4J3OG

Crystal structure of the fimd usher traversed by the pilus tip complex assembly composed of fimc:fimf:fimg:fimh
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
144
Chain Sequence
b'ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimG
publication title Structural and energetic basis of folded-protein transport by the FimD usher.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion/chaperone/membrane protein
total genus 16
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oG00
4AVKA 4AVJA 4J3OH 4XOBA 5IQNA 4AVIA 4XOCA 2XG5B 3MCYA 3ZPDA 4AV0A 4AVHA 5AALA 4J3OF 3JWNG 4X5QA 5LNGA 3BWUF 4CA4A 4AV5A 2WMPB 3ZL2A 1UWFA 1N12A 1KLFB 5F3FA 4AUYA 2JMRA 3BFQG 3BFWA 4AUUA 3JWNH 3RFZA 1TR7A 5FS5A 5AB1A 2J2ZB 4BUQA 4LOVA 1QUNB 5AAPA 4CSTA 2W07B 4XOEA 4XODA 5ABZA 5JQIB 1KIUB 1PDKB 2XG4B 3JWNE 5LNEA 4X5RA 3ZL1A 4X5PA 5FLUA 4XO9A 1ZE3H 5F2FA 2JTYA 4AUJA 5CGBA 4CSSA 4AV4A 4ATTA 3ME0B 2UY6B 2VCOA 5IQMA 4X50A 4J3OG 3SQBB 2UY7B 5FWRA 1N0LB 4XO8A 5IQOA 4XOAA 5FX3A
chains in the Genus database with same CATH superfamily
1LWHA 2NTSP 2R51A 3O3DA 4LCCC 5AWNH 5D7LA 1UYWH 1A7PL 5IKCA 1G87A 3NIGF 1TJIH 2C7UA 4RH4A 5K39B 1QQDB 1T1YB 2AFNA 2VDKH 2XYCA 1AHWC 1RUPH 5TDPA 1CFNA 4FQXA 2X4PB 4ODXB 3L8QA 2I07B 4DKEH 1NIFA 1BF5A 2YK1H 4UM9B 4X5QA 4G59C 1IKFL 3MJ9H 3QUGA 3VQMA 1A8JH 1DDHB 1OAZL 1U58B 3MA7B 4Q0XH 5E8EB 5A2BA 4ZAKA 3OAYH 4ZW6A 4Y9CA 2DYPA 5D1QA 4PJCF 3UFIA 2E9BA 4EDXA 3ARBD 4JM2B 3D2UA 1RZJH 4Z95H 1OGTA 5EU4A 1JN6B 2DQUL 1PVHA 1OPGH 5I0WA 2IV8A 1G7HA 4J8QA 4PLKC 3RFZA 4CVXA 4B0MM 2FX8H 3BLBA 2QT6A 5KBDA 1CN4A 3T0WA 1CGSL 4GBXD 3RUGB 2ZWNA 3P11H 1Z5LB 2X9YA 3CMOH 3G6AB 1ZAGA 2ED7A 5IIEB 3T0EA 3ES6B 1DE4A 3P9MB 4IOFD 5DEJA 2K8MA 1IKNA 2VXVH 4XODA 4AGLA 4XBMA 5F3BA 2J3SA 1UM4H 1OVZA 2BP8B 4QHLA 3RILA 3OZKA 2G3XA 2YAOA 1LEIA 4Y2NA 2ADFH 3U2SA 2GYSA 1VKXB 2ZE0A 2JKWA 1FAKT 1TLMA 5FO2A 5IB3A 4AH2A 1H15B 1OTTD 1RJZB 3IDNA 2ZF8A 4F7CA 3UAAA 3TEWA 5K1JA 1BQLL 4UT6H 2VTFA 3H6JA 5FYKL 3ZL1A 1GC1L 4Z7AA 3PGFH 2FHBA 4YGAB 1OAQH 1XB3A 2OJZL 4OGAD 3C8DA 2ADGB 3G3LA 1OCZB 4QJ3B 4EMZA 4JQIL 4KY2A 2FVNA 4MXWH 3IJHB 5KSUB 3CC1A 3FT4A 1VGEL 2IGTA 2VT0A 3KGTA 4RCAA 4DSYA 4YHLH 2ATKB 2E0PA 2DQHL 4U1JA 2FZ3A 5FFOA 5JLZA 1KJ3H 1WWCA 2GJZA 3MCG1 4TV3A 1W72A 5E00B 2WXPA 3SDXA 2BVQB 1WBYB 2ZX7A 2PTUA 3QP3A 1RUQH 3UPRA 1FO0H 2Z0UA 3D39D 4KHXH 4JNXA 3GSUB 3OHXC 4JL2A 1USZA 4M5YL 1AAJA 4F92B 1P4IH 4RBPK 4H40A 2VUOA 5HGDA 2PXYB 4LHUA 2WMPA 4IRSC 2QL1A 3LS4L 2JJVA 4MQTB 3M17B 1LE5A 3KJ6L 4P5TA 2DQIL 4Y5YA 2G3NA 3S35X 2VO5A 1I9JH 4EI5D 1M4KA 4YFLI 4A6YB 1GPOL 2ENYA 3F58L 1HYSD 3QDAA 4IIZA 4ADIA 2JV6A 2ZWKA 4FZ8H 4DEUA 3PWUB 3OF6A 3D25A 3HE7A 3H0TA 1CR9H 1UH2A 2H9GA 1N7MH 4YDLC 3X3FH 1DL7L 2NY3D 4KVPA 5LHDA 1NAMB 5E6IA 1HK6A 4MD5B 4QRUA 2K9UA 4E5XG 4JG1L 1RJLA 5DF0A 1KENH 1U8JA 4QRRD 5E6SB 1ZLEA 1WZ1H 5KVEH 3POCA 2HFEA 4QRTA 4L1BA 3STLA 1NBZA 3CZGA 3HS9A 1QWUA 3B9KC 2BWQA 4FFVD 1IM3D 4NQXB 5H94A 43CAB 4AQ8C 3J7HA 4PJ8C 2VISB 2EIKB 3VGAC 4O9HH 5GZND 3IGAB 1XD0A 5SWSE 1NDTA 3SPCA 4YQXL 3SQBA 1IGML 1FNSL 1URLA 3QCTH 2HT4D 2IQ9L 4YXHL 5I0XA 5CFHA 1DZBA 1H0DA 2I25N 1M7XA 2JJTC 2QQNL 4HC1H 4LAQH 4O02L 1SDYA 5BVPH 1ADQL 3N1PC 1XH2A 2O6CA 1TPXC 3GJFH 4OSUH 5IQLA 5FB8B 3OM3B 3RYMA 1HILA 2W88A 2CGZA 1FNLA 3D8MA 1DSWA 2A74C 4N2IA 5DHDA 4KJQD 4WWOA 5T3ZL 4G7QB 4W4NA 4NAJA 3GLZA 4L8BA 2AGJH 4G42A 4LFHD 3C5ZB 4PREA 1YHPA 5T1KB 1CYWA 3RJQB 2MQ3A 1T22B 2DYSB 5ACMA 1CFSA 5F88A 4HUVB 1I7RA 4LF3B 4XNZB 4KFZC 1NTDA 1L5GB 3KPOA 2EIZA 1G9MH 3AAZA 2CALA 5AW1B 4YMPA 5D2LF 1IQDB 2JLLA 5HGAB 5JXEC 2I7SA 1R0AH 5GISL 2NR6A 3D07A 3O3BA 1C08B 1IGJA 3LS5L 2DIJA 3N85H 3CZFA 1NGXA 2WIIA 3O45B 1DBMH 3C6EA 4HS6B 4ELKB 1CF8L 4H8WH 4M5SA 1E0OB 2V7HB 1CFQB 4J12A 4J4PA 1BQHB 3VSVA 4OZIF 1A1MA 2ROYA 5F7LB 5A2AA 4GNKB 1T6BX 1V3MA 3OKLB 3SB3A 5I8KH 1JZ3A 3UO1L 2GABA 1U3NA 3S4SG 3MLPA 2KHAA 4ZPVB 5SWSB 4E9TA 5KSBE 1I8LC 1NBQA 4HUXA 4PTTB 3BH9A 3ARDC 3QUKA 2OPCA 3S88L 2LU7A 1Q94A 2YPKB 3AXIA 1YG9A 4YIQA 1ZTXL 2PR4L 1IKOP 4NKIL 3ZYZA 4LE8A 2AKRB 2APTA 1G6RL 3R06B 2PP9A 4G80B 1OO2A 5HHVH 1NLBH 2VZ1A 3D48R 1C7SA 2JXMB 3LQAC 5ICZB 1QBAA 3PGCB 3I3EA 1KGYE 4YDNA 4BWTA 2X53A 3GRWA 1E27A 1K8IB 4OVVA 4TVUA 2JKSA 2P7TB 1BD2D 2B5IC 5IT2L 3SE3C 2BMKA 3NIFF 2R56L 5DO2D 4OCRH 1GAFH 4M61B 4AEIH 1WCBA 4YS4A 2P5PA 3DPBA 2KZKA 3EO9H 2XTJE 1T80A 5IFJB 1YEEL 4K3DL 1KXTA 2XRAL 4KTDH 3OAZK 5HI3D 5FYKU 1T66D 1Z5HA 2FE0A 5EU3A 4OFQA 4WNQA 5AOZA 1BFOB 3IDMA 4LEOB 4UZSA 2O93L 4X4XB 4H0GA 3SPJA 2G2RB 1BPLB 2Q86B 1P84K 4S1SL 4XRCB 4KRMB 1AFVL 2CO7B 2PR9A 2J8UA 4NXKA 3HG5A 2GG1A 1DLHB 2Q87A 4FYQA 4I2XE 1SQMA 1OCRB 1RULL 3KYNA 1RZ8B 2QR0B 4OZFA 4DUVA 4WK0B 5KSBB 4LLMA 3GPSA 1KN2H 3B9DA 2OV0A 1K5NB 3F6JA 1FIGL 2BSCA 4LLAA 4Y4HB 3KDPB 4FQ2L 1AH1A 1FNHA 4NHUA 1R17A 2HB0A 3SGJA 4PG2A 3QHTC 5B3NA 2UY7A 2WAHA 2ZKXA 5ERWB 1SDDA 2D7QA 2KUTA 4N28A 4TL4A 3HLKA 5GGUA 1F5WA 4JKKA 4MD4A 4WSGA 3RWEA 4ZMPA 2WKLA 4MGXA 2HJLB 1RZ7H 3TIDA 3KJ4C 5D7IA 3PWNB 3RNQB 3WEAA 2CDGA 3VYNA 3BYYA 4K0OA 1GS7A 2KT6A 4QHMB 3SGDI 4TVPL 3QI9D 1PY4A 2WQSA 4IJ3B 5I73C 1ACZA 