4J3OG

Crystal structure of the fimd usher traversed by the pilus tip complex assembly composed of fimc:fimf:fimg:fimh
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
144
Chain Sequence
b'ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimG
molecule tags Cell adhesion/chaperone/membrane protein
source organism Escherichia coli
publication title Structural and energetic basis of folded-protein transport by the FimD usher.
pubmed doi rcsb
total genus 16
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oG00
1KIUB 4XOEA 4AVHA 1QUNB 3RFZA 2VCOA 2XG5B 5IQNA 5AALA 4J3OH 4LOVA 5FLUA 4CA4A 3MCYA 4AVKA 4AV4A 4AV5A 4CSSA 4XO9A 3JWNG 4AUUA 4X5RA 5LNGA 5FWRA 2UY7B 2XG4B 4ATTA 3BFWA 4BUQA 4AV0A 3BWUF 5AAPA 1N0LB 4X50A 4XOBA 4XO8A 4XOCA 3BFQG 1UWFA 4X5QA 5IQOA 2JMRA 5CGBA 3ZL1A 4J3OG 3ME0B 2UY6B 4X5PA 2WMPB 5F2FA 5AB1A 3ZPDA 5FS5A 4AUJA 3JWNH 1N12A 4AUYA 1KLFB 4XOAA 5FX3A 4CSTA 3JWNE 5IQMA 3SQBB 4AVJA 2W07B 3ZL2A 4AVIA 1ZE3H 4J3OF 4XODA 5ABZA 5JQIB 2J2ZB 5LNEA 5F3FA 1TR7A 2JTYA 1PDKB
chains in the Genus database with same CATH superfamily
1NJ9A 2AK4D 2HSIA 3O3DB 3LN4B 4MJID 5E0FA 5K33A 4YIQA 2GSGA 1I53A 4KKNA 5EOTB 1ECZA 2XTLA 4CSSA 2ICEB 2XTJB 5GRZA 1AKJD 3NGBC 2IOOA 5DT1H 1A1OA 4L8DB 4XPTL 3VXME 4WO4D 1JG9A 3QULA 2VDKL 4ENED 1QFHA 4KQ0A 1UB5A 2GHZA 3HZKA 3NJKA 3NZHL 2VDMB 4BCZA 1IC5H 5ECJE 1YN6A 1HH6A 4DO4A 4QGYA 2V2WB 3VXMB 1K9TA 4D8PA 5FW8A 1IGJB 1X7QA 3NRFA 3MBWB 1Q9LB 3VQMA 2OCFD 4UQDA 3MC0A 2TRYA 4PP2A 2VXVH 2VL5A 3QJQB 3IMUA 2A73A 4LDOB 1LWHA 2I9TB 5IVXA 1OGAA 2BOBB 3TJEL 3GBMH 1UCBL 5E7FA 3VX1A 1NJ9B 1K2DA 2DQGL 2O6EA 2HTLD 2H7WA 2EEBA 4X7EC 2HPOA 3BKYL 4CSTA 2YXWA 4UIKL 2EP6A 3O6LH 1DJWA 1JGLH 2V2TA 1FNSH 4QXVA 4CSPA 1QSZA 1NCWH 3NIDB 3BZEA 1ULVA 3C5ZC 2KYIA 2IAMD 4UYQA 1ZLUH 2XG5B 1HHJA 5FOJA 1ZEAL 5AQ0A 3WI9A 1C9SA 5E2WH 4ANUA 2D7NA 2VL4A 3T65A 2TSAA 2FUQA 3KW8A 4H0HB 2L04A 4UIKH 1DLHB 4YHIA 4QYOA 3C9NA 1W8OA 1OARH 2EDBA 2CNZA 2WV3A 5LBGA 3NJFA 2A9BA 3KS0H 3SPGA 3I9GH 4ZTPL 1S7QA 1NAMA 1WWCA 4NJAH 5FECA 4Z7VE 2QL1A 3T2OA 1T89A 2QT6A 2CR6A 1ZHKA 3HPJB 5IMMB 4H1LB 5GGSB 5PCYA 2FT8A 3KD4A 4NUMA 5DO2C 3LSOA 5ACZA 3MV8E 4BKLA 4RZKA 4J4PA 1BXAA 2UY6A 4GG6F 4WFGD 2WYZA 4MXWL 3G5YB 1Z0MA 4O2EB 1EFXA 3LPOA 1EHKB 3RE0A 4JANB 4XMZA 3IPEA 3GXPA 4YSOA 4NKDB 2BP8B 1MW1A 4PGCB 3EDKA 4YJZL 4ZD3H 3L54A 3L6FA 1N70A 3LVTA 3GRWA 5FK9B 1R24B 1DVQA 4BRVA 2CJUL 3MV8A 1E3ZA 3NSJA 1JUFB 1W6LA 2NY5L 4LVHB 4U49A 2FHCA 2HRLA 2NR6C 4P9MH 4R7XA 4DCQA 4WO4C 2XN9B 3AB0C 3ZX1A 4WCYH 1S3RA 1AE6L 4N8CH 4AY0A 3C8KA 1ZLSH 4YXLH 1WCBB 3QEGH 4AC4A 1EO5A 4MMZC 4YPJA 2UYLA 3HLAA 2RD0A 1M9SA 5I1EH 5AW1B 4E9LA 5EPMA 5FYJD 4JM4L 3OJDA 4OLZH 3T0EA 3QQNA 1WGOA 4UF7C 1BQUA 1L9MA 4FS0A 1JOIA 4IBSA 2VE6A 3F6JA 4BSVA 1AY1H 1FL3A 1ETA1 2NNAB 3BH8B 4R4BA 2AERT 3DSNB 3DHMA 1P53A 4JRLA 3T3MF 4V1DA 5ICZA 1DFXA 2X41A 4AMXA 2OTWB 3HS0C 4OM0L 5GIRB 5ILTH 3WTWA 1CTNA 1HFUA 3MKKA 4LCUA 1V7NH 3VI3F 5C2UB 3M8OL 3O4OC 3DO3A 4M8VA 4OLEA 5KN5B 5KSUB 4ELDA 3M46A 1AH1A 1NAMH 2PXYA 2X4TA 3KXFB 4NQCB 5TH2A 3LN5A 1IC4H 1A3RH 4H5SA 1AQKL 3N85H 3MCLL 5EF2A 4KI5E 3ABLB 3VQLA 1OAJA 4A6YL 4C4UA 3UTSE 5GS0D 3KXFE 4NQCE 2R2EB 1GGBH 4NGHH 4JPWL 4Y9FA 4GSRA 5EO0A 4WWKA 1BFTA 3EJRA 2BNQD 4HULB 3QNFA 2IOIA 4M48L 3U83A 1YLBB 2R4SH 4Y4KC 3ZKNC 4I48B 4LSSH 5IROA 1OTTC 2CK2A 3TT1H 3LQAC 1B0WA 3NESA 5FS5A 5KTEL 1H3VA 3HC4L 3HCVA 5F9OH 4YGVA 1GS6X 4EZMA 1XR9B 3BRGC 1EAPB 3GMPA 3BP7A 4WUUD 4ZDHA 3TT3H 3BVWA 4C4KT 2CO3A 3LEXB 4NOFA 5BZXA 5GXBB 1SLUA 4KTGA 4CN4A 4OJDH 5HDOA 4JPIA 3APDA 1D3CA 4AW7A 3QI9D 4WI5A 1V05A 4HV8B 4AENB 1HESA 3IFOB 3RGVB 1HI6A 3O0LA 5AZ2L 4Y5VA 3ULSA 4A7UA 1AO7B 1I1FB 2PWFA 3PXHA 1JP5A 2EJ1A 1IQDA 4ZAKD 1YEWA 1KXVC 4G43A 5D1XB 3LIZL 1BGXL 3VFMA 4ODUB 1FQ9C 3S8WA 1IZKA 2Q8AL 3UPAA 1YDPB 3G6JF 1ECYA 3OSVA 3TFKC 1NUDA 2N0KA 4F7KA 2FJGA 2LQRA 3IDYC 4P5MA 4Q9CA 3JSSA 4ADGA 4IKNA 4FZEL 2ZSWB 1TJHH 2DMGA 2EDXA 5J57B 1VIWA 5AOMA 4YPGA 4LSSL 2PP8A 5I2IA 4DGYL 2FJHB 3HB3C 1B9KA 2H26B 4G8IA 5FCUL 2H2PD 3JTBA 1AFVL 5I0ZA 4P46B 4PJCE 1OAXL 5GGVL 4J27A 4NQVB 1ETZB 2PO6B 1QLEB 4JDVB 3FOLB 1F13A 1E9QB 1J8HB 1FFPA 4GRWB 2CPCA 2FYYB 1HCVA 1MWAH 1NFDF 5HDBE 3UDWC 4KAQL 4DKFH 7CGTA 3KLAA 5DRWA 4LASL 3MV9E 1PZ3A 1KPUA 2GITA 5IJDC 2UXVA 4OD2A 3A21A 5KBLA 1KTBA 3GI9H 4ZXBD 4NRYB 1BZQK 3HG0A 2OCJA 2WXJA 3NFPB 3QHFL 2WWKO 5EUKA 1PLGH 1A22B 4Y2OB 4ZFOB 5C0DB 1L7TL 1IILE 2HTKD 4BZ2H 4K5MA 4PJBE 4HXBL 1MFDH 4I5BA 5EOQH 4CMHC 4L9LC 4HYTB 1DJHA 1SMAA 3KCPB 2O6FA 2VC2H 5LGHH 1PX4A 4XMLL 4P2QD 1QKZL 3KPQB 3L5IA 3IRZA 4PUBL 4R4NC 4YHPB 3RNKA 2R2HA 5C0IB 2DQEH 3NGBB 1QPPA 1DQDH 1SEQH 1DEEA 3I02A 1IJ9A 4OQTL 2AJUH 4BZ2A 3ZDZE 2FH6A 4DUWA 4NYLA 2XPZA 3ILDA 1EA9C 1PG7X 1SLVA 2ZUQC 2BVPB 3NRQA 2AK4B 2P5PA 4AIZB 3FTGA 4YDVA 3HPJA 1IEBB 3RFZC 2OM5A 1VGEL 5E2UL 5I1KH 3B9KD 3NEOA 4XI5D 4NEHB 2AITA 4MLSA 4HIHA 5K9QG 4RETB 2GTQA 1YEDA 1G9NH 1I7ZB 2IAMA 2ROXA 4EVNB 2IALB 3UTTA 2NNXA 2X05A 3T65B 4OJYA 4ZAKC 4NO2A 4OZHB 2F53D 2R0WL 1WHOA 3F65A 5EWIL 3IDNB 1FJ1B 1F90L 1TYRA 4G8FB 3O8XA 3MRCA 4G9FD 3V4VA 1KB9K 2ODIA 4G8EB 4ZFOL 5J3HC 