM8B 3ARGB 4FD0A 1GYVA 3V4PH 4UDTA 4V1DA 2VDLH 4IK7A 3QDMA 5DJDA 5EBWA 4TOYL 4MDIB 2HTLC 4Q9QL 1MZZA 3TBCA 4R0LA 4G7VL 1GYCA 2MJWA 4LCWD 3ARXA 2OM5A 1D7CA 1N8ZA 2Y7OA 5CGYD 5E8NA 2Q3ZA 1IU1A 3B9VA 2BFGA 1EDYA 4N2CA 1HESA 2JKJA 5HI4D 4C57C 1S9YB 1F3DJ 3GJFA 5C07A 3QDJA 3AS3A 5IEKA 5JHMA 2OTPA 1E7UA 3WFEH 3SDCD 3IWVA 1WRFA 3HRPA 3QCTH 4Y0GA 1F4XH 5LBSA 2AJ3A 3OR7B 3S88H 3UXFA 1GOFA 1S7UA 5IW6A 5I73B 2XZCH 1OQXA 5DHVH 3NESA 1HEZB 1MCRA 1UB6A 3DVFA 4P2CG 5F7EL 1MW2A 4GQPH 3FQNB 3K2MC 4PV1C 3DRQB 4KNUA 1DVSA 2LFGA 4XVTL 5E2TH 3PV6B 2BNQA 3L5WB 3U82B 3W0WD 4PRBB 3FF7A 1ID5I 1GAFH 2HVBA 1DO5A 3PF2A 3D50A 3GPEA 2WUCH 1NGQL 1NGPL 3HG1A 4MVBC 1L7TH 4DGVH 3DV4B 4EN3B 5HYQA 4S0TD 4ZUUB 1S78D 1XF3B 1RZGB 3NJNA 1JPTL 3F8UB 1ZVHA 3VFSA 1ZTXE 4HHWA 5EOCJ 4DPAX 2WAQA 2DL2A 4MX7B 5H94A 3BWSA 4Z3HA 5FW6A 3IDIA 4HS6A 5T3ZH 1FCCA 1O75A 1MQKH 1WIUA 1U8PB 3PAUA 2ZX5A 5FCSH 2V3DA 2CRYA 2BNRE 3I3EA 4O4YL 1IBYA 3RVVD 1HQ4A 4C55A 5IJCC 3CVHH 4AV0A 5FGCB 2QQQA 4XP5L 4ALAC 1SMDA 2G3NA 3GXDA 2F8VA 3E8UH 1M7IB 4ZAKC 3SDXA 3WKYA 2R69H 2FYVA 2YAQA 4GIPD 2D7NA 3IDMB 4JRXB 4YNYA 4HFWA 4IOIB 5AVWB 1BAGA 4YSRA 5HGAA 1CJYA 3E0GA 3DBXB 3V0VA 4YHKH 3Q48A 4W70A 5CCHE 4EI6B 3L3DB 2WVTA 4JW3A 3WS6C 3LNEA 1H3WM 2ZUQC 2GY5A 3VRLE 2B5IB 1S8DA 2R0KH 4MJ6B 4G9DA 3UAFA 4IRJB 1VESA 3G5WA 5GGTL 1ZXQA 4GOSA 4IM8A 3MXVH 2GJJA 4NQCB 4WIQA 1INQA 4OU3A 1JF5A 4JNXA 1XGPB 3P54A 4N25A 1RUPH 3MLRL 1E42A 1NSNL 4XP4H 1B9KA 1FAIH 5FFLA 4L8DB 3QIUA 1SF5A 1BMZA 1ZOXA 3GMQB 1JNHB 3VNYA 2ZCHH 2R51A 4I89A 3MGTB 1NBZB 4WU7B 4X98B 2AV7A 2ZNXA 5L4JA 5INDA 3X1EA 4OGZA 2NW2B 1ACCA 3BVTA 2BY1A 2W92A 3EYUL 1MWAB 3B2VL 4NM4L 4X0KA 5AKTA 5GJSL 1PFOA 3LZRA 4WNSA 4Z23A 4QJ5B 5F2FA 4ZW6A 5I1CL 3PWPA 3D9AL 3WTUA 5HHNA 2X4PB 3FCTA 3S5LA 3PABA 3ZHKA 5I1EH 3PAVA 4Z5RA 3RBGA 3K6NA 1BVNP 2NYYC 3DX4A 4KJPD 1A6WL 1SFHA 3BUYB 2VDRH 4OJYA 3BISA 4ELDA 3HW7A 5J57B 3N41F 4PVLA 4HW6A 2B77A 3FUDA 2XN9E 4OBRA 3N1PC 5G5DA 4OZHF 1RVFH 4LARH 1KTRL 1J48A 1DYZA 3C60B 3U9UA 4P46B 1NCCL 1XB6A 4ZS6C 3UBGA 1PLGL 1T3FB 3B8SA 4H88L 5T5NF 3E7JA 3UTTB 1T0NB 1KCLA 4G8AC 5FF6A 4BUGA 5ELIA 1T4KB 5BS0A 2NUTA 5C09D 1OPGH 3LEVH 5I28A 3P0VL 4PV8A 4X6FA 3TYGL 1Y6KR 2H32H 3RGVA 3BQUB 3SPJA 3WIIL 2W81C 4YX2L 4JFEE 4OZFG 5JOFA 2HFFB 1OPOA 1EQWA 1IGIL 1CDBA 4WKZB 3QCVH 3EYSL 1Q1JH 4AM0B 2X4TA 2FX8L 3K2UL 3ATEA 1AXIB 4M8UA 4QRPA 4LLQA 3BUTA 1CICA 3O3AA 2QQLH 3EFFB 3GXMA 3PLYA 5I18L 4OJFL 4PIRF 2WNKA 5HYSB 5TDNA 3B9KD 5AZ2L 4OCSH 4PBWD 5LGJB 2A4EA 2W88A 4X8CA 3VI3F 2OYLA 3VFRB 2E9WA 4YE0A 4MHHG 4KX7A 4G9FB 1I7ZA 3KGRA 4N8VG 3A3YB 3N42F 3GMRB 4GW4A 4YWGH 43C9A 4KUZL 4MCYA 1LTXA 1ZHBB 3Q9PA 4K7FB 3BP5B 2FDBP 3AFLA 3TCLA 1ZTXH 5HHME 4DZBA 5BZDB 3ULUD 1IEBA 1JP5A 2X1PA 4JHWL 2FR4A 1GY1A 1DEEB 2ZUVA 4ZPVB 4ZMZA 5L2KE 2Z92A 5BVJB 2A9BA 3SKNA 1GVIA 4ZUTB 4AZ8A 2DV6A 3D6GA 4F3FB 2R2BA 4MCMA 4FMVA 4X5PA 1J0ZA 2HUHA 4LLWB 2ZZUT 2ZUUA 4BDVA 4ZSOE 2CWRA 3DV6A 5FUCC 1PX8A 3F58H 5GGQH 4AYID 3ARYA 4HHGA 2PCXA 2APTA 1MEXL 4V1DD 2D3VA 1WAAA 2BFVL 2C9VA 1JPST 1UGNA 3QDMD 4EUPA 2VZTA 3OXSB 3H7BB 5EU6E 4BH7A 2DDQL 5CU5A 1JWSA 3OQ3B 3CFNA 3DGGA 3LY6A 3UEZA 1SJEA 1QTSA 5HJ3A 1V27A 3SPCA 3MUZ1 4G8EA 3RNQB 5G4OA 2IQAA 5AVZB 1RJLB 1U3JA 3OKNA 3IETB 3QDJD 2YFNA 1CLZL 3CN4A 4WU5B 3C2AH 1LWJA 1XGRA 3TL5A 3SJVB 2H1PH 1IM3B 4UQ2A 5FGBC 4OUUA 2AEOA 3LS4L 4FQJH 4WI9A 3CU7A 1RQ5A 4ICXA 4FI8A 5JW4Q 3IGKA 4A7UA 4QNPF 5E6SB 3S98A 2A9AA 2C3VB 2GK0B 2RIKA 1GCYA 2WXGA 3O6FC 4L3AA 2F19L 1MUJB 5J12C 5DLMH 5KS9F 2AJUL 4TNVK 2BNQD 1PLAA 1BSIA 2EJ1A 2ZXQA 3RVUD 1C8PA 3DMMA 4XMLL 3GSVB 4TL4A 2AVGA 3HN8A 3CSYA 2EUZA 3HMXA 3W1ZA 2AMGA 4U1IA 4E9QA 2R2HB 1LP9E 3P2DA 3EOAA 4F5CE 5LXVA 3HG1D 2R1YB 4FQLL 3VXSA 