3TO4A 3Q01A 3BJLA 3BZ4A 43C9A 3L4TA 3ZKQD 5KUKA 2BNRD 1ZHNB 2XTJB 2F7QA 3L9YA 4M1CD 1NCBH 5FFGA 5KSAD 2ZYSA 1MFEH 4KMTH 3QR0A 4QRSB 3DIFA 4RGMB 3WTVA 1QLEL 2ENPA 3N40P 2GSIB 5I71B 2Y36H 1A4KB 4DPRA 1DFBH 3MTXA 12E8H 3H2WA 1ESOA 5BVJA 1RUMH 4M4RB 3RE0A 3U48A 4TMPA 3L3DA 2VDNL 4CN4A 5FHAH 3SOBH 3TEUA 1T0NA 4FYSA 4X6BB 1MAMH 1N4XL 1AGFA 2VRQA 2X1PA 1B9ZA 5LXGL 2OZNA 2D0FA 5HD8D 1YSOA 3MX0B 3VNZA 4ZTPL 5LGKA 1ACCA 5E2WL 2WZ6A 3DSFL 2OSWA 3OPZH 1Q4NX 1JF5A 1RZFH 1RURH 3CFQA 2A9CA 3ZL2A 3KXFE 4JO2L 3H6AA 2CBPA 4OQTL 5C08A 1I9EA 2UVEA 3D06A 3MA9L 4FFZH 4G82A 4EN3C 1XZWA 1HAUA 3VE0B 3IK2A 1BQRA 1MHHB 5DK2A 4ACTA 4B3EA 1T04A 4EIBA 1TO5A 2J2ZB 2BIOA 1L7TL 4L3ED 9PCYA 4KKZA 3W81A 5DQ9A 2HRLA 2XZQH 3S97C 1S3KL 2NTFB 4K9EL 2Y5QA 3KPMA 1MLCB 5DLLA 2QDWA 3HR5B 4G8EA 5T5NF 4C83A 3BIBX 2ERJB 5F7FA 1JV2A 2Q0ZX 4HCRH 1GC1C 4BCXA 1N6UA 4AQEB 2AJSL 4PW3A 1P4LB 2MCG1 3MRHB 2X12A 1QZ1A 1IGTB 4MX7A 4P5MA 3ZE2E 3W39B 4A55A 1EDQA 1YC7A 5JDSA 5A16A 1HXYB 3SYCA 4L9LA 4PMEA 1S9VB 1CD1B 1FQ9C 1BMGA 2AJ3B 4XCYB 1NFIA 4LLQA 2J1KA 1UB5A 5LWYH 4YFDB 3SQOH 2ZXGA 1FFQA 4Q9RL 4JFDB 1B4TA 2AXWA 3AT9A 5FLUA 3VU1A 2JB6B 4OF6A 3TBWB 1QSFE 1MWAB 2J1WA 1SJHB 2XPGA 5ESVA 2F61A 2Y2TA 4EUPB 3D2TA 4MAUH 2WQWA 1PCXA 4PAZA 4UNUA 5HSFA 3ESUF 2X4RA 3FQNB 2XSKA 1IJ9A 1S7RA 2PNDA 3BQVA 3MUGA 3BPOC 3SN6N 3QRLA 4D2NA 4TUKH 5HYSA 2EVFA 2Z31C 3TWYA 3WKML 1DQTA 3HI6L 3KNBA 3UG4A 5FKPB 3KLDA 2CDFA 4HAFA 1FGNL 1DVFB 3RGVB 3HN3A 3TWCH 4XX1G 1C12B 3P2BA 5TE7H 4FNQA 2VL4A 4TOYL 3X1BA 2ICWA 5EFIA 1ONQB 2Y5TA 3VYOA 4B3VA 2NZIA 3CH1B 2AK4D 2UXVA 4HFWB 4R4BA 4V1DA 1HE7A 4XVTH 3B9EA 1E90A 1HZLA 5CUSH 5D1ZC 5DZLA 4ZZFA 5FGBC 3AC0A 4X7SH 5HYQB 5BV7H 2PW1A 4UAOC 5HVWA 1CB4A 3ZKXB 4P5TD 2J5LB 1B0GB 3LPFA 3ELQA 5EZLA 1K9TA 3JTTB 4KDTC 2BNUB 3V9EA 1LO4H 3ZE2B 2XXGA 1AHKA 4GY4A 2R2CA 4X80L 1XR8B 2XVBA 4JDZA 1J5OH 4AM0B 4PGEA 5DVOA 5SWZA 2AVFA 4W9IC 4WK2B 3TVMA 4BZ1A 5PAZA 4UDTB 3BKCL 4JGJA 4HIJB 3OLEA 1WWWX 5JO5B 1MDAA 1HAWA 2Y7QA 5LAXB 3VXQB 1GSMA 1GIGL 1QW9A 3ZXAC 1JWSA 3F8UB 1NAMH 2BNQE 2DQCL 3D85B 3FQRA 4LK4A 4NOBA 2FJUB 2ZKHL 4L4VB 3BWAB 1BXXA 2G0KA 2E7BA 3R19A 1AIFA 2OMTA 1A2YB 3T5WA 4EIZC 1IFHL 4YR6A 2HN7B 2J4WL 4CN1A 3NZ8A 4DZBB 1YUHB 4NQTA 3FQUB 4TLKA 2C4FU 2K6YA 2GBAA 3T2LA 3MODL 4OZ4A 3VXTB 1LGVA 4BYHA 4ERSH 1P9MC 3CZEA 4AIZA 2YPLA 3JXAA 3FYIB 2BOBA 3WTYA 1QRNA 2JCCF 2RA1A 4O51A 4F7PB 2QQLL 4PM1A 1BBDH 1JZ2A 2GTQA 4YO0B 1N64H 2N7BA 3T2NL 4WFGD 5B8CA 5C9JA 2MKWA 1A1NB 1OZUA 4IRSD 1OTSC 2WIMA 4R97C 5DO8A 4GO8A 1E7UA 4FQHB 1SYSA 2VDOL 3EFOA 1HZHL 5B7FA 4R6UA 1NDMA 5J6SA 4Q89A 1EHAA 1V3JA 1N0LA 1P7BA 2FB4L 1NCWL 2G3ZA 4JFSA 4JY5L 5LN8A 3HW7A 1YY8A 3VFVB 4OGZA 1GGCH 4QTHB 5IMMB 2GITB 4TUOA 4KJYA 4BRVA 4FXKA 2AABL 2AEIT 1O7DC 5DRZB 1WUZA 2UYLA 1HI6B 3FTGA 2PP7A 1SYVB 2V2XA 3FQWA 4OJCA 5GS2D 1HSBA 5DUJA 4XCNA 3SDYL 1KCWA 3PHOB 3HG0A 4UTAL 3FN3A 5DJ0B 2FX7H 2BRRH 1LO2L 4F7TB 1B6UA 2DOCA 4P9MH 1KTLB 3ILDA 2DEYX 4GI8A 3ZJAA 4WW1A 3B9KD 3P77B 2CJTA 4MKTA 2CHDA 4PJ8D 3T0BA 3QEQA 1RIVL 4X4ZA 3MLVL 1RSYA 4LXFA 4JG9A 2X1QA 1OAYL 1BM7A 1T2QL 2NNXA 4J3OH 1J0KA 1YJDL 4XVSL 3HNTL 2CGYA 1AC0A 3EOBB 3O3AA 4OCLC 4JHUA 1ET5A 5EO1B 1RPUA 5CJQH 4UT7H 1YNTB 2Q76A 4LCIL 7PAZA 2VSMB 5BNXD 1K4CA 1SY6L 1GXEA 1Y07A 2EICA 2EE2A 1IGIH 5IQ9B 2GI7A 1FVDB 3BZEA 3CZNA 1R5VB 4NNXA 4HALA 1B3JA 3IJSB 1KLUB 3WS3B 3RVWC 2ITFA 5IZ7A 2YXWA 3THMH 3PQYE 3KW7A 3OR6A 3WKYA 3CU7A 4M6AA 4EQ2A 4OKDA 1CTMA 3HMWL 4Z5RB 2K7QA 3VXPB 5K9OB 2ZG2A 1RK0A 5ITFA 1HIMH 3MVSA 3N1GC 4MJ4A 1A7BA 1DBBL 4N1CA 5JXED 1QWNA 3OSVA 1F6AA 3QVAA 4ZQKB 5B22A 1ZV9A 5E0QA 3WENA 5D1XE 1WFTA 4YWGL 1B88A 1JZHA 2AQ2A 1DQKA 2QLYA 2VN7A 3TV3L 5BW7A 2BSRA 5DD6B 5C0CA 3I3DA 3IFNL 5IF0B 2Y72A 1OY3B 4BZYA 4PJFA 2ESVE 4NKDA 1J05A 5H37A 2WXLA 2X28A 3ZYOA 5IMOB 4JHAL 3LKQB 4XZUA 3NK3A 5I15L 4Z7NF 2OL3L 4AC2A 3G6JF 2X4OB 1FF5A 3CVCA 5ALCH 2R2HB 5CEZD 2WXGA 5E1IA 3ARDD 3KEHA 2F5BH 1LO5A 2J6EL 1BREA 2OMWA 3DK2A 1RZKH 1PLBA 5AQ0A 4NRYB 3EF4A 4MDRA 2IADB 2Q7AA 1MCPH 3FHAA 4PJBF 2HKHH 2R1XB 3RPBA 2DIBA 1VERA 3EXJA 5F0JB 4LSQH 3P4MB 3X1NA 1X6NA 4O2FA 5ADOH 3QFJA 1KJMB 3HE6D 4HIQA 5KN5B 3MREA 3PQYB 4XVUC 1JGVL 4Z7WF 2FH8A 4G8GA 4A7SA 1NGWA 1OP5K 1LILA 2G60L 4WWNA 5HGBA 2QV2A 3T71A 2WLIA 5FW7A 5D93B 4P2RA 5CEXB 3V0IA 1WC7B 2KPWA 4M3KB 2CRYA 3CN0A 1A1OA 5FO9B 3ZDXE 5FHBH 3UTTE 1S2EA 5DUBA 5EOQL 5D1XB 3KDMB 5CCKH 2V5TA 4FQCH 4P3CL 3CVDA 1PLCA 3V9FA 2O5XH 2DRUA 3LZQA 4HXBH 5JYMA 2NQDA 3CFEA 2CCWA 1Z9SB 2XKNB 3VAEA 4ZX5A 1F11B 4ONHA 1DQVA 4HKJA 1VGKB 5BRZB 1A3RL 3VXRE 3PREA 1PKQB 2FIKA 5ESQB 3ATDA 2AV1B 4EAEA 3AU1B 3W9EB 1NUNB 1ZSDB 4ZI8A 3SY0B 3ZHKA 2XZCL 3REWA 3FUNA 3KPRE 4P23A 4MKMA 4N0UA 4DN4H 2JB5L 3S5ZA 2HTKC 2FWOA 1NA8A 5CINH 5K59F 3C6LB 2WQXA 2DDQL 4JN1L 4JO8A 1KEGL 3AQDA 1IAIH 2GCYB 1JFQL 2G75B 3VI4A 1GZHA 2NX5A 1VEPA 1GGBH 4BK8A 2YUWA 1NC2B 3DX8A 2R29L 3KYKL 4JQVA 4QF1A 2HRGA 1PZ5A 4G43A 4R3SB 5TK4A 3DJSA 3V4VA 4JO4L 3UC0L 5DUML 3WYRA 2BWDA 4GIPD 4ZOEA 1NMBL 3HG1D 3MLXL 3TZVC 3AG3B 4EIUA 2IV9A 4XN4A 3P2TA 1R3JB 3IJYB 5LNDA 1V7ML 4S2SA 4GAAA 4PJ7A 3TA3C 1LDPH 1EO8H 3IU3A 4D8PA 4MSWA 