2Y2WA 4K94L 5AAMA 1N12A 1HL4A 5FYLE 2VZTA 3RVTC 4YFLF 5IOPA 4NO3B 3OZ9L 2Z35A 4OQTA 4OIBA 1NTDA 3CSTA 2PR4L 4GMTL 1EO8L 2VZ1A 1VFBA 1WFJA 4CC4C 4D9LH 2QGDA 4XMXA 4LIQL 3G5VB 4F15B 2A74C 1MIEH 1U8OB 4PJDF 1NBCA 1PZDA 2Z91B 4NZRH 2YGPA 4OF8A 1L9QA 4XTRC 1HI6B 3EYFA 1YJDC 4FNLH 2JB5L 2R0ZH 2DJSA 1MI5D 4JHAH 2G60H 2G5BA 1INEL 1CGYA 2YLHA 3QI9A 4KKAD 1EHLH 4MQXD 4M8QB 2W60A 1GW6A 1F4HA 3Q3GB 4U3SA 5E8EA 2VSMB 3GM0A 4JDEB 5IIEA 3D48R 1EUTA 1TU2A 4NZUL 5E2VL 2QLVB 2Y2TA 4PGZA 5E5RB 1MUJA 3GF8A 3GINA 2FL5A 3VYOA 2ZZUT 4Z78B 1H8SA 1P4BH 3FUKA 2A77H 3KBHE 4HS3B 3RDJA 3FO0H 4F9PA 4TOYH 2HX7A 3ARDA 4NRXA 2PYEB 2YEZB 2O5YL 5IQ7H 2HLFC 4TQEL 2QGEA 5I73B 1VZHA 1LHZA 1T20A 1WH0A 3FQTA 3OMNB 4N4YB 4UT9H 2OI9C 4I77L 4LARL 3WY3A 4B9IA 4MJ6A 4NO0B 3N91A 3IVKB 2MKWA 4L8CA 5C7XL 4G7VL 4F37F 4L8SA 3TF7C 3IXAA 3VXUB 1TLMA 2EXTA 2G0KA 1CGXA 3J2PA 1F3JB 3B9DA 4HIIA 4XPGL 3SJVB 3O11A 1G0YR 3PWNB 5IP4A 4F93B 3T2QA 3VWKA 2CO7B 2ZD0A 5D7LA 2I24N 3VFGL 5DHXB 4RDBA 4G9DB 1OP3H 2XQBH 3N41F 3ECBA 5E2VH 4XXDB 3AXIA 4OKVB 2CBQA 4FXLA 2H9GB 5CD5C 4DN4H 3MJ9A 1G7PA 1RUMH 4L05A 1X5FA 3QDGD 1KPVB 2FBRA 2DTSA 3EJQA 4EOWL 2JKRM 1ZHNA 3HBGA 4XNUH 2ED8A 3WNNA 3ASOB 4FLRA 4IBVA 1CDJA 4N25A 1C1EL 2CLZA 2GBVA 2HX9A 3QUML 4FYSA 1E50A 1I1RA 1JTTA 1KLFB 1V3KA 3EOTL 4KVCH 4LFHG 3U6XA 3BEVB 3EYVB 2XQYK 2Y5EA 3UADA 5C0EB 4U7MA 1N4XH 2PW1B 2NY4C 2WBJD 3L3DA 5D2LA 1KXQA 2CK0H 4Y4FB 1KJ3L 1NIDA 3DRQB 4OJFH 4G82A 4P3CL 2R69L 4KI5F 1QFWL 3WMQA 3RY6A 2FZ3B 5JIHA 4M56A 4DOHE 1KBWA 3W3BA 3V4PL 2EVGA 1RL1A 3WTTA 1UWYA 4XR8C 2BIOA 4GINA 5F0PB 2R2CA 4FXGA 5IB2A 2G0LA 5DC2A 4RFEB 4Z7VB 3BQUA 4U0RB 3GUTA 3T4AB 4BQ9A 4FQLH 2YAFA 1JXJA 1G5AA 3DRTA 4FP8H 3GSVB 4Y1AE 4LKXA 3WU1A 2MPAH 2QMKA 1DVFC 3GMQA 5B3SB 1EZVY 1RZ7H 5FO7B 3LH9A 5IMMA 1XF4A 1RFDH 4QIRA 3D87B 4ZMNA 1BD2A 1JGEB 1GYUA 3GMOA 4HMEA 5EC2A 5F7YC 3H7BA 5DI8A 3KNBA 3R06B 1JWSA 3E2HB 4HVBA 1JRHH 2BZ7A 2NNRA 4S2SA 4OIFA 4DUXA 1DSFL 2APFA 3GJFA 1SN2A 1WTGT 2VDQH 2EDFA 2GBTA 4RBPH 3KPRB 4LESA 5T1MA 3MJWA 1EMTL 4P23C 1OHZA 3IKCB 4QJ3B 3VH8A 3D69A 2A9NL 3E6HB 3QEUA 2QQKH 1UD8A 4TLKA 5EDXA 5C71A 5DVLA 1OK0A 1N0XH 3DHPA 1FFOA 1UOLA 2H3NB 4OZFA 2PW2A 1UA6H 1AVAA 3L17A 2D3JA 1TFHA 1Y0LB 3ASNB 5BZDB 2ZT9C 5L8LB 1JZDC 1SXCA 1ZT1A 3G6AA 2DYPD 3STBA 4CVZB 1OPGL 4XE0A 5EIIG 1ZXKA 2EDEA 1MHHB 2Y1VA 3WIFA 1T04A 4QJ5B 4UDUA 2HMID 1P9MC 2VZVA 1NUFA 5GGVH 4UANA 5IFAL 1Z5YD 4LHQB 4WU5A 1SXZA 2CE6A 1SXSA 3IAPA 2OPCA 2X1PA 3BDXA 1T5WA 1ZV9A 1IEHA 1TIUA 5IROD 2WXMA 1IGTB 1VACA 5G4MA 3S97C 4ELME 4HOMA 1SYVA 4LLDA 4W1TA 5EOCJ 1PZSA 3DPBB 3H0TB 3O41A 4TRPH 1HSAA 3ATAA 3BUYB 3OGOE 4X6BB 4XNMA 1MRFH 2IDSA 4ZS6D 5ITFB 4Z6AT 1ZE3H 1YA5A 1HZKA 5F6IC 1VFBB 4LBAA 1T1XB 3VXPB 3QAQA 1LE5A 3HS0B 3BRDA 1OSEA 2VSKB 1A9VA 5LGJB 3VXRD 2NY6D 3PHQA 5C6PB 5B3NA 2EXYD 3R4RA 1AS7A 3P2BA 4PG2C 4YVUA 2Y7MA 4E41A 2HAZA 5CWSA 3GBNL 3KYOA 4AOFA 4F24A 4Z7QF 3LRSA 3MLUL 2XQ0A 1COBA 1BBDH 1JNJA 4N0YL 3TN0A 5CN3A 3SYAA 1MVUA 5CN2A 1I7ZA 3BEWA 3GMMA 3TGXA 3EBGA 1KT2B 4WO0A 2OSLA 3NSFA 4O9HL 5B39A 2J55A 1J5DA 1FH5L 3QAZB 4ESKA 3HR6A 3NCMA 2BSRB 1F02I 4IS6B 4XP5H 1CD0A 1JDCA 2AJ3A 5JOFA 1I1AC 4ACTA 3ATBA 5HJGA 4F7EB 2V33A 1KGYE 2BVPA 2CO6A 1FPTH 3C6EA 3VD0A 2XIBA 1QATA 1P9MA 4S1DC 4RDQF 3BYYA 3W56A 4AXWB 3MZTA 1SY6H 2FYVA 5C2BH 3H2QA 2F6AA 4UOZA 2NYKA 3DX0A 2X6AA 3GZQA 3D3VA 5CLTA 1CB4A 4LSTH 5T1JA 3MA7A 1D5XB 1QSEE 2FO8A 1UT2A 2XWRA 2ENPA 3H9HB 4HSCX 4J2QA 4LF3A 4X4ME 5EDSA 4RX4A 3KW7A 4OI8A 2FATH 5KVFH 1KN2H 3N85L 5LBVA 4TLUA 4XVJL 2L7EA 1G6RL 3SE8L 3SY0B 3UTPD 1GHFL 1TZOA 2YKLL 3CXDH 1S9WA 3EO0A 4E36A 1O9ZA 1QASA 4HPOL 3GRGA 5F1IB 4RGOL 1CXLA 2VLMD 1U2HA 4OD2B 4PJFE 1UXLA 4N2DA 4QOKA 1PZAA 2X87A 3MOQA 4AJYV 3MLUH 5MENA 1AXSA 3V5HB 2W38A 1MCKA 2M2DA 3CPLA 4JG9A 4FI7A 1F6LL 4G8GD 3ZYJA 3WTUA 3DWTA 1BWWA 4E9QA 1BZ9A 5DD0H 4JJ5A 1NUGA 4JAMB 4OM0H 2VLME 1VKXA 2HFTA 3LQZA 4QRPA 2WINB 1MG2C 3BWZA 1DQLH 5DUML 1N7ML 1AMYA 4YX2L 1P2CB 5AW6B 3QDMA 2ZSWA 4JO1L 4Q9QH 2WIIA 4XNQB 4PR5B 5FYJL 4XN9A 3IS0X 4H88L 1M4KA 5DMKA 5H35B 5KJ4A 2AS5M 2X9XA 1N2RA 3HI1A 4PJ5B 4YK4C 4KMLB 1ONQB 4GAFB 1ERNA 1MCBA 4ODUA 4PJ8A 2FJFB 3VFMB 4WV1B 2FAUA 3VD2A 2VAAB 3ESVF 4OD3L 1F11A 4K2UH 2IDUA 5EBWA 1B4LA 3GKWH 3OKLB 1MI5A 4ZMWA 2PABA 1RSFA 3NBNA 2QPSA 5BO0D 4WNSA 2VH5L 3P40A 4HHGA 1CICA 1CGSL 1X9LA 3FU6A 3TU6A 3X1NA 2AJZA 3FMGH 4WSJA 1OB1B 2WXFA 4X6DB 1JYXA 2R8SH 3FCSA 3WBDA 2EYSA 4F33B 3CSPA 1H8LA 1E0OB 2N59A 4LCIL 1BMZA 4OTXL 3AXLA 2NY6B 3QORD 4HCFA 5IHUL 3I6LD 2QJDA 4Z3IA 1T4WA 3ZQ9A 4CBPA 3L8QA 3TXAA 3GIZH 4AG4L 4WK0B 5EBLA 1S5HB 1D5ZA 3GRWH 2F68X 2KS0A 5DEJA 4P5RA 3H55A 4TRPL 1MLBB 1UWFA 3W81A 2WSKA 2P4AB 3OR6B 3LDBB 4XNUL 2YD4A 3GSRA 2WN3A 3QQDA 1T21B 4HK3J 4TVSa 5E8NB 5I6XC 1B0GB 3HNSL 2QSCL 1SM3H 4PJCF 4HCRA 2DQTL 3VXRE 4PY8I 1YQVL 1P4UA 4JFUA 4W9ZA 1R3HB 2VW7A 3IJSB 4BGDA 3IM1A 4AKQA 3MOBH 3DMMD 1JZFA 4GW1A 2OXGB 4KK8D 4B0MB 1XH2A 2UZIL 3IGLA 3LHPL 5C1MB 5FO8A 2QSCH 1PMYA 2Y25A 4PH8A 2G3NA 2QADB 1KYUA 4OZGA 4NBXB 3ML9A 4AEFA 4BH7B 2Y06H 5BZZA 3GSWB 3V0FA 4PV1C 2BO0A 3OGCA 4ZS7L 4R5XA 1OT2A 3M8OH 1V7NL 3VXQA 1TPXB 3MACL 