4J3OH

Crystal structure of the fimd usher traversed by the pilus tip complex assembly composed of fimc:fimf:fimg:fimh
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic basis of folded-protein transport by the FimD usher.
pubmed doi rcsb
molecule keywords Protein FimG
source organism Escherichia coli
molecule tags Cell adhesion/chaperone/membrane protein
total genus 48
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00419 Fimbrial Fimbrial protein
H PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH02
4CSSA 5AAPA 3ZPDA 2XG4B 4X5QA 4CA4A 4AUYA 1TR7A 5JQIB 4AUUA 4LOVA 5LNEA 4CSTA 4AUJA 2UY7B 5CGBA 5IQOA 2XG5B 3JWNE 4X5RA 4XOCA 5FWRA 4ATTA 4J3OF 4AV4A 3JWNH 3ZL2A 5AB1A 5F2FA 4AV5A 4BUQA 5FS5A 4AVJA 3SQBB 4X50A 5IQMA 1UWFA 4X5PA 4AV0A 2W07B 2VCOA 4J3OH 4XODA 5AALA 4XOBA 2JMRA 2WMPB 5LNGA 3ME0B 1ZE3H 4XO8A 3JWNG 2J2ZB 1PDKB 1QUNB 4XO9A 5FX3A 3ZL1A 3RFZA 5ABZA 4J3OG 3BWUF 4XOAA 2JTYA 2UY6B 1N12A 4AVIA 4AVKA 1N0LB 3BFQG 3MCYA 1KIUB 5IQNA 4XOEA 1KLFB 5FLUA 5F3FA 3BFWA 4AVHA
chains in the Genus database with same CATH superfamily
3C8KB 3G5ZB 3ETTA 4TQHA 4X4ME 1JFHA 1AQKL 3ZYZA 2FJUB 3MFGB 4LPVA 3K0YA 3CLEL 2CJ3A 4AQ1B 5CUSH 1V5JA 2GQHA 4QTHA 5DJ0A 4HQQL 4CKVX 2WTRB 2YAMA 4LP4A 5D8JL 3E6HA 3RAJH 4DT2A 3S5LB 1OM3H 2EILB 3RL1A 4XNYH 3UAAA 4L4TD 1NCGA 3T77B 2WZAA 4JRYB 4KJYA 1JIBA 2AXHA 1C5CL 4OZ4B 1MFBH 2VDNH 5EG6C 1A1NB 4YLBA 4ERSH 2YMTA 1ZVSB 3WLWD 3QWRD 3IJ7A 4G7YH 4GBXB 3MCKB 1ZV5A 4POZC 3GRBA 3BT2L 4FXGA 3ARUA 4DKFL 1Q9OA 5GQBA 3WXWH 4R8WL 1J8SA 4QHPA 2ZCLL 3ML9A 1JGDB 2ZX6A 1N6VA 1TO5A 1TQVA 3RYMA 3GHEH 3DRTB 2NY4B 3V6BR 4I0PA 4TULL 4CBZA 3GNML 4DAGH 5DLMH 4WJ5A 4CU7A 5GGVL 2NSQA 2VSKB 3IKKA 4OF7A 5I8OH 1JWUA 2E27H 2NTFB 3HI5H 1SPDA 4GH7B 4X8CA 5J6SA 2O93L 1T04B 3DV4A 3FOLA 4DUVA 5MHSD 4QXTA 4JQXA 5HYIA 2DD8H 3BE1H 2BZ7A 4JBSA 3EO0A 3LV3B 2BRRL 5GS3A 2F54B 2P80A 4HCGA 3CU7A 5EOCL 2Y07H 3FUNA 4P4RA 2K7PA 2G4GA 5KSVA 3A6BL 2YGPA 4DERA 5FYLD 1IZJA 3QQXA 4JZJB 5C0CD 2VNCA 1MZZA 1GGUA 1MFEH 2VLLB 4DGYL 5CBEA 3RIAK 3MHZA 3GO1L 3R06A 4EXKA 1QHQA 2NR6C 2VDKH 2M1KA 5J0BA 1F4WH 4YUEL 1QKZL 4YHOL 1MRDL 3MROB 1MCWW 3OJMB 4CAGA 5AENA 1CXLA 1Y1UA 4KY2A 1HWHB 4XC3H 2DQIH 2CO6A 4NBXB 5JMOC 5JA8B 1AG6A 2WB7A 3T6XA 3BYTA 5C6WH 1MIEL 1SBSH 1HKFA 2M8XA 4TSCH 1XBRA 2PPDA 2WBJD 1XMWA 2ICWB 3HCVB 1FPTH 4GY4A 4PJXA 5GRWA 3OAUL 2CJTA 1BEXA 2YRZA 3GUTB 2VXSH 4GT7A 3GDCA 5B7MA 4N2HA 3ZT5A 4F37K 3UAEA 1OAQL 2X6VA 3UO1H 1VKXA 4V1DD 4XPTH 3SJVB 5HVFB 4JPSA 3PHOA 4DTGH 4P06A 3CDGA 3BWUC 4QRRE 4M4PA 4NCC1 5MI0C 3SDAD 3IMRA 2H2SD 1IC1A 4OLXH 2J6WA 4WFEE 3ZGIA 4ZO6A 1SMAA 1NGWB 4MYPA 4JFFB 3QA3A 1O9VA 2R0WH 4M62H 3HS0C 1S2EA 2ZSVA 3Q6FB 2J1WA 3JWNE 1COBA 2A0LC 5EO1B 3EGDB 4J3OF 2BVEA 3RIAF 1FZMA 1A6PA 3C5JA 2Q8AL 4P2OB 5ANME 4XP1L 4LDLB 2B4CL 3TZVA 3ZRCC 4O2FB 1J5IA 2FYYB 1E7VA 5AOMA 3OKNB 2R0ZL 1EEZB 3HTLX 1HZHL 2XV0A 4FTDA 4KV5F 5DUPL 4MD0B 2GVYA 1GGTA 1CN4A 5HJDA 1CU4H 1GYAA 4Q9RH 2GY5A 3HNSH 4LSUL 1PIFA 5DC4B 4EZLA 3LKSB 4N0FB 3KPMA 4LARL 3WNLA 3KZ8A 2VDQH 4UILL 3UGEA 1EHAA 1GGBH 1KPRA 4F37F 2IPTH 3CFBB 5I5JA 5KVEH 2DLGA 4P9ML 2VDOH 5FA4A 5A2CA 3ULVE 3IPEA 5DMJB 1Z9SA 4KGJA 2Z8SA 5AYUL 2AEWA 3PE9A 2HRPH 3UTQB 2E56A 3BPOC 3BGFB 3IRCA 9CGTA 2O72A 2YJQA 4OD3L 2NX5D 5D7KE 5HVWA 2DMKA 4G7VL 4P57B 2G3MA 5JOFA 3GK8L 2HX7A 4JCLA 3IJHB 4OLYH 2Q7YB 1ULVA 5MEQA 4LAQL 4TPRL 5BV7C 4HAFA 4OFDA 3K2UH 4YS4A 2ZWYA 3AS0A 3TCTA 4Y16B 1NGQH 4IOSA 3V5HB 3N42F 3V9EA 2CBPA 2OCJA 1D6EA 4C59B 3L3GB 1I7UA 2QKIA 3DLQR 3UO8B 3FQRA 3RWJB 4OH2A 4PWGA 5F7BA 2HFEB 4JY5L 3CX5J 2KLSA 5CN3A 1KIPB 4D8PB 5C0GA 2HYMA 5GRYA 4FNTA 4XAKD 4PAZA 1MF2H 