2ZYRA 5IB5A 4WI8A 1IBBA 2ATPB 1VFUA 3AITA 3ZDXB 1NICA 3UTTB 2RFXA 2LOEA 3TF7C 4KX9A 4LAJH 5DC2A 5FEBA 3ECBA 2WOYA 3OB8A 4HU8A 4G9FB 4YXLL 5L2JA 1HVXA 3RHWF 4XP5H 5IHWA 4U31A 1FZKA 1HEZB 3LB6C 4GMSH 5FF6B 2WWKO 3CVHB 5T8IA 3MV8B 5LO7A 3VXRB 4JFQA 2FEDC 1EEZB 3LKNA 1EDHA 5D70H 1JZ8A 1FYTD 3DURB 4F7MA 1DJGA 4LGRB 3BHBA 1MAJA 3QQDA 1CGUA 2GFBA 3KPRB 5D5MF 4NFBA 1BFVH 1J8HD 2IIJA 2GPZA 3QIUD 3MAWA 2HH0H 1FFPB 4DP7X 4B9IA 4ETYA 4XMLL 1MELA 4S1QL 4XNUH 5IHUH 5IVOA 4YXKL 1MWAH 4RZCB 2XWDA 3O4LE 4EUPH 2YPVH 3OLGA 2EE3A 1LP9A 4HWZB 4MXQD 1ACYH 2AJYL 1QFWH 1IC7L 4K3JL 2HG5A 1I8IB 2Y7NA 1I1RA 5LN4A 3VI3A 1KTCA 5L6YL 5FX3A 1F6LL 4QAMB 5CJOL 3O6KL 1J9RA 4GI6A 2OCFD 4KH2A 3H4HA 3QEUA 4N2BA 3QULB 1NL0L 4N90E 3RWFB 1QR4A 4I9XA 4AYFB 1JPST 1MHCA 2NDGA 1NPJA 1I8KA 1KGXA 2UXGA 5DI8A 3QCUH 3MMEA 4I77L 1YECH 5F9OH 4V1DD 1OOAA 4JCLA 5FYKD 2R2BB 2HFFB 2RCSL 4D9RE 1PF3A 1REIA 4L5FH 2ROXA 1M2VA 4NZUH 4WNJA 3UYRH 1LQSR 2YAQA 2W9EL 1NFDF 2VN3A 3C60A 3FSVA 3ZHDA 5K9KA 1E3ZA 2XPZA 3VACA 1U3HC 1V7NL 4HFUL 3Q8CA 5D4JA 5JTWA 4ZW7A 3NJMA 2PW2B 3O41A 4Y8DC 1UENA 3I02B 1HDMA 4N24A 1E4KC 1J8KA 3FB5A 4OY9A 3I9AA 2VMJA 1SEBB 4PP1C 2VH5H 2VITB 1OW0A 2VDLH 5HGHA 3V6FA 2EVJA 1JXFA 4JE4B 3PS6A 5JHMA 2E3VA 3KZ8A 3SKNA 3MLWH 5TPWL 3QEGL 4WO0A 2MQGA 2OMNA 3JV6B 4GP8B 3GGWA 1F3JA 3EFDH 4OJAA 4QXGL 1MCSA 1JXGA 1CDYA 3O4LB 4FEMA 5K1NA 35C8L 1I7UA 5JIKA 1P7KB 2ZP8A 4PQXA 4PTUA 5D6CA 3K80A 5DD5L 4JO1L 3BX7C 4ZTEA 2HJFB 3IBOA 4KZCA 3WN5C 1T21B 2UWEA 3A6CL 1MFDL 2VDQB 2PO6B 3PU7A 3QJTB 1JMZA 4HJTA 4FMKA 5AZEH 4BQBA 5HYJD 3BSZL 5C2BL 1R1CA 1S6NA 2D31B 2IGFH 3ETTA 4NBXB 4KGLA 4WV1B 1RP9A 2K6ZA 4PR5A 3UTQB 4HEME 2E4TA 2WLMA 1EHLL 1KDJA 3WTTA 1HHGB 3P9WB 1KCRH 2ICEB 4G72B 5D1ZD 2D9QB 2YD7A 2QFPA 4L3FA 4KUZH 2DTSA 1DJHA 3GSWA 4MA3B 3H2PA 5C0DA 2VXUL 3U30C 1TXKA 3GXPA 1XL6A 3ZL4H 5LQBH 3LMJL 3WFCH 4OCWH 4QNPE 4HWBH 2JTYA 1M2OA 2OYKA 1U95A 1AD9A 5T5FH 1KCBA 3BO8B 1ROWA 2R4SL 1VLXA 1ZD6A 2VB5A 1S7QA 1I7ZA 3OAZH 1EZLA 3R1GH 4DFIA 4W4OC 1BOGA 3AXLB 1R3LA 1YAIA 4H88L 2VZ3A 3ZIYA 2WTRA 4PGBA 1C1EH 2J7LA 3EOAB 5KJ4A 3BVWA 2YR3A 3ZTNL 3US1A 4S1RH 1V5JA 4KK8C 2Q3AA 4HCGA 2MEJB 4XNYL 3ZTEA 4DFHA 3RDTB 3WJJC 4KC3B 1PX4A 2WLKA 5T3ZD 2XG5B 3IXAB 3LAFA 4FD0A 2FEEL 3KD4A 4GW1B 4B27A 4PCKA 1T2XA 4HWEL 1L9PA 4MWFA 2NY2B 2WLLA 4N8VA 2YUVA 5L7XH 3BP7B 4X4YB 2ZXBA 3C9NA 4LHQB 5FOJA 4KXCA 3N1MC 1JCKA 1P4UA 4G6ML 1BZDA 3PGDA 5BXFB 4KRPB 3GUTB 3B56A 4HUWB 4L4TE 1CU4H 4GXUN 2XV0A 2WHVA 3JWDL 2QFRA 1N2RA 4LP8A 1GH7A 2F5AH 4MQ7B 2LTQB 4PJDA 2V37A 4F57L 3D0VB 4ZXBC 2VL5A 1UJ3C 5EEYA 2KMWA 1XAKA 4BH8A 1KYUA 4PJ9B 3KBFA 4XN1A 1BECA 1B0WA 3DUSB 3QORD 2F53E 4HQQL 3BAJA 2QGDA 3NGBC 4HEPA 3VGFA 1X44A 5E24E 5E4AA 1D5IH 2GY5A 3FQYA 2EYRB 1WS7A 1MH5A 5MEQB 2Y1YA 3BXNA 3TGXA 4HK0B 3JYCA 5I0DA 2F54D 4XO5A 1F86A 4CSTA 5C0GB 4YBQC 5EIVA 4TRPH 3IJEB 2QHRH 2W91A 3FFCD 4NUJB 4YDZA 3BLPX 5E94B 1CG9B 1ZS8B 3MRMB 4XP9L 3E1F1 1IV8A 2Z64C 4AKPA 3MBEC 4NBYB 4Y2OB 4WHTB 5DC0A 5AL0A 2TAAA 2I60H 3GTNA 1G9NH 4OCYH 5DHYB 3WIHH 4MQXD 4UT7L 3MXWL 1BVKB 1UXSB 3ARRA 3BDXA 4KPHH 5IWLA 4LCYA 4WI0A 3K0WA 6PAZA 3VX1A 1TSRA 3MJ7B 4NQDA 4M43H 4HIPA 2G4EA 1M6OB 1I31A 4WJG3 5DHVA 5HJ3B 2YKLH 4DPCX 3ZHLA 4D9LH 5JPMB 1CBVL 5GRXG 5FYJL 4S11A 2B59A 2UX6A 3MJ6A 5JHLL 4PJAA 3QJRB 4LPUA 5DT1H 4KKNA 3VFNB 1TTFA 4X8JA 3WEBA 3RVVC 4HXAL 3DXAE 4WCYH 1AS7A 5C7XL 4LZKA 4NRZB 1AGBB 1E6JL 2ZF9A 3IEAA 3KYOB 4JRYE 4RFEB 4N2FA 2IH1B 2F53B 1A22B 3MFFA 4G6KH 2KKQA 2Z35A 5EC1A 3T2PA 4RFOL 4ZG1A 5IVXE 5JOPD 3LKRA 1MJJA 3F12B 2R8SL 1SLWA 2NDFA 2ZJSH 5AW2B 4NO0A 1N9PA 3ZDZF 2WCGA 5F71A 1TVDA 2F7PA 4YDIL 1AR1D 1KIRA 2NXYB 3BQUA 2CM6A 4MMXC 1Z9NA 4YVNA 3OKMA 3VO0A 1OTUD 2OULB 2ZTBA 3ARVA 3R0NA 5KYXB 1NSNH 1J1PL 2XZAL 5FKAA 1N8OE 1OPOA 4PGCA 3ZPDA 2FT8A 2ICWI 3L5JA 3QS3A 2M83A 5C0FA 2Q9OA 4IDJL 1QPPA 2E76C 4H1LH 1PGRB 5JXAH 2X3AA 2IBZY 3D4CA 4RAUA 3FONB 4OZGA 3T0XA 3ZY7A 3EYUL 2HFTA 1KYAA 4DAGL 4JZJB 4P4KD 5FA3B 4U1NB 2Z8VC 5EUKA 3U7WH 3NMEA 1MEXL 4V33A 2WZPD 3OJMB 1LL1A 4P23D 3GSXA 4I0PA 3ULUE 3TS8A 3U6XS 4TVPD 4YSEA 5HHOD 3X1FA 3BKML 5IHZA 3NIDE 1MFAH 4NN6C 5F7UA 5CZKA 4D9QD 5GS0H 3POHA 3AJ7A 5IUSA 5KS9A 2CHXA 3VG9C 4CC0A 2X09A 5F7AA 3V0VA 5DWPA 1BD2B 5KBNC 3AREB 3VD1A 2APBA 1JJUA 3O8XA 4M7LT 4AGQA 1U93A 3DXAB 4IBVA 1X3DA 4QHPA 4YVUA 4NO2A 3VD9A 4WKZB 4L1HA 3NFPB 2K3TA 3MJWA 4JRYB 4P46D 5ID0B 4ELMB 3HAEG 3KPLB 5E8NB 3OQRA 3MCKB 5JPNB 3ML9A 3WFEL 2EIEA 4HHGA 1PAZA 3L5HA 4P4RB 5IVXB 1JGLH 5GHWH 3QDJE 2BK8A 3FB6A 1JXKA 3FQXB 4K5LA 3SJVD 1AMXA 4UNVA 3MYJA 1SHXA 1O7VA 1Y0LB 4WFFD 4IGBB 2JIXB 4N9GA 3X14B 4AQ1C 1O9WA 4Y9EA 1M1XA 2DWDA 1KEMH 2K6WA 3N91A 4PY8I 1OOWA 4XXCA 4ZS7H 2VN4A 2ZSWA 3DGCR 3WUWB 2A6JA 3FRUB 4OLYH 2EIBA 1MI5A 1U8HA 3SBPA 1DQJB 1X5GA 5EN2B 2W0FA 1NC4A 4ZSOA 5HDWA 5HI4C 1UD3A 3NTCH 4LESA 1ZGLA 1QYGL 4UIMA 3CVHH 4OJYA 1R9FA 3LZFH 2MOVA 1JRHL 2YAMA 3SE9L 1QSZA 3ISRA 1MW3A 3QSKB 1NMCB 1P5VA 4IMKA 1IGYB 4UM8A 2F9BT 1I9IH 3D34A 1YQVH 4IRJD 1T1XA 1R34A 1YN6B 2CR3A 4H2CA 4MDJA 1UA6H 3GM8A 5D1QE 4IRZL 1F4XH 1KJVA 2GJ6E 3L45A 5GJSH 3SPVA 1YDPB 2R1WB 2ZOUA 4BBWA 3FUEA 1U8OB 