4TSCH 3WE6A 4PWJA 4QRAA 5KOVC 1RIUH 3UJIH 2F54B 3VXMD 1KCSH 3BJLA 5GJSL 2K9UA 3I85A 4WI4A 5D7SH 4MNHB 5LKNA 4LCWB 3V7AG 2X3AA 5CLWA 4N5ED 3G6DH 3GSRB 2A1WH 1OT1A 2X4SA 1E8XA 5K9OB 3LKOB 5BV7L 1IGCL 2R1XB 2OMYB 2YPVH 1CF8L 3DX1A 3P4OA 4NPYA 3CLEL 1CFMA 1U2CA 2OBGA 4HMDA 4JKPH 1XMWA 3O2DL 4GRMB 2O61B 1CGUA 3IMTA 4LKCA 3PQYE 4AV4A 3O6LL 3MR9B 2BOLA 4UNIA 4HJUA 5DUJA 3C60C 3FTWA 1ZGLA 4R5VA 3SPVB 4FXTA 3NH7L 4PFEA 2YZ8A 3PWLB 2HVKA 3SDYL 3BX7C 5ETUB 1FVDA 3UZEC 3ZVVA 2BS71 1HYRC 4D3CH 3L4TA 4D0BB 5AVXB 1Z9OA 1B2WH 4QTHB 1DQLL 4JCWA 2N01B 2R29L 5GGQL 3IK2A 1WZ1L 4AVKA 3QZOA 1X5YA 4GS7B 4LVNB 5DA0B 1M7DA 1M1XB 2K7PA 2BSBA 4IRZL 4WKXA 2J56A 4ZAKA 3RDTB 3LKSB 1XF2A 3QEQE 2RIKA 5A2FA 1I9IL 4LP8A 2BIIA 3P9MB 3TNNB 3CDYA 1XGUB 3C6LD 2A6JA 4U1IB 4PR5A 3PL6C 2HMIC 1JNLL 3DMMC 2DOCA 1A7OL 1MCWM 2UXFA 1R0AH 2PETA 1G7HB 1HOCA 2AV1A 1YJDH 3K72A 3UL4A 1OAUL 1V3JA 1YAIA 5G55A 3KPSD 2YAEA 4LE8A 4NT6A 4FA8A 2H0FA 5EU5B 1E6JH 1M3JA 2DIAA 3TFBA 1GL4B 4HFWB 3ASWA 3DXAD 3L3HA 3U46A 3U0TB 2D31B 5IQ9B 4KQ4H 4W4NA 4A2LA 5IHBA 1FVEB 2EC9U 5L6YH 1LE9A 3RZCD 4M5TA 2VN5A 1WRFA 1EZVX 4QXUL 5F88B 2KQNA 1UD3A 4RGND 3MTXA 1W72B 5F7DA 5JIMA 3ARED 2W9EL 1JD7A 1PDKB 4PG9A 1FC2D 5K9KA 1Q9LA 4BQ8A 4FRWA 2A9AA 4F58H 3WIIH 4O4YL 3BWAA 4NXKA 4JX0A 2EQDA 4DQAA 3UMTA 5JORA 4AKOA 1UXSA 4B9PA 2X4NB 4X6FB 5AW5B 4EEEA 4L0PB 1XZ0B 1F3RB 2HRHA 1NGQL 3FU7A 3BP5A 1NMAH 1FGVL 1F4XL 3D3VB 5I1IH 3OKKB 4HOWA 4JR9L 2JB6B 3ISRA 1ZAGA 2D8KA 5DDHB 4JDZA 3TWCL 1AAJA 1E5ZA 3EO1A 3UPCA 3NJHA 3V9EA 1YEGH 2B16A 4XPTH 4AQEB 1F3DJ 3ZMNA 3VFRA 4C56D 3NCFB 4EMZA 1WA1X 4J8QA 5CJOH 4NQED 3RWDA 4JNXA 4I1NB 4F92B 5D8JL 4APXA 4FKEA 3PLYA 4GO9A 4IOIA 5CGTA 4JZJC 2QV4A 5CR8A 3M45A 4KHTH 4OVVA 3FB5A 4KJYB 1WVZA 4ZUTA 3WKMH 2ITEA 1UQSA 4PJHF 5H37A 3QNZA 3FSAA 5JQIB 4KJYA 5CGMA 2CRYA 4YAQB 4JFOB 3S4SA 4U05A 4HKZA 3W11C 4QR7A 2X1OA 1KXVA 1JGIA 4MSWA 1BPVA 2LFGA 4KZDL 2NTFA 1J18A 1H3UA 3ULAB 1OAYL 4ATWA 5KVDE 5D1QA 3S88L 1PZUB 2IGLA 4LSUL 1U3HC 4IOSA 2NW3B 2Q2LA 4JR9H 4XXWC 1XCQB 1U3JA 4WW1A 5JXAH 1NMAL 4S0TD 1PNDA 3IXTB 3KLKA 4KRPC 2O5XL 4M7JL 3BAEH 3F6IA 5DD3L 2L7JA 2AQNA 4QRUB 4IBTA 3IDGB 3MMEA 5SWZB 5GS2H 1CT8A 3BUPA 3WN6A 3ZRSA 2V4LA 4Y2DC 4G59C 5KVEL 4N8VG 25C8H 4XN7A 4X0KA 1TCMA 1E9OA 3T8XA 1RP9A 1T2QH 1A21A 2Y6SC 1EX0A 1MRDH 1M53A 2Y6TE 3MV9A 4UTBA 2DI9A 2R4RL 5KW9L 4MJ5A 3QUXA 3MNMA 2EE9A 1O7DC 4RVBA 4L3ED 3QPXL 4Z7OF 4P5SA 3BJ91 3O81A 3AMLA 3UABA 3TX4A 2AJUL 2AXFB 3NCXA 1R3IL 4N8VA 4X5WA 2P44B 4YSEA 2EXYC 2N7SA 1LE9B 3BUDA 5TDPB 4GI8A 1OAYH 4YZFE 1FVEA 1LK2A 1MCPH 1JYVA 2LE9A 4OUUB 1ZTMA 4HFWA 1PX8A 1HQRA 4CA4A 3OAYK 3ZDXE 4J8RB 3P9LA 2ZUTA 1DANU 1UVQB 3E80A 4GNKB 1MFDL 1G7HA 4UT9A 1MFVA 3BAEL 3AAZB 3IFPA 3TNMB 5ISZE 3D25B 2ZNXA 1G9MC 1WC7B 4S2SB 2P52A 2ADFH 2LVEA 4HGKC 3WD5H 1RMFL 3GWJA 4HUMB 3V6FB 4XO3A 3CQPA 3HG4A 5E6ZA 1GTNA 2X4QA 4M7LL 2B5IC 3C8DA 2R27A 3P30H 4ORGB 2QSVA 3LD8C 1Q90A 5J9PA 2BIMA 1DJXA 5DR5L 5KBNC 2W0PA 4AV5A 2P24A 3EJPA 3B9KA 4GUPA 3CXFA 2IFFH 5HHXH 2WXGA 1J0IA 5KSAD 5CF3A 2XN9E 3EDDA 4PJFB 1LNUB 5FYLL 5KTEH 4ZMXA 5EU7C 4KHTL 4PS7A 4OCWH 2HJFB 1HCFX 2VUOA 2F1AA 1FL6B 1MNUH 2HLAA 3BDYH 5INDA 3GDCA 3TEWA 1LO5A 5HI3C 1M05A 5HDRA 2HG5B 3EH3B 4EOWH 2M1KA 2DKUA 4W9JC 1MVFA 1HCZA 3KPSA 2DIJA 3EW3B 1E4WL 3S96A 1IGCH 5AOJA 8FABB 4TVUA 3MYJA 3OQRA 4QY8A 5JZ7C 4GUQA 1KIQB 3VMNA 4YHOL 5TE7L 5MEOB 2UUDH 5D1XD 2OL3L 1RK1B 2C9PA 3ZIYA 2OMYA 2Y36H 4I2XB 2D2CC 3ISWA 5C09B 2J21A 1WIOA 4P07A 2RFXB 2KLRA 3ZMRA 1L9PA 4X8JA 5KG9B 5CILH 3LKQB 2MQCA 4N8UA 4XNYH 3V6OA 4J6RH 2XQYA 2FX9L 4GLRH 4OFIA 5F1KC 4OV6F 4BM7A 2HG0A 3D18B 4CU8A 4IBWA 2KL6A 3PAYA 3QQ3B 5E08L 5I1CL 1E3XA 3QNXA 2IH9A 4BSJA 4HIJA 3TC9A 5C7XH 5AVZB 3UH8A 3MRHB 2MNUA 4FQXA 4XXCA 5HYQB 4FZ8L 3ZE1F 3L81A 3HC4H 1WFIA 2EEDA 5HJ3A 4ZSOA 4ODHL 4KV5E 3RUGE 1NDGB 1FCCA 3K4AA 2ITFA 3WJLC 3I6KA 4HKJB 3NABH 3MGTA 3CVHB 1JTOA 3TIDB 4EAEA 3QO0A 4KOCA 4F7CA 5IY5B 4Y16D 1JN6A 2VJ8A 4U6HB 4JHWL 3JYBA 4G7SB 4OSUH 4XOEA 4ZUUB 3S4SB 1FI8C 2QQNL 3NDZE 1S4IA 2QMJA 5C07D 2CKBA 3QRFM 4IIZA 4G5ZL 5L8KB 4DP5X 4X4KA 1D9KD 2WQSA 2DQGH 3IYLW 3E3QC 2W0FA 1J1OL 3KXFD 4NQCD 2ENYA 1WJ3A 1W0VA 2ZWZA 4KRNA 1VEMA 1I4FA 5T5FH 1JXFA 4KKRA 4JFFA 4BFEA 1VZGA 4OD1L 3VGBA 1B4JL 3FNKA 4EXPX 2WLIB 4MZ2A 2XWTB 4B3VA 2Z31A 4XX1E 5DD6B 5FB8A 2PO6C 4B5EA 3FU0A 1ZANL 4JPQA 2OJ1A 4JDEA 1EXUB 4XE5B 3VDCA 5EMYA 3N5AA 4NKOA 1MFUA 1H3PL 3FU7B 4AMKL 3CFUA 5IVOA 2CDEB 1G6VK 2APXA 2Q0ZX 1XH3A 3HBQA 4IRZA 1TNMA 4XGZA 3HMXH 3DOSB 2Y5TB 3BKMH 2AJZB 4JBSA 3X1EA 4CDHA 4RQQB 2DYRB 4OZGF 1CICB 1OE2A 3KVDD 4YWGL 3SPHA 1FP5A 4JN2B 3M7FB 3X11A 4DP0X 4OGAC 5LB1A 1TXKA 3W82A 3ERXA 2W81C 5I16B 1NWOA 1SXNA 1WEJH 3MCKB 1AGDA 5FLVA 3KPOB 3CZUB 3SE4C 1FO0A 3REVA 4JJOA 2UZXB 4BWWA 4D0CB 2XG4B 2NYYD 4KH9A 3T3PE 4A2MA 4PJ8B 2BY2A 2E6PA 3U7YL 4PJCB 5G2NA 2QADC 1MHPH 2MQ3A 5DLLA 4QLRA 1BFVL 2G5UA 5C0AA 3VTMA 4F7TB 4MS6A 1IX2A 1MW2A 4HOXA 5D93C 5IMKA 3KLHD 4M7ZB 3MV7B 4XCEA 3NJGA 4LDEB 2C9SA 3RUGA 1GJIA 5D9SB 3CVIH 4QF1A 4KMTH 5KANI 4OZIF 1M3IA 3NCEB 5EN2B 5ICYB 4M5ZL 4HC1L 1P7HL 3NN8B 3SD2A 5DJ8B 4Q6YA 4QI3A 3GK8H 