3L3JA 4U4BA 1ZDSA 4PRPB 1HTYA 3LH9A 4YBQD 5E9DA 2AJXH 1F58H 4PJEB 4F7TB 3SSGA 3O4LD 4P07A 2P8PB 2YQBA 1AHWA 1YDPB 3JQOB 3A67L 4XAWL 1OGAA 4ADJA 3P9MB 4DP8X 5I1KH 4BBWA 3IDYC 1QFWI 1GGCL 2D7QA 2J12B 2ZOWA 3TBCA 1Q9WA 4A2HA 1G7PB 3GUFA 5E6SB 2AKRB 4X9HA 3S4SB 1ZHBA 3DXAE 4M8QB 2CSPA 2CBMA 5DD6A 4ZW7A 3ULVF 3VX0A 3ZTNL 1SXAA 3MUJA 1J5DA 4PJAE 4JFEA 1G6RB 2P1YA 2EE2A 2J88L 1N5AB 3L1FA 1UH2A 4R7XA 2UWEB 4P2RD 4JK0D 2AK4E 4UNTA 3S5LG 2OAAA 2SODB 4G8IA 3O2DL 4LLUA 1NSNL 3B7TA 4BH7B 2O61A 1DBAL 4L3CB 5FKPA 3OXRA 5DQ9B 3BRDA 4U6YB 1A3ZA 5C0RH 1OB1B 5CU9A 3SD2A 5JDSB 5BRZE 4IBLT 1BOGA 1KENL 3OKOB 3K7UA 1T2QL 4ETQB 2BP8B 3T4YB 4BK5A 1ZSDB 2YKLH 4P3CL 2NY0B 4AC2A 5F8RC 1GIGH 5DD0L 4EE2A 2W65A 3H7BB 3NK4A 1N10A 2Y06L 3ARYA 4QRBA 3NQIA 4RZKA 3DBXB 3ARDD 3DGGB 4JFPA 3L3IA 3PDOB 4MJ6A 4MA8L 3U30C 1LO0H 4LCWE 3DPBB 5GRXG 1O7DC 2EUXA 1WCQA 4MMYB 4W9HC 4X4KA 2EDDA 4LP8A 1T2XA 5C0BD 5IWLA 1MQKH 4QRSB 2IXQA 1QRKA 5BZZA 4D9LL 1OWWA 2KS0A 5IMKB 3U0TB 1HH9A 3LZFL 4OAWA 2OJ1A 1A0QH 4L1HA 3MACH 2R2CA 2QFRA 4A7SA 2DIJA 3NCXA 1B6DA 1DTUA 4UAOB 1AY1L 3K6DA 5DWUH 3BPOB 3A21A 5I1DA 3LCYA 4I48B 3SKNB 4JO8A 3MYZA 5FUOL 4MA7H 4HIQA 3HUJA 2WZ5A 5B8CA 5HYQA 4WEUD 5IB2A 1EANA 1LDPL 3NACH 1TJGH 32C2B 3EBGA 4TRPH 5AFAA 5CSZB 4JPVH 4DZ8A 3IU3A 4AIOA 5FLVA 4OZGA 4PCTA 1MLCA 5HGHB 3UTTD 4GIOA 3AFLA 4R4BA 5BZWA 2I7SA 5BV7B 3G04B 5IQNA 4GAYA 2LLLA 2ZXEB 5C09D 2XU9A 1ZDQA 3IS0X 2EIKB 3M1CA 2FD6L 3WJMA 4L3AA 2OSWA 5DYOB 3MZGB 4QRFA 1T5XB 4WCYL 1ACYL 3IYLW 4WEBL 1AI1L 2NXZC 3GLEA 2NUPB 4KKBC 4YSQA 1I53A 1PBYA 3X3GH 4O2CB 1QUNA 5AAMC 5A6IA 2CCWA 4ES8A 1AGEA 5F3BB 4NN5C 4XNAA 3OKMA 1HQRA 4D0BA 2AW2A 4AYID 5D5ME 5MERA 2DQTL 4FI8A 4JZOA 4XWOC 4YDKL 3CZUB 4KY1L 3ZTCC 1I1AB 2DBLH 1F1DA 1Q4NX 5E4EC 3VD7A 4YDLC 2YPLA 1CD1B 4NYLA 5CINH 4EIUA 4WW2B 1BVZA 1FL5A 5LNEA 3QCTH 3WFDH 5E2WH 4TSAL 1GTNA 1EA9C 4FZ8L 2COVD 4PJ9C 1Y7VA 1CI5A 3DO7B 2LLNA 1PLGL 1QP1A 4N0CC 1BWWA 1D5IH 4GRLD 4XOCA 2A9MH 5ILTH 4K3HA 5KSUA 5SWZE 2X70B 1B0WA 1J86A 1S9YA 4WY7L 3O3DA 2CDGB 5EBWB 4NUQA 1A1MB 5HGBA 4NBZB 2CIIB 4G7QB 2CDFB 2Y25A 1UD8A 5D2LF 3UIZA 2CIKA 5DZVA 5TK2A 2BNRE 1YZZA 1BVKB 4LCCB 4UNUA 2CRIA 3T6WA 1Y18B 1HNYA 4YOKA 4ORGA 2F1AA 3D39E 4FLOA 4ODBD 4UIMA 3EHBD 2OLDA 1E28A 4HZ1A 4AQAA 3T0EE 4DP0X 5BVPL 1KGJA 1JGEB 2QEJA 1F6AA 5FYJH 4F57H 4KK8C 3HE6C 4IBWA 2W07B 1WC7A 3J07A 5TGBB 3UTSB 3QFJB 3WIAA 1P84K 1XF4B 1BM3H 3LNHA 3RFZB 1AZVA 1V27A 1KT2B 1W0VA 3NESA 4X8JB 4OFQA 2DQDL 1E8WA 3CLEH 5H37G 4E9SA 1DFXA 4HQQH 4KDTC 4FE9A 3QQ4A 5D8JH 5D5MF 4MNQE 4JRYE 5KG9A 3WD5L 3FBKA 4KNUA 3FSOA 1C5CH 4MDIA 5DQJB 4BKSC 5DMKA 3O3UN 4PSRA 1LP9B 3UEQA 3ARGD 4NXSA 4HV8B 4DESA 3L1OL 4JFVA 1KSRA 3DVNB 3QJHB 1I7TA 3GDBA 4HG4K 2OXGA 3BT2H 3MRDB 3PUUA 1KGXA 4DKFH 4R8WH 2D4DA 2R0LL 2ZCLH 4MCYB 4OF6A 1BF2A 1CD0A 2AZUA 2VMDA 4Q89A 5ACZB 2H3NB 2W0PA 4MSWB 4TVPE 5C9JA 2V2TA 1GMIA 4XZ4A 3LS4L 3MRFA 4TULH 4OW6A 3GNMH 3M8OL 4UT7L 1SDAB 3QEUB 4NFCA 1ESOA 4BDVA 4N20A 1G7JB 1SJHA 3ZZ1A 2YAEA 4PRHA 2FIKB 4NEHB 3U36A 3VH8B 3C6LB 3RVUD 4PGEA 1OV8A 4KTYA 4PRDB 4YPGB 2BRRH 1SJVA 2WLYA 4W81A 5CMAB 4ODWB 2JKXA 2XXGA 4ZTPL 2WVTA 4G1MB 4S1SL 5EOCH 1XGPB 4XN2A 2OW7A 2GK0A 3A6BH 4NN5B 1YPZF 2KPNA 3FT4A 4XZUA 4YDZA 3SGKC 1S7VA 1BREA 1X9UA 4F8OA 4CDGC 2ZKXA 1WCBB 5F7AA 4LSSL 4Y9EA 4YDLB 3VG0L 4DGYH 2GJ6D 1GTFA 3F2LA 1AZUA 1ONQA 3GO1H 3OAZH 5E6UB 5GGQL 5HYJE 4KNTA 4RIRA 3WE1A 4YUEH 1I8IA 4QJ4B 1QKZH 4XP5L 3S4SG 3BVNB 4YHOH 4FA7B 1MRDH 1V3KA 5DSCA 3ARBB 4MS6A 4FMVA 1EXHA 1WFUA 1UQSA 5EO9B 2X4SB 3FTGA 1LWJA 4TNWK 2CAKA 2DWDB 4X9GA 4MB1A 4P2RA 4E9QA 1EEYB 3FRPA 1IIKA 2BY3A 4JFOB 2IALA 3UZVA 1MIEH 2N0KA 4A37A 1BZ9B 