4FTVD 5CEYB 3M7OA 3ATAA 3G5ZB 3VFGL 5FW8A 1ZS2A 1YPZF 1S3RA 1DQLH 3TZVD 5CKAA 4JFFE 5AWNL 1DJIA 4PJCA 4HJ1A 4HKXA 1JV5B 4L18A 1GOFA 25C8H 1FAIH 5F3HB 1TJIL 3T0EE 3TA3D 3APDA 5EO9B 5C6PB 2VDKL 4JGUA 3DV4A 1RUPL 4MJ5B 3HI1A 4JDEA 1E9QB 1BQ5A 4WNSA 2OZ4A 4P2QD 5IB2B 1QR1B 1MRCH 4DKEL 3GDCA 4PJXE 1U8MA 4L48A 5EBLB 4TQPA 5G4OA 3QJVB 2M26A 3CVIH 5I66B 1QPKA 3OKOB 3EYFB 1I8AA 1OF0A 3MJ9L 4X5XB 5H4ZA 1PFOA 1MQKH 4FG0A 4Q0XL 5GS3A 4ZNEA 4QCIA 1CLYL 4H0HB 4KHTH 5DYFA 2AXFA 3O3DB 4G2AA 4KI5D 5D7LB 5TDNA 4BD4A 2FEDD 5IKCB 1L9RA 4Z95L 1RZJL 1UGNA 2R9HC 3D18A 1BFSA 4FLQA 2FYYA 4JFHE 2C7UB 3HZKA 4KX8A 4YSSA 2GIXA 5TDPB 1OPGL 1WDAA 2X4UA 3AABA 1CFNB 2N1TE 4FQXB 3ZDYE 1VPOH 2BO0A 1URZA 2FX8L 3CSPA 4ODSH 4N3TA 1RK1A 1UCBL 4K5MA 3P11L 3CMOL 4OJFL 2ENSA 5FYJU 4ZAKB 4GSRA 4ENZA 3KHOA 3NZSA 5K1VA 5C2UB 4EZMA 4LPWA 2DYPB 5D1QB 3BUQA 1E4XL 2CK0H 2IAMA 4EDXB 5C0RH 1UM4L 1S7WA 3D2UB 1OGTB 5EU4B 4Q2ZA 3T6ZA 1UEYA 4U1MA 4MJID 5DRNA 4APQD 4WW2A 5KYWA 4K23H 1G7HB 3RFZB 2FBRA 1EANA 4CVXB 4U0RB 3WIFA 4NO3A 4WEUD 3PLYA 4Y5VC 3QNXA 4Z7VA 3LYRA 2APVA 4BFFA 4UYPA 4UT6L 3IWUA 3DUHA 3S3JA 3TA4D 2R0ZH 3PGFL 3T0EB 3U7YH 1DE4B 5FECA 2X70A 4U6VL 1OAQL 2RBLA 1SFDA 1RH8A 5F3BB 2AEQL 4Y4KA 2ZUTA 2NY4D 2YQ2A 4QHLB 4MXWL 1LEIB 3K0YA 2P49B 2D03H 3U2SB 4IOSA 2ENQA 3AY4A 5EH1A 4X4KA 4YHLL 4N8PA 5IB3B 4AH2B 3IDNB 4JFXA 1N18A 2ITDA 4F7CB 3B1TA 7FABH 1CD9B 2X7LA 3WAKA 1E30A 4OKVA 1ITCA 4P2OC 2ED8A 3F04A 1RUQL 4GAJH 4BFIA 1FO0L 4KHXL 5C09D 3ZDYB 1P4IL 3E2HC 2ADJA 1EGJL 3QXVA 3DSNA 1UZGA 4UTBA 4NZTH 1ZEAH 4U1JB 4E41A 2FZ3B 5JLZB 5DGRA 2GJZB 1W72B 3VWJD 3ZE0F 3JWDC 3SDXB 4BK5A 1L9OA 5AOIA 4UNIA 5ES4B 1U0QA 3UPRB 3K8KA 4FZ8L 1AHWA 5FUOL 4XP1L 4LMQI 3VXMD 3LJ3A 3BI9X 3RIKA 5E2JA 5JNYB 1CR9L 3MXVH 3X3FL 5LCVL 3QUHA 4OW6A 5HGDB 3SDCC 1XF1A 2WMPB 3DVFA 2AERT 4LHUB 4ODVH 5FDWA 4WIQA 5L0QC 1LE5B 5J56B 1KENL 4P5TB 4Y5YB 5E9DA 5FCUH 4BDVA 5KVEL 1P1ZA 4ANVA 5I0VA 2O61A 5F3FA 5AD0A 3UZQA 1WG3A 1S9YA 1OAKH 1T89C 4O9HL 3WNKA 3V6OA 4YDVA 1OP5H 1S78D 1J1XH 5J12B 4GW4A 1J7VR 3L4ZA 3D25B 3HE7B 3H0TB 4W9GC 2H9GB 1OD9A 2Y5EA 2B20A 4Z3GA 4LQ1A 5C1MB 3D6GA 4HC1L 4LAQL 2JKIS 5E6IB 3MDJA 2IMMA 2NRDA 1A3LH 2WQUA 4QRUB 4UAHA 5BVPL 5T3XE 3OC5A 3UTSA 3VQ2C 5IREA 1RJLB 1U8JB 1CXIA 1YEKL 4F3FA 2HFEB 4QRTB 3STLB 1PBYA 1NBZB 2IOIA 5H94B 2Y24A 3F7VB 1GYUA 4ZFOL 4AZ8A 5DJAA 1MIEH 3D5OF 3MCLL 4HKBA 4WDIA 3S8WA 1S8DA 2F7OA 2AGJL 1B0IA 2OA9A 3W37A 1GRWA 1ULVA 4DW2L 4FADA 3DI2B 2VIRA 1AANA 4TNWK 3BYTA 1UACL 2ZICA 1H0DB 2D7NA 3AROA 3OMNB 5BUGA 3KPSA 3K6SB 1HWHB 3UADA 4EE2A 2Z7UA 2F19H 4ORGA 1ETZA 1R0AL 2NY1C 2XWXA 1HILB 3V4PB 2VKWA 2CJSA 1TEGA 2IMNA 3N85L 3DX1A 2VLME 4OFYA 2EDBA 5KEZA 4L8BB 3FCUB 4G42B 3VXSD 4H8WL 4PREB 4NKMA 4KY1L 4KFMA 4ZXBD 4UQDA 1L7IH 3CHOA 1CFSB 2VLJD 5F88B 1I7RB 5DC4B 4GUCA 1E2VA 5I8KL 4KO5A 4TS6A 3KPOB 1MJ8H 2EIZB 5B38G 3AAZB 1IO4C 3IBEA 4NQCA 3FN0H 4PRIA 4EQ3A 3UTPE 1K3ZA 1YMMD 3O3BB 4Z0XA 1IGJB 1TEFA 4PU2A 1MJ7H 3CZFB 3SYQA 1HQ4A 1NGXB 2EXYD 2WIIB 3MV11 4TLUA 4AENA 1W6WA 4RGNE 3BH4A 4YBQD 1SVBA 1IM9D 3LQMA 1SFHA 5C07D 2J8UE 4KXBA 1CBJA 3SKJH 3WUZA 1A1MB 2ZX9A 2CA3A 3QHFH 3QUXA 5HHVL 2CPUA 3KM1A 1NLBL 3KVQA 4R4ND 1WGVA 3KPQA 2UXTA 4KVNH 4UBDC 4XCFH 1BCIA 5E1GA 4HUXB 1J9SA 3BH9B 3EYOA 3QUKB 4OTXL 1BMZA 4U1SA 3S48A 3ZO0A 2QVFB 5AG9A 1GAFL 2KPNA 5CMAA 4AEIL 1Q94B 1SF5A 3C87A 3MGAA 1BF8A 4WTWA 4YIQB 3EO9L 3OG6B 3I9GH 1IRAY 1U6AH 1IBYA 3MV01 5CP3H 4OCSL 1N12A 1C5BH 4KTDL 1NCIA 1J0YA 2RAMA 1CQKA 3RWIA 3G04B 4AQ8A 5D7IE 4O5LH 3NK4A 4NLHA 1ZJBA 1MPAH 2OS7A 1E27B 5AAPA 5HVFB 3GM0A 2BMKB 2HFGH 1WCBB 3DPBB 5ICXA 2JJTA 4L1LA 4PGDA 4YBLB 3ABZA 5JUEL 3UC2A 1KXTB 3FAXA 3AMKA 4FKKA 4B9PA 1W15A 1I3RA 4LLYA 1FH5H 1OE2A 3B7SA 5EU3B 1A6WL 4P3WA 4WNQB 4B60A 1BMWA 3IDMB 1X5LA 3HZ3A 4FFTA 2A74A 5E70A 1N0XH 1MCIA 5CGYD 1JGEB 4RGNB 3F7LA 4P8QA 1XMWA 4UZGA 3ULVE 2VXQA 2J8UB 1E8WA 4PJHF 3AQZA 3ZZ1A 3DI3B 3IFPA 4MBOA 2CIIA 5F6IB 2DQ6A 3K1DA 4GP4B 5IB1A 5LLIC 4DGIL 3H9SA 3KYNB 1RZ7L 4OZFB 4LLMB 4QHNA 4U6TA 1BWWA 1IEHA 2Z7ZA 5I16A 3FZUC 2NNRA 5AVWB 1ECZA 2E7HA 4NO5A 1A0QH 3EDEA 1OP4A 3GO1H 4OGYH 2WXQA 4POZC 4PRHA 4NHUB 2C7FA 3FULA 1F1GA 2UY7B 4HLZH 1SDDB 2D9CA 2VOTA 3UMNA 1MFEL 4KMTL 5GGUB 4FA7B 1KCVL 1CLCA 5IV2A 1WYJA 3TEYA 1BQSA 2K8QA 5HPMA 2X44D 1C9SA 3L1OH 1EJ6A 4MD4B 5DS8A 3RWEB 4HZLA 2WXMA 2XTLA 3NZHH 2RGSA 3ULUH 3TIDB 2Y36L 5I0ZA 1XDTT 1DFBL 2WVVA 12E8L 4QWWD 5D7IB 1RUML 4ZQTA 4FA8A 1EFXD 2CDGB 1ZY9A 3R8QA 1IMHC 4AVIA 1Q72H 4D0CA 3R18A 2YGOA 3DK0A 3SOBL 1MRDL 3TO4B 3BZ4B 43C9B 4HK3J 2RTTA 3CHRA 1EXHA 3CSYA 2WSPA 1HCZA 2UUDH 3DIFB 1RZJC 5AVXB 4XB7A 1RIHH 2GBTA 2VC2B 4Y2DD 5BVJB 1NWOA 3A6BH 3L3DB 1QD0A 2WXIA 4MNQA 3U36A 1H8LA 2O5YH 1RZFL 1RURL 3R0MA 3SE3A 1TVBA 4E9YA 3BT0A 1T0NB 1NH6A 4WI2A 4OFKA 3CX2A 3IMWA 2WCSA 1RVFL 1AGFB 7TAAA 3EJUA 2DL9A 5D9SA 3ZR6A 4K55A 5HI4D 4ZDHA 5D7KD 1CJYA 1YYCA 1NFKA 3K4AA 4R8WH 3HCVA 1T5XA 2FAUA 3ZN6A 2XZQL 2A77H 3TCXA 1GSKA 4HIEA 1M42A 4X7TA 1GGYA 2WC7A 4URTB 1VF5C 4F93B 3KGRA 4WI3A 1T2JA 2BHYA 2QMJA 2LABA 3EH2A 1XH1A 2WW8A 2YARA 4LCWA 4HCRL 5C08B 3AWFA 3QARA 2GK0A 2EVGA 2YWZA 1RZIA 4AY0A 