5LO7A 2PWHA 4FFZL 1GZQA 3IEAA 4OCXH 2NCEA 3WL9B 4Q6KA 3NA4A 5IR1B 1NBVH 3FT3B 3V7MA 1T0NA 2UZXA 2BLFA 1RUKL 3KPOA 1CFQA 4X6DE 4ZFFB 4Z0XA 1BW8A 2UZIH 3CMGA 2CZNA 5CJ5A 4Q74A 5EFIB 1QLEL 2E8YA 2JKSA 1BZ8A 4BRJA 5F70A 2BWQA 5J12B 4BUGA 3KS0J 2DMBA 2HCZX 2IEPA 1EZLA 4XO4A 1BJ1H 3DOSA 4CJ0A 3TO4B 5D1XE 2WXPA 4UINL 5CU5A 3VGDA 5C2BL 1DSYA 2ZCLL 3VD4A 2WP3O 4PWIA 4N86A 2BOCA 1IBBA 1OCRB 2XPGB 4WVRA 3ZE0B 2BMKB 2JKLA 1MJUL 4LKCB 4O2CB 1MKFA 3SYOA 3N04A 1AQMA 2BSTB 1WV7T 3QJUB 4H8HA 1LMKA 4QKTA 2WKOF 2B0SH 4WU7A 3D34A 1BD2D 2JLLA 3CC5B 2CO6B 3H8NA 3P4OB 3OAWA 4OIIH 4G6ML 2ZWLT 1WA0X 1J7VR 4IRSD 5L2JB 1EDHA 3GHPA 1BZ7A 1A7PL 5BRQA 4N2NA 1O6TA 4KJWC 4S1QL 5FM5M 2EIJB 2NT1A 1TYJA 3F7VB 3LEYH 4G42A 2WXRA 3SKJL 1IC5L 1FORL 1BV8A 1F6FB 4HDIB 5HDBB 2RB8A 4HUCA 5D7JD 5FHBH 4HEPG 5FKPB 5F7UA 2CHDA 3GI8H 3BHBB 4IOSD 3B37A 4KC3B 4AEEA 4F8OA 1WDAA 1A6AA 3BXNA 1G7MA 1CGWA 2FJGB 5H2BB 4MXQD 4RRPG 3ARBB 3FUIA 2MCG1 4OZGB 2FWOB 1KSRA 3QYCA 3X1BA 3SE3C 1Q0YH 3AS1A 4X4XB 5CJBA 1A6ZB 3SE6A 2W65A 4K3DL 1QSED 1T3FA 3K7UA 2BFVL 4CADA 3SO3C 4BXVA 4P2RA 4J12A 4MFHA 3SOBH 1XF3A 2WZ5A 4DGWC 3DUHA 5D7IF 2YOCA 4N90E 3VI4B 5CFHA 5AKTA 4I1RA 2WBKA 3ZE2B 4XMKH 1QWHA 5D96C 4HXAH 4WLCA 1WUNT 4KRPD 5JNYB 4M7LH 1WIPA 2WSPA 4JW3A 1ZLVH 2B59B 1V7ML 3JT0A 4XWGL 4JPIB 4FADA 4ONHB 1T04B 3WFDL 1KB3A 3MRJA 1PAMA 3MRBA 4Q0XL 1AD9A 4NFCA 4ONHA 3TH2T 4XNDA 1ZV2A 2YFNA 2VN7A 3DUSB 4GAGL 3X12A 2EIDA 5C0GA 4HPOH 2YRPA 5F1SA 1A8JH 3ILEA 1SVZA 3S96B 3TA3D 5IESL 5I8KH 2X3CA 3KPSB 5J7CC 3U36A 4F8NA 4JO4H 3TJHD 3GBNH 3TEXA 4CILA 3LRLA 2XIIA 3O3BB 5JOPD 3QIUB 3W5MA 5HHME 1AIFB 8CGTA 1EGJH 4JRFA 4XX5A 4WI9A 4J3UA 3S2CA 4LHUB 3VG0H 3TCLA 5DMGD 3V0GA 2GAZB 3A4EA 1J0HA 2H2PC 3GGWB 5FA4A 1BX2B 1CTMA 3IDIA 2CGYA 1ZT4A 2E8ZA 3HI5H 4NO5A 4WJ5A 3BDBA 1HYSD 4KNSA 1T5KA 5FC9A 2YGQA 4Q7DA 4PCSA 4JG1L 3FPXA 4XBEH 1DVYA 5KN5A 2NY3D 2K6YA 4AGOA 4YXLL 1YMMB 4XB8A 4PJ9C 5DJDA 4JFPB 5F89B 2VZ3A 2X9YA 3D0VB 3O3AA 4H0LC 3M1BA 4NXSA 4Z3FA 4BH8A 1ZDSA 4LEEA 3FRPB 4LCYB 5I1JL 3IETA 3BP6A 2Y22A 3O4LD 5EZOL 3UO1H 3QZMA 1U8JB 1CZ8H 2EH8H 2OMUA 1DBKL 3PP3K 3VWJC 4DEUA 5C0JB 2HWZH 1BBDL 3AQYA 2WLKA 5GISL 3DUUB 1YUHA 3MBEC 4RFEA 2BNUA 5IB2B 1QSEA 4QO1A 5AD0A 3H1ZA 4QRRB 2BSSA 1KYFA 1E4XH 5IJVB 4FQ1H 2G4EA 3OJMB 3T1WA 2G9HB 3KPLA 1N64L 3IDXH 4GAYA 4PGJA 2KMWA 2BMKA 3REVB 2FEEI 2QPEB 3FYIB 1I9RH 2AXFA 2GG1A 4OUOA 1ET8A 2XKNB 1FLTX 4HBCH 4Q14A 3ULUC 4N2EA 3BPOB 4AJ0A 1GW0A 3DBSA 5J1AB 4UT7L 3H3PL 4BFIA 4LPUA 3SY0A 1HHGA 3X3GH 4OAWB 5MP6H 5CO1A 4L3EA 1XF5B 2EIZA 3P4NB 3MJ8A 4W93A 2YD0A 1U91A 2YK1L 5EZLA 3VA2C 3SQBB 4JB9H 1SDAB 2VDLB 4XC3L 2EDYA 4NKOB 3V4VL 1IBHA 2CO4A 1JMZA 4QRUA 1AIZA 4NKIL 1P84K 4NKDA 1GVIA 2JNZA 1TZIB 2MH4A 3MBEA 2MOQA 4YDIH 4S0SD 1MHEA 3D5OF 4K07A 5AW7B 3HZVA 5JLZA 3U1QA 3Q1EA 1U0QA 1J5OH 2X4UB 1NCWL 4IRJA 3EYQC 5TK4A 4G80B 4P59H 4JRYE 2Y72A 1SEBB 4PW3A 1FYTA 2FO4B 3BO8A 3EYSH 1Z9SA 4XXDA 1J5CA 4ZFGL 5EN2A 3LRHA 3MRQA 5D1QB 1YEIL 3G5WA 3BLBA 2NX5A 2J8HA 4DVRH 4E9YA 4PJ9A 4XOAA 3VW3H 4CC1A 3O0RL 5IMLA 2QQKL 5D1XC 5DA4A 4GAAA 2W91A 3PHOA 4E41E 5KSVB 2DM2A 4ZFZA 4AVHA 1JK8B 1G7LB 3F7RA 4HS6A 2YN3A 4M02A 5IW1B 4ABUA 5C3IA 2WLYA 3SGKA 3P3YA 4UQ2B 2LU7A 3S34H 3L3IB 1KCVL 1U4EA 1GGCL 3I6GB 2F53B 3BUBA 3FTUA 1FFNB 1LO4H 1S5IL 2OMWB 4YO0A 4U6HA 1NBQA 5DU7A 5LCVH 3MLXH 5C0ND 4POYA 1YEKH 1MJ7L 5CGBA 1FWXA 1L7IL 1MRCH 2DWEA 4N0UB 1G7JB 2I7SA 4P99A 3VG9B 2AEQH 2E59A 3BSZL 4LVHC 4TVPE 2V5RA 4U6VL 2MIZA 4S11A 2YUZA 4WUUE 3VB8A 1WBXA 3ULUL 2YD3A 3BAKA 2YHGA 1AR2A 2CSPA 5D7KD 3VWJD 3VX0A 3CMOL 4P5TD 2ATAA 1D5RA 1IC1A 1PTZA 2DIEA 4PP2B 5BPPA 3DSFL 3IJ7A 1JV5A 2J88L 4OF6A 1AXTL 2AEQL 5DURD 1MLCA 2WYTA 1QFWM 3ESNA 1Z3RA 3ARGB 1XGTB 3MLVL 4DK6A 2OW7A 1JHKH 3VD5A 3UFIA 4QRBA 1U41A 2BVOB 2WMPB 4I13B 2HRPH 2X6UA 3I75A 3CQFA 1MFEH 3D05A 3MODL 4ZX6A 2VITB 4YHLL 1A14H 3IMBA 1I4FB 3LZFL 1QTSA 2C3XA 5DJ2B 4NUJB 3BQVA 4N9GA 4OSUL 1A47A 2QEJA 2DYPB 4G7YH 2XWEA 5FWQA 4KXZI 3KWUA 2H3NA 5JMRA 3CLWA 1QFWI 3SE9H 4X50A 5DFWH 2VDRB 4NZDA 3MLXL 1QSEB 1CICD 1G7LA 2DAVA 3E6HA 3QEUB 5EV7A 3DUUA 3L5HA 2ADGA 4QRTB 4HUUB 1WITA 1FCGA 2FQEA 3AROA 2WB7A 4Z76B 2WZ0A 4P46D 4XN4A 4OZIE 4IMKA 2H47C 2FRGP 1B6UA 2H5UA 3HJEA 4FQ2L 3UIZA 5KYWA 4PV9B 4GQZA 2VDLH 3V5DA 4JFYA 2LR4A 5HYQA 4FQXB 4MAUH 5ESQB 4U4BA 2X4QB 3WJJA 4ONFH 2YPLD 2WYIA 5F3HB 1JF5A 1ZLUK 3VWJB 4PGEB 1AGFB 1PX3A 2A77L 32C2A 1JZHA 4YMPA 4FG6D 4ZUSA 4R4FL 2EUVA 2B3RA 3DETC 3PUCA 1HXMB 3ARFB 3SO5A 4EBQH 3TVMD 3MACH 1ZE3C 2VERA 5IV2B 5AOIA 2P49B 4PY7A 2JCWA 1FC1A 2Y1YA 4Y8AA 4OGYH 5C0IA 4LP5A 3I3EA 1GPOH 4GKZA 3EJCA 1J8SA 3LEVH 5CGYD 5JHDE 1T03L 1BQLH 4UZUA 3PF2A 3QFJB 3C5ZD 5F21B 2WTRA 3EHBB 2XACC 4LB8A 3OZ9H 4HCRL 3TH4T 2PWDA 3LKPB 5IF0B 3T0ED 3L4VA 5C09E 5AB9A 4N9GB 4N0RA 3D85B 1QYGL 5GS1B 3DJZA 2AABL 3CSGA 4K7PH 1AD9B 5FUCC 3L3DB 3SKUD 4IMLA 3MRNB 2V9UA 3CN3A 2Y7OA 2VABA 4Y4FD 1UXMA 2GK0B 5FCUH 4WWID 4X9IA 4PB0H 1L0YA 4MX7B 3B7UX 1XGPA 1CT8B 2XJKA 1BYOA 4M6NH 4BFGA 2G60L 2Q9OA 3Q06A 2EUXA 1S7WA 5CEZD 4I8DA 1KZYA 4RAVB 3WMSA 4YC2B 5FGSA 5T1KD 3RWHB 1BQHA 1C16B 2WWMD 3Q2VA 4S1SL 2X4PA 2PP9A 3PFUA 