3ULSB 5KS9F 1KXVA 4GO6B 2Z31C 1TZOA 2JWYA 1X5ZA 3K74B 3QI9D 2P42B 4N1EA 4AV0A 3OAUH 2NLJB 5I76A 3FCGA 1EJ6A 3G5YB 1L4IA 4IU2A 1OAQH 2K3HA 1SXBA 3L3OB 4HOZA 3NSYA 1CFVL 3VQMA 3AC0A 5HGDB 4MWFA 4PRNA 4YSCA 3GEWB 3EDDA 3TURA 1ADQL 2C9RA 5CBAA 5IJDC 1OAUH 4JFFE 4YDVB 3UYOD 4F7CB 2OK0L 2DQUL 5E8PA 3WKPA 4Z3GA 2D0HA 2NNXA 4YLCA 4K3EH 4AGNA 3LKPB 2Q3ZA 1JPTL 3OM3B 3QNXA 1K9TA 1J0KA 5DFWH 3KPOA 1XCTA 3VMOA 1KIQB 3MNZA 1SHXA 4CSPA 2GAZA 2XWCA 3DHJA 3Q2VA 4U1HA 2Q8AH 4XP1H 3KR3H 4UOJA 1JPSL 1ZANL 2B4CH 3VXQA 3WFCL 4TLSA 4GW4B 4WEMB 2CLRB 3IMSA 5E8OB 1MCHA 2R0ZH 2QADD 1HZHH 5I24A 1U8QA 2H1PL 1PG7W 5DUPH 1WFOA 3UTTA 4QY8B 3G5XB 4G8FA 4RAUB 5C09A 2JB6B 2X4NB 4JUSA 4LSUH 5F93C 3MTRA 4K3DL 1R17A 3H56A 1HCZA 4M48L 4P5KB 3P73B 4LARH 4YXKL 4CC4C 4UILH 3VNYA 5H94A 2IWGA 3ARVA 2BW4A 2VO8A 5F7DA 1IAIM 2CR6A 1JZDC 1MAJA 1T1YB 3DMMC 4P3DA 4P9MH 4FNRA 3NG5A 4HEMA 3HC3L 1EZUA 4C56E 5J4MA 3Q06A 2G5RA 2GCYB 2KI6A 3DJ9A 2WIMA 5AYUH 5C0AE 1CDYA 3F7PC 2Q86B 4LLVA 4RETB 1TFPA 1H8NA 4ZODA 5L8JB 1T0MA 4MMZA 4MAYC 2QPFA 1UD2A 3KPRA 2PABA 1XIWC 2CDEA 4KX7A 1Z2KA 1FO0L 4OD3H 4Z7UF 4G7VH 3WN5C 2XY1A 4U3SA 2A6JB 1IAOA 1DVFA 2I32A 1WWBX 2UY6A 2XZZA 3GK8H 5DURD 5EFIB 2AS5M 1CBVL 4LAQH 4TPRH 1VEOA 3FNKA 4UQ2A 1J0IA 3K72B 3ZHDA 3UYPB 5F1IB 1DHKA 3N43F 3QXAB 1JZIA 4TNVF 3V6OC 3B3IB 3ABZA 4BA0A 1I8MA 5E95B 4LL4A 2I07B 4XVUC 2XCMC 2CJUL 1FNSL 1CFSA 2Z91B 3O6LL 1UGKA 5L9DL 4JDVB 2AQPA 4JY5H 1LMIA 2KLTA 5IQMA 2AQTA 2WQXA 4EI5C 5JMRA 2EKSB 1L0XA 1FYHB 4QOKA 2YXVA 4GINA 2O6EA 4ABVA 4PRPE 2E76C 4WSGA 1L6XA 1MW3A 2PO6D 4R2GC 1WQVT 1QSEB 4TTDD 2KUTA 4D9RD 3A67H 4XAWH 3PV6B 1CZ8L 1GGCH 3NDZE 1C16A 3L95A 5EV7A 1J8HA 1L5GA 1ZTXE 4PR5B 3NBNA 2AERT 3R4RA 4X7DC 4E9XA 3UTZB 1E9PA 3VD0A 5JNYA 2ROXA 5L7XL 4OCRL 2ZCKL 2D3JA 3ZTNH 3N44B 4I1RA 3IMUA 3VWJA 5DT1L 4Y1AA 2OSYA 4NIKB 2F53D 2FLRT 2UWEE 1PG7L 1PX8A 3ZHFA 3P4OB 2UVFA 3O2DH 1NSNH 4WKZB 4E0RB 1DBAH 3ARGA 1Q90A 2H4EA 2E6PA 1T03L 5IHUL 5FR3A 3VQ2C 1OT2A 4KO7A 1RSFA 1T1XB 3FCSB 2NSXA 1KENH 5AKRA 4NP4L 3GINA 1T2QH 5DHDA 4Z7OB 2GYSA 3HI1A 3PFUA 4Q2ZB 4LQFH 4JX0A 4XNBA 5J06A 5HI5C 3OR6A 4P3CH 2NUTA 3UFIA 4P5RA 5C0IA 4M7ZC 2VDQB 4CNIB 3A4DA 3PWVB 2P26A 3HG4A 5DD0H 5FECA 2DI7A 3DWTA 2Y06H 3MREB 1J11A 1KELL 5E1QA 2HFFB 4GRMA 1L9NA 4MA8H 5D96B 3EJPA 3TEUA 4HWBL 4L8SC 1ORSA 2ZOKB 2C9SA 4DPBX 5I1CL 4AQ8C 4YSEA 1H15B 1HHKA 5DRZB 5I5MA 4D9LH 1OZTG 3PDGA 1RIHH 3HLAB 4X0KA 1CTMA 3BVXA 3GMLB 3L45A 3LZFH 1LDSA 5EZLA 2H47C 4TL4A 1DSFL 3OHMB 4J3TA 2H9GA 4Y4FC 1RI8A 3QZWA 1AY1H 4P2QD 4WRLA 3QEHB 1OSYA 1XIWB 1NBQA 3LB6C 1OCWL 5FUOH 4XN9A 3EFOB 3LS5L 2XV3A 3QPKA 3WN5B 1FGVL 1LDPH 2GSIA 2HT4D 3C6SA 3PAUA 2NNCA 2F5BL 4HOXA 3LNGA 5F7KC 3QR1A 1HYRC 3D34A 5JIKA 1JWSB 4CJ0A 3TXAA 1ZE3C 43C9A 4GG6B 2P24A 2FD6H 4FXLA 2XTSA 5CO1A 2UX6A 5C3TA 2D3LA 1ACYH 4WEBH 3LEXB 1AI1H 3RTQC 5KBDA 2Q7AA 3QI9A 1RCYA 2HG5B 4EI5B 4F33A 3K0WA 1QWUA 1R3JB 4IIQA 2WC7A 2MSPA 4TSBL 3P2TA 3RBGA 3S36X 4P49A 4HWUA 3EYQC 3VRJB 2DQTH 3IAPA 5DZJA 5HPMB 4YDKH 4KY1H 4F8QA 3Q6GL 5EU6E 5B1CA 2BNUB 1PZ5B 1C12A 4K7PL 2MEJB 4K73A 3KYKL 4I0CC 5CJXC 4TSAH 4TVSa 2FJFB 2XJLA 4FZ8H 1AMXA 3AQZA 1PLGH 3F5WA 4I13B 5E99L 1S9VA 3DA0A 4GKLA 3PL6D 2P8LB 3T3PF 4WY7H 4JPQA 1QHOA 5E9NA 2J43A 4HXAL 2Y1YA 3WBDA 3ECQA 4X9FA 1EZSA 2K45A 4YSSA 4P23B 3X1NA 3O11A 2WJ5A 1C8QA 3KGUA 4NZ8A 2EIJB 4QYAA 2DIEA 4G9FE 3NDYE 2CO7A 5BVPH 1VFMA 1DJWA 1HJBC 1EFXB 1EHLL 1XGRB 1F97A 3D69B 3R0MA 4XMKL 3UTSE 4JFZL 2FEJA 4ODHL 1HCVA 3CPLA 1FG2A 3LMJL 4JDZA 4XMZA 5E03A 2BPBA 2WSKA 5DC9B 1S9WB 3NABL 1D7FA 2VE6A 1CGTA 2DQDH 1HOCB 3KWXA 3T2NL 4YVUA 2EDFA 5T3XD 4J2XA 1OWRM 2G9HA 3F7YB 5GS1A 3REVA 3FYEB 