2H2PC 5FO8A 3H9ZA 3P73A 1TJHH 5DK2B 4ZMXA 1T04B 3EYSL 2L7JA 1J87A 3GSOA 4JM0A 3US0A 2C3VA 2UV3A 3NFNA 5CBEA 3Q6FA 5DQ9B 5LWYL 1ETA1 1W16A 3SQOL 3AUVA 4GFTB 3WY3A 3KPMB 1NBYA 4GXVL 2ID5A 4C83B 4G8EB 1HZKA 3IDGA 1FNGA 1GY2A 5HDRA 1HWGB 3CFBA 3ARQA 3GIZH 1S7SA 1JV2B 4MAUL 4XNDA 5KW9H 2DB8A 1SHSA 3VQLA 1YEFH 2DQTH 5FGRA 1W8EA 1VFMA 1ECYA 1YMHA 1IILE 2GHWB 3V6ZA 4MX7B 4P5MB 5AVTB 1SGKA 2EKJA 5A16B 4TUKL 5JDSB 2HRPL 4L9LB 4N6RA 2PYED 3SCMC 4NZDA 1NFIB 2BY1A 4LLQB 1UB5B 5SWZE 1L9TA 2DH2A 4LCVA 2JQMA 2VAJA 1TG8A 2XPGB 1D7FA 5ESVB 2D73A 1EPFA 1JS4A 5EUOF 2YGNA 2O4EA 4KK9D 1CTOA 4XMZA 1S7UB 2X4RB 5ELIA 1EAQA 1NUGA 1S7RB 3MUGB 3LCYA 3QEHA 4OF5A 2C3HA 4LVHC 1KB9K 1HXMA 3SGKC 3CJJA 1WISA 2DH3A 2Y1AA 5HYSB 4E5XA 4X7SL 4HMDA 3KNBB 1KLFA 3TBCA 5BV7L 1Z9MA 4FL4B 2CDFB 1QO3A 2CDEB 1NCDL 3S3CB 5HDQH 1E50A 1YEWA 1U8LA 2VSKB 2W65A 3LEVL 5GRJH 4O2CA 2ICWB 3VGEA 2FQDA 5EFIB 3PIQA 3TEZA 3LN5A 2Y5TB 3N43F 4GSDH 1P4BH 4A6YL 1X9RA 5EC2A 4WFHD 1J5OL 5DMKA 4R4BB 3K81A 3F7QA 1GJUA 3VSTA 1O6TA 1S9XA 3LN4A 3IMRA 3WIAA 3BZDA 4J8RA 1AXTH 3RVUC 4NN7C 2PW1B 4H25A 2JMRA 3G5WA 2H6OA 4JFPA 4PJ5D 2F58H 1NAML 4EN3A 5EF2A 5EZLB 1BVZA 1P84J 4OD3L 1PZDA 5A3IC 4N85A 1DYZA 5MENA 1CLZH 2IPUG 4MS6A 4JDZB 3SY6A 4FG6C 5TFSH 3Q8EA 4H13C 4PGEB 3VFTA 5SWZB 3LV3A 3TVMB 2YMTA 1ZHLA 3IU4H 5GZOA 2WNWA 4P2OD 4ERSL 5JIPA 2ALAA 3CN3A 4FDWA 4N25A 4Y16C 2O6DA 1NCOA 2Y7QB 2ETWA 4Z3HA 1EJ8A 1TMCB 3GI9H 1JWSB 1CQYA 4LGSB 4M62H 3DLQR 1G9MC 2UY6A 3QEQE 2X3BA 1N64L 3CD4A 4OLWL 4DTGH 3FQRB 4LRIC 4L0YA 2B1HH 4XAKD 1AIFB 2OMTB 1R24A 3LOWA 2BZDA 4YR6B 3TN0A 1ZV2A 3NZ8B 1XGTA 1OM3H 5AVUB 1RZPA 1X5ZA 1T5KA 1Q0XL 3PWPA 3S3BB 4H8WC 1ZE3H 3EBHA 3HN5A 4OZ4B 4HP5A 2EDOA 2YPLB 3S4SA 4B50A 2BOBB 1QRNB 4X9YA 4O51B 3BISA 2C1PA 1RUAH 1H9DA 1BLNA 3RVXC 3VGGA 4WEMB 2YIHA 5B8CB 5C9JB 3SDCD 3AG4B 1L6ZA 1SXBA 3N9GL 4U1IA 4HX1A 2FX7L 1B2WH 1SYSB 1MJUH 2BRRL 2Z31A 3EFOB 4NI6A 5F7EH 5CFAA 3I6SA 2D4DA 1NDMB 4QAWA 5MHSE 1N0LB 1ZIAA 1AKJA 4XPHL 1YY8B 1RUKH 3MFGB 1QNZH 3NSYA 4U6YA 4TUOB 4KJYB 4FXKB 3I85A 4OFIA 4Q8BA 4LIQE 1EEQA 4UQEA 2OXHA 3DRTA 3MV9A 2UYLB 2AQPA 2BJML 3FTGB 2V2XB 3FQWB 1HSBB 4NCC1 2VW7A 4XCNB 4J3TA 1LHZA 5FA4A 1AC6A 4Z7IA 5LVEA 4R5TA 2E4FA 2MQ0A 5CJQL 5FGBA 3WO3B 3DYMA 4PJFE 4NNYA 1CS6A 1IGIL 4WW1B 2B4CH 5E2TH 3QEQB 3RQ3A 2JELH 4ODHH 4ZRGA 2ZCZA 1PZAA 2Z7WA 5FYJD 4DPAX 4AZUA 3THML 1CZ8H 4PCTA 1SQ2N 4BZ2A 5KBMA 3FOMA 1UWYA 1ZLUK 1IFGA 1PJWA 1KJ2A 1WIUA 2E9WA 4X4MA 1UADC 4HJEA 2VSDA 3O3AB 2EEXA 5A2JH 2BSEA 3NCFB 1HIML 3BFQG 2Q76B 1TQCC 2XWBA 3VB9A 1K4CB 3OGOE 4FERA 1TR7A 3QUZC 4O02A 4XPFH 3OKNA 5KVFH 3H3PL 5E6YA 3BZEB 1LD9A 4NNXB 3IN2A 2IVFC 4RGOH 3O0LA 3QFJE 1MRFH 1VHPA 5DJCA 2ARJQ 3SODB 1UZ8B 3OR6B 3OAUH 4GG6F 4PJEA 5AOMA 4PJBA 2X6UA 4G8GE 4GOSA 2AXJA 3GDBA 3DYOA 4FS0A 4M03A 5EZOL 4Q9QH 3Q13A 4HLJA 5I1DA 4OF7A 3IVKA 2Y2WA 1GZPA 1CXKA 1DUZA 1RK0B 1PTZA 2ZOLA 3LKOA 5ITFB 1ERNA 1P9MA 3GRWH 4UOJA 2DBLH 1F6AB 1EO7A 4XWOC 5ALCL 1P5UA 4ES8A 3U0TA 4DJMA 1HEJC 1TJGL 2F5BL 3MRLA 4P07A 2X4TA 2P46B 4Z7WA 3TPUA 1F58H 4CU7A 5E03A 4GKLA 1IIKA 2BSRB 2WCPA 1S5HA 3IDYC 4FEIA 1J0ZA 4XVJH 5C0CB 4LMQE 1MCPL 4UF7C 4PJFB 2HKHL 1KGUA 1O75A 4FHJA 1MXDA 2BFVL 3E9UA 4NKDB 1J05B 4AKOA 4JRWA 3RJDA 1SBBA 4XZUB 2CUMA 2IAND 2LQRA 5ADOL 1QA9A 4N0UE 1PX8A 4QRBA 1CGVA 1LO5B 2BVPA 5JORA 3SD5A 2OMWB 5CEZH 1ZWIA 1KFAH 3FTVA 4FFWC 2NW2A 4A2FA 2APWA 4YLQT 3MBXH 1ZA6A 4U1KA 1OQOA 2BIIA 2KDYA 2NX5E 4H5SA 2AAAA 3LH9A 5CSZA 4WO4A 5FHBL 4JY6A 3TT3H 4FQCL 1DJXA 4A7VA 4O2FB 3D05A 2FSEA 3QFJB 3QWRD 4HXBL 4JRXD 4BEIA 4M7ZC 1EHLH 3MREB 2FNWA 1E43A 1FFRA 1NM4A 4KRLB 1SJMA 4A38A 3EJZC 2LFGA 4FI7A 4N2DA 1JYXA 4G8GB 3DMMD 3IFOA 1NGWB 5HGBB 4L1SA 2WLIB 1AXSA 3FK3A 4P2RB 4X9HA 1A14H 4PRPD 4A37A 1A1OB 5CZRA 4UANA 4LSSL 2KZBA 3X3GH 4BM7A 4DN4L 6CGTA 1M1SA 4QYAA 4A68A 3ASOB 3V5KA 5L9DL 3QWQB 1N59A 1FBIH 3UPAA 2FL5A 2CPCA 1AS6A 1IAIL 4N0YH 3CFEB 3QXAA 1WZLA 4JM2C 2Z7YA 3EGXA 5JMRA 3Q9QA 2H8PA 4ONHB 4AUYA 4HKJB 2VC2H 1WWBX 2YEVB 2FIKB 3V2AR 2A1WH 1WTLA 2VAAA 1U92A 2X9XA 2PWEA 3O6LH 2XN2A 3REWB 1P69B 3IT8D 5EO0A 4A7UA 4N0UB 2H2SD 2J43A 5I6PA 3W0WD 3DOSA 3T3PF 2FWOB 4ZX3A 4DGWC 4F91B 1ZVNA 4X9BA 5A7BA 4J3UA 5AW4B 4GRWH 1ZMYA 2YLHA 1ZKAA 3DETC 3O11A 1FFTB 3VI4B 1LP9E 2NX5B 3JVGA 2X1XR 4GUPA 3DGGB 3ZT5A 3DX8B 3NABL 3KH4A 1FNAA 2H4EA 1CIUA 2YOAA 2CGRL 1L0YA 3EOTH 4QF1B 2AQQA 3VI3E 5DWUH 4G43B 4DZ8A 3MRBA 4FLHA 4WUKH 3V4VB 2W0PA 4XP5L 4CDHA 2O6PA 4FNPA 4R90H 4ZMNA 3INUH 3KWTA 5D70L 2WN2A 2WP3O 3MRIA 2YD8A 4S2SB 4PJ7B 1MSPA 4IHOA 3IU3B 4MSWB 1NCAH 4HWUA 3G08A 5IB5B 5JW5A 2WO4A 5I74B 3RX7A 2RFXB 4XBGA 2HH0L 1ETB1 1N70A 2G5RA 3IS1X 5KG9A 3ECBB 1MZZA 2EDQA 2QQKH 3FU3A 3GMNA 1MWAL 5L2JB 1M3IA 4WUUA 5K9QG 3TFKC 5CNHA 1FZKB 1E9OA 4M8VA 4JFQB 5IQOA 4MAYA 4GKSA 4F7MB 5BV7C 3BHBB 3ISYA 4OVUA 4F15B 3BPNB 3QQDB 1D5MA 2GFBB 2XWTA 5CXPA 1HC1A 2PTVA 2OYLA 4H44C 3ZE1F 5I75C 4AT6A 1IC5L 4P3DA 2DQUH 4M4PA 1QI4A 1W9XA 4I9WE 5H8DA 5IFHH 1LP9B 1YECL 5F9OL 1T03H 2O26U 3LHAA 3ARGC 1WCQA 3QXTA 3B37A 1INQA 3U9WA 1ILUA 2HG5B 1YEHH 5I5IA 2BIHA 3VI3B 4QMEA 4NBZB 3K8MA 4NZUL 4GUOA 4NGHL 3UBFA 4WWKD 4MQSB 