5IVZB 3FRPG 2AMUA 2C4XA 1G94A 2WWNA 1DL7H 1MIEL 1S5IH 3WDHA 4PJ6A 3D25A 2E46A 2I60H 3C09B 2M83A 4NN7C 2D4FA 4TSCL 2AJXH 1N0LA 3C6LC 3IFLL 2OSXA 1CCZA 4AE1A 1NANI 4YO0B 4KNQA 1TITA 4X9HA 3BCFA 3US9A 2GIMA 3QJHA 4HJSA 4N90D 1F3JA 4HIIB 3VW3L 3IAQA 1RKRA 1HNGA 3N6YA 1PG7L 5FGCB 2H1LM 1IQDB 4J3OC 4M1CD 3GO1H 4JM0A 4PHXA 5DJ0B 2ICES 3RB5A 1ZCRA 3Q2NA 3G9AB 5DQJA 1MRDL 4AENA 4N2KA 3ESPA 1IBGH 1YYLL 1T20B 3BUQA 1G4RA 5F9DC 1CD1B 2BXZA 3B2UD 5KVEH 4PJ7F 2IPTL 2IOMA 3EADA 1FYTB 2X2IA 2XZCL 2FDBP 3MLSL 3CC5A 1HXYB 1ADQL 5I5MA 1D5ZB 3CZNA 2EYRA 3RIKA 5D71L 2B39A 1QQDB 3ARGA 1HXKA 4RCAA 1IM3D 3KWXA 2DQFA 2Z31C 3FBQA 1FNFA 4FDWA 2JK5B 1YCSA 1H3GA 2A4ZA 1CU4H 4LQ1A 4CU6A 5E1HB 2J2ZB 4TPRL 2SEBB 3MV7E 2ARWA 4M6MH 1MAML 4HCIA 2WLLB 2ZICA 4I0PA 1A4KA 2F18A 4U1GB 4DP7X 4HT1H 3EGDB 3EYFB 4FFWD 1ITCA 2WLJA 4PG9B 2WLNA 3UG5A 4H1LH 4R83A 5AW0B 1I9EA 4D9RD 1NDMA 4GKSB 2XLLA 4QXTA 2BVEA 3TWYA 1ZK9A 4JCLA 2IGTA 2PNDA 1MOEA 2F53A 5GRYA 1ITBB 4DP6X 4L29B 4AQAB 4L37A 3QQXA 1E8ZA 5I75B 2BIHA 4LVNC 5TE4L 3SYCA 3L4CA 3SD5A 4B3EA 4F1ZA 3WJJC 1WGVA 3NFNB 4DQOL 1ZA6A 4PJFF 4YZFF 2GC4C 4XCNA 1FGNL 1SJVA 1ZA6B 2IMNA 4JM4H 2GJJA 2J5LB 2K1MA 5C86A 1OLLA 3DJSA 3HRZA 4UILL 3Q6FA 3S35H 3SPJA 4GXFA 1OEZW 1YEDB 1TJHL 2IAMB 3OAYH 3V0WH 1FYTD 2OMVA 2CDFA 1NLDH 3MNDA 1O7DE 2PWEA 2R2BA 4IRJD 3LS4H 1MIMH 3RVXD 2OYLA 3HLAB 5E1GA 4TS6A 3MBEB 4UOJA 2DQCH 4F58L 4MMXB 5HI5D 5I76B 3ATFA 3V5HA 4LOVA 1XSOA 2B4CH 2J4WL 2AK4A 3GI8L 3ZTJG 1EGJL 4XPBH 5I1HH 3SQBA 4TTDC 2B7DT 4FNQA 5DHVA 4KPHL 4YHYC 5JORB 1QHQA 1S9WB 2F19H 1MW3A 4MD4A 3TT1L 1ACXA 2BCKB 4KWUA 2WBWB 3RJDA 1QRKA 2CIIB 4RQQA 2R2HB 5K9KB 2ICWJ 4HUKB 3IPBA 4UI2A 1NCUA 5DUBA 5GRWA 2GI0A 4OCRL 5IB1A 1NAML 3RL1A 5BRZE 1B90A 5KBDA 3GZOA 3KVPA 4RGNE 4Z0XB 4NX0A 3ZKQD 3ENEA 1OD7A 4P4KB 1KTCA 1SJEB 4H20H 1TVBA 2EIKB 2PTVA 3CN4A 2VT0A 1ZHLA 3L3JB 4Q52A 4Y2OA 5AZEL 2K45A 4JCMA 4P2CG 3TYGL 3UCRA 4KKZA 5FB8B 1YUKB 1JSYA 1JDAA 5GGRA 2Y1AA 3CVIL 1XGZA 2VLKA 5E1AA 3CLFH 1D5BA 3AQZA 4BKLB 5EOCH 4WSGA 1O6SA 4GI6A 3OG6B 2ZCHH 1J8HA 4IRSB 3QWOB 1OZUA 5DS2A 3ULVL 5DQJB 4PGBB 1IB5A 2I27N 4X6CA 5DK2B 4Z95L 3C9NB 4YHIB 3O3AB 4ZO6A 4PB9L 4XP4L 1IQWH 4WNQA 3ZZLA 4OZFG 5DTFB 2COQA 1HKLH 3N42B 3BZ4A 4RIRA 1IFGA 2JKTM 1E8WA 1NL0L 4M4RA 1UJ3A 1N0LB 3TN0D 4TSAH 1KCKA 2O30A 5EORL 3ZKXB 5BJTA 4J28A 5GRVK 3VFWB 2H41A 3GGWA 4XO5A 2D7TH 2YJLA 1I8LA 4NC1C 2DDQL 3CQQA 4WI8A 3TZVC 1XH1A 3CNKA 1A8ZA 4F57H 2BOBA 1OGAB 2JIXD 2VZSA 3O2VH 2AJXL 4HP5A 3AB0B 5IJBC 3OSKA 3CHRA 3AJ7A 2E56A 4G42B 3AG2B 4FCAA 3VD7A 4R3SA 1A7PH 2Z65C 5DO2D 3TA4D 4O02H 3QXTA 2C9AA 1XSJA 5I9QB 1OGAE 1RHHB 1IGFH 1X7QB 1Q9WA 1H15B 3RVXC 1K6QL 4U1HA 1PLCA 1QLEH 2H6PB 3FFCD 3FXIC 4XMUA 1JF1B 3UAEA 3WLBA 4NQXB 1ID2A 1CYGA 1KOAA 2R0LL 3RGVD 1JGUL 2IIJA 2DZEA 3I9GL 4BZ1A 4CJ1A 2JV6A 3FSZA 3ARRA 5FEBA 1EEYB 1HT6A 4FLSA 4HA1A 1GOFA 2ATKB 4U1KB 5I74B 4NC0B 5TFSH 4QCIB 1GOHA 2BFGA 1UGKA 1FBIL 5C08D 1Y0LA 5I71B 3MLZL 1I8KB 1BG1A 3NCYP 5D5MA 4G8GA 4J3XA 4XXWA 5D6CA 1LILA 1LO5B 1MWAA 4LDLB 3NIDE 4L2YA 5JHLL 1VENA 5KVFE 5D1QC 3ZE2F 2VIRA 3RY4A 4Z7WB 3EGSB 3UEQA 5HYJA 1S9VA 4HCRH 1D2OA 1OP3K 1DQMH 4N2LA 1UCBH 3ARUA 2O6CA 4P3CH 4YHNA 1LL1A 2VM3A 2WSDA 2YQ2A 4QEGA 4U0RC 3MLYL 1VJSA 1G9MH 2WWKT 32C2B 3GK8L 4Y4HD 5BJTB 2VDNH 2KDYA 1WA2X 3VWJA 1RURH 2VAAA 5AL8A 5DQDL 1E43A 2PXYB 4OD1H 4F91B 2G3MA 1BD2E 4G7VH 2JJUA 1DVZA 4CAGA 3VE0B 1WICA 1YC7A 1YMMD 3EG9B 4Y9BA 4OKDA 5EC2B 3WY2A 5C0BA 4N2AA 3RIAK 1SBSL 1UT9A 2I85A 2NNCA 12E8L 1TYEB 4OCSH 5CD3A 3UTSB 3BD3A 5E6RB 2X44D 1NIAA 4FLQA 4C54A 3PXLA 1U3HB 2Q76A 4K15A 3LKQA 1ZV5A 1JPGB 3QUXD 4NQEB 3PGFH 3GJEB 2VABB 2ORBH 3D3VE 4MA1C 4QAWA 4WEEA 5KVEE 4RWYL 4IGBB 1KUMA 1Q9KB 4PRNB 1Z1WA 4MJIA 2Y9RT 4FXGB 3RHWF 2EKSA 2X12A 1S5HA 4NKMB 1RIHH 2JKJA 1H5BA 4GSQA 3FQ2A 1CXIA 1PAZA 5IJCC 3APMA 5J11B 1KJ2H 1YZZA 2BHFA 2W95A 3SIKA 4DT2A 3VQ2C 3TF4A 4N2GA 4JHAL 4OGQC 5C07B 4N2MA 3UG3A 2OL3H 5SX5K 3AXLB 4TNVK 5IMOA 1QW9A 1XGRB 5CHNA 4HIEB 5ISZD 5FUCE 2PO6D 1X5GA 3HMWL 2AXHA 3KCWA 3MLWH 5DUBB 5DJ6A 5DVPA 4W9GC 1MVYA 3COOA 2XJLA 1XR8B 5LNEA 4P48A 3VDAA 3A6CH 3GT6A 5B39G 3ZHDA 5IV2A 1NC4D 4U1LA 2UZPA 1VEOA 3FRUA 4Q97A 1IT9L 2XWBB 2VLJB 3L5WA 4FQCH 4H88H 1T0NB 1NSNH 1ZVYA 5DJCA 4UV4L 3FN0H 5DD6A 2HRGA 1CIUA 4WEBH 2VDKH 2MEJB 4JM2F 4N28A 5E8OA 1A0QL 2CDFB 4WW1B 5L2KB 3V6FA 1TFPA 2C9QA 3EBHA 3OKOA 3WGVB 2CXGA 5HYSA 1KB9J 2OX5B 2G75A 3DMMA 4OFDA 1LEGB 5FPIA 2P42B 3PV7A 3UBXG 4I2XE 1INEH 2AF2A 2MPVA 3D12B 4KVNH 4HZLA 1DVSA 1KLGB 2GFBA 2Y3NA 4UQ3B 3LH8A 4GRLB 4YDNA 3SE3A 1KXQE 4OCWL 4Z76A 2WINA 4EDWH 1CE6B 2DDQH 2CLRA 4QT5A 1I1AB 1BQHG 2HFFA 1Q1JH 3CVHH 3QFJE 1M2VA 1GYCA 3EOAA 4FHKA 5C0BD 3LPWA 2VWEE 2XG5A 5TDPA 3R8QA 1G6RH 1ZLEA 2J7LA 3SE8H 4L8CB 3TCTA 3KMDA 1T6BX 3V2AR 3QRGL 3ZHLA 4FKHA 4CRPA 3CFQA 4FFTA 1YEJL 3NACH 4NN5C 1L9SA 3UZEA 1II4E 3APNA 1ZTXL 1LEKA 2VDQB 2XA8L 1INQB 3C12A 1A3LH 1KYOK 4J3SA 2OZNA 4E42A 2NY0B 5B1JA 2FX9H 1LWJA 1A4KB 4GIAA 2ZWKA 5JLZB 2HZHA 2CDEA 5ELIA 1D5MB 3DVNA 2JB6A 4H0IA 1HAWA 4A55A 1A1NB 4UILH 4HSQA 4JFFE 5E8EB 1G9NL 1PD6A 1QHPA 1WZMA 3QZWB 5JMOC 1NIFA 2WAHA 4WY7H 