5EC2B 1K8IB 5HJGA 4AUJA 3K5SA 2OMTA 3WD5H 4M03A 4Z3EA 2NNAA 3TBSB 2VDML 2H1XA 3R8BB 4H1LB 1AGBA 4NQCB 1LP9E 4HHGA 1JHLL 5C07B 3L1OH 2QJDA 1LK2A 3NSDA 4WWID 3FO2B 4X6DF 3GSRA 4LHUA 2OR8A 2ZD0A 3NIGF 1OQOA 3W5MA 3BP4B 2OR9L 2FLBT 2NW3B 5T33L 2R0LH 5KVDE 3CVDA 4UV4L 3UG5A 1WWCA 3HZVB 1JFQH 1BA9A 1J5HA 4UU9A 3K8LA 4P48A 1FF5A 3LS4H 3M8OH 4UT7H 2NCMA 2YRBA 1BZ7A 1A02N 1NUGA 4IBUA 1HE7A 3MQIA 3BQUC 2AV7B 1LNUA 2W5PA 2JFCA 4PFEA 5FFLA 5GGUB 4IOFC 4ALAL 1DQJB 4M56A 2YGVA 2Y6SC 4FHKA 3NP3A 5D1XC 4UT9L 1VFOA 2WUCL 2WVUA 1KGWA 3QNZB 3OAWA 3HPLB 1JV5A 1RKRA 3N40F 4ZTPH 3N1PC 4S1SH 3WIFB 3JZ7A 4BSWB 5BOZG 4IYKA 5C0EB 4JRXD 4KH9A 1LE5A 1ZA6A 2QLVB 4K8RC 2H0PA 5AVQB 4LSSH 3VG0H 4MDJA 3T4AA 4JFDB 5T1LA 5B1JC 3RPKA 4FFVD 4EMZA 2YN3A 3VI3B 4KKAD 5GGQH 1JZ6A 4PJ5D 2X7LB 4XP5H 5ADPL 3QUXA 4MZ2A 5G4NA 4BFGA 3STLB 2F53A 1GSMA 3UBXI 4HJSA 3WSQL 1HXMA 2UUDK 3DX3A 5BVJB 3U9PH 1KIUB 1IGCL 1KFAL 2P5EB 1CF1A 5IUCA 3UABA 4IHOB 3M6DA 3ZO0A 4B41A 2FQFA 3CVHL 3G5WA 1YVLA 2XBTA 3OR7A 5INCB 1AQDB 2CHZA 3VFOA 1RJLB 3O81A 2CNYA 1AKJA 3BUTA 3PWLB 4HZLB 1L3NA 1DQIA 3ESNA 3MRGB 4K94L 5I1EH 2G2NA 5DRNB 5D93C 4QHMA 5HPOA 4I3SL 4DCQB 4MCMA 1GJWA 1N8ZA 2XKNB 4ZW6A 2NY1D 3RY6C 1TQBC 1CFVH 4IDLA 3WTVA 1KCKA 4OGAD 2CR3A 4YFLF 2I9TA 5L2JA 2XXMB 1XCQA 1ADQH 4JB9L 1T83A 3PG2A 3O3AA 4DJMA 4EIBA 2CLZB 2OK0H 2DQUH 5ELIA 1WIUA 3NP4A 4QJ3B 2IANB 5HHME 2VLRB 2JCCB 3AG4B 1UKSA 3LH8A 3QJTB 1ETZA 3AXLB 4NC1E 2B2XL 4KO5A 1R34A 1M71A 1JPTH 3CFJB 3QVAA 1N2RA 1JZGA 1CXKA 4LEOA 5IOPB 3L3HB 4JR9L 3OJ2C 1A5FL 4F7EB 1FHGA 1BZQK 3ABGA 3IJYB 1AC6A 1YNTA 1JZFA 3TOPA 4P2QA 1JPSH 4DEPB 1ZANH 3X3FL 3QJZA 4R3SA 3WFCH 4ZUTB 1AQ8A 1D9KD 5FO8A 1P6AB 4PJCE 2X6BA 4XNUL 5HHQB 1KIRA 2H1PH 3HG3A 3DX6B 2PP8A 1OL0A 1HHHA 5FKAA 2D7PA 4AKOA 3B83A 3CN1A 2WLHA 3NZ8B 5ERWB 2XZCL 4N87A 5AALA 4K3DH 3ROOA 2OI9C 4M48H 4YXKH 1VACB 2C8NA 3QS3A 3BQUB 1WBYA 4RAVB 1KUMA 3EYFA 3HC3H 3WNOA 1T1ZB 3MV9E 5F3HA 3KVPA 4FCHA 4JGNA 4GKOA 5HGAA 3P2BA 4JKWA 5IHBA 3BXNB 4Z7WA 4YDMA 2ARWA 4B6ZA 2QPSA 5J5EA 4QAWA 1FO0H 4POUB 3K71A 3IXTA 1W15A 3FT9A 1NH6A 1Q0EA 5B39B 3K3QA 4KK9D 4JG9A 3ULUC 4C4UA 4F80A 3GJEB 4RWYL 3C8HA 3QXVA 4ZMWA 5LDSA 1CBVH 2BNQA 3QORD 1JVOA 3P54A 4PJBB 3QDGD 5E6ZA 1AO7A 3MLZL 4YGVA 3UH8A 3TFKD 2FVNA 2BRQA 3AABA 1OCRB 3B2DC 2F18A 5H35A 1NCWL 2CJUH 1D5XB 1FN4A 1FNSH 2BY2A 2J6EA 3O6LH 4HC1L 4XXDB 2PW2B 4QT5B 2GBAA 2R2EB 3KYNB 2YK1L 4FKHA 2IH3B 4Q8BA 3RX7A 1JK9A 1B4LA 1J48A 3RWFB 2H8PA 1IGML 4KJPC 3MCG1 4UBDD 5CZKA 2GTWB 1F3DH 2OXHB 1ASPA 5T5FA 2JKLA 4GQPH 2EABA 2VZ3A 2XQBL 4TF4A 1ILUA 1BD2E 4IKLA 2WVVA 3ECBB 1G43A 1QSEE 4MXQC 5AW9B 4JQXC 1A7PL 5EBGA 4R4NC 1IEHA 2ZUQB 5BQDA 5EA0L 1FYTD 5GJSL 2NYYC 2X4QA 2C3HA 3S2AA 1U8JA 1CZ8H 4ZUWB 3W0WD 1AFVL 5DUML 1TQBB 3NCBB 2ICCA 4YSTA 5L7XH 4OCRH 1ZT7B 1FDLL 2QSQA 2ZCKH 2VKWA 2FGZA 1X7SA 2ALWA 2FEEI 4P59L 4WU5A 3TVMB 4C47A 2XFXB 3OB0K 1DANT 2CGYA 5DT1H 1DUZA 2R29L 4JFHE 4XH2A 5I0DA 2OMXB 4PREA 1PG7H 1TVBA 1ND0B 4R0LC 5FA3A 4B96A 4HUXA 4PHZA 4L4JA 2X4TA 3SO3B 4ZQKB 1JAEA 5DA4A 3NZUA 3BMVA 4H1LG 4PS8A 3QCUL 5TF1L 1T03H 5IHUH 3SDCD 1FFRA 3F12B 4PRBA 1JF5A 3GMOB 2C9QA 4NP4H 4Z7OE 3V0GA 1NLDL 1SFDA 3U1SL 4DO6A 5LBSL 3ILQD 2Z8VC 1F11A 2MPVA 4XTRD 1IUZA 3NPSC 1I7RA 1R47A 1AG0A 4GSRA 1E3FA 4OFVA 1KELH 1WAEA 3FHEA 3AS2A 3H6AA 5FV1L 2BIIA 1TZIB 3Q2WA 1OE1A 1RJZB 2D4FA 5KJ4A 4HWBH 1ZK5A 4Z3TA 3C5ZD 3QUKA 2PPAA 4NZDA 4BFOA 5I1CH 5CGTA 1L9OA 3V6FB 5B3JE 3V79C 4G1EA 2YQ2A 4B9PA 5J7CC 2ZG3A 4KQ0A 2DOCA 1IM9B 5F7LB 3KG5A 1DSFH 2O5YL 4JRXA 5FGBC 4G8GB 4TQIA 4IOIB 3LOWA 5FGCE 1JP5A 5DJ0B 4AEEA 2YBRA 2ZX8A 3VA2C 1NJ9A 1OCWH 4IHBA 2GY7B 3LS5H 1FGVH 4MCZA 4X4ZA 