1CF1A 3K4ZA 3QEUB 4XTRC 5K93A 2GJRA 4W9ZA 4G3YH 1XHHA 1MHCB 5DI8B 1I8KB 1R3IH 3MMEB 1E3FA 2R69L 1XO8A 4HULB 3FOLA 4YHPA 1KIUA 2J57A 5C3LD 2WV3A 1M2VB 5IK3A 5F9WB 3L5WA 3C60B 5K9KB 1U4FA 4NZRL 2OJZH 1TQVA 4X5WA 4B7IA 4R2GD 4JQIH 3SCMD 1JNHA 3O41B 1HDMB 2JKXA 4XNMA 2OKMA 4OF3A 3FB5B 3GBLA 2QLVB 4JM2F 1XEUA 4XNQA 3UO8B 5HGHB 3HC3H 4Y1AA 3V6FB 5AZEL 5MEPA 1TZOA 4HPHA 3SKNB 1QVOB 2YXMA 3Q1SH 2IGFL 2WWMC 3BAYA 4ATWA 4BZ1H 3C5ZC 3GGWB 1F3JB 5BMFH 3CHPA 1ASOA 2HTLC 2ORBH 4OIIH 1KCRL 2EDWA 2AJUH 1I7UB 4PTUB 1T83A 3GXMA 1J8RA 5D6CB 4XO9A 2AW2A 2HZHA 1XH3A 1H3UA 1YRKA 3ZL4L 5LQBL 3WFCL 5DJXB 2UWEB 4KV5E 4OCWL 3D1MC 4HWBL 3SDDA 2VZOA 3VD3A 1NFAA 4JL1A 2NY0B 4Y0GA 3RLSA 3BDYL 5AVVB 2X4NA 2BOCA 2FD6L 5IVZA 4WU5A 5IEKA 4B9GA 4GAYB 3R1GL 4PR5B 3NN8A 3QHZH 3SDAA 4KNUA 4UOW1 4PJDE 3D08A 4J3OC 2MRYA 1C1EL 3GSWB 5C0DB 4MCYA 1OSYA 3TTYA 1MG3C 2FBOJ 3LPWA 1U95B 1AD9B 3VXUD 2VLRD 4JFED 3T3ME 3QRGH 4YSTA 3V0GA 4K8RC 5EF1A 1S7QB 3O6FD 4HPYH 1I7ZB 4TXVB 4FG6D 5G4NA 4CADA 1DCEA 1PNCA 2CBTA 2DJUA 4YSRA 3P3TA 1BOGB 1RU9L 2FHCA 1R3LB 1RFDH 2WTRB 4Y16D 4PGBB 5T1KA 5L7XL 2XWJA 1IGMH 1FNSH 1CICD 5CLTA 5E6RB 4YXHH 1BZ8A 2IDSA 5IROC 3MLRH 1HCYA 3L4WA 5ABAA 2HVJA 3QRBA 4NCDA 3KH3A 1JI1A 4KTGA 4JFYA 1ODAA 2EJ1A 5LBSA 3X1GA 3GBML 1BWMA 4GO6B 3GRBA 3VRLF 4J6IA 2V9QA 2HT3C 4HK3N 3M07A 3GFUA 4HSQA 4DP5X 3S3SA 2R39A 1E4KA 1XF4A 1YEIH 3AT0A 5DJYA 5DVKA 1EBAA 3LPGA 4MWFB 1MCCA 2WLLB 2X41A 4N8VB 1GOGA 3QUMH 2LE9A 4IKLA 4NQDE 3EADA 5KVGE 2EACA 2E6JA 1D5IL 4ABVA 3C9NB 3X17A 1QLRA 2BP3A 3PGDB 3K2IA 1I82A 4PJAE 1TQUA 2MCAA 5C0BD 4XP6H 1XIWC 1Q9LA 3UX9B 4WSJA 1N2RB 4PJDB 3OV6A 4YHNA 1EZUA 4TRPL 3UCRA 2VL5B 4X6CF 3Q2WA 2QHRL 1RZKC 3GUFA 4JJ5A 4KKCC 4BH8B 3WN5A 3IM1A 1KTDA 2X2YA 2DQJL 4ISVA 1H8OA 1HCVA 4BWWA 3H56A 4D0BA 3B2DC 2I60L 3LEYH 3T3MB 1G9NL 4OCYL 1MH5B 3A4FA 4PS8A 4Y4HC 3BXNB 1PLAA 1P7QA 3I9PA 4XZ4A 3UO1H 2YZ1A 5D7JA 1I85C 2AK1H 1M71A 2C8NA 2QPUA 2B7DT 3HJ0A 4ZOCA 2YA2A 3KL5A 1EEYA 4CBZA 1J9QA 4XXWC 2YKLL 3LXBA 5TF0A 1O7SA 2F2HA 3U4BL 4D9LL 3VA6A 2B77A 2YD0A 1F3DH 1JYVA 4UTCA 2XKUA 5I8EA 4DGVL 5F21B 1TUPA 2PR4H 2VXTL 4OZGE 3TP4A 3FPYA 3C2SA 3Q2CA 2ZWLT 1G6RH 2H1XA 2FJSA 4L8SA 3MJGX 4W4OA 4LCYB 1T7WA 4WI0B 5I26A 4NQDB 2YMOA 4G6KL 5DHVB 4C57C 5I71C 5IT2H 3QUZD 2OTPA 1JDAA 2R56H 3EH3B 4BIKA 2B59B 2HCZX 3VSQA 1GHFH 2P5ED 5KS9E 1E4WH 4I85A 4PJAB 4MZ2A 4F1SA 3FUFA 4OF0A 4X8JB 4KROB 2DLFH 4PJGF 1M56B 2YAFA 4Y19D 3TC9A 1FP5A 1D6EA 3VU2A 1KG0A 2FWSA 2FO8A 4KZ0A 3EH5B 2Z9TA 4I8DA 3MKGA 1MCQA 4J3OF 1AO7D 3MFFB 2QSTA 5JXAL 2BHZA 2Z35B 5EC1B 2AANA 1AFVH 1CVSC 1MJJB 4DK6A 3HFFA 3QZPA 2B3IA 4W9CC 4NO0B 1I1AA 1SMOA 3HMXA 4UCFA 5DZJA 3P0YL 3RURA 5EOTA 3U7WL 3CVBA 3L13A 1RULH 2BZCA 3BQUB 4HG4K 2DMKA 3OKMB 2J1ZA 3ZHNA 1FIGH 5FKAB 4PGCB 3ALPA 4WRLA 5GS0L 3HB3C 5C0FB 2BY3A 1BEXA 1AMYA 4X6DF 3T8MA 4AYDC 5JMOC 3QWOA 4FQ2H 1MI5E 1MFVA 4Z7OF 1YN7A 4HVBA 4RAUB 3GNMH 1J11A 1J18A 1TYEB 4ZSOE 4B95C 4OZGB 4YHIA 5DHEA 5EUKB 4ALAH 4G1EA 2H32A 2OL3A 1TZGH 2ERJC 1WA1X 2EIMB 4FFWD 3GSXB 4I0PB 4XWGH 1J48A 3NIGE 5IHZB 2I27N 4YC2B 2J1XA 3II2A 5GHWL 4TVPH 3SD2A 1UZ6F 4HSCX 3FL7A 4RSVA 2XBTA 4YPJA 5KS9B 4I2XA 4JQXA 3VFWA 5JQIB 3V0VB 3UZEA 5C6WH 3MBEA 1BF2A 1CK0H 3N55A 4J3SA 3WJLC 3O8XB 1U93B 3CK0L 3RU8L 1OSZB 1BVNP 1L6XA 1THAA 1VFOA 1A7NL 4NO2B 4X5RA 1KEML 3E0GA 1QLEH 4ZS7L 4GXUM 5CGTA 4W68A 4PJCE 3W82A 3WKQA 4AI7A 4OLYL 1FLRH 1X5IA 2FWUA 3QIWC 4K71B 5DS1A 4UM9D 2X4SA 4OI8A 3CVHL 2OFQA 3MYZA 3FB6B 1YPZA 2FJHB 3CHXA 1EBPA 3MYJB 3GINA 2ZNWA 2XVLA 3AS1A 5DFWH 1G5GA 1SMAA 4ZNEE 4N9GB 1I9IL 3AZUA 1M1XB 1YQVL 1VZIA 4JM2D 2DWDB 1DVFC 4JLRA 5KVMC 3RGVC 1UA6L 4K5OA 4RMSA 2ZSWB 1QI5A 1F4XL 1AG6A 2ZAIA 5GJSL 4N86A 2A6JB 1MI5B 1U8HB 1OKEA 2V0AA 4F37K 2AQ3A 5JW4N 4NJ9H 2W0FB 1NC4B 4ZSOB 1N19A 2PPFA 1SXZA 4JO2H 4UIMB 1ZGLB 4FQLH 4FLRA 4KO7A 1OAUL 1DQLL 2HLEB 3MA9H 4G8IA 3HZYA 1P5VB 4BSVA 2JCWA 25C8L 3DETD 4MMXA 4UM8B 5I9QB 3NIGB 3UTZA 3ZKXC 1T1XB 4ETQA 4MDJB 3KLKA 5J3HD 1L7TH 3ZK0A 1KJVB 3MRDB 1BYNA 3SPVB 1ZANH 2RD0A 5E8PA 1E40A 1IGFH 2MNWA 2FECI 3VM7A 3UXFA 4K9EH 1MCOH 4NUPA 3CVIL 1ASPA 4H1LG 5LNGA 3D33A 1HKLH 2WXOA 4MVBD 3BRGC 4U1GB 4PJCB 4HKXB 3ARFC 3GMRA 4XCEA 1UWEH 4MHHG 2G9KA 3DV4B 3HI1B 4JDEB 1W0WA 3KXFA 1VPOL 4IBSA 3MRNA 4LKXA 4BUQA 4ODSL 1U8MB 5IESL 1XQ4A 1BX2A 1HHHA 3NAAL 3FAWA 1QHQA 3TFKD 2APFA 4QCIB 3OL2A 4YHOH 1LEKA 2AXFB 3MLYL 3BLKA 1WUNT 4IKNA 4L3EE 5TDNB 5C0RL 1OEZW 4BGLA 2ZPKH 3D18B 2FYYB 3KAAA 3HZKB 4HUMB 1T7XA 3KCPA 1R33A 1BAWA 2X4UB 4K23L 1SM3H 1EWHA 1N5YH 3MZTA 2PXYD 4N6QA 1FGNH 2F6AA 2XT1B 3WY1A 4DT2A 1RK1B 4BKTC 3BW9A 4TTGA 1KGCE 2CAKA 2R0ZL 3U7YL 4AQ1A 4E41E 3EDKA 2V8LA 4QOKA 4JRFA 4N2MA 2IAMB 3CH8A 1H3GA 1HL4A 1S7WB 4XB8A 4Q2ZB 3RI5K 4P06A 2D03L 1ZLUH 4U1MB 5DRNB 5KYWB 4WW2B 1QSFA 1WD8A 1FJ1A 3WIFB 4NO3B 4XTRD 4GKOA 7FABL 1O5DT 2GKIA 3MACL 3QNXB 4Z7VB 3TO2A 1BOYA 5IJCC 5J6HA 4GLRH 1QFOA 5FWRA 5FECB 2X70B 3RPIA 5INCA 4Y4KB 1CDJA 1CWVA 3RZCC 1TTGA 5ISZA 2CLRA 3C8KB 5C0NC 3V6OE 4L3CA 4NZTL 3U2IA 4ZTOH 3T4AC 4JFXB 1KZQA 2ITDB 2X7LB 2C3GA 1KZYA 4OKVB 1L9NA 3AXHA 2ZKHH 1Z3GL 5FW6A 2VM3A 4D8OA 3UTSE 4BFIB 