4AI7A 4EI5D 4YNYA 2NY1C 2YPKB 3H9SB 1YMHB 1RUAL 3KPNB 3EOBB 4FMKA 3ZZSA 2R56L 4A68A 2GJ6D 4WDIA 4JB9L 4XC3H 4G2AA 5I6XB 2YGOA 2FX8H 4PRBB 1O5DT 4XCCL 2XXGA 1U8OA 3B2MA 1CMOA 4XP1H 4YBHA 4YSCA 1HINH 1ZT7B 2X7LA 2HG5A 4K3EH 3IFNL 5CU9A 5IOKA 2CM5A 1AKJB 1FFOB 4OZHE 3A4AA 1U2YA 2X3BA 4N1EA 4FFZA 4JO2H 4N24A 3NCWA 3ZQWA 5J56B 1DYZA 2ZUQB 1KJMB 5LWYH 1OANA 1OK8A 4G8EA 4I18B 5F3BA 4ABVA 1MQKH 1LO0H 3NZ8B 3U7WL 1KLGA 2GFBB 5IZ7A 1N8ZA 4G1MB 1J0YA 5MEND 5LGJA 4NO2B 3JBG7 5DHMC 3VVWA 3FCTB 1X5LA 3Q6GH 1E28A 3D39B 4YDMA 5C0CA 5EBMA 1U8LA 2MNWA 3IN0A 2X4UA 2X4PB 2BC4A 1BQHB 3QK0A 1UGNA 3EZ8A 3O41B 1FAIH 4J1UB 3ROLB 2R69A 3RTLA 3C2SA 4WJ5B 1NC4B 3UJTL 3ZRCC 4WY7L 3QHZL 5FO7A 2YAQA 2A3TA 2ZE0A 2L0DA 2ITDB 2UWEB 4OF0A 1XZ0A 2D73A 2FD6H 1OQOA 4XBEL 1FFRA 4HWZA 4PRPB 3SE4A 3PYCA 3FU5A 2GJZA 3WDJA 1JZ5A 2VXSL 5F7EL 2WKLA 1TQCC 2CMRL 1DQJA 4XCCH 1F8TL 4JUTA 4ZZKA 4AWJC 5AKSA 5IM7A 1C08A 4RH4A 2A6DA 1DEDA 1EPFA 1XGRA 5CHNB 1S46A 4PJXE 4MCMA 1DFBL 3ARBD 2VLKD 2X40A 2VAJA 3U36B 1RAMA 5GSVA 2OJZL 3VDBA 1Z9PA 1U93A 4RGMC 1T0OA 2FT7A 1RH8A 5FUOH 2YGVA 2XYCA 3MV8D 4NPYB 3QUXB 3C8HA 4Q8BA 4MJ5B 5ISZA 4RISH 4UBDC 4X5QA 5IVXF 3GYRA 1TQWA 2ITCB 4S1SH 4C56B 1AKPA 1JV2A 4OGZA 2XBZA 4PJ8C 2NY1D 4A37A 3S4SG 4JFDE 4M5YL 1HHIA 2LLNA 2GBUA 4KVNL 1KJVA 1D9KB 2DMKA 2FD6L 2Z7WA 4PRID 1NGZB 1WZ1H 2FWLB 2WQRA 4P2RB 4PJHB 4PTTB 4Y19E 3K80A 2RQ8A 4JQIA 2YMOA 1JGEA 1AZUA 1FYTE 4JFWA 1M7DB 1FG2B 3D2TA 3DV6B 3NTCL 1CLVA 4NQDA 4U6XA 3SZKC 5AAPA 5BS0D 1IVTA 3OLGA 4UB0L 1TT6A 3HNVH 3WYRA 3UO8B 5HHMB 2MMXA 5JDJA 2IQ9L 5KYWB 3IFPB 1NFAA 5BZWA 4IRZH 3TBSB 1MZYA 4ELMF 4PCKA 1H3XA 3AREB 4MHHI 3WJLA 4JFXB 4WK4B 3ZE0E 1GH7A 5SWQB 3O3EA 2GI7A 4NNYB 1DN0A 4G8GB 4GI9A 5D6CB 2OR8A 1DBMH 2CA4A 4FQXC 3MLPA 1JGDA 3PJSA 2QFRA 4OF3A 4JGUA 4XOBA 1EV2E 2WQXA 3RWDB 4PRHD 1UKQA 1HIMH 5HHNB 5IBTH 1QBMH 3RWEA 3QIBC 3HUJB 5I5RA 1ZGLP 1NGYB 1KIPA 3K1KC 5GRVL 1N19A 3ZL2A 1EJOH 1UYWH 1BIIA 3UROR 4Z78A 4CSZA 3BP7B 4R7DA 2R56H 5J8OA 2I07A 3UJIL 5TE6L 1IBDA 4AZ8A 3K6DA 1IRAY 3MV7D 1DVFB 1IKFH 3WEAA 4D3CL 3HEIB 3B34A 3H4HA 3RDTD 1C5BL 1JWMA 1QYGH 4XPHL 5LGKA 3L3OC 5BVPL 4KZDH 4KY1L 5DHYB 3TT3L 1CI5A 1OCWH 2FLRT 3GHEL 3SYPA 3VQ1C 1MF2L 3HE7C 3OWRA 1G6RB 3BWAB 3EH1A 1HN1A 4NC2B 1F4WL 5C8JB 5F2FA 4UM9B 1JK9B 4MZ3A 1XMEB 4G9DA 1JZ3A 3OKLA 3FJTA 3B2VH 3OX8B 1Q72L 2JTDA 2XBDA 2X42A 3OKNA 5H2BA 4YSQA 2R7EA 3QDJB 1J9RA 2BP0A 2W88A 3JWOL 4GXVL 4RAUB 5TH2B 3FAXA 3T5WA 2CJUH 4PI0A 1YQVH 3W2DL 3KLHC 3RX9A 2C3WA 1ODAA 4FHJA 1QUNA 2H1XA 4PG2A 5GS2D 4K3HA 5IW1A 4JKMA 4ENZA 2APTA 5B1BB 3MBXH 4ZJ9A 5HD8C 4DEPC 3JVFC 3FO1A 5E8DL 2XV3A 5EU5A 5FKAB 5ICYA 2WM0A 4G1EA 3MRCB 4HUNB 4AUYA 3LD8B 3LS5L 1SXAA 2JJTA 1AQDB 1QZNA 3SJVE 3ZT5A 1T21A 1MI5E 4MXWH 2NYZA 1NCNA 3UPRB 2Z31D 1TJXA 4FLHA 5F9JA 1Z66A 4KNUA 3LXBA 2GJ6B 1FF5A 5GQBA 2MCPH 4HGWB 3SSGA 2V7NA 3L3JA 1CG9B 4FYQA 2LW3A 2Q7AA 4MZIA 5FDYA 2NY3C 2R1YB 1DQQA 4MB5A 4WAFA 3WN5B 4Z7NB 1R5VA 1S6NA 5KVDL 3T3PF 5EZLB 2OMXA 1ZKAA 1HHKA 2VO8A 3K74B 4L3EB 1ILSA 4X4YB 2ZPKL 3IJ9A 3FN9A 3MRDB 2WO4A 4J3BA 3U9WA 4MASA 2VM9A 5HDLA 4X4YA 4OD3H 5EU4A 5J1AA 3E0GA 3RIFF 1JGLL 1VESA 1ESOA 3GS0A 3L6FB 1N8OE 3GLDA 3QUXC 1WISA 1VERA 4F57L 4HFUL 3AGVA 1OCCB 3FQRB 5EBWB 1F11B 1P7KA 4QUOA 4NNXB 3EIFA 3FU8A 4WHTA 4HLJA 1J5HA 2R9HD 4ODTL 4ZS7H 4GG6B 4XVSH 1GY1A 4JO3L 1O75A 1P5UB 2FUTA 5IEHB 3H2PA 3UXFA 2H6OA 3GXFA 3V8CA 5TK2A 1YEIH 1G7IB 3UBGA 2GJ6A 4BFKA 4QRRA 1OAZL 4HFUH 2B15A 2P28B 3CFCH 4OH2A 3Q6FB 2R1XA 1S3KL 3IGFA 4ZQTA 3BD4A 5GGSA 3HNTL 4JRXE 2FYYA 1BAFH 3QC5X 3LAFA 1HOCB 2EDKA 3NSYA 3B7RL 3V6ZB 2QGCA 3NCJH 4J4PD 1A6TB 1U3HA 2Q76B 1GYVA 3L5JA 1OP5H 5BQ7A 4MB4A 4P46A 3CU7A 2JXMB 3QJXA 1MXDA 1QBLH 2YO3A 2X28A 3T4YB 3K2UH 1HH9B 4CL7A 1NKOA 3DPDA 3FUDA 3EFOB 4GRLC 1AC0A 2CGRH 1TQUA 4H4NA 2C26A 3PIQB 3ZXAC 1KN2L 2VISB 2IANA 2VDPB 1YDPA 3X11B 1DEEB 3I02B 4UM9A 3FUNA 5AOZA 3ZDXF 1R19A 1CDGA 2WZ6A 3IWVA 2P46B 2I9TA 4KTDL 3UACA 3PV6B 1XH3B 4HIJB 1W72L 4LF3B 2R0KH 1ZVNA 1SN5A 4Y4KB 4KKBD 1EXUA 3P3TA 1C8QA 1Z9MA 3B7YA 4LNRA 1KCUL 1MAKA 1JZEA 1TJGL 4R7DB 3ZRFC 4QGTA 2EILB 2H45A 5JIDA 1MLBA 1KTDA 4MKMA 1MHHA 2CWRA 2ZCZA 3HNSH 5LNGA 4W70A 3LEXA 4LCIH 5IHUH 3GSQA 2VLJE 4IHBA 1NCGA 4NBYB 4G7RB 4XMPL 5E8PA 1WP6A 1F4WH 4OCYL 4DGVL 4OCRH 4KU1A 1H15A 3S3JA 3UC0L 1F2QA 5B39B 2HJKA 1RHHA 1OVZA 1E67A 1I8MA 4DK5A 3GRWL 1BZDA 1UWEH 3T0VA 3NT0A 4GBXA 3H9ZA 1PLAA 1X5KA 4W6XB 2CD0A 2VN4A 1U8HB 1IKFL 1O9WA 2W59A 4ZW6A 4AGLA 3P1VA 2O72A 4JFXA 1INDL 3VXQB 3BKJL 3UBXA 5D7IB 3V55A 2EVHA 4K71B 5T3ZE 4PRAA 4Y5YB 4PJ9D 3KPMA 3FQUA 5FM4A 4QHKJ 5FW7A 1NLDL 1HIML 1QW8A 3LEYL 1NDGA 5AVTB 3B3IB 4L8SC 2YC1B 3S35L 1JZ4A 3BVNB 2FJFA 3R06A 3BZ4B 4RIRB 5E24E 3OKEB 4NQDD 2QR0A 2WLMA 4TNEA 2F5AH 4W6YB 2YSSA 1DR9A 4L1BA 3Q8EA 5CP3H 5BXFB 3F04A 1IGML 3RWJA 2WQUA 2J72A 4HD5A 2ALWA 1CDUA 1W8EA 5E5UB 5AB0A 3ARDC 2DS4A 5TE4H 4F9PC 1B0GA 2WBJA 4AL8C 2B1HH 2KDGA 3PL6D 1FL3B 2NNAA 5GRXG 4ZMVA 4L1DA 5LN4A 1A25A 1QRNA 4JFED 1XB3A 1RMFH 2NX5D 4EUPB 2BRRL 3E2HC 1OTUC 4ES9A 1JD9A 2PWGA 4Z7VA 4WFFD 2ZWNA 1AO7E 2E5EA 3T0EB 5BV7B 3UCQA 1E27A 3CE1A 5I66A 5I1DB 2DJUA 