4KJYB 2W95A 2YGOA 1NAMA 2PWEA 2HFTA 3IKCB 2WTPA 5TPWL 1FVDA 5IQLA 4BQ9A 2X9XA 2M83A 3VB8A 4Y5YA 4HLZG 4WGVB 3HR6A 2FH8A 3PAVA 1OTTC 5IKCA 5J13C 5LXVA 2EVIA 4DSYA 1NFIA 4FXGB 1KEML 1D2OA 1Q9OB 3LKNB 1ETB1 4LIQL 3RGBA 1K2DA 1IEBB 4A67A 1J7VR 1FFPB 5IB4A 2FSDA 1WRFA 5FCUL 3I3DA 2JKNA 3BJLA 1X5AA 1YMMD 3KLAB 1LVEA 4I0PB 5EIIB 4WHCA 4WJ5B 1EAOA 1U6AL 4TSBH 4XNZC 4HMCA 1JWUB 2JJVA 1P7QA 1YSOA 3L9RA 5HHPA 3Q6GH 3FOLB 3GTVA 4LVNC 4MQ7B 1B90A 2WWMC 5AZEL 5HHOD 4YPJA 3RZCD 4K7PH 3EO0B 3GXIA 3KYKH 5K9KA 4Z76A 3C87A 3RPIA 5E5UB 4YFDB 2Q9OA 7TAAA 2DQGL 2A2QT 5E99H 4IGBA 4PUBL 4P4RB 9PCYA 5A2AA 1B2WL 2FX7L 3KPSA 4HXAH 5HYSA 2JI1A 3I50L 1D7DA 1FCCA 2EUWA 5CBEB 3MV8E 4LKCA 1CWVA 4PJ7E 1B0GA 1CUOA 3QWNA 4ICWA 2VN6A 2QKIC 2YPVL 1AXSA 1WWWX 1E27A 3HNTL 4QHUB 3BUYA 4U49A 2CO6B 1X5GA 2E3VA 3OGOE 1PY0A 4WUUD 3S3BB 1EHLH 2YOAA 1FP5A 4XMKH 2X05A 3FQWA 4JFZH 4WSKA 1IZKA 3IRPX 4MKMA 2YRPA 4JKKA 3UYRL 4AG4L 3LMJH 3FFOA 2WLMA 4PJXB 5IROD 3IN0A 3NABH 4RX4A 4DEWA 1Q1PA 4K5MA 1AHWC 4K55A 3JT0A 4JJ5A 3ALPA 1BQUA 4APQD 4CADA 1D7CA 1MAML 3D2TA 3PHOB 4FQJL 5DJAA 1S8DA 3VXSD 4HVBA 1Z66A 2WLIA 2DBJA 3LQAC 1GY1A 3PJSA 3EFFA 2B20A 2YGQA 4TLKA 3HB3D 3ZHKA 2VDMH 3MDJA 1MCFA 4NQCE 4E2OA 2N7SA 1KBVA 4OGXL 3ZSSA 2P46B 1JHLH 5C07E 2PW1B 2ZSVB 3LNFA 4XCFL 1WFJA 3WELA 5EEXA 4A1RA 1BXUA 4PRIA 3SQBA 4MVBD 4GKZA 3G6JF 1OD9A 4XRCA 5T33H 2V7NA 5T3XL 4MJID 5M94B 3BSZA 3DARA 3QORA 1QRND 1TTBA 4UV4H 3V10A 4HK3N 3EUUA 4C57C 1HILB 3C5JB 3RB7A 1I3RA 1JGIA 3QC5X 1UT9A 5BS0D 2EZ0D 1R5IA 3TZVB 4BK5C 4U1LA 3IJEA 4PJ7F 4UOZA 3DV6A 1CT8A 2J1ZA 2VMCA 5JQHC 3FSZA 4ALAH 3KGRA 3O3BB 1AHKA 2EE3A 2X53A 2AQRA 1CCZA 4UIKL 4UT9H 3ISWA 2WUCH 3EKCA 1KBGL 4WNJA 3RDTA 4FHBD 3ZPDA 2JI2A 1AOHA 3WOVA 5F89A 5IWLC 5DVNA 3RGVD 3KPMB 5I17B 3QUML 1FVEB 4K9EC 1CJYA 1KPRB 3TIEB 1JPST 3G7TA 5IW1A 5E2UL 4LVNB 3NCJL 3W0WA 4JFDE 2Q2LA 4X5RA 5EF1A 3VI3E 1IKOP 3QJSB 1OTSD 3VMNA 3IDNA 2APSA 1GJIA 3HE7D 1QABA 5ADPH 5EBLA 5B8CC 5JOFB 2FCBA 2DJ4A 1KNOA 2VB5A 3OWEA 4YHNA 5F2FA 4EUPG 1EZVY 3WSQH 4L9LA 2YD5A 3DBSA 5FYJE 1QLEL 2CA3A 3AREA 1LYQA 1IGCH 1KFAH 4IS6A 4YJZL 3EYVA 2XIDA 3VFSA 3US9A 2OULB 3T2PA 3MR9A 4TOYL 3CVHH 2AMGA 1UCBL 5E0FA 1M9WA 1I7UB 2QKIB 3BFOA 1R6VA 2BWQA 2VW7A 4K94H 3FQRB 2EH7L 3F64A 3B8YA 2GIXA 4PI0A 3CN0A 4I3SH 3KLSA 5C0GB 3IMBA 1ES0A 1CD9B 1S7XB 5IB1A 3P40A 4M93C 3SGJA 5FDYA 3W11D 3MJ9L 3US0A 1LHZA 4JB9H 2CUIA 2IOIA 2OR7A 3CFCL 3VFRB 1VGKA 1AHWB 3C5ZA 3FTYA 4Y9GA 3VM5A 1T6BX 1ASQA 3MPCA 4KUZL 5KBNC 2H2SC 1QAWA 1B9KA 1BF5A 1Q9WB 2B2XH 5JIIA 4OZIF 3F84A 4JR9H 3V0WL 1A5FH 2XWDA 1GH7A 3A4EA 3IAGC 4C83A 4F8LA 2OV0A 3P11L 5DD6B 5I0VA 5F0JB 5J1AA 2XVGA 3X3FH 3T3MB 3QNFA 4R7NB 2WN2A 3L5XH 1LTXA 4L4TB 4WNQB 4G8IB 3FK3A 4XNUH 4LLUB 1ZSHA 3H0TA 2O61B 3E9UA 4UZUA 3HFML 1HVXA 3RG1C 5JORA 1S7RB 3OXRB 4DKTA 1U8NA 2XZCH 3BFWA 4ATWA 4Q58C 2YARA 4ZQTA 1XT5A 4ENED 4WTZA 5GZOD 2CXKA 1M42A 4CSSA 3OXSA 1DFBL 5FV2A 2R1XB 1UURA 1C8PA 1UT1A 1YMMA 2W65B 4EEEA 1KCWA 4B5EA 4L1SA 3T2LA 3GXDA 1PZAA 1XH3A 4JFPB 1YYCA 2H0JA 4FQQA 4AMKH 3D4YA 4XPGL 3GB7B 4HUVA 2ZP0T 5HHOA 4KTEL 4JW3A 4YBLB 2YIHA 2CQVA 4KKPA 3U7WL 1KBBA 3W5NA 2WWOA 4XBGA 4ATTA 2ZSWB 4RWYH 4J3OD 4PJBE 1HH9B 5E6ID 1OGSA 3AZUA 4OAWB 4OGZA 5TJWK 5JOPE 4I2XA 3MLZH 3OG6B 4PU2A 1OEZW 2RACA 4NQTA 2RCSL 4RMUA 2Z0UA 5C0CB 1NCWH 5C71A 1R3HB 3H2WA 5I1DB 4OCNC 4HC1H 4X7CC 4YFEA 2YPKB 1EAPA 5B8CB 3HUJB 3KXFD 2YK1H 3L4UA 2N59A 3ILPB 5ALBL 4JDEA 5CEYA 1IGMH 3KPLB 1EO7A 3IU3B 4P2CG 4H25B 4FP8L 4OZGB 3BGMA 4F5CE 5EMYA 1MLCB 4HKXA 3QIUD 2XQBH 5BZWB 3H9SE 1T7XA 2H2PC 5HDLA 4GAYB 1A7NL 2C9PA 4L2LA 5EO0B 1D5RA 2OL3L 2WCGA 3WJMB 4CKQA 3UCRA 3KGTA 1XF5A 2CU9A 