3U83A 3VRIA 1NM9A 4HD9A 1IFHH 2A83A 2J4WH 5D2LE 2WWMD 3MUJA 1CE6A 2ADJB 3ESOA 4NC2B 3C5ZD 3CX5K 3KPNA 5T1KD 3V8OA 3MXVL 3MODH 3TH4T 3DSNB 3QXWA 3FXIC 4ODVL 5AAMC 2AMGA 1YEJH 2CNYA 2FIRT 3RVTD 4E41B 2QQLH 2B08A 3NSFA 4LHJB 1FG9C 1OM9A 3ZRCC 5IY5B 1X5MA 4HS8L 3T2NH 4HU2A 3OLIA 4QJ4B 4I1RA 3KPSE 5TE4H 4RFNC 4CSPA 1OAKL 2ZUQC 4ZMTA 1AHWB 1J1XL 3GBDA 2H26A 2FB4H 3ZE2F 2NY6B 5LJYH 2YRPA 3O9WC 2BNQA 1AZUA 3QQ3A 2DAVA 2I26N 5T1MA 3ZKNC 3MOQA 1G9NC 5FDWB 1A3LL 1SVZA 3HHRB 3RNKA 4J3OD 3WGUB 5E9DB 3F05A 4WTQA 4BDVB 1P1ZB 1WH0A 2O61B 3HBGA 4YBHA 5SWSD 5AD0B 3Q05A 3UZQB 2K78A 3GSNA 1S9YB 2Z6FA 4K5PA 2XKSA 1ND0A 1G1KA 3K2KA 4KWUA 1LO2H 4YDVB 3TJEL 3QQ4A 4GW4B 2OX5A 4PRIE 1Z0MA 3EJYC 1UM6H 1TTAA 4YSUA 2AP2A 1ZK9A 3NIFE 1OV8A 5A2KH 3MLVH 2EO9A 3PWJA 3UTSB 3IMUA 5CAYB 1T2QH 3DPDA 1TMQA 4LDEB 4Y88A 4F3FB 3CHQA 1FGVH 4LOUC 1OK8A 4XVSH 3S98A 1IC1A 3QZMA 4FN0A 4YL9A 2HUEA 2CLZA 4AZ8B 3VXPA 5DJAB 4HKBB 4WDIB 1S8DB 3HVDA 5DCCA 1N5AA 1HNFA 1DQIA 2HT3D 2VIRB 1SUHA 1L7IL 2AQSA 1EZSA 3FFDA 4MJ2A 1PMYA 2VQTA 5TH2A 3KPSB 4RX4A 1MJ8L 4ORGB 3BVDB 4TNVK 4B97A 3OR7A 4QXWA 1ETZB 2G5BA 3FN0L 3MRCA 2CLVA 3CSGA 2VMFA 2IFGA 3HI5L 3BRDA 1MJ7L 2OMVA 2WYZA 2N3JA 3J07A 3DOHA 1DBBH 1F1DA 4NKMB 5AVZB 4AOFA 1GMIA 3S0PA 3SKJL 3ARSA 3VH8G 4DKAA 3APFA 4Z3TA 3ZTJH 3QHFL 2VUYA 4N0CC 5EBMA 4A1RA 4QTFA 5DVMA 3JWNG 1EAPA 3B4NA 3IFNH 1FG2A 5CJXA 4KVNL 5GS0C 4NQCB 3CHSA 4Y4HD 4P5RA 3BP4A 2KLTA 4PBVC 4PRIB 5MI0B 3ZT6A 2NCEA 4Z0XB 3CPLA 2AXGA 4FCAA 3PL6C 4IM8A 1G7QA 3CDFA 4NQQA 1HQ4B 5I15H 2H47C 3HAEA 5CHNA 3I9GL 4ZD3L 4AENB 1IBGL 1R46A 2BC4A 1C5BL 2H3NA 3B2PA 5DD1H 4Y8AA 4BFKA 1OHQA 1YNTF 2J6EH 1KBWA 5GSRA 4HH9A 4F9LC 1MY5A 3QUXB 3CFDA 3CTTA 3H9SE 5FDYA 3KPQB 4YHMH 1T89A 3ESMA 3W11C 4O5LL 3Q5YA 3EYOB 4U1SB 2XTJD 4MA1C 1MREH 2G2PA 2H6PA 2HFGL 5CMAB 4YDLB 1NQBA 4PJHA 2ADIA 1TDQA 1UC6A 4PRHE 5IHLB 4FQPA 3ECQA 3RTQC 3MBWA 4F80A 4EKXA 1JGVH 4ZFGH 3IMTA 1L9QA 4KNTA 4PH8A 3RWIB 1SLUA 2ESVA 1FH5L 2WZ5A 1V8HA 2G60H 5E23A 3NPSB 1TZHA 3TX4A 3IWVA 3T0DA 3TJPA 1N0XL 1E8ZA 4GINA 1BP3B 2EC9T 4GQPH 2HPTA 1WWAX 2CMRL 3TNMA 2WBJA 3RZWA 3LEXA 3O3EA 1EFQA 3GJFK 5ICXB 1TTUA 4JGNA 1BAFL 4PGDB 2QBWA 5JZ7C 3CBRA 3BAKA 3GSVB 1HN1A 2JLPA 4NDMA 1SHMA 1I3RB 2CA4A 4LLYB 4LSRH 1A3RH 3UOAB 1A0QL 2A74B 4K7PY 3GO1L 4J6RL 2SEBA 3CXFA 4LBAA 5GS1C 1U8IA 2BVYA 2A2QT 4MNQE 2XZCH 4W9FC 4HMEA 3GBEA 4LEEA 3L4UA 2WANA 3Q43A 3Q48A 3C75A 3IFPB 4RWHA 4TNFA 2CIIB 3L1OL 2A73A 3A6OA 5IB1B 3H85A 3NZHL 2CSPA 4FFYA 2DDQH 3H9SB 2X89A 4LFHG 4O4YH 5AW6B 3ULUL 1MIMH 1QUPA 1JFQH 3DX7A 2X2IA 3BWSA 3M1BA 5EEWA 4QJ5B 1DANU 5I16B 2YA1A 2R29H 1ILSA 4HT1L 4NO5B 2XY2A 4LL1A 3CNKA 3DX6A 2HG0A 4N2NA 3L95A 4PRHB 3LH2H 1UA3A 3UAJA 3CQPA 5JHDA 4I89A 3ML8A 3FKUS 4FOMA 3VFSA 1EZVY 5I5RA 4YDJA 5IV2B 1NMBH 3MLXH 4LCWE 4FMFA 1A7QH 4IBQA 5HPMB 2H7WA 1C16A 5DS8B 4BQ9A 4HZLB 1F4AA 3SGEH 1RIHL 1V7MH 1JD7A 4OJDH 2WVVB 3T77A 3A6BL 4KZEH 5CM1A 1EMTL 1M9SA 1ZGLP 3NCJL 1F0LA 4YDMA 4D0CB 3N06B 4JFDD 5KANG 1UG9A 4TF4A 2LAAA 4YXLH 1I75A 3A4DA 4PBDA 2YA0A 3CSYB 3QAQA 3BUPA 2V5SA 5B3JF 3A0OA 3ARBC 3KXFD 2A77L 3ETSA 1UFGA 4MNQB 2CXGA 3U36B 4DEPB 4PWGA 1DVFD 2OZ4H 3RGVD 1TVBB 2G0LA 3HG1E 4H8QA 5CR8A 3WEXA 1LLAA 4GBXC 4JM4H 1T20A 4YXKH 1DCLA 3KS0H 2Z93A 1NGPH 4RAVA 1G94A 4K7PH 5D9SB 4WV1C 4CMHB 4ZDHB 1TJHL 4IOFC 1JI2A 1JGIA 5EU6A 4B53A 3WGVB 4K3JH 1BAGA 5LG1A 5B21A 5JR1L 3GMQA 1P2CA 3PDOA 1T5XB 3LVEA 5L6YH 4HIEB 4IOIA 4X7TB 5CJOH 4F5CA 4UQ2A 2D7TH 4RDQG 3L4VA 1JBJA 2ICWJ 1OTTC 4NFDA 4LCWB 3GIZL 4PW4A 5BZZA 4P2AA 2GK0B 2P8LA 3ZDXF 1YEFL 3R4RA 5GGRA 1RZIB 4D7BA 4JKPL 1MCDA 4I77H 4F2EA 5FO8B 3P73B 4XC1H 3PAYA 3LDBB 1HYRC 5FUCC 2RCSH 4OGAC 2VABA 3GSOB 3RY6C 4NUGL 2C3VB 1ZDSA 3NFNB 3Q6FB 5CBEB 1S7VA 2OJ1A 3D52A 5J13B 1UOKA 1T0OA 2W9EH 2XQYK 3UEQA 2Y2YA 2E7MA 1NBYB 4A7QA 3IDGB 1FNGB 1UM5L 2CD0A 2DJ4A 1V7NH 3CFBB 3JWNC 1S7SB 3D85D 3W1ZA 2JCCE 3LY6A 4FNLH 4QRPA 4L4VD 5BOJA 2OR7A 2RR3A 5F9AC 3RDTC 1YMHB 1MCEA 3V6ZB 1JZEA 2N56A 3N2JA 5MENE 4N6RB 2IWFA 2BVOA 2NY2C 3FF7A 4UZUA 5I73B 2EDNA 3MJ9A 1VSCA 3LNFA 4QXGH 1Z0NA 1TJMA 5HDQL 1IQWH 3TV8A 2PYFA 35C8H 3NCYS 4NZFA 4PBXA 5GRJL 3BZFA 2I5YL 1HWWA 4KRPC 2CWRA 4LP5A 4YSQA 5JOFA 1EIBA 2VR9A 1LEGA 1P4BL 5HDBF 1G0XA 3QEHB 1HINL 2PWHA 2BVUA 3BSZH 1HXMB 4PJ9C 2XC8A 3NJLA 4E5XB 1KLFB 4O58H 2IPKA 4KUCD 3AG1B 5FGCE 3PWPE 1QO3B 1OSPH 2IG2L 3FRPG 4UTBH 1A6AA 2C9SA 1D5ZA 3OMIB 1U8LB 2W65B 2YD9A 4O2CB 3B2XA 4OUOA 2FO4A 2OK0L 6PCYA 2VXUH 3GYRA 3PIQB 3V5DB 3OLDA 1ZPLA 5HTSA 5EC2B 4FFVC 5AAWA 5DMKB 5TFSL 2DIAA 3MOBL 4JPSA 4CC4C 1S9XB 4H8HA 3LN4B 5GZNC 3IU4L 1X5KA 1DSFH 4J8RB 3GSRA 4H25B 5E1AA 4HOZA 2HT4C 1E4HA 4JFPB 3GI9L 4M62L 3BFOA 4EN3B 4JPWH 1SOQA 1FE8H 5C0ND 3TIEA 2B1HL 3HZMA 5LNEA 5MENB 4YLCA 1KB5H 3VFTB 4KJQC 3LV3B 4K15A 3L08A 5JPMC 1EK3A 2Y0SA 1WIPA 3OKDA 4OLXL 3UJTH 4ZO8A 3CG8A 3JZ7A 1RUAL 3CGTA 5E2UL 1B4RA 2UY6B 4HWEH 3DIVA 4WI9A 5I2IA 2KZWA 1Y1DA 1S46A 3K3QA 5EA0H 5FOBA 4ANKA 1R24B 3P54A 2EYRA 5F7EL 4NAMA 3TN0B 4ODWA 2KL6A 1XGTB 4EBQH 4Q74A 2XN0A 1HH6A 3KR3L 3PWPB 2QEJA 1RUKL 1QNZL 1CXFA 4WEEA 2ZYIA 3H7BA 3L17A 3J8F7 4BQCA 1KLGA 3S4SB 4Z7NE 