5KBPA 1MFCH 3QZBA 32C2B 3PNWA 3V0DA 4J3OH 3DXAB 1OB0A 4A2MA 3LH2L 5TK4A 3WLWC 3FJTA 3GHBL 4JFXB 4PRDA 2NY1C 1PG7X 4PP1C 2AVFA 4JFOB 5CD5D 2AQ1A 1ZXKA 2A4CA 3WE1A 2D31B 5DQDL 4D9QE 1TZOA 3MN8A 5CIPB 1TVBB 5F6HJ 2X4SA 1TCRB 5BRQA 1LNUB 5MEPA 2FQGA 1GXEA 1P4IH 1QR1A 3WIFA 1I9RL 3N41B 5DMGD 3S36H 2VSKB 4OZHB 4P5SA 2I32A 4YOKA 4KROC 1NBYA 4XR8C 3TFKC 3FYIB 4NPKA 5HHXH 5FGCE 3EGSA 4BFFA 1TETH 3N44F 3QQ9C 4F8NA 1FLRH 3D2TA 2Q2LA 1QG3A 1UB5B 3M45A 1MPAH 3RP1A 4JRXE 3U36B 1DDTA 1BG9A 4N9OB 2YO3A 1YEKL 2I60L 3FH5A 3QDAA 4GQ9L 2W0LA 5HY9A 2AEIT 1PW3A 4TQEH 3I3DA 3FOMB 4PJBF 1RL1A 2WVSA 3G5XA 3I2CH 1IBGL 1VRSA 1G7QA 4H26A 1HH9A 4MAZA 1VKXB 3ZL4L 1WT5C 2JMRA 5KJRH 5IHZA 2PPFA 1IILE 2C34A 4LOFA 4Q2ZA 3P0YL 3ETBJ 1D9KA 3NJVA 3QIUD 4XOAA 4P5MB 3U7WL 1KWKA 4HH9B 4HUXA 4WTZA 3V10A 4MNHB 1P7KA 3CPLA 2ZOOA 4PB9L 1BFSA 4KX8A 1HHJB 4WK2B 2VN6A 5C8JA 2EZ0C 2FX7L 2VLMD 4ZO8A 4QXVA 2CKBH 1I8MB 2W0FB 1RJZB 4DKEH 3VI3B 5IB2B 1QSEA 4NC1C 4LVOB 4BZ2H 1TZIA 4D3CL 1EFXB 2BK8A 1I9IL 3PWPD 2L7UA 3GJEA 3N42B 3QUYC 1MAML 2FECL 5JYMA 3TT1L 1LO4H 5C0CA 1KWGA 3C6LB 2E47A 3BIKA 4HKBA 4NKQB 4MJ5A 3ZE0E 5TD4A 3UAJA 5B1KA 2ITCB 4L1SA 4XN5A 1JHLL 2FLBT 4GAJL 2Z31C 3T1FA 3US9A 1E9QA 3EOBB 5D1QB 1NEPA 4LDOB 4ZI8A 4JRYE 4FTVA 1DVFB 1O9VA 1KT2B 3GD1C 4S1RH 3C6EA 3ZO9A 5DU7A 5BS0D 1UURA 3PHSA 2A6DA 1FFPB 2O5ZL 3O2DL 4UINL 1NCUA 5H2BB 5H35B 2J12B 4AENA 3RGVD 4K9EC 3UTTE 1MHPH 5IMLB 1T21B 1XHHA 2NY2B 3KPMB 4LL1A 2DS4A 4OZ4B 1HOCA 3BH9B 4UZSA 4NUMA 4DPRA 1IFGA 1E6OL 2HPTA 5CGMA 3DECA 3BLPX 4QRPD 1VEOA 4K73A 1CICD 1S4IA 1QSFB 2X9YA 5CP3A 4ZQTA 5BRZE 1OE2A 2YK1H 2Y5TA 1WS7A 1SEBA 4BFKA 3TXAA 3Q8BA 4OV5B 2MKWA 2ZYHA 3S3DB 2VCOA 4GMTH 5IFHH 3G08B 4HZLB 3FB6B 4WV1B 1VLXA 4YZFE 1F00I 3C8KA 5T1KB 1MLBA 2E86A 3CSBA 4APQB 3HZYB 1YPZE 5EN2A 3MV9B 2AJVL 4J12A 3EJYC 2X6VA 1X4ZA 2FO8A 1WHPA 5DWPA 4F20A 2BRRH 3MRLB 2EH8L 4B9KC 4OIIL 4DN4L 4BK5C 3C8HA 5KS9B 3D39B 3M6DA 4AV5A 1OARL 3KJ4C 2VDPH 4IDJL 4XMPL 5D1XA 4U6YA 3RDTB 5IHLB 1NUGA 2HH0L 4NT6B 5ANMB 3ZUCA 1KB9K 5D8JH 4TN9A 3DURA 3SEPA 2CDFA 3R0NA 5IIEA 1SM3L 1EUUA 3A4AA 1Z5YD 3CUPB 3GT6A 4QO1A 1O5DT 5F0PB 3BGMB 4AVHA 4M56A 4TNFA 1WBZB 5CJOL 1WGVA 1TPXC 4H25B 5CD3B 1CLYH 2IDCA 3KPNA 5D7SH 2VXVL 4FXKB 4M1GL 3B7RL 1XL6A 2HXAA 4WY7H 3ME0B 1VGKA 2Z8WC 2Y3AA 2DQJL 1JZ6A 1UHVA 1T20A 4X7TA 1H8OA 3TX4A 3QRGH 2NQ3A 1EANA 1LHZA 4HMDA 4B41A 4BSVB 4MRCA 3AITA 1ET8A 5I1IL 3FU6A 1ZHKB 4LCUB 5JHDE 1HHGA 1HH6A 1HYSC 2LVEA 1ZLVK 3E8VA 1EAOA 4AX3A 4YXHH 5DJCB 3OZKA 4LBEA 4JM2C 3N44B 4PS3A 4WHYH 1KIPA 2X4QB 1GW6A 3JV4A 3NN8A 3T4YB 3TLRA 2JJWA 3VRJA 3QI9C 3QXVA 4RAVA 4UUJB 5EBLB 2VXTH 2Z8SA 1DQKA 4YR6A 3C87A 4OZGE 1MJ8H 3CFDA 3LS5L 4ZMYA 5CZKA 4R90L 3SJVE 5D7JC 4PJBB 4C4KT 5DHVA 1AHMA 2PABA 3QBTB 2OTWB 1GPOL 3HI5L 1QUNB 3BKJL 3E3QC 3OVUB 4BFJA 3RILA 5A16B 2DLFH 2IBBA 4UTAH 3G6JA 2GAZB 4JE0A 3UYPA 1CG9B 4MTMA 4N8CH 3VW3H 3MNMA 4ZMTA 3SPHA 3ETTA 1U8QA 1LD9B 1WO2A 2NT1A 3LIUA 1D3CA 2GSGB 4APXB 6FABL 2F7OA 1G9MC 1KOAA 3NPZB 3EOTL 1DBKH 5IG7A 3VXSD 2Y0SA 4X5XA 1MWAH 2EUXA 4E68A 4PPTA 2FO4A 4UQ9A 3AUWB 4L9DA 5DD6B 1IC7H 2F5AL 4EXPX 1AR2A 4JN2B 3NQIA 3AC0A 2JJVA 4YS4A 5JQ6L 1L3WA 4Z7IA 2NR6A 1BQRA 1IAOA 3UDWA 3DXAE 4XBEL 4BH8A 4DH2A 2H0JA 4LSDA 2BP0A 1L6PA 1KDIA 2AANA 2MCPH 3CLEH 2QKIA 2GEQA 2HRLA 4G8GA 1AC0A 1N64L 2EEBA 4KQ0A 2B08A 1GGUA 3NEEA 4DP2X 1MFBL 3CVHA 3LMJH 4LFHD 4P2RA 3L2MA 2CLRA 4KQ4L 3UZVB 2G0KA 1U9KA 5TH2B 1RZQA 3BPNC 5IHHA 3X3FL 4HDIB 3MI6A 3OG4B 3GJFK 5DD0H 4HPOL 5I1KH 4DF9A 1H0DB 3K2KA 3C9NA 1MI5B 5F6IB 2Y06L 3ETBF 4QF1A 3TBTB 2BOBA 4KI5F 4Y4FC 3KYKH 2IMMA 4PY8I 3TA3B 5J1TC 1RK0A 5HYFA 4P9HH 4HQQH 4WFED 5I6XC 3H9HB 4GEJA 4JO1L 1N7MH 3KPSA 4HJ0C 1GGBH 2LQRA 2VE6B 