4ZUUA 2VITB 1A7PH 8FABA 2VT0A 2WCPA 3AWFA 1P84J 5KYNA 1UXLA 1TEFA 3IF1A 5TE6L 5EA0H 5GJSH 4W1TA 5DMGD 3BLPX 1LJMA 3Q8CA 4MNGE 1EAQA 2WBJB 4HUMB 1HHJA 1WGVA 2RB8A 1QUNB 5IROA 4D0DB 1AFVH 5DUMH 2EVHA 3I9AA 3OKMB 1MVUA 3LPGA 2DY2A 4IKKA 4D0BB 5SX4H 1B4RA 2ZXCA 5MERB 2MNJB 4APQA 4GSUA 1FDLH 2EIZA 4P59H 4JHAL 4V1DB 1HIMH 4MXVE 3LQMA 5F1KC 3V8OA 2R29H 1S7TA 1FL5B 3SDAB 3VFMB 1NOAA 2GEQA 3QIWC 3NA4A 5EUOF 4MS8C 4HG4J 3BP6A 5AB2A 1S9YB 1ZXKA 3QCUH 5TF1H 5IR1A 1TYJA 5HGBB 1WUNT 3GM0A 5DVPA 4BINA 1U2YA 5GS0D 4LT7A 3WJJA 2Y5EA 1WBZA 2CIKB 1FNFA 1FZOA 1KXVC 1NLDH 4J3UA 3U1SH 5LBSH 1QRNA 3J8F7 2VMFA 2WXOA 4UOW1 5KANG 2CUAA 3VAEA 2HJLB 4ORGB 2IDFA 4UIMB 3ZN6A 1E28B 4HHWA 1ZKAA 3FO9B 3BCDA 3PNWA 4FFWD 3HMXA 2BVUA 3CFNA 4PBVC 2IAAC 3S37X 1WC7B 1Z9OA 5D2NA 2A6IA 4W9FC 4XHQA 1GOFA 4J4PA 4NUMA 3ZT7A 2P3YA 1FO0B 2KH2B 4GG8A 2W38A 4P46D 3JV6A 1KCRL 2X4UB 2WIIA 5JYLA 1RZIA 1F00I 3RGVA 4S11A 1H3UA 3UL4A 4YSPA 4A66A 4PI2A 5HI4C 2O5YH 4G8GE 1XR9A 3FT3B 3K46A 4DPAX 3OZLA 4OQTA 3U4EA 3BAKA 3QQ4B 5K9QG 1N0LA 1OVZA 1FVCA 1KYDA 4N8CL 1XGQA 3GHPA 4XBEL 4YHYC 4I5BB 5KG9B 3EBHA 3OZ9L 3PY9A 1XB6A 2WKGA 3HRZA 1DEEA 3OG4B 2WNWA 4MDIB 5TPWH 4DK3A 3HE7A 1NANI 2X4RB 3KLQA 2NX5B 1GZPA 4BFBD 5D55A 2XTJE 1WIOA 3N85L 1I7TB 4POYA 4TV3A 5ID1A 3DSFL 1KEMH 4XPFL 5T5NG 5TQ0L 4LIQH 3Q8AA 3LHPL 4Z5RA 1BG9A 2F19L 1VEPA 5DD3L 1NINA 4EBQL 2A6KA 3B5TA 5FCUH 3CZGA 4MHHG 4DW2L 5A3ID 1V8HA 4XOBA 3RVVC 1ZA3B 1U6AH 4BDVB 2A77L 4QD2E 2YEVB 4CRPA 4OFYD 3F6LA 1ZE3H 1RZPA 4JRFA 5EZJA 3ZKQD 4J3BA 4L3EE 4GIAA 3MUZ1 5AZEH 2O26U 4Y19E 2E74C 3U36B 4PGEB 4PY7A 1KDIA 2GT9A 2PXYD 1W0WA 1NOLA 4IBQA 2G75A 4MMZC 3QARA 4LVOC 1WJ3A 2R39A 4FTVD 2DQGH 2FEDD 3WY2A 5T1MB 2WNXA 3IRZA 5IVXA 5IVNA 2ZWSA 3O4LB 1MH5A 4PUBH 3U7AA 4GLRI 2GK0B 4X4MA 1B2WH 1DVFC 2XUWA 2FX7H 3IFNL 3W9EB 1S7VB 5HYEA 1RH8A 5GJTL 3K6SB 3I50H 3ARXA 3JVGA 1RXLA 3GSXB 3QO0A 4LCUA 5JHLA 1ONQB 4HHAA 1PLAA 2IWFA 4QLWA 2ZUUA 5CGYD 5CGMA 1TQSA 2H32H 1I8IB 3IDIB 1XB8A 1NGXA 3S3DB 5DSCB 3HNTH 1A1OA 4EJ1C 3MLVL 1UQSB 1ZGLP 3S3CB 1OLLA 2ADYA 4P2RB 3CZFA 3QFDA 3FRPB 4FCAA 4HJ0D 1DLHA 2IALB 3E3QC 3UZVB 3T0DA 2BJML 3BAWA 4EVNA 2WBXA 1JRHI 2E7BA 2B1OA 1KPVA 5BRZD 1G9MC 2HTLC 3UYRH 2KZBA 4AG4H 4QWWC 5J11B 5K9JL 1EFQA 4M5YL 1BSIA 2ZUSA 4NLHA 1I8KA 4PJIE 2JV6A 4YWGL 4PIBA 3L2LA 4IU2B 1MAMH 1ID5I 1DJIA 1M7UA 1NUFA 2J5WA 2GFBA 3C2AL 4G59C 3WAKA 5CNHA 3N40P 4FQJH 3WXVL 2X87A 4MWFB 2X89D 3ARDB 4OI7A 5CBAB 3SGDI 1JOIA 5KJ7E 3VWJC 8PAZA 5H2BA 4OGXH 3DX4A 5E8PB 4XCFH 1JF6A 1KFGA 4LGRB 2F74A 5B1KA 2VLME 3ZE2B 4FQXD 5T3XH 4XCCL 4Y4HA 5E6IA 3CH1A 5AD0A 2B9BA 1TZ8A 3GS0A 4OSUL 3TGXA 4WGWB 2MPAL 3LQAL 4XP4L 1FWXA 5BQ7A 5L0QC 3KPOB 1XCTB 3WLBB 3MNZB 3GJFA 2X2UA 1JHKL 3VXQB 2QZ5A 5AKTA 5C2UB 2IIJA 1CXIA 4J1UA 3UBXA 2J55A 4YO0A 1U8QB 4J27A 3FFCE 2H6OA 4UIKH 3UTTB 3QIUA 2VL5A 1KBGH 3E2HB 4PBXA 3B2VL 4AL8L 5FYJU 3D3VD 3L9BA 5C09B 1BQHA 1LO3L 1BPLB 2WLNA 4G43A 3ZIMA 3MV7D 1ZLUH 2MNWA 1HWWA 1PDKB 1V54B 3V0VB 2XOTA 3CJJA 5A43C 3QUMH 4IM8A 5GGSY 3L4XA 5H94B 5LAPA 3V2AR 1WVZA 5F7DB 4FLRA 3FUJA 4P3DB 5E2UH 3NCJH 4PJIF 2OMZA 5KSBF 3SBQA 4YXHL 4LLVB 4UYQA 4A7TA 4QRRA 4NNPL 1IIIA 1NC2D 1TJHL 3K2IA 4LVOB 1MCIA 3KPRB 1T0NB 3APCA 2VM9A 2DYPA 4M1CD 3ZUCA 4LOUC 5D7SH 2AV1A 3O8XA 3F85A 3FCTB 5CLZA 5CLYA 1IAOB 1DVFB 2UY6B 2F08A 2BW5A 2OSLB 1A6VL 2NQ3A 1VRSA 3W39A 1QLEH 2X9WA 4UQ2B 5AG8A 3DPDA 3KYOA 4PJHF 2H6PA 4CN6A 4GRLB 4PV9A 2BIPA 3VQLA 3P0VL 1YNLL 2HTKC 5CD5C 1I8MB 5FHBL 2NT1A 4TOYH 2BNRD 3BDXA 1UCBH 3D6GA 1A8JH 1CFSB 1O6SA 4UF7C 3D39D 1SDDA 5IM7B 2EH7H 5CEZD 5ANMA 2OMWA 4G82A 4QMEA 2HJFB 3BPCA 3V0DA 3TNNB 4IIQC 4TM9A 4G8EA 3M17A 3MJ9H 5K33A 