5I28A 2KPWA 3QI9C 2VDOH 4QYAA 1RP8A 2V9RA 4TUKH 1FHNA 5AW2B 3CV5A 1RUPL 1LVEA 3RP1A 5IB5B 3UOAB 1FZKB 4C47A 5ACZB 4H20L 1DQJB 1IC4L 1RUKH 3V0VA 4RDQG 4FQJL 5EIIB 5AVVB 4YXKH 2VDOL 5EB9A 3W5NA 1PD1A 4HH9B 1MFNA 1E9OB 2B2XL 3ZK0A 4FABH 3GTVA 2N0MA 1YYML 1EHXA 1OGAD 4DO5A 3L1EA 1HS6A 5F8RC 5A2LH 9PCYA 2JELL 3D09A 3AWFA 3ESUF 5SWZA 3DDFA 4FQXD 2WD0A 1Y6NR 3FT9A 4GS7C 5IB4A 2LVCA 2B77A 4XNXH 1GS8A 1RZPA 4MAYB 1JWSB 1WAAA 2VQ4A 3X2QB 1GYAA 3QZWG 4HWBL 3U2JA 3IB4A 3VFVB 3O8XC 4KHXL 4GKOA 4WGWB 5D2NE 1S78C 1DLFL 2EDOA 3AG1B 2AQRA 5DRZA 4RAHA 4PVNA 4PGDA 1UM6H 2WGXA 3ZDYB 2WIIB 4K7PX 3CIQA 4XCNB 4XNQA 3QDMB 4LKXB 3VWKB 4M8UA 2E4FA 3TO2A 3CN0A 3P2DA 7FABL 2E7DA 2GTWA 2ICWI 3ABMB 4ODXA 4JLRB 3GMMB 1EJFA 4UQ9A 3SJVA 1RK7A 2WWOA 3GMLB 2GB2A 4OFKA 3RFZA 4OUUA 2F7IA 3HKZA 4UINH 4KBPA 5TQ0H 2ZPKH 1MREH 3KYOB 1U21A 2R29A 1WQVT 3WNKA 3WLWD 4X5WB 2WWMC 3QCUL 3BZEB 1GJUA 4F8QA 1NDMB 4GKSA 1ES0B 1XTMA 3G04B 4NUJA 2JQMA 4RNRB 2O6PA 4WFFE 1X6NA 4R7VA 4DEPB 1FHGA 3CFDA 4KFZC 4PWEA 4I9WE 3WKML 4E9XA 4ODSL 4HUVA 4ELMA 4J3WA 3ETTA 4NRXB 4AEHH 3G6JB 4L9LA 5C0FB 4M43L 1NZRA 1TKWB 4KK8C 2V5SA 1AD0B 2CBPA 4FFVC 1WWAX 4EN3B 1B4TA 3BPCB 1HZHL 3MA7B 1WD8A 3HS9A 5J1TC 2BHUA 1NGXA 2JIXA 3VRLF 3BP5B 2YBGA 3Q3GA 1CJYA 3QXUA 3RWGB 4NJAL 4JFDD 1EFQA 1X4XA 3UDWA 4KXDA 1VCAA 5I74C 5AYUH 4NDMA 4F7EA 1QSFD 2XZAL 1FGVH 2B4CC 4JL1A 4BD4A 1NC2A 1I9JL 2OI9B 5ALBL 1CICC 3MLSH 3OZKA 4L1SA 3QWNA 3W2DH 2FBOJ 2W0FB 3ML8A 3QEQB 3QIBD 3QB7C 1E4XI 3LMJL 3RA7L 2OCCB 1A7RH 3HE7B 2YPLE 4HJGA 4B6ZA 5DZAA 1GC1C 3EFFA 5F6IB 1WZKA 3POHA 2CKBB 4FTDA 3TV3L 4KO6A 1C12B 5IK3B 1BMWA 2YGNA 3B1UA 5IOPB 2AJYH 2LTQB 2H32H 3AY2A 3QJSB 4QXUH 3FTYA 2EXSA 5CR1A 2IF7A 2ICWB 2CBTA 2J1ZA 3G5ZA 5A6MA 2JVUA 4GRLA 1S7RA 2XZZA 1EJ8A 1U33A 5EUOF 3PNWB 4HJEA 2A74B 2LU3A 3L9EA 1EFXD 1LEGA 2OV0A 4EVNA 2EDJA 2FECI 2P43B 2VDQL 3MUUA 2EEAA 4P46C 3BVUA 4TULL 4Y5VC 5B21A 1BAFL 1IZJA 4HAKA 2ZX6A 4HKXA 1M57B 4GUOA 1SYVB 3OKYA 5J6SA 5BUAA 1CXEA 4IKIA 3EOTH 3UZVA 1VFMA 5ENWB 2X0UA 3WNOA 2GUOB 4QTHA 3NAAL 3FS9A 3JTTA 1DDTA 5T5FA 4FXKB 2GUYA 3E8UL 1L5GB 4HW6A 3RNKB 4AGQA 4Q9RH 1PDKA 1KTRL 3QULB 5ERWA 4ZW7A 3HZMB 1KTLB 1KCBA 1ZT1B 3WAKA 4KQ3L 4A2DA 2DQUL 4I0KA 4ZPVB 3OF6D 2CUMA 3IU3B 2GSGB 5EOTA 1F1DA 1UZ8A 4MQXC 3QFJA 4PRDB 2BNQB 3LQAH 3RWFA 4JK0D 4LK4A 2OR7A 1PKQE 4FTVB 4LDCA 1KCWA 4FEIA 2CUIA 1FG9C 4KKQA 2PW1A 5D2LB 4JFZL 3ZHKA 3MLTA 3JWDH 3S3SA 1WZAA 1QSVA 1MCOH 1QPXA 2X4SB 2PYED 2EDWA 4B9CA 2EH7H 3AS2A 4IHOB 3ZSSA 4GMSL 4JN1L 4OBRA 4S10A 3QE5A 5G4NA 3DGGA 1D6EB 2HKAA 4MVBC 5T5FL 3W11D 2FNWA 5H37G 5TF1L 3GMLA 3SHSA 1KELH 4DAGL 1R75A 5F6HI 5L9DL 5EWIH 5F9AC 2VLLB 4ORGA 4X99A 2H2SD 2B1AH 4OI7A 5DJXA 3TO2B 1MJ7H 5ABDE 3TBVA 4IBUA 2OJEA 2EEFA 2DQMA 4PS3A 4A6YB 2D9CA 3QORB 5CP7B 1I7RA 1OT4A 3F3HA 1BX2A 1IL1A 1TQTA 5D96B 2IQAA 5E4IA 4YL4A 4Z9KB 4MA1B 5CFAA 2JH2A 3FL7A 1XEDA 1JPTH 1JL8A 1JXGA 2QTEA 3JV6B 1CFTB 2X88A 2F7RA 4YDJB 5JOPE 1LLAA 4FFYH 3SKMB 5ETUA 4F15C 3TA3B 3BFQG 4P8QA 3HTLX 1BQRA 5CZVH 1GGIH 4MAZA 3FB8A 1PZ5A 5JIIA 3WFCL 3NQKA 3QDJD 1AHWB 2FBJH 4WO4A 4EIBA 1ZGLB 4L3EE 5KOMC 4NO0A 2EO1A 2NR6A 4HV8A 2OMNA 1ETB1 1QPKA 4V2BA 4H25B 4LPYA 3UZQB 4Y1AB 1MWAL 3K2MC 4MCYA 1AC6A 1RJCA 1B3JA 3V0IA 3IGAB 5I1KL 3L3OA 3BZ5A 4U3CA 3SDAD 4B96A 1SXBA 4OT1L 3QHFH 2CO2A 1KC5L 3Q8AA 4JHUA 1JAEA 4PS4L 4OF5A 4TOYL 1NKGA 2FIKB 1VZIA 3JV0A 2P48B 1DVFD 4EIZC 4B7IA 3VI4A 2Z1KA 1TCRB 3UO1L 5J89A 3LH2L 4M8QA 4J4PC 4U3SB 5AG8A 2BVUA 2EIEA 3EAKA 2MWCA 4P49A 3RWCA 5B4MC 3WE6B 1SY6A 1T3FB 4IDJH 4XP6L 2BNQE 2R2EA 4ENEC 1EHLL 3EZJB 4Y0GA 2O5ZL 4LIQH 4B9FA 4PIBA 4N9OB 1BHGA 4FG0A 2JF1A 1N64H 5BXFA 1XSKA 4TQ8A 3RILA 5FYLH 1AGBA 3GC3A 3EXJA 2A0LD 5CBEA 3IN2A 3FF7A 4P23B 4YE0A 3A0OA 3VVVA 5I24A 5KS9A 3VM5A 5D8JH 4GEJA 3C5ZA 2BY1A 1RZFH 5D4JA 2EH8L 3LNIA 2E9BA 3KE0A 4DPRA 5AVUB 4ZW5A 4N2CA 5EZOH 1ZMYA 3KPMB 4L8SB 3RGBA 3NTCH 1MW0A 1W16A 3VG0L 3WFBL 4NN5B 3F85A 2YOAA 2R83A 1PNCA 4M00A 3IMWA 1RJLB 4MCZB 2V3DA 4WK2B 4FQ1L 5E7BA 1OSZA 2X6CA 3ALXA 3NOIA 3UBXB 1XCWA 4KK9C 3RY5A 4JDTH 5JW4R 3DSNA 2AFNA 4X7SH 4GAJH 2VQ1A 4BUQA 3GNML 1JZ8A 5L2JA 4G6JL 3VWKD 3Q9PA 1T7YA 4I3SL 1OCOB 4ZUWB 1AP2A 5AVWB 1ZSHA 1UM6L 3FO9A 5FR3A 3IJYA 2BM3A 4ZNEA 4FFWC 4H40A 4O2CA 4XHJD 1RIVH 5B1KA 1CLCA 4PWKA 2AEIT 5LBSA 3HE7D 1N59B 4UQBA 2ZKMX 1ZTXH 4RFNB 2VJ0A 1KTDB 1UXWB 4MAYD 3WELA 5ECGA 1ZRUA 3MJ7B 1BVZA 1R3IH 1K8DB 3RY6C 1TZHA 4LNRB 3MV8B 4NBZB 3W9EA 4TKWA 3MU3A 4XAKE 4MD4B 1MEXH 3FO2A 2JCCE 4KTEH 4J3OG 5E70A 4KQ4L 3F12A 1J8KA 2DWYA 1URLA 5FYKE 2YPVA 4H5SB 5JIQA 4JS7A 5AVYB 3S6CA 1OSYA 5T1DL 1Q0YL 2QSQA 5D1ZC 3VFOB 2DQHH 4EJ1C 4HBCL 2HT3C 1Q8MA 2R2BB 2OZ4L 1I9RL 4P4RA 3U46B 4QO1B 5AD0B 2COVD 4Z1PA 1KPUB 3PIQA 5HGBA 2CM6A 4F8LA 4KZCA 2B8OT 2AJ3B 1JS4A 3NA9L 1YRKA 1FZJB 1JNHA 3HR5A 5B4MD 1FJ1A 4G8FA 1U8JA 1FH2A 1WUZA 2WLZA 3BP6B 5E6YA 2J1WA 3BI9X 1ZVSB 3DOIA 3PU7A 3S5ZA 4X99B 4BBWA 4QRFA 5KSAA 4KX7A 3F7YA 3U4BL 1XZWA 2B1OA 3UYPB 4HZAA 5BMFH 4G8IB 3X13A 3KGSA 3UYPA 2X9WA 4JJ5B 4LPXA 3ETBJ 4PREB 1CR9L 5A2IH 1LO0L 1VFAA 3FTVA 1PCSA 5I8CB 3ULVC 1QG3A 2A6KB 2YWYA 4YGAB 5FM8A 4XRCB 5JQ6L 2HLFD 