1DN2A 4CNIA 2VXSH 3QZWA 5TE4H 3L4TA 3TEXA 3VXUB 1V54B 1GC1H 5ADPL 1SNRA 4NKIH 3Q6GH 2ESVB 3UJTL 4HU8A 4Z8FL 2Q86A 3UOAB 4QOKB 4S0HA 4O58H 1I1FA 2KZBA 7TAAA 1ODAA 1D9KD 1K8IA 2XIIA 2VC2B 3ML8A 5CNHA 2FIKB 4GFXA 1SHXA 5DK2A 2OP4H 1WYJA 3SGDI 5E8PA 3TBYB 2WN2A 5GRUL 2VDKL 2VLRE 4AQ1A 2YD9A 1EJOL 1FL6B 2E59A 3EGXB 4JDZB 1QSED 2NLJA 2YBRB 3MJ8B 2D03H 4JQXA 5CM1A 4NZTH 4GB9A 4DW2H 4IKKA 4AE0A 3GI8H 1KBKA 2CNZA 1VGEL 5C0CD 3VI3E 4PTUA 3KLSA 3ZE1E 1NMAL 3I74A 1EV2E 5GS1C 2WYZA 1I1YA 3UAJD 3O4LB 1NDMA 1ADWA 3GSQA 1UCTA 4EDWH 2ZSWA 1UOVA 4GP8B 1UWXK 3QUMH 1WCQA 4JFDE 5T33L 2P7TB 4Z7OE 3K6FA 3P4MB 3MTXA 3MLZL 1CPUA 4FTVD 4JPQA 4B9JA 1FL3A 3VNZA 2WYTA 3VG0L 1CZ8H 2Z0BA 3DPBA 1I3GL 4QHNB 5FPIA 1T83A 3GRWH 5D1QE 3DUSA 4N0UE 3QJHA 1ZE3C 3UTQB 3VWKC 5J7CC 4CSSA 5E5MB 4X80H 3ROLB 2AXWA 2NCEA 3Q8AA 3DJTA 1JVOA 3DETC 1IE5A 1EZLA 2OJZL 2H32A 3FRUB 3U0TA 1J5IA 5F1IA 4CN4A 4JGUA 1LDSA 4NQEE 2VIRB 3S8WA 5B38B 2J55A 5BV7C 1WZ1L 3QIWB 1ASOA 1CYGA 2R23A 2YKKA 4KRPB 1IGJB 1Y18A 3WMSA 5I2IA 3BH8A 3H0TA 2OMZB 5BCAA 1QBBA 4PJXF 3U0PB 4E9TA 1IC4L 1QSZA 5JNYA 4KOCA 5KYWB 3RZCA 2TSAA 5K9QG 3UPRA 1MCJA 3L5HA 2BSRA 3I6LD 1N68A 1WWWX 3D08A 1TMCB 2A6IB 1EO7A 4HHAB 5GQBA 4ZFGH 2MRYA 5D7IE 3VRIA 4BE6A 4LCCC 2HLFD 3S35H 2VAAA 5A2JH 3WO4C 5BMFL 5F1SA 4HJGA 2XWCA 4QNPE 4U1JA 3GWJA 1KBBA 1TKWA 2B8OT 4N28A 5D1XD 1QFWL 1II4E 3IT8D 5DJ0A 3MV9E 2LFEA 5DGRA 5F1KC 5FOBB 3D4GA 2JKLA 4CMHC 4HD5A 3JBG7 3K46A 2JVUA 2EDNA 2YXWA 3SPVB 2HMID 4KVNL 4OAWB 4DKFL 5ANME 4O2FA 1NEUA 2BNRA 3MCLL 3QP3A 3UCRA 4TSBH 5FYKL 4NQSB 2NNAB 2W9LA 1EBAA 2CLZB 2WLNA 1IARB 1FE8L 2NXYC 1QHPA 2HVKB 4I0PB 4NO2B 4YDIL 5ETUA 2QVIA 1HL5A 5ECJE 3WTXA 1J12A 4OM0L 2ITFA 1GSMA 1U8JA 3QNXB 1Z0MA 1BQHA 1RAMA 3REVA 3CFJA 2CIIA 3ZTEA 4XNYH 1D6VL 3QG7H 1X4XA 1RI8A 1EHAA 3ZO0A 1Y0LA 2CO2A 3WXVH 4H0LC 4AEIH 4DK6A 5KSVA 1KIRB 1XL4A 2GJZA 2UX7A 2H26A 4MJHA 1NPNA 4P48A 5LXGH 5HGGS 5BQDA 1UUNA 1U8IB 4AMXA 2R4SH 4WWID 1KLUA 4YFLI 1MVYA 3TOPA 1TQBB 4GT0A 3IDNA 2A77H 4XPFL 3Q8CA 5SX4H 3OAUH 1WC7B 2WO3B 2H6PA 1NWPA 4JHBA 4BE5A 1TYEB 3M1OA 4DP4X 1KV3A 4Q8BA 1RK1B 3H3KA 3UG4A 4BSWA 3P3SA 3QZOA 1CL7L 3F7YA 2KPWA 3IS1X 4JAMB 3CZJA 3O6ML 5F7DB 3K6SB 3VG9C 4ALAH 4P3CH 3PL6C 2OMNA 5I6OA 2C7UA 1UENA 1P7QA 3VXTB 4PJBE 1Q9WA 4UU9A 4KBPA 1H6TA 2NY0C 4QY8B 2YRZA 4ZXBA 2O93L 4Y9EA 2FEDC 5FUCE 3D7PA 3FO0H 4K8RC 4FYTA 2JKNA 2OYPA 2YN5A 4AVIA 2VSCA 3ARDA 1S7RA 2ZSVA 1EUTA 2JB5H 4AKOA 2UYLA 3LEYH 4LOEA 1E2WA 1OLZA 4R2GC 4CGUB 5F0MB 5FK9A 4XMZA 3ZMRA 4JFHD 1ZHLA 1JZEA 2NR6D 2Q8BL 4QTFA 1A6ZA 5T3ZD 4IGBC 1XSKA 3MV8B 4FXGC 5ANHA 2WLZA 4YBHA 4G8GD 3WY1A 5DS2A 3AG3B 4M00A 1IAIM 5IB4A 3SE3C 3SO3B 3H4FA 4B9CA 3ROOA 4IBQA 4P2RD 2V9UA 3II3A 4XN4A 3GZQA 5GSVA 5ISZA 3LRHA 3HB3D 1X9QA 4OLVH 4RMRA 2APXA 2QJDA 1J87A 2WXRA 4NCC2 2P8PB 1KCKA 1K6QH 3LPWA 1ZV9A 3LB6C 4C54A 2X4NA 3WEAA 4EIBA 4JFEA 5DJAA 1CE6A 1NIEA 1HN1A 4HCFA 1SYVA 2DQUH 3CFBB 5DURD 3RU8H 2FX9L 3GUTA 4W9JC 1ASPA 3HHMA 3MOAL 2P8MB 1F4AA 4JB9H 5LBSL 1QLEL 5GRYA 5E5UB 1HINH 3AU1A 4ZW7A 4K94L 1JOIA 5KW9L 2YGPA 1EWHA 1TOXA 3LN5A 4OH2A 5JMRA 1MELA 4N20A 7CGTA 3S8FB 1CMOA 4TVPE 1J9RA 2WO2B 1HL4A 3OGCB 4Y2OB 1E5BA 3F12B 5FKAB 2YUVA 1U6AH 1HOEA 2E4FA 1NC2B 2XTJE 4DT2A 1YZZA 4ICWA 4OCLC 3QPXH 4PJXB 2NY7H 2WXPA 4M7KH 5ICXB 4IOFC 5K59F 3RVTC 4I18C 4OI9A 4Q6KA 3QNZB 2M26A 2CKBA 3GIVA 3VACA 4DP5X 3UTZB 4YBQD 3TVMC 1RUAH 3FZUD 1L7IL 3H8NA 3VWJA 3K4AA 2YN3A 3HG0A 3OB0H 4PVMA 2B14A 5I9QC 3NBNA 3SQBB 4G6AD 1QACA 4W6YB 4JG0L 1I8UA 1MW1A 4RH4A 4WTZG 3SE6A 2QADB 1LWRA 1X5IA 3BKCL 4PW4A 4F9PC 1FH2A 1ILUA 5L2KA 1P1ZB 4XPGL 4YDKL 4OFYA 3OXRA 3R18A 1KLFB 1A3LH 4IYKA 4YPGB 3KPPB 3UGUA 1D7FA 1F4WL 2ZJSH 1CIDA 1E67A 3LXAA 3QAQA 4KO9A 1BQSA 2JK5B 5C97A 3KJ6L 2MNUA 3S4SB 1NPUA 3FMGL 3G5ZB 4BM7A 4Z7VF 4J3TA 1EGJH 3K71A 2HFGH 4PJFF 3G6DL 4P2OB 1QWUA 2PN5A 5ESQB 2WBJB 1YN7A 1C5CH 2CE6A 5AVTB 5HI5C 2EH7H 2AEQH 2BIIA 4QRFA 3ARGC 1Q90A 2E9BA 4OI7A 5F3FA 3HBGA 1I53A 1L6ZA 4KHXH 3ARUA 4G42A 2VAJA 3QSKB 3D18B 3CC5A 4IK6A 2J73A 2PWGA 1UT2A 2OW6A 4TNWK 4PMFA 2LTQC 5B21A 3RZCD 4FNLH 1O7VA 1OSPH 4UZGA 4ZUWA 3BD4A 1ZRUA 4ISVA 2AK4A 4QJ3B 1M71A 2H3XC 4IBUA 3LEXA 1HNFA 4HIJA 4LAQL 2ADFH 4C56E 1KDJA 1BXAA 3AS2A 1M9SA 3HG3A 4M3JA 4ZX5A 1LP9A 5DJ8B 3IDGB 3O3DA 2EYRB 1XGZA 3HS0C 4GRMA 4NUGL 4NRXA 5I73C 1HK6A 2HB0A 4YN3A 3TP4A 1SN0A 3DTDA 5IEHB 2WYHA 1JFQL 2HX8A 4WWKB 1R34A 2WQXA 3OMZA 2WZPA 3T2PA 4L1HA 4EVNB 1JD9A 4PJHF 2Q1EA 1RUQH 4O2EB 3WHXA 1XIWA 1E4WH 3I50L 2ZWSA 1GJWA 5E6IB 1PZUB 5AW8B 1CFTA 1D5ZA 1FGNL 2BNRD 1HAUA 3HNSH 3L17A 4P06A 4AXWA 5D7EA 2NY3C 2ILLA 1R3JA 2XZQH 1XXFC 2LR4A 1VENA 2EE6A 4MWFB 1DQTA 1R3LA 3QB7C 4H8WC 5EOTA 5F21B 4HSCX 2BH0A 2QSTA 3CCHB 4HYTB 4EZJA 2NX5B 1UZ8A 2AITA 3NP4A 5AD0B 3Q6FB 4W9HC 2IADB 3HZKB 3CX2A 3RHWK 4XVSH 2E7HA 2X6UA 3KDPB 1K5NA 5DEFB 1KYOK 1IB5A 5K39B 2APWA 2QPDB 2ZWZA 3JWDC 1QHQA 3V5KA 4H1LH 2APFA 1N67A 2ZWLT 1XCTA 1J10A 2BINA 3FOLA 4MQXC 4KTGA 3V6ZA 3UGEA 4LPUA 5CZXC 1DVXA 4JZNA 1HJBC 4WDIB 2KZWA 1B4LA 5B4MC 2HYMA 2XWTA 3UBXB 4YC2B 4D94A 4HF5H 4TVPH 5D7LA 5DD5H 5E23A 1HVXA 3GBNH 1CTMA 2A6KA 4KKCD 4Q6YA 2ICWJ 1FCGA 2ZD0A 2I24N 1JK9A 2A99A 1I7RB 2OXHB 4R7DA 1OOAA 3NH7L 2ZYIA 1KLGB 1YQVH 4KI5E 3ZU8A 3N04A 2B5IC 2CHXA 2RBLA 3MRDB 5C0AE 1TVHA 4LDLB 3E6HB 4ES9A 1ZHNB 1YCSA 1P7QD 4KJQC 4ZXBD 4RZCB 2CDGA 1CE1H 3V52L 4LOVA 3S6CA 3ARDD 4A7SA 1G7PB 4B53A 4H40A 4GUPA 4ECNA 1LE9B 3BKYL 4JO2L 1AGCB 1F6AB 4HPYL 1TENA 5DJ6A 1PFCA 3RAJH 4J3OD 5SWSB 4F7TB 3VTAA 1NL0H 1A1NB 2YMXL 2ZXGA 1MVFA 5CJXC 4PV9B 1PYWA 4ZTPL 3EJQA 3QPKA 4D8PB 3S97C 4OCMC 2VR4A 1N4XH 4JRYA 5HPMB 2BM3A 2JELL 3LIZL 3OPUA 1CD1B 4H8VA 2Y36H 2DQFB 2DM3A 3OZLA 4P2AA 1ZLDA 4AJYV 2UXGA 3MV8E 3VGAB 5CJQL 2P5EB 3CNKA 2PW1A 1VFUA 3PP4H 4G70B 4QHUB 5DRNB 4F7KA 3Q1SL 1QTPA 2NSMA 4JFED 3E80A 4XVJL 3UC0H 2ZOWA 1GZHC 5E0QA 2J20A 2P4AB 4KPHH 2XPGA 4Z7VB 1RZ7H 4PW3A 3NCJL 4PJFB 1QYGL 2H2SD 3WN5B 1Q72L 4TSAH 5BO1H 1CQKA 2GIMA 4KXZH 1E9OA 3L3OA 4DVRL 3G04B 1ED3B 3GS0A 3E9UA 3FQ2A 1FL5A 1ROWA 1L9MA 2K70A 2OL3B 2VH5L 3JTTA 3LNGA 4GSQA 5BRZA 2MPAL 1INDL 4F24A 4KI1A 3VQ1C 3BWAA 3GMNA 2BJML 2BVPA 2R29L 1WCBA 1YEIH 3UCQA 4ZMNA 2O4EA 3MX0A 5MENA 1Q94B 2GBAA 4PIBA 4AL8C 1F1GA 1JGEB 1CBVL 1YPZA 2ZG3A 1JZ7A 3MLVH 3HMXL 4HWBH 3VB9A 2I9LB 3NGBC 3RTQB 1K4DA 2KYIA 3QZWG 2Q6WB 3KEDA 3ECBB 1NJ9A 4KC3B 3QO1A 2EILB 5F7NC 3VWJD 3GS4A 4PJXE 4UT6H 1LWHA 5C6TH 5C9JB 1ZIAA 3ESVF 3LZOA 1RV6X 1BZ9A 2MTAA 3P2TA 3HHSB 3HN3A 5L2KD 1F3JB 1QQDA 4YGVB 4OFYD 1PLCA 3F7KA 1UKQA 4TQ8A 1EERB 1L5GA 5DO2D 2ZXEB 4G1EB 3QUMA 2V2TA 4GP4B 4PJHB 2PKDA 1WWBX 3RVXC 5C2BL 3A4EA 3HS9A 2X70B 5LWYH 1P0SE 2I9TB 1KIQA 1BMGA 1UA6H 2VITB 1CFQB 1GKEA 1A4BA 2UZIH 2P80A 3BW9A 4GUQA 1C1EL 1DFBH 1DJSA 1Q0XH 3GRWA 3QS2A 3GZKA 4RMSA 1N5AB 5JHDA 2XVBA 2ZTBA 2CJUH 2C7FA 1OAUH 3CZEA 4NQDA 1EH9A 4HBCH 4O02L 3WEMA 1I9JL 3WEOA 4L3EB 1E9PB 2FCBA 4JMXA 2EE2A 1A14H 1KENL 2V5YA 3EW3B 3DROB 1KGJA 4HFUL 5EU5B 1EEYA 2BS8A 2XWZA 4GRWF 4MAUH 4UILH 4HK0B 4X6BB 3ILQD 2WANA 5C71A 2PCFB 1NM4A 4YHML 4OZGA 4XCFH 1MQ8A 1JYWA 2V7NA 1EXGA 4NN7C 4N6QA 1QWNA 3TH4T 3FQWA 2DMGA 3WNJA 3KWUA 1I4FB 1YSOA 2H8PB 5J8OA 1BX2B 3M07A 4PD4K 4ZYKB 3BZFA 1J8HE 4RGMB 3M17B 3RE0A 1J0YA 4EF3A 4NO0B 1V3LA 4LL9A 3CE1A 3GEWB 1JTTA 5F9WB 3QNYA 1PCSA 4K0OA 3KLQA 4MA7H 1YYML 4F33A 3PUCA 5JO5A 3DTUB 4HD9A 2WZPD 5F89B 3QJQB 5KJ7E 3KDMA 1BYOA 1UM6L 1XIWD 1CR9H 4ZO6A 2QR0B 1BAFL 4IMKC 2CCVA 4J8RB 4L8CB 4D9QD 1RIHL 1A7OH 3CK0L 3MSPA 4RA3A 3TNNA 1AR1D 1BEYL 1H6UA 3GXUB 1DE4A 4F58H 2VDNL 1LEIA 4NFCA 4ENEC 3N1GC 1NC4B 2KZ1B 1NMCC 2WK2A 5HD8D 5K93A 1ZGLB 4L1LA 4I77L 3NFSH 5I74B 1A9BB 3N50A 1BQUA 1OCWH 1QNIA 3IXAB 5D2NC 4TXVB 1NLBL 4M48H 1OGAA 3IBEA 1EHXA 2YD3A 4YHNB 3VFUB 4ACTA 3JZ7A 1RZIA 1RIVH 1LDPH 2NX5E 3A22A 2XOTA 4LNRA 5H4ZA 3IE4A 5DEJA 2IOOA 3F5WB 3COOA 2ADGA 3KPRA 4PRHB 3CPUA 5D7LD 4KFMA 4O2CB 5T1MB 3GM8A 1JFHA 2J4WL 2HKFL 2IBGA 1SOKA 1A47A 2D8KA 4L4JA 3OX8A 3QEUA 3FW6A 2NTFB 4LCYA 4FZ8H 2JI2A 2OSXA 1RJCA 1Y6MR 1C12A 3LPFA 1WEJL 4XWOD 3TTYA 1FFOB 1IGYB 2Y69B 1NAKH 2VLRA 1KIUA 3E1ZA 3OKDB 3HLAB 3ZQWA 4JKMA 5IMKA 2CK0L 1NCDL 1NGWB 1RUML 3HKFA 1QRNE 1RZJC 4LIQE 4YHOH 1FG2B 3MV7B 4OLXH 5IJBC 5FLVA 4G5ZH 3SE4A 5BQ7A 2FHFA 3P77A 1UZ6E 1OCZB 3ABZA 2CDEA 1LYQA 1U8NB 2IGFL 4NZRL 3W3BA 4OSUH 2AXGA 3GGWB 1W8OA 2EXWD 5EZLA 1E4HA 2NNCA 3D09A 5I16B 1M42A 3FT2B 4I8DA 2WXIA 1N2RA 4JFDA 3FQRB 4KZEH 1HC1A 4LGRB 4JRYD 5KEZA 1IBFA 3DO4A 4LVOC 1B90A 1EHNA 2AZUA 4UQDA 1JNLH 1PKQE 1TZGL 4FQQB 4JR9L 3PU7A 1B4JH 5CBEA 1SMAA 4LSRH 1IQDA 4NM8H 4A63A 3ATBA 1DUYB 2XN2A 3ARSA 4JFQA 3JTBA 1NEZB 2VDLL 3ZTJG 2AJYH 4LHJB 4AIZB 3DGCR 3MBWA 5FDWA 5J11B 1XSIA 1R0AH 4A66A 5TQ2H 1H3GA 3O3UN 4KO5A 4JZJB 3CLFH 4NHCL 2BSTA 4NQEA 1MHEA 3RVWD 3VI4E 2B39A 3OMAB 1EAPB 1DVFC 1F0LA 3N9GH 2AZAA 5D70H 2ORBH 2F53E 1BLIA 3HR5A 1YEJL 2CK2A 5HVGB 1T2XA 1YMMB 1F4XL 4TUJB 3SDDC 1H15B 3BIAX 4HUMB 4RESB 4RRPA 4JFSA 4Y9BA 5BRZD 4YO0A 5AG9A 4FQHB 5I8CA 1N6QH 4H8UA 5E8OA 2C9AA 4GRWB 5DDHB 1AHKA 5MEND 4PGCA 4CJ0A 1X5JA 2NY2C 1MCDA 2D9QB 2XWBB 4WI2A 3P4NA 2OZNA 3BVVA 1LQSR 3BXNB 3ISWA 4N2OA 2IDUA 4HUWA 1IUZA 2R0WH 3L7FB 4HS8L 4M7ZB 1T7ZA 4L29A 3NRQA 4YLCA 1UJ3C 2IV9A 2ZKHH 4QTIH 2PWFA 3EO9H 1X7SA 2Z93B 1B2WL 3G9AB 5IY5B 1MH5B 4DQOL 5JR1H 2HKAA 3V8CA 3R4RA 5BV7H 3F04A 4OKVB 1EO8L 4EQ2A 5T3ZL 2I07A 1T6WA 3D4YA 1UT1A 4JKLA 5L88L 3ENEA 3BSZA 2M8XA 3ASOB 1V7NL 3QULA 5A43C 4KZCA 2XYCA 3GNMH 3D0LB 2A0LD 2FK9A 3EH3B 3MLUH 1L9QA 2AQTA 2JLLA 2P80D 1JD7A 3OLDA 3NIGE 4KK9D 3VGGA 1OD9A 3A47A 2YGVA 4MKTA 2YR3A 2DWDB 1HXMA 4HEPA 3AXLA 4A6YH 3KYMB 2OMVB 5JHDD 1HT6A 1JXJA 2GITA 5L9DH 3KXFB 1EGJA 1DQIA 3EHBD 5D1ZI 4NQDD 3UIYA 2GJPA 3VCLB 2CO6B 4WFGE 2QGCA 4IBTA 2R0KL 2GI0A 2ICWB 3PWVA 5EO0A 1NLDH 1JZ8A 3EBAA 1DTUA 4R7LA 4CDGC 3CX5K 4WFHE 1DLFL 1M6OA 1T66D 1VDGA 3VSUA 4RNRA 1S5HA 3AAZA 4NAJA 3TCXA 4F7PA 5LG6A 1NCAH 3AREB 3QHZL 5A2LH 5DJYB 3VFNB 1CFBA 3B4NA 3SJVD 1K8DA 4G6FD 4GH7B 2KZKA 3CFUA 1FAIL 1K4CA 1NCBL 5CN1A 4NO3B 3ISYA 4X4ME 4F7MA 2XWJB 2GUOA 1OAQH 5BXFB 5IMOA 4JCWA 1ZT7A 3D3VB 1NCWH 2HRPL 1CDCA 5BZWA 2B3RA 4LIQH 1WP6A 5I8OH 2EIDA 3NK3A 5F3BA 1CURA 1BZ8A 1VFBB 4MD5A 2X09A 2HTLD 4Q9CA 2ICWI 3PWNA 3IEAA 1X5FA 1I75A 3GKWH 4ZX6A 1D5IH 1HI6A 3K1DA 2ALWA 4IBLT 4PUBH 2DJMA 1J88A 1LEGA 1RK7A 1YYLL 3BLBA 4LO9A 3PGDB 4LLMA 3ESMA 1JUFB 4AJWA 2VDRL 2DQCH 4E36A 1ORQA 3POHA 1VADB 3L6FA 3RPIB 4Q6IA 3KLHD 2B1HL 4Y2DA 1RVFL 4LARL 4C8XA 4QRQA 2Z8VC 3IFLH 1UQSB 5L7XH 3IJEB 5I19L 5EIIA 3AG2B 3BEWB 3N40F 2Z35B 2YMOA 3O6FA 3QXDB 3QH3B 4OB5L 3NCYS 3DX3A 4J4PC 5DJXA 4KY1H 4JY6A 3KS0J 3LD8C 1DO6A 1T5XB 3LAFA 1OPGL 3FQ1A 4HJTA 4X4KA 3CXFA 4ZS7H 4K8RH 3SE8L 2NNFA 4ZFOB 5I1HH 4NS0A 4PCYA 3BRFA 2VJ8A 4MMZA 4FNPA 5GS2H 3K2IA 4HP5A 4NLHA 4AOFA 2HSIA 4LLVA 4WUUE 3QRLA 1X7QB 2JJTC 4H1LA 3CBKB 3OM3B 3A6BL 3EFOB 3W39B 5JXAL 2XFXB 3QJFB 4MVBD 4ANUA 4B0MB 3QCVL 4RBPK 3ARFC 1SDDB 3AMKA 5FR3A 2OL3H 4N0RA 2NXZC 1IM9A 1MJ7L 2C9PA 4NRZB 4XVUD 1Q0YL 4MJIE 4ODSH 5F6IC 3DVGB 4DP8X 1NBQA 3O45A 3LZFH 4LEOA 4OGYH 5DS8A 2X6AA 3MRQA 4N0FB 3TA3C 3T09A 4YVUA 2VLRD 3P9WB 5IJVB 1NGYA 2R9HD 3SGKC 5C0IA 5IMMA 5HHOA 2RFXA 3U9WA 1Z1WA 5ICYB 2FE0A 5BW7A 2GI7A 4P4KB 3MRGB 1TZHB 3TEZA 3STZB 4B3EA 4M4PA 1MNUH 3P3YA 2OQJA 1WFNA 4E5XG 1UM5L 4HIEA 5GGUB 4UT9H 4ORZC 3AWFA 4BQBA 1EHLL 3HMWH 5D5ME 5LQBH 5JDJA 3MV7E 4JFDD 3RWCA 4AH2A 4PY7A 2AQQA 2F74A 2V7HA 1JE6A 3IB4A 3DHUA 2CO1A 5DR5L 1DBJH 3DX6A 5F7KC 2X1XR 3U4EA 1H3XA 2A74B 3JYBA 3MJ9H 2OMWB 4TLKA 1LMKA 3RUGE 1B0GA 1I8IB 2HT2C 4E0RA 4DEPB 4M93C 3D8MA 1WT5A 4JPWH 2FJFA 2JLPA 2CMRH 3F58L 3JUYA 3JYCA 3H9SE 2MTPA 4Q89A 4M5ZH 4JREC 4JUSA 2DKUA 3OJMB 5AALA 2VKXA 2WJ7A 1E6JH 2OCCB 1NANH 1OE1A 2VR3A 4UOZA 2CBMA 2IALA 4XC1H 4I2XA 5ERWB 3IFPA 4YDMA 2FTAA 3D69B 1T1XA 5AW9B 3S34L 3VFPA 4NKOB 4IKIA 1XCXA 2G2NA 2WWKO 4NQED 1EDHA 4AT6B 1CDHA 1JPSL 3D2UB 5AAWA 1DSWA 3RKDC 5ID1A 3ZE2F 1J1OH 4FQJL 3PGCB 5FM5O 3LKPB 5AYUH 3G5YB 2NYYD 1ONQA 2VDMB 1GZQB 1ZLSL 2FD6H 4JKPH 5EZIL 1Q9OA 1J18A 3A6CL 3QUKA 5C0EA 4D2NA 4PJ5B 1YMME 4OW6A 4PJGF 3DK0A 2NY6B 1ZVSB 5A3IC 5ADOL 1PL3A 4M8QB 4C56A 3VD4A 2KC0A 5AW7B 1SUJA 1H6FA 1ZIBA 4ZS6D 3ZYJA 3ES6B 4KRPC 3FSZA 4HWBA 4R97B 2AABH 3FU7B 2B1AH 2JE8A 4ZTEA 3L4XA 2RB8A 4E9XA 5JLZA 3RGBA 4XPHH 2E74C 1RZPA 1MFCL 2ARJQ 2X4OB 1NCGA 2J8OA 3X1FA 4IMLB 3LOWA 1LXMA 3TWYA 1A0QH 2ICES 5DUPH 1FNGB 2DEWX 2NZ1A 3QDGE 1DQLL 1OW0A 3L1OH 1A4JA 4XXWC 4HAFA 3GLZA 3RDTD 1F86A 1XB3A 2GJ6B 2WINB 4G72B 4NENA 4AC2A 1JHKH 1KB5H 3EADA 5C3TA 3MLPA 2V5MA 25C8H 3I9GH 5IVZB 3QFDA 1A8JH 5DCCA 1ECZA 5I1DA 4YHZH 1PZ5B 1ZS2A 3WCYA 4NP4L 3UO1L 3QCUL 5DVOA 3ZVVA 3S36L 5L6YH 2FJUB 3PDGA 4BIKA 1MF2L 4TUOB 1HHHB 4G83A 1ZS8A 2IQ9L 1G9EA 4R4BB 4J5VA 2EYTA 3GHEL 4U3CA 3ULVF 4U4BA 1KTJA 1TTGA 1CFNB 3ECWA 4EDXA 3PHAA 5DRWA 3IU3A 1A7QH 2YD7A 3AG1B 1Q38A 2AAVA 2QQKH 4OJCA 3H53A 4NRYB 3GLAA 1FNSH 4H4NA 1I7UB 4I0PC 1G7IB 1MHHA 2DWEA 1N5YL 3PJSA 3TBVB 2ZPKH 4G2AA 1OCCB 3OKMA 2FNBA 4ODWA 4CU8A 3O3BA 5AW2B 2QDWA 5J1AA 5DXWA 3NSFA 3EYVB 3SKOB 1ACZA 3RX7A 5LNDA 3CHXA 2EIBA 4OKDA 2I5YL 1AXSA 2O5XL 5DMKB 5C0AA 5IWLC 4E9LA 4PM1A 4ZPTB 3E6FA 4NGHL 1CDIA 1SN5A 2JF1A 4XNXL 4X5LA 5C0JB 2J8HA 3RBSA 3L9EA 5E2WH 3CDZA 4E41A 5HHQB 4XNBA 1JRHL 1Z2KA 3GRBA 3QORA 1GL4B 5ENWA 2FZ3A 5E8EA 5KTEL 3EH4B 2DMHA 3D3VE 3RFZB 2VR7A 3V6OC 1TU2A 4JKNA 4D0CA 3JWDH 4P9MH 5DTFA 2F5BL 1FZOB 1U3HC 1MCHA 1MLCA 5TE6L 2ZUWA 3PCYA 2P47B 3L4VA 1LO4L 3J8F7 4XP1L 5E4EB 3U2SA 2EEFA 3K6DA 1XBRA 1ZGLP 4OLYL 4JM2A 2WOBA 1XX9C 1XGYH 5J3HC 1BJ1H 3QI9A 1ZANL 2X38A 4J27A 4TNVF 4Y2DD 3W2DH 4IOSA 5J9PB 4CC4C 3BVWA 5EIVA 2E9JA 4MS6A 3FUIA 3VXRB 4LGPB 2JCCF 4UIMA 1F11B 3O6FD 4ONGH 5D7JA 1G84A 3HE6C 2DPKA 2R7EB 1ZTMA 4K2UH 1REIA 1V7MH 4K23H 5H37H 4RAHA 3HC4L 2HKHH 3MRNA 4QHLB 4N0YH 1YY8B 4FN0A 3HVNA 3D87B 4QTHB 2DB8A 1JZ3A 3UTPE 1S9WA 2PXYB 3MRPA 1EJ8A 1MHPL 3I02A 2Q7NA 2OI9C 4Y4KB 1AC6A 4LK4A 4PJDF 3F64A 3OGOE 4JGNA 1D7DA 1ORSA 4QRUB 1F13A 4NWTH 1H5BC 2YC1B 5ITFB 3PXHA 2VO8A 3WLWD 3FB7B 1XF5B 4XCCH 4XH2B 5FO7A 5LAXB 4NQVA 4XC3H 2IDSA 3QWOA 4MJ4A 1T03H 1XMEB 1I3VA 3N0PB 1IM9D 3TF4A 2CG9X 2ZXWB 2WXLA 3GBEA 1EXUA 4WUKH 3JWOH 3ZE2B 4AEEA 2XTJD 5E7BA 1R5WA 2B4CL 3B5GA 5FW8A 2V17L 3WMQA 1JNJA 4GQQA 4FMFA 4PN6A 3WTTA 2D9CA 4WNQB 4DETA 4NUPA 2BCKA 4TOYH 2Q2EB 4F8PA 4Q9QH 1BFTA 5HHOD 3MLWL 3FONB 4G7VH 3BCDA 3IMWA 4PJGB 3AW5A 1OM3L 4L8BA 2BZCA 2EDJA 2BRRL 2VO5A 4KROD 4CU7A 5E6ZA 5D2NE 1Z9NA 3QQ9D 1YMHA 5I30L 3VXMB 2ENSA 2RD0A 2OKMA 4F93B 2P49B 4A68A 2EEXA 3ECVA 3JZYA 1XEUA 3ARTA 3WL9B 4NHUB 1AANA 3FCSA 1ZPUA 1JWMA 1ZWIA 4UI2A 1EAJA 5F7EH 2WLYA 4AMKL 1CLYL 5EO9B 1DUZA 3I84A 4WY7L 4XVTH 1RD6A 1E40A 1BFOB 1V10A 4ORGB 3OC5A 4FYQA 2P46B 3V55A 1EEUA 2MHAB 4GBXC 4TQHA 5I5JA 5KSAB 2EZ0D 3OKEA 5IGXH 1NGQH 3ZMEA 3WDJA 4EZKA 2CBQA 1NGPH 4PGBB 4UAOB 1NKOA 4WK4B 3C75A 4BFEA 3NFPA 2EE0A 1JPTH 3RJDA 4WW1B 4X9YA 2E8YA 3LVEA 4HMEA 4YBLB 3BD5A 4OZIE 2ZE0A 4MNGE 3L08A 3DVNA 3FB8A 4QXTB 4F91B 4AJ0A 5GS1A 3V0GA 1BGXL 4QHMB 4AG4H 5EDXA 4XP5H 3TJHC 4M4RA 2J2ZA 1BVLA 4C56D 2AV1A 2GVYA 4DGIH 4H0GA 4QRSB 5SWZB 1L9OA 1J8HA 1Y1DA 3AU0A 5TF1L 3VD1A 4FL4B 4WHTB 2DL9A 3TN0A 1KXQA 2VQTA 1BZOA 4N8CL 1KEGL 1URIA 4KDTC 1CTOA 4NZUL 3SGEI 4RRPG 4KKNA 1WVZA 3MFGB 3NIFF 1DBKL 4N8VB 4GINA 5E9NA 3EG9B 4LDEB 1KJMA 3W57A 3LKQB 1AP2B 2BSSA 5LKNA 1WICA 1RP8A 1OAZL 1RLWA 3PGFH 4Y2NA 3WXWH 3TURA 4P3WA 4A7GA 2QZQA 3BWUC 4PJIF 2FWUA 1GYUA 4Z3EA 2WBKA 4F8LA 1HCYA 3D0VA 4CADB 4MA3B 3DOHA 1QLFB 4PR5A 4XX1E 3V2AR 4AIEA 4F15B 1QZ1A 3MJ7A 5LGHL 1GCFA 3VFMB 1RIUH 1V05A 2X2YA 2N01B 1P4BL 2PP9A 2JCCB 5IVOA 2BP8A 2W60B 5DD0L 1OK8A 1NICA 3CU1A 5GJSH 1FN4A 3NEOA 5FLUA 4A6YA 3DUHA 3MCKA 3EJYD 2X9ZA 5KYUB 4PMEA 3HBPA 5AVVB 4PI2A 3RWJA 3WS3A 3QR0A 4AI7A 1LE5A 4GG6A 1FNFA 4HQQL 4OLWL 4R5TA 3WSQL 5K9OB 5EF0A 5KSBF 5J1SC 1N7ML 3VJ6B 3HUJA 4HPHA 1A6WH 4GRLB 1XGTB 3TFBA 1OHQA 3QEQB 5L4MA 4ZUVB 4HOZA 4PJDB 4NKIL 1BVZA 4PI0A 1W0VB 3JV0A 4PJEA 4BFIA 1UUSA 5C0AD 4BFBD 5IR1A 4MD0A 4MZRA 3TV8A 1NCCH 3MJGX 3RWHB 4B9IA 1PLGH 4H88H 4P05A 3BC9A 1QD0A 3AABA 1GTNA 4E41D 1Q4NX 4XCNA 4LEXH 3WUWA 4CSZA 5AL0A 3QORD 2E6PA 1QRNA 2GFBA 3P0VH 4PLJC 4TRPL 3TYGH 5IHUL 3WIIH 2D03L 4A2DA 2ED7A 4WJ5A 5F70A 5JPMC 2O6DA 2WC7A 1A4KB 3SDCB 1O6TA 1F8TL 3KGTA 1IGIH 2D7PA 4XAWL 1HYSD 4POYA 1AZZC 1RP9A 4OF8A 3EYSH 5EF3A 4B5ZA 2BIPA 4N6RA 2FJHB 5FECB 5I8EB 1KTLB 4JM2D 2AQ2A 2FX8H 3K2UH 5D55A 4JJ5A 1PG7W 4EDWL 1CB4A 3QI9D 4MMXB 1J1PL 4PJ8A 2J21A 2XN1A 4UAHA 1FA4A 4IOSD 4UQ3A 4X6EA 5I18H 4OJFH 3BPOB 4FJYA 4OTXH 5AKVA 2CPCA 1PKQA 1U4FA 1XTLA 3W0WB 1H3VA 4GKZA 5AZ2H 1S7SB 3JT2A 2XY2A 1CXFA 1XCWA 4G80B 2VDKB 5D7JD 4ABWA 1SXSA 3ULUF 3WY2A 1AG6A 4TS6A 1BYNA 3P3RA 3MLYL 3CFMA 1FVCA 4KUZH 4PWEA 3PL6A 2YGNA 1UT9A 3EYOB 3UYOD 1RZJH 3VI4A 4V2BA 4ENZA 2F53A 3HZVA 3X12A 4FCHA 4Q56A 1O6SB 3T6XA 2MNJB 3ATAA 1A6TB 5AW6B 3GDBA 2J8UA 3L3KA 1PTZA 2IDQA 4MQTB 4LCIL 3TA4D 4ZBJA 2HN7B 1A6VH 3MO1B 4Z77B 5ALBH 1A5FL 2GKIA 3ABGA 2R1XB 3PFQA 1YUHA 4IGBA 3WELA 1MEXH 3NJXA 3LYRA 1SOXA 2BFVH 3T04D 2W8CA 4W9KC 2ATPA 2PYEE 4FEMA 3SE3A 1N0LB 2DDQH 1WZKA 2ZOLB 3ZE2E 2CJ3A 2TAAA 4HXAL 4P23B 4ADJA 1OSEA 1Q9LA 5HYIA 2QMJA 1MCCA 1YUKB 3LZPA 4YSSA 3PWJA 4NI3A 1NUFA 1CLZH 2UWEE 4GI8A 1P4LA 1MRDL 4PJGE 2ZOKA 5CEYA 2K45A 1BOGB 1U92A 2FQFA 2F1AA 2OMTB 4UT9A 4LQFH 1HSBA 3L9RA 3NIFB 1IAKB 2WXHA 3LVTA 1UXSA 4P5KA 1UXWA 1KYDA 3EBGA 2HVJB 3BCFA 1FRGL 4Y8DC 1XGUA 3S2CA 1E27A 1FNHA 4U33A 1E5UI 4KK8C 5CMAA 3MJ9A 5EHFA 4OD2A 3LQAC 2MWCA 4PJIB 2AJUH 2HJKA 4R96A 1KNOA 2WXQA 2B7DT 1RH8A 4LLYB 2JKXA 4POZC 2IIJA 3SCMC 3UACA 4FQLH 4AVJA 4I18A 2MOVA 1AGDA 1HCZA 4Z0XA 5C70A 2Z4QB 4AEIL 2FO1A 1TO4A 4ODXB 3TVMA 3LH2H 2CIKA 4RETB 1S7TB 1KG0B 3GHBH 5E94A 3Q5TA 3SDXF 4JPSA 4PP2B 4L4VE 7PCYA 4F37K 3AQYA 2WAHA 2KQMA 2YEZA 3FK3A 5DQDH 4F9PA 4MYWB 1OTUC 2XXGA 5J4MA 3FBKA 5KSBB 3OAUL 1HXYA 3MJWA 4Y5YB 2CGRL 1I9RH 1AHWB 4I1RA 3S8GB 4OF7A 4RGNC 2IFGA 5DUJA 5C09B 3QUXB 1A2YB 1J8HD 1NFAA 3UZQA 3P02A 2KL6A 4ALAL 3FFDB 4N2DA 3TBBA 1UWEL 1I9EA 5EZOL 3TN0D 4HULB 2BC4B 1M53A 1Z7JA 4XVOA 3EO1B 5TPWH 4RMQA 4E9VA 1LM8V 1CVSC 5C92A 1GR7A 4ETYA 5AWNL 3BJLA 4MLIA 4Q14A 3X11B 2PF6A 3GMLA 5FOJA 5JOEA 1YEKH 2I60H 4GQ9H 1JGUH 2ED9A 2M2DA 2N56A 2R2EA 3F00A 1SN2A 4WWKD 3K74B 2QTEA 1U30A 1FGVL 3C5SB 5C0NC 1IBGH 4FNQA 4PLKD 3D25A 1OB1A 3B9KB 5DHXB 3ZL4H 1BM7A 2WNWA 3GYRA 1E4KA 4X9GA 1SQ2N 1KB5A 3P0YH 3U7WH 4IRZL 1I85C 3AWEA 4IS6A 3QXWA 5B7MA 1YAIA 15C8L 3N40P 4WI0B 3L7EA 2YJLA 4DP1X 4N0CC 2E7DA 4Y1AA 3O8XA 4PB9H 3R4DA 3MRJB 3BP7B 4IW4C 2FX7H 5CBAA 4URKA 2R83A 1S9XB 2PPDA 1OT1A 1T6BX 3LQZB 5EBMA 4D3CH 3II2A 1I9IH 2DIEA 4UOW1 5DUML 1ZLWH 1WBXB 1IBZA 4WUUA 4ESKA 3LQMA 4R4NC 3FHAA 1AGBA 1ZSDA 3DX1A 3HS0A 4HEMA 3TT1H 3L4CA 2FGWL 3RU8L 3GBDA 3ZBMA 2YOCA 4GXFA 3KPQA 2DF3A 3BRGC 2XRAL 2DMKA 3NCBB 5ALCL 5F9JA 5FB8B 3DHPA 3FAWA 3HI6L 4FX5A 4ZW3A 3LHAA 4U1NB 1GRWA 4ATTA 4RQQB 1DP0A 2F0CA 1JHLH 4MJIA 4GAJH 3K80A 4UDTB 3GMPA 3OAYH 4V1DB 3JV6A 4QWWC 2DQHH 3QDMB 5DJDB 3QEQE 5EBWB 3X14A 1F2QA 5I15L 4HLJA 4QHPA 4XODA 3FUEA 1OVZA 1HDMA 1U3YA 4R0LB 3UABA 1G9HA 1HCVA 1NGXA 2NXYD 1N8ZB 4HWEL 4HJ1A 5E8NB 1AS6A 2O5ZH 3O2DH 4UINH 4V2CB 1F4YL 4PTTA 5HI3D 3BZEA 1QRND 3DDGA 3F6JA 3GJFB 5DYFA 5C07B 3VH8A 3QDJB 4QXWA 3V9FA 1VFOA 5AOLA 5IEKB 5E4IA 4LXFA 2VMJA 4QPEA 3QXAB 2EC8A 4MFHA 2J88H 5D5MA 1QBMH 2AJ3B 4W6XB 4Z3JA 1S7UB 3DKHA 1KYOJ 4U1SA 5IW6B 5B3JF 1E6OH 3CZFA 4GKSA 1UB6B 1MN4A 1GH7A 2XKUA 2C9XA 4PJ8D 4JPVL 2FUTA 3QGVA 4ES8A 4A1RA 3RUGA 1EEZA 3BSZL 4ONFL 3VXPA 3ZDZF 43CAA 5F72S 2BNQB 3ZTCC 3H9SA 2PW2A 4P49A 4JQIH 2P48B 1YDPA 2QFRA 2X9XA 5EA0L 1HHIA 2AJVH 3HG1B 5JHLH 2WXFA 1EGJL 5HYQB 4OIIH 4DN4H 4TNEA 5I24A 1RKRA 5LUMA 2NY0D 3VFSB 5JPNA 1O0VA 2GTWB 4IDJH 4XMPH 5DUBA 4K8RD 4NQCA 2DM2A 5H94B 1KCWA 2HH0H 4AIXA 2F53D 3GFUA 3T4AC 3OAZK 3IDIB 4HS6B 4G43A 5DFVC 3T08A 1WIPA 1A6UL 1WAAF 1HFUA 4YZWA 2EINB 4NUJA 4R2GD 1HQ4B 3B9DA 4OZFH 3T8XA 4EKXA 5J11C 3BYYA 1MZYA 2ZXAA 5DFWH 4NWUL 2B59A 1KXTA 3SDXB 5CJXA 2VXVH 4M1GH 4YNYB 3OBAA 4HFWB 5HGAB 2DQJH 2G75A 2MEJB 4IGBD 1FDLL 4L3FA 4TLSA 3V0VB 3L3GA 3NP3A 4DTGL 2VNCA 1S8DB 5I1IH 3NIDF 3ASNB 4G9DB 4F7CA 3SD2A 2PTVA 4PJ7E 1AGEA 3WTVA 4LHUA 1UM4L 1GJIA 3LB6D 1P9MA 3QDGA 1A1OA 1R33A 1INQB 1JGVL 3IPBA 2GPZA 1WFJA 6PCYA 5KVMC 3EJTA 3KLLA 4NI6A 2ZX7A 4K5PA 4JL1A 3QIUB 4ZDHA 4EI0A 4HUNB 2BMKA 1R3HA 1X5YA 3LS5H 5C0FA 1G7LA 3NDZE 4R90H 2XVGA 3RIFK 2EVGA 3TONA 4I1PA 1TXKA 3NIFE 3KWVA 2AV7B 2N7SA 3BKJH 5D1ZC 2YA0A 4PCTA 5INDB 1D5RA 3OWEA 1DQML 4LPCA 4X0KB 1HZKA 3D07A 4UIKL 4FULA 3ZSSA 1LK2A 2IVFC 2FUQA 3JXAA 2WWKT 3LTVA 6FABH 3PWPB 3QIBC 4PJIE 5EEWA 5HHNB 2YAHA 3EOTH 3RVTD 3FCTB 4Y19E 3S5LB 3PABB 4WJKB 4Z5RB 3B5HA 2OXGA 3TO4C 2EXTA 2Y7LA 3TVMD 2MSPA 4H20L 2N4IA 2F5AH 4XX5A 3L54A 2OCJA 2NNRA 2Q20A 4AGMA 4S2SA 5G5DB 4D0DA 5JQ6H 2MNWA 3MTRA 3RL2A 4EZLA 1FH5L 2YSSA 2IPUG 1YYCA 3DNKA 4XBEH 1SJMA 2CHWA 4PJAE 3SHSA 3U9UB 3BHBA 1XCQA 4I3GA 5KJ4A 4NYLA 1I1CA 5DZVA 5HJDA 5FF6B 5BS0B 2NUTB 3IJ8A 4KKPA 1MFBH 5FYKE 4FAAB 4KQ4H 2W07A 1CC3A 1ZT4A 4X6FB 3CXDL 3IJYA 4PV8B 5KSBE 3H9ZA 5B3NA 1TITA 3RGVB 3HJEA 3X3FH 2ICEC 2F54E 1AJ7H 4RIRA 4HPOH 5JOFB 1B4RA 3AREC 4FNTA 4AUYA 4U0RB 3CHOA 3RRQA 3T6QC 3HLKA 1NA8A 4Z7UE 2PMZA 1IBBA 5AVRB 2X4TB 2BVTA 1ZEAH 5B8CC 3ZYIA 4QRPB 4IU2A 2BSBA 4JO1H 4LLQB 2AP2A 3DK2A 1CICB 3O3AB 4HC1H 2O6CA 4FKHA 4BZYA 1GS7A 3PNRB 5ADPH 2YD0A 5TDNB 1YC8A 3ZQXA 1OF2A 2YD2A 4I9WE 3UJTH 4Z8FH 2HA1A 1MWOA 2G60L 2E27L 5F7YC 1I7ZB 3VXNA 4KTEL 5IESL 2V6HA 4DGYL 2QHLA 3RL1A 4AYMC 4L3CA 2J57A 3O8XD 5CZRA 4GW4B 3SGJC 4AQZA 4XN1A 43C9B 3AQZA 4MCYB 3RNQA 3L9BA 3ZDZB 3B3BA 3FT3A 5GRUH 2ED6A 3TCLB 3VE0A 2OK0H 1EJOH 4DZBB 1XO8A 3A0OA 3FUFA 3GSNL 3HC3L 3FBQA 4Z6AT 4FLQA 4YHYB 4FLHA 4WUUD 1P2CA 3ZDXF 2FR4B 3EBHA 1OALA 4KPHL 3S3CB 1VGEH 1RZ7L 2Z92B 3MRFA 4FTDA 1NMAH 4TSAL 3SKNB 1ZLUH 4AZ8B 4CAGA 5KANG 2BIMA 4NX0A 2R2BB 1A4AA 3LRSA 3QW9A 2Z91A 4LEBA 5EDSA 4BDVB 2V2XA 3HAEH 5T33H 4N3UA 1EMTL 3DV6B 4BJLA 3TH2T 4MJID 5FO8A 1KPUA 3GTVA 4BCYA 3MLZH 4EUPB 2BXZA 2GCYA 4BH7B 1F3RB 1G7HA 1SXCA 2NY3D 3K6OA 3RHWF 1I3GH 1JWSB 1OCOB 1SJEB 3TC9A 3NZUA 3P3UA 5EUKA 3WMPA 3M1BA 4G8EB 3V6FA 2IQAB 4F7EA 3QDME 3OKNB 4BFRA 4M8VA 5D2NA 2F7RA 4AJVA 4AW4A 1XGRB 2OJZH 2WWNA 4J23A 4ZQKA 4ELKA 2VMFA 4K9EL 2QPEB 4UQ2B 2ADJA 3FSOA 3OMNB 2FSDA 4OUUB 3WIAA 3RB7A 5F7HA 3NIDB 5C07E 2H3KA 1WZ1H 3NPSB 2F68X 2HJLA 2AC0A 4OCNC 3JVGC 5DI8A 3SBWC 1FNEA 5B4MD 3GIZH 4DUVA 2IPTH 5MEQA 4OZHA 3CFKA 3D85A