3HMWL 4EN3A 1OP3K 1P5UA 3R18A 3ZKXB 3CFCH 4N8VB 5GGTL 5JQIB 1TITA 3MRBB 3IETB 2VDMB 4CBPA 1KN4L 2B14A 1NC4A 1QLRA 4KUZH 1ERNA 5HHXL 3PABA 1C16B 3L95B 3Q5TA 1J8HB 1L5GB 5JDJA 1AYRA 3DIVA 5F6HI 4MQTB 3S2CA 4MRBA 4BZYA 5JNYB 1TXKA 2V5TA 3V0WH 4TUJB 4WO4C 1HU8A 5HJBA 4MRCA 3P11H 4MNQD 3VWJB 3BIKA 4EUPH 2F8XC 3B2MA 2G4EA 3HZKB 5DZOA 4BYHA 4KHXL 4L4TE 5E6RB 4XE5B 3D25A 5I75C 3O9WD 2GK2A 3B9EA 1J0ZA 3HFMH 2CKBB 5ACMA 5A2JH 1I3VA 3ARGB 1R3KA 3N1MC 4U1IA 5L0QB 3VACA 5A2LH 3D18A 4TVPD 1JZ4A 3CV5A 5CU5A 3OR6B 1DFBH 2NUTB 5C0IB 3VFNA 3BN9D 1GS7A 1SN5A 4DPCX 3HN3A 4ELME 3NRFA 4JPWL 5L8LB 4OI8A 2DM3A 4I8DA 4YHKL 4GRMB 4N6RA 4XPGH 2WAHA 5GS1C 2ZJSL 4KTEH 4AIXA 4PLKC 1AQMA 5F6IC 3U7WH 2FSEA 1H9DA 3P3YA 1HHKB 2PXYA 1WHOA 3CBJB 4OF0A 3VWKD 3TV3L 4PS3A 1NCBH 5ES4B 3IGAA 4OZFA 1I1CA 2DI8A 3OL2A 2UZYA 5FYLE 2IAMD 5JXEA 2RCSH 4ZX3A 1RZKL 5C0CE 5EB9A 3QZWB 1ET5A 5FK9B 4Z0XA 3UPRA 2GJZA 4BQBA 4FLSA 2RQ8A 3HUJE 3OQRA 3WJLC 3DXAA 2IJ0C 3PQYD 5HYJD 3Q2CA 4BKLA 5ALBH 3LNDA 4O5LL 5D1ZD 3C6SB 4EDXA 4PJAA 3LYRA 4FP8H 3ARFA 3BGAA 5ETUA 3VGEA 5E56A 5HDBB 2AK4A 1A7NH 3ZE0E 4OLVL 2OL3H 3ZY7A 2E9GA 43C9B 2P24B 1A65A 4I18A 4LNRA 4LSQL 5JZ7D 3B6SA 4LFHG 4GO8A 5INDA 4AE1A 5TE6H 2Y7MA 5F0MB 1H5BA 3FO1A 3FT1A 1KF9B 4JO1L 2BSSB 5BRZA 4CA4A 3QI9B 1PEWA 3F04A 2Y7SA 3MVSA 4BFEA 4IBVA 4H8PA 4IIQB 3AU1A 5GZNA 2XX1A 4UQCA 5EU7E 4DK5A 4UQDA 5I1GL 4NJAL 4V1DE 4JHAH 3CZKA 2X42A 4ELMF 3APMA 2J73A 4TQEL 1C12B 3T4AC 5IUSA 1OANA 4LCWA 4QYOA 4QRPD 3IGFA 3QQ3A 4F8TA 2CUMA 1QG3A 3D2UA 5HY9A 2Y0SA 3F62A 4L8CA 3F5WB 3Q1EA 2H26A 3QUXC 1S9VB 4I87A 1P5VA 3WDIA 4PLJD 3HN8A 3U7YL 2L7UA 2X1XR 3LKQB 4QRQA 4DUXA 4L8DA 3IEAA 3TA3D 2FJHB 4HFUL 4X7TA 4NO2A 4TKWA 1E6JL 4F27A 3CK0L 2G3NA 3HHSA 3VD1A 1WAAF 2DWSA 3MO1A 4YEFA 1S9XA 2EXSA 3HBZA 3U46A 3FU3A 3NA9L 4PJDE 2O6CA 2OMNA 4OF8A 2XWJA 3I02A 1HI6A 4ACTA 1ZVNA 4QNPF 2QADB 3SYCA 2E8ZA 4PD4K 1FH5L 3QP3A 4QAMB 4UT6L 2F1EA 3TWCL 2V5YA 3CPLB 4AKQA 1ITBB 2ETWA 1H6EA 2QSVA 5GS0L 1H8SA 5DHVA 1T83C 1KCRH 3MRNB 2Y7QB 4PJEF 3V4PL 2VE6B 1CXHA 4LSRL 3FUKA 3EJTA 3T0AA 2R69L 2C34A 2EE6A 2G9HB 2WHVA 3NSXA 4FEIA 5EOTA 3REVB 4KAQL 4Y4KA 1RIUL 2ZPKL 4CC1A 5D5MA 5F6IB 3BWUF 2BOBA 4N8CH 1HESA 4XBEH 2OMTB 4ZO9A 1SF5A 3OZ9H 2NNAB 1IMHC 5KN5B 1NC2A 2NY6C 4OJYA 1A4KA 1AGBB 3QPQD 4HXBH 2Y5QA 3HIZA 2NX5E 3CIQA 3GXNA 3TS8A 1LK2B 4JFTA 5DI8A 1KCUL 3N85H 4A7QA 3PJNA 3DSFH 1RL1A 4XPFH 5DURB 2PCXA 5SWZA 5TQ0H 2ARJA 4MB3A 3LHPH 3PPEA 4GQQA 3EOBA 2F19H 3O45A 4C54A 5DD3H 4EBQH 3GXUB 4NC0B 4ZXBA 4FFYA 4DW2H 2BNRA 4K3JL 4NHUA 3N1FC 2ADIB 2A83A 1OT1A 1FRGL 1S46A 2VXQA 2A77H 5EPMA 3D39A 4ZW5A 3WMSA 2Z6FA 4NXKA 3T0EA 4XNMA 3X14B 4RNRA 3N1QC 1NIFA 3X11A 2EQDA 3FB6B 4U2YA 2P8MA 2COQA 4XAKE 4MQXD 4P5TA 3DSNA 4AJVA 2PO6B 3O4LE 2JKRM 2K6ZA 2GG1A 3G5ZA 4GXUM 4OF3A 5IQOA 3N0PB 1N6QL 1WDAA 1G0DA 4KITB 4EIGB 3IFNH 1TYRA 4FG0A 5GJTH 4MMXB 4AQ1A 5ISZD 1QNIA 1OARL 1XL4A 4ZOCA 2DIAA 1R33A 1NIBA 3EH2A 3T77A 4MNQA 2WKOA 3QUXB 3UBGA 3WNIA 3MLVH 4TVUA 1A1NA 2F53B 2ZONA 2UX7A 1AZBA 3P02A 1HXMB 4L8BB 4QXVA 2EACA 2VUOA 3C5SA 5F9OL 4NUPA 3MCKA 2BJMH 3WHXA 4ABQA 5CZVL 1UATA 1DN0A 4TQ8A 5K9JH 4M5YH 2VC2L 4QXUL 3OR7B 3VFOB 3ESOA 5LGKA 3MBEA 3FF8A 4YWGH 3T0WA 4Y8AA 5LKNA 5EEVA 3VSVA 2RGSA 4MFHA 5F21B 3C2AH 1KBKA 3BP5B 4HALA 3WXVH 1NDGA 4NBYB 3T1WA 5L2JB 4KKLD 1MY5A 1YNKL 1UM5L 1XCQB 1AR1D 1BJMA 3B37A 3O3AB 2BFVL 3HI6H 5C0BE 1Z5YD 3FRUB 3SZKC 3U9WA 1DJZA 2C7UA 2R8SL 1A14L 2CG9X 1ETZB 2HX9A 3NCFB 3CPUA 4XCCH 4JZJA 3C5XA 1HZLA 4OSUH 1N2RB 2MPAH 3LQAH 4LEOB 2WV3A 4XP4H 3C60D 4HGKC 3FOMA 5I6XB 2NT0A 4KWUA 4ZW3A 1P4LA 1WK0A 1JHKH 1YNTB 2W80C 2ZNXA 4P2QB 1TNNA 3TF7C 2W9EL 3QZWG 