3Q7JA 4LIQE 5EU3A 1FZMA 5B1AB 1AZBA 1N6VA 2FEDD 4MQ7B 4HWUA 1G9NC 2FX7L 3NH7H 4WTWA 4QNPE 3HE6A 3I50H 4FERA 3RWFB 1KENH 2VXTH 4OV5B 3OHMB 4M6OL 2R4SL 1UM4H 2FGWH 4W81A 4DGIL 2HP4A 4B9JA 4EE2A 2WLLA 3MI6A 4I0PB 3CZSA 4XN1A 1JWUA 4RGMB 1VAHA 4XCFH 2KI6A 3KCPA 5AVRB 1I8UA 2VDMH 4DIXA 1I1FA 4NI3A 2OSYA 2QVIA 3INOA 2CG9X 4RA3A 3OLIA 3B6SA 3WJMA 1Z32X 2XT1B 5F9WC 4ZOBA 4ZD3L 5E6UB 1JZ6A 5DHEA 4MJHA 4PN6A 4X8GA 2BRQA 1JNLH 2VLRA 5E9DB 4PBVC 4L18A 2PPAA 2RMNA 4OU3A 5JQHC 1HJBC 4HAGA 4HJ0C 3W57A 5KYYA 3OF6A 2IWFA 3QCVH 2NSMA 4QHLA 4ZMZA 1DQTA 4HC1H 1Z2KA 1S7QB 4LOEA 2Q20A 1MCJA 3D1MC 1ETZA 1LJMA 4HGWA 2G30A 3STLA 3FO9B 3QWRA 3VTAA 4ZUWA 5JW3L 5F7MC 3VGAC 4XAWL 3CGTA 1E7VA 1E65A 2QQLH 4HXAL 3SY6A 3MXWL 5EG6C 3GBLA 2A74A 2EYTA 1SHMA 2YRBA 1V27A 3QUGA 5T3ZD 5DGQA 2DKMA 4ZUUA 1WIUA 4CC4A 3CPUA 3HRPA 4G83A 4G71B 3VRLE 4JFEB 3VRJA 5HYSG 4DETA 3MGTB 3TIDA 4HF5H 3I6KB 5AAMC 2EIBA 2HJLB 4W68A 1OOWA 4JREC 1U8CB 4GAJL 4AE0A 3L1FA 2H8PB 3GBEA 1RJZB 5EH1A 4OZ4B 3THMH 1BVNT 3GXUB 3BW9B 3JUYA 2N56A 1KDJA 1PIFA 3AG4B 4NWTL 3BKYH 3QISA 4Y16A 1VPOL 2HFGL 3BLPX 5KVGE 1TENA 2CKNA 4WEMB 3RWHA 3S37L 4ZW8A 2IAMC 3TBTB 3OX8A 2ZJSL 5CJQH 4U31A 3GSUB 4ZSOE 4LLMB 2XOTA 4LOFA 3V7AE 3Q13A 3NIDF 3KL5A 3RI5F 3SDXB 3VD9A 3I3BA 2ENSA 2YAMA 4BFBD 3MO1A 4P5TC 3U0PA 4R4BB 4ZMTA 3EDJA 1BLNB 1MNNA 3RWCB 1PFOA 3MOAH 5BCAA 2WUCH 4C56A 2QKIC 1RFDL 5L2KD 4QXGL 2ARJA 4FJZA 2JIXB 1U8IB 5JW4Q 4P3WA 1UH4A 3N43B 3KAAA 2NY4D 3HCVB 2V17H 3WTXA 3ZW3A 1J10A 2HA1A 2Y7LA 3Q9QA 3FHAA 4AITA 1Q0XH 1GC1L 3DX6A 1CUOA 2R15A 2DWDA 3DNKA 3IGAA 4JE0A 4BUHA 4D8OA 2EYSB 4E41D 3LRKA 2DLEA 4F33A 2A6IA 1KJ2A 5TDNA 1BM3L 2VXVL 2CJTA 1QLRA 2J20A 2W9DL 1PLBA 2VLRE 3ESMA 2R1WB 4DZBB 5BS0B 3V0EA 2HLEB 5EFIA 1PW3A 5ICXB 1EAOA 1GIGL 3QA3B 1SFHA 4PJDE 4ZUSB 4DVBA 1H5BC 3GJFB 3VFUA 2Z3FA 3R18A 2DQTH 4LZKA 4ZI8A 2H0PA 4DZ8A 3DX9B 2IQ9H 2VDOB 1SM3L 1UM5H 4MA7L 1J1PL 4GT0A 5DJAA 2JKXA 5TGBA 3PE9A 2JJSC 1B0RA 3IKKA 2QVTA 1EDYA 3MCG1 2MCPL 1KGWA 3PDGA 5B7MA 2ZXWB 2VDRH 2DLHA 2M8XA 1NEZA 3T0BA 5JYLA 4FHBD 3MNWA 3WFEH 1TR7A 1WFMA 1MDTA 2M26A 4XN8A 3VH8G 4HH8A 2KZBA 1AYRA 3V4PA 2PPEA 3MV7A 4XCEB 5D70H 1OLZA 3FFDB 3MN8A 2VQUA 5LAXB 4Y19A 4LPVA 4MYWB 3L9BA 4X6CE 3NIGB 2VLLA 4JHBA 4LL4A 4QYOB 1DLHA 1UB6A 5GGVY 2EE6A 1JZ2A 2FGWL 3DGGB 1DBBH 3KM1A 1KGIA 5HHOB 3NEXA 1MCCA 1NOAA 2K6ZA 4B9KC 2X89A 2QHRH 1AHKA 3DIDA 4MMXC 1QBML 3MX0B 3CHOA 4M9PA 3C6LB 3TZVB 4NENB 5IG7B 3IVKA 3TJEH 1KEMH 5DSCB 2ZUVA 1I85A 1UH3A 2B4CL 2J4WH 2YEZA 3K4DA 4JQIL 3K0YA 4JVWA 4PSPA 1JPFA 2Y7QA 3BVXA 2WQAA 4FJ6A 5E6IB 3FH5A 1W2KT 2ZCHL 1TTBA 2P47B 4O5LL 3I50L 3QCVL 5T3ZH 2ZUXA 2O93L 1QTYT 4PGCA 4HK0B 1YEFL 1NQBA 3UAJA 1OCWL 2DQJL 2P5EA 1KULA 4X7SL 1SQMA 3O6FB 5ERWB 1MF2H 1MY5A 2DWSA 2FQGA 1CGTA 3DI2B 3FQWB 3EYOB 4IDLA 3J8F7 4KI5C 1AI1L 5LHDA 1IJNA 1Y6KR 4BSWA 1EH9A 3CZGA 4UTAA 2V2WA 3VXMA 4D8PB 5IROC 1UTDA 2TAAA 2FHFA 1G7PB 4R97C 1WBXB 2GUOA 4H26B 1AR1B 4YHKL 3KDMB 1EZSA 1M7IA 2DJMA 5HDQL 3O9WC 4WWKC 4AM0Q 2WJ5A 5IKCB 1RZGB 1UADC 3QXVA 4KK6C 1GMEA 4LEXL 3CFBB 3KLDA 1JHKL 1YMME 1OP4A 2OSLB 3QEHA 3LV3A 2QR0B 4P2YA 3O3DA 4UAOB 2Z35B 3OZLA 4P3DB 4DPBX 4HS6B 2HB0A 3FK3A 2PXYC 1N8ZB 2ZCKL 4MDIA 3D50A 1R5WB 1UOKA 2WVVB 3BWUC 3NIFE 4IOIB 4U2YA 5K1NA 1UJ3C 3DI3B 1T5XA 4YHMH 5DFVD 5T1LD 3WS6A 3CVHA 2NUPB 3Q5YA 4S1RL 5AW3B 1N26A 1TJMA 2BNRA 2W5PA 1REIA 3VNZA 2E4TA 4MKTA 3D9AL 2BDNH 4DTGH 3MRQB 5IK3A 3HS0A 1U8HA 3R4DA 2MHAA 1IM3B 1JHTB 3ZT6A 4HU2A 3NJXA 2A38A 4H8WC 2FL5B 3ARVA 4MS8D 4OQ1A 4ZOEA 1BQSA 2FH8A 5LVEA 2NXYB 2VL5B 5EOCL 1YQ2A 3OKKA 1IEBA 5E8PB 1OM3L 3T1FA 1O9VA 2APVA 3ZHFA 1EEQA 5J13B 3L3KB 3MBWA 5F97E 3ARQA 3H9SA 1S7VA 1IBGL 1YYLH 4MMZA 4BQBA 3EGXA 3RA7H 1NUNB 5DMYA 5C6TL 4FG4A 5HHQB 2YD2A 4GBXD 2GQHA 2NY1B 2XVKA 3CSYB 3BAWA 4C83A 4M7JH 1ORQA 3QDJE 2WZPD 3DDGA 4HLZG 1BAGA 4HKBB 1NGXB 2CUHA 4L8DA 4HK0A 3EJUA 4ZTEA 1X9RA 1KFAL 1IIIA 4R9HA 2AQSA 5EZJA 2F74B 1VB9A 5JW4N 4PJ7E 2C7UB 1USZA 5EC1B 3ZY7A 4EZLA 5C0DA 3SGJC 1CDIA 1QEXA 1ZXQA 4UMSA 2ZX7A 4F7PB 3QJFA 5IQNA 3ME0A 1MAJA 4TPRH 1Q9OA 3FTSA 4G6FD 3TL5A 4ZX4A 2A0LC 3KBEA 4GYBA 4ABQA 2BSSB 1F6AA 1I3UA 4LLVB 5CEZL 2ID5A 1Y18B 4W9DC 1B4RA 2P5WB 4XRCA 5TTRA 1H6FA 4PJGF 4GUPB 1QO3A 4X98A 3VUAA 5ADOH 3PWUB 1J1XH 2Y69B 3FRPA 1MN4A 4Y1TA 4OY9A 1T89C 4PSRA 3O4LA 3RFZB 5EIVA 4M61A 4HG4K 4DKFL 3HRZC 2Y2YA 2Z6FA 7PAZA 2H32A 4UZSA 2WXIA 4HZLB 3FQ4A 5TQ0L 5M7QA 1T6VN 3MRKA 2XWCA 1BP3B 1X7SA 3WHE1 4PJIA 3HB3B 3VSUA 4DGYH 3OKOB 1IC7H 1Y1DA 4YZWA 4YR6B 3ILQC 4DKEH 1KYDA 1K4CB 4KKCD 4LPTA 3QRLA 2RGSA 4PLJD 1AZCA 4YVNA 1WLHA 2AEOA 4WI0B 3MRIB 3WS3A 3WY4A 2VKXA 1T03H 2HVJA 1JPST 5D7HA 2X10A 2XV2A 1IGMH 1KIRB 1YNKH 2E6QA 1AIFA 3KEHA 3OAZK 3U4EA 4AZUA 1CL7L 3QA3A 2CHWA 4J3OH 1OTUD 1HZLA 2Q6WB 2J3SA 2P8PA 4P9HC 4XC1H 1E5UI 1YEEL 2ILLA 5FYKD 4XNXL 5H4ZA 3P3RA 1SNRA 1ZS8A 2ZOLA 1MHCB 3LZLA 5BVJA 4OB5H 4FQIH 1RZJH 4B9ZA 1KJ2L 2CPUA 1BMGA 4E0RA 1ROWA 4DN3L 4YUEH 3ZPDA 5L6YL 1IM9B 1U9KA 1ICTA 3KLAB 5BRPA 4PVBA 4XTRD 1K5NA 1SOXA 1WAAF 1DANT 2EICA 1H6UA 1L6XA 3QP3A 4B41A 5DK0A 1INDH 4ZMPA 3IJEB 1P5UC 1JZ7A 1SDDA 5C0NC 5I1DA 4O51B 4Y7OC <