4F57H 1NOFA 1FL3A 2AQTA 3G6JE 3WS6C 2C1PB 2NXYC 3T0VA 4RETB 3V0EA 1BLNB 2LU5A 1AQ8A 2IH9A 3OAWA 1XB6A 3ZKND 5DEZA 4GRMA 4OCMC 4U1IB 4HX1B 2CKBA 3PXLA 3ZYIA 3SGKA 2Z31B 3N1FC 3TH2T 4GQ9H 4PJEE 4NOFA 1MWOA 2NNCA 4PJBE 1YNLL 3WL9A 1AKJB 3SE4C 4DO6A 2BX5A 5EMYA 2B2XH 1SXAA 4U6YB 2EDHA 5AW7B 2JELL 4JZJC 2OXHB 2H41A 3DRTB 3KBEA 3MV9B 3Q3GA 4N0FA 3U4EA 3KLHD 1WEJH 3EJYD 4C55A 1QLFA 4AMKH 2WWNA 4Q9CA 4Z7WE 4C8XA 4GG6A 5FA4B 2W8CA 5I28A 4L4TA 4PSRA 3AGVA 4HF5H 32C2A 3D3VA 5E1QA 3NG5A 4NNYB 5DO2C 3AW5A 4XPFL 5KVFL 3K2UL 1KFGA 4KMQA 4A66A 3PQYD 1L9SA 3WFDH 4OM1H 3VVVA 1O7DE 2HJKA 4I48A 5LB1A 1CDBA 1ETJA 5HI3C 3V5HA 3MV7A 3WE1A 3OAUL 1T66C 3FOMB 2G5UA 4PB0H 1TYJA 1KJ2B 3ZR5A 4GXFA 3U9UA 5MEOA 1JVOA 2E59A 5SX4H 5C7XH 3QR1A 3GRWL 5D1XD 2XWBB 1FRGH 4Z7NB 4G7SB 3EZJB 3QJSB 4UDUA 4O02B 4CMMA 3OKNB 4IGBC 5HDOA 3WY2A 1LD9B 4QO1A 1F58L 2K9FB 5K59E 4QXVA 4RFOH 4XVJL 3INOA 5DJCB 4JG0H 5BRZD 2R8SH 1Z32X 4PJEB 4ZUSA 5M94B 4PJBB 1HE8A 2VLKA 4GQZA 4LNVA 4MRBA 5I1DB 3OBAA 3IVKB 2CBMA 1GZPB 3LKOB 1DUZB 1DVZA 4HOMA 5GS0D 2V4LA 3AFLA 4WHYG 2WD0A 3ZGIA 2JI1A 5C3TA 1P5UB 1XXFC 3U0TB 3C6LD 1D9KA 2QZQA 1NMCC 3MRLB 3DGDA 3ULUC 2Q20A 2X4TB 3RIAK 3TPUB 1KACB 4Z7WB 3BKJH 4Z6AT 4F20A 1KFAL 1WAPA 1NC2D 5FYLH 1S5HB 1QRKA 5KVDE 2H0JA 1KPVA 3MBXL 1KNOA 3V7AG 1NBVH 3EYUH 4Z77A 2NNFA 1BBJA 2E7DA 4DAGH 3QI9C 5EEZA 5E4EC 3PV6A 3NEOA 3TT3L 4DK3A 1KB9J 1KN4H 2OTUA 1QBLL 3E8VA 3W11D 3BKMH 2VXQH 1EX0A 1QA9B 2L3BA 3VGBA 5F7WC 4AEEA 2BVPB 3QZWG 2C9XA 3FTXA 5JORB 2FQGA 4F7EA 3WFHA 1ZWIB 4AJ0A 5IW1A 2QV4A 3K6DA 2VDPB 2NW2B 3TM6A 3CDGA 3Q5TA 3UTTD 1ZA6B 4U1KB 1OE1A 3N5AA 4H5SB 1XH0A 4XN9A 5DYOA 2YGQA 5CSZB 4WO4B 3QNZA 1FZJA 3X3GL 1L3WA 4G9FD 4NM8L 2EC9U 4JY6B 5GJTH 4LLWA 2C9AA 1XGQA 5CZVL 3V0HA 2QVMA 4OCXH 4IBZA 2D3NA 2FSEB 3IAGC 5E0FA 4ONFH 3MV8D 4N0YL 3VXRD 5HD8C 1XF5A 1N26A 4PLJD 3IFOB 1J0JA 1PSKL 3VWKA 4ECNA 2VC2L 1IAKA 3PJSA 2HKAA 5CZXC 2A1WL 1AXSB 3KPRD 5CLYA 2ARWA 4KI1A 4JCMA 3EJJX 3VFPA 3ULVL 3O6LL 4XX1E 2ZP9A 4E9WA 2GI0A 4ANXA 5C0IA 3LZOA 4ZAKC 2C9PA 4YGVA 3V5KB 5IOKA 1SJEA 5D1QC 1N59B 4WJ5A 2FL5B 5CILH 1TJXA 3QXAB 3EGXB 3T1WA 4R26H 2H8PB 4NN5C 1KIQA 2IBZX 5KJRH 3KEDA 3EOTL 3GXIA 3QIBA 3ZKSD 2DM3A 2VAAB 1U92B 3LRSA 3U6RA 3QDMA 1NFDE 3B7RL 2N7SA 5EO0B 4FAAB 1MCJA 5EF0A 1SOXA 3MJ8A 3QDJA 4R90L 3DOSB 4PRNA 3LIZA 1CXHA 3T0EC 3INUL 4JPKH 1NBCA 3V8CA 2PKDA 4PWFA 4ELMF 2DIEA 4UV7H 3QISA 4OUUA 5FXCH 3O11B 1UQSA 3M6DA 4QRFA 4GUPB 3O2VH 1JF6A 3EBAA 5DVPA 4AUJA 4CBPA 3BN9D 3ZRFC 1UURA 2L0DA 4DZ8B 3H55A 3MRBB 4C4KO 2QQKL 2A9BA 1MQ8A 2P24A 4P59H 1JGDA 3LRHA 1BG1A 5D71L 4M3HA 1A47A 4XO8A 2YSSA 1ED3A 3IAQA 5FPIA 2VXSH 3MRIB 1D5RA 4IHOB 5LUMA 3GXTA 2GTZA 1CLYH 3G08B 5JW5B 5I76A 4OZHF 5LGJA 2IWEA 4I3GA 4KOBA 3V0AC 2VE6A 2GJ6A 3BC9A 3O4LD 4XBGB 5KZCB 1QABA 3QJHA 4FNUA 5BRQA 4HGMA 2F18A 5KG9B 3BE1H 3GMNB 4MCZA 4WUUB 1DSYA 4CJ0A 1ET8A 1EAJA 2DL2A 2J56A 3RJOA 5IFHL 5C71A 3ULUF 4LGPB 1T03L 1E9OB 2PO6D 2UX7A 4JFFA 2JJWA 4B41A 2C26A 1YEHL 4APXA 1UCBH 3I6LE 2CIKA 4MAYB 4GKSB 4L8DA 4OJFH 3RWCB 5T5NG 5EZIH 1GOHA 5B1BB 4Y1AE 5G2NA 2QQQA 4N90D 1D5MB 4FQQA 2FEJA 1Y1UA 2XWTB 1E4XH 3H4FA 4FFZA 5TD4A 3SPGA 3OKKA 1XL4A 2WSKA 3L3HA 4NQSA 4AT6B 4PJXA 1YZZA 1M3JA 4G3YL 4P5TC 4P3DB 3ATBA 2HPOA 1V3LA 3TCLA 1R3IL 4D9RD 3BFWA 3GMPA 1I3UA 2MWCA 4U1LA 4AYID 3MROA 1INQB 1QKZH 4KVCH 2ZOTA 1JYNA 2R7EA 1D2PA 1L9MA 4M6MH 2NY7L 3N44F 3P3YA 4HCRA 1BVOA 4U6VH 1B0RA 1ZSHA 2ED9A 5BQ7A 4JJHA 4EXPX 1KYOK 2AEQH 3JTSB 5E6IC 3PFUA 5HP5A 2OXGA 5DZVA 2WGNB 2DJSA 2CBOA 4QGTA 4U3HA 4DERA 1D5XA 4LU5L 2DBJA 3HC3L 3UAFA 3FOLB 1G7PA 5D6DC 4YHPB 3PHQA 3Q1SL 1KIUB 1ZE3C 2CJ3A 3RDTD 4G8FA 4BZ1L 5F1SA 5BMFL 5IK3B 3L5WB 2ORBL 4BCZA 2PWGA 4KNQA 4OIIL 1ZV5A 3QDGA 5CN2A 5AZUA 5GRWA 2AJUL 1KXHA 4M7KL 2V3DA 4X5WB 2C4FT 2NY2D 1JNHB 4AX3A 1FFOA 1EGJH 3QT2A 5JNYA 3DO3A 1ZLWH 4XNMB 4BFRA 3VFUA 5DHXB 2W1NA 4XNQB 4KZDH 5MEPB 4Y1AB 1CPUA 4KRPD 5HHME 4AV4A 1I3GH 2CH8A 3QR2A 1CE1L 5E99L 1BZ9A 1TCMA 4PJIF 1BZQK 1A4BA 1QHOA 2AMUA 3P1VA 3QHZL 5SWQA 1VCBC 2O5ZL 5EG6C 2NZ1A 4PJ9D 4YN3A 4XP1H 2HA1A 5FUOH 2XV6B 1A5FL 2ZAHA 2HT2C 3H9HA 1OP3K 4LPVA 1XH3B 4JFVA 1DBJH 5LCVH 3PUCA 3DUUA 3AUWB 4R83A 3SDDB 3EYVA 3QJXA 1WJ3A 3KLSA 4IBUA 2BLFA 3QRGL 2B4CC 2X4NB 3IMBA 2BOCB 1WHOA 3IRPX 4HPYL 5IVZB 1DO6A 2WTOA 4WU5B 5IEKB 3F7VA 5I6XB 3NN8B 2IDTA 3SDAB 4J4PC 4LLVA 3OZLA 1RFDL 3BAIA 4NYLA 3PHSA 1H5BC 1ZIBA 5IOPB 3BGFC 1IL1A 3ARGA 3WNPA 4CNIA 4IBWA 4MCYB 1WAEA 4RDBA 3MLRL 1BXAA 4I3SH 1N68A 1I9RL 4PS7A 4JFTA 2P52A 3FSOA 5DD0H 3K6SA 4HBQA 1OQXA 4ABUA 1YEKH 4AV5A 4P5KA 3SKMA 1A4AA 4MRCA 2E8YA 3V4PA 4CADB 5HYSG 1AHMA 4X6CA 3F01A 3W56A 1OAXH 3G5YA 4NB7A 1YEIL 3ULSA 3MCLH 5L2KA 3QXDA 3QUML 3SDXF 2XWJB 4DW2H 2W0LA 4HJGA 5HHMB 2FYVA 2P80A 5GGTA 1UACH 4WU7A 2LHAA 2HVJB 3HS8A 3JT0A 2WSDA 1PD0A 4XP6L 2E47A 4PD4K 1OWRM 2EO7A 4JFYB 2A4ZA 2BS71 1U3HB 4I5BA 2LAGB 2F53D 4PHXA 4OV6F 3RWHA 1VFAB 1JNNH 5A43C 1XF4B 3NCWA 5DJYB 5D72H 1A6ZA 1Y7VA 1PCSA 2DKMA 4KY1H 3NCXA 4JE0A 1GGUA 2IH8A 4LCUA 3T2QA 4BZ2H 4D3CH 3FFOA 3LEYL 4FXGC 1QLRB 2CG9X 2NXYD 1KJ2H 5GSVA 5FUZH 3EGSA 1ZVYA 1Q9LB 2AK1L 4LIQL 2Q10A <