5JIHA 4R3SB 2DKUA 3MRPA 5HYJA 1K72A 1NCHA 1CDCA 4EZMA 3MROA 4NQSB 1MQ8A 4FXKA 1KIRB 4KRLB 4YC2B 3V4VL 3IAQA 3B2VH 5FKAB 5FO7B 4AL8H 3PF2A 1LO3H 3N04A 1MCOL 5IIEB 1SXCA 2EUVA 4IIZA 3FU8A 2J4WL 1WBYB 3EYFB 4JZNA 4BELD 1TDQA 4I1PA 2O6FA 5AOIA 5F3HB 1ECYA 2DQFA 5G5DA 4YXHH 4JNXA 5ICUA 4U2ZA 1FFTB 1SQ2N 3CDCA 1TJHH 4NNPH 4Z7WB 3ECVA 3TJHD 2CBQA 2HH0L 2X5PA 5EORL 4PGDA 5EZPA 3HZYA 3K71B 3IXTB 1FFNA 3ARQA 5C1MB 4QRPA 4JFFA 1A6VH 4J8QA 4JKMA 1SYSB 1UXSA 4O9HL 4Y5YC 1AO7B 1P1VA 3P0VH 3VXMD 3LKRA 1U8KA 1YNLH 2P5WE 2YEQA 3PL6B 4X50A 5FF6A 5FHBH 3KMDA 5DMYA 1TJMA 4LESA 3BAEL 3EG9B 4FI6A 4NAJA 1ETA1 4P2OA 1NAKL 1PGRB 2Y24A 1JK9B 4JLRB 5I8EA 5I28A 2H8PB 2Q0ZX 1XZ0A 2NW2B 4O2FA 2FYYA 3R19A 1QSVA 1IKNA 3OAYK 1EEZA 3RQ3A 3T0VA 3HMWH 3SDXB 4BV1A 1RAMA 2WVVB 2G0LA 3GSOA 4G6AD 5GGTH 4QTFA 2JJSA 1W16A 1KN4H 1UUNA 2YAPA 2X4QB 2V33A 5HHXH 3LKSA 4N0FA 3S36L 3TN0A 5IEHA 3W57A 1JXDA 3GM8A 2FZ3A 4IGBC 2XBDA 4Q6KA 1IGTB 4NRYA 5CEZL 1J0JA 5F70A 1QVOA 4RBPK 4C56A 5FYKU 5C0AA 3B2UD 3BAJA 4JFUA 2APFA 3NMEA 4MKTA 2WYIA 3BW9B 3UTQA 5JW4R 4XH2B 2C3VB 4PREB 1TVBB 4KHXH 5FA3B 4AW7A 3V8CA 1XV8A 5E0QA 1XMEB 3L1EA 1MWAL 4AM0Q 4P57A 2WSPA 1EGJA 1WZ1L 4E41D 1RK7A 2XDHA 2X9ZA 3RPBA 4M6AA 4PRBB 4NWUL 4LHUG 4Y16A 3CFDA 4I0KA 4OIIL 5MP6L 3RA7L 1BMZA 2Q7NA 4PJFE 3NFNA 3N06B 4KXBA 1F11B 1EHKB 1I7RB 2EADA 1GAFL 2ZYHA 3BZDA 2HFEA 3EJZD 4JPWH 1CDBA 1KIPA 4D8PA 2CPUA 4PWHA 4YHKH 4NKDB 5DF0A 1RVFL 3MV11 5E5MB 1NA8A 1A6WL 1SOKA 2WLLA 2ZJSH 4AUUA 2C4FT 4PRPA 1A66A 2XIIA 1MJ7L 4OUUB 3GT6A 3SYAA 4EOWL 3MZTA 4F7TA 2WQRA 4G1EB 3FDWA 1H3VA 1DYZA 2IMNA 1EO8L 1WE5A 4RGNC 3MRLB 1TEYA 1KB5L 1QSFD 3TV3H 3HS8A 3P9MA 3JWDL 2Z93B 1X5FA 2L4OA 1TMQA 3FQXB 1QLEB 4JRXB 1RZKH 3QIBA 4FFZA 4KK9C 4YL4A 5PCYA 3BISA 3GQFA 1G7PA 5ESAA 3TYFB 2AKRA 4A6YL 1NJ9B 5B4MD 1SY6A 2GJ6E 4BXSV 4DP4X 2V9UA 2Q6WA 1JXJA 3SE4A 1W0YT 4O5LH 1YYLL 4IRJD 3WUWG 1SJEB 3ZDZB 1N5AA 1NAMB 2X0VA 2VZVA 1WT5A 2UWEA 3LDBC 5CJOH 2MWCA 5AWNL 2ZAIA 5HDBE 1QPKA 4OLVH 4BH7A 2VO5A 4J3OH 3HHMA 2ID5A 4JEGB 1NFIB 4LSQH 4B7IA 2B3RA 3OKLB 4H0GA 1K2DB 3JV4B 5FW7A 3PP3K 3B34A 4KQ4L 4GRWH 3RWGA 1BP3B 2CHWA 4JO1H 3RDTC 5IB4B 2NZIA 3OSKA 2BP8A 3T4YA 4KDWA 5CWSA 3QFGA 4PJFF 4WUKL 3H7BA 1LO2L 5I1GH 3L9RB 4NJAH 1NFDF 2NY2D 4HUWA 1E0OB 2I69A 5HHPB 1BXAA 4HOWA 3DBXA 1DJHA 2HKHL 1MOEA 2NY1B 4TQEH 5IHZB 2NXYC 5K9KB 3DPBA 2FWOA 4Z76B 4MJHA 2BWIA 2VLKE 2Z92B 3D1MC 3MUHL 3NN8A 4HCFA 3JUZA 4MMYA 3RPIB 3D09A 2OX5B 3PV7A 1M56B 1T4KA 4NQED 4E5XG 1EDHA 5IMKA 3U7YH 1KC5L 4U3XA 1IKFL 5A7EA 4PTUB 5CSGA 3IXAB 2WXLA 3AREC 3ARSA 2R4SL 2OTWB 3PWPE 4HFUH 1K4DA 4X5LA 1QTSA 4LKCB 1E6JH 4I48A 3CK0H 2GHWB 3C60A 1L0PA 2BS71 1A9EB 4JY6B 1SFHA 1LQBC 1P2CA 3MRIA 4K71C 1AXSB 4NN6C 1EX0A 1E27B 3NA9H 1QATA 2J2ZA 3BUYB 2LT9A 4QKTA 3WEBA 1HAUA 3NJGA 1D9KB 1SLWA 3MGAA 4OM0L 4IMLB 3S96A 5IEKA 3ARPA 1XGUB 3SGJC 1AP2B 1FH5H 3F05A 4UT6H 3CDZA 3TWCH 3ZYIA 2VN3A 1KXQA 2Y7LA 4FFTA 3TBYA 5GS0H 2BP0A 1EJ8A 3B1TA 3VQ1C 2OA9A 4HJUA 2NUPA 3C5ZC 3V4PH 1J88A 4LSRH 3ZDYB 4IU3A 2F15A 4CADB 3MV9D 2R69H 2Z64C 5I1IL 2UVEA 3DJZA 3PAYA 1THCA 1TIUA 4KAQH 1IBYA 1RIUH 2ZPKH 1S8DB 1J87A 2WLIB 5ICXA 3GBML 2QHLA 5CZXD 3EFFB 5EU6A 2JIXD 2HT2D 4WW2A 3DX9A 4XO4A 4RGNB 5AVYB 4LBEA 4L3FA 3VD3A 2EDLA 2IWEA 3ARZA 4ZUSA 3ETBF 3DO7A 5D6DA 1KCUH 4OI9A 4W4NA 3L7EA 2EICA 3SQBB 3V9CA 2X70A 1F4AA 4GKZB 3BKJL 3FZUC 3UJIL 1ZGLA 1QEWB 3QORB 1A1MA 3QDGB 2CIIA 1T1WA 1XZWA 2NY3D 3ZTEA 4YK4C 1BVKA 1I3RB 2LAAA 4LCCA 4S1DD 1VSCA 4K3JH 3SPJA 3MC0A 3S97C 1FRGH 1R5IB 3LDBB 3EOAB 4U1LB 3IJEB 3PIQA 2I9LA 1CT8B 3DV6B 4PG9B 1GW6A 1MI5D 1J9QA 1SZNA 4G9FA 1BD2D 4KK5D 4OD2B 3TBBA 3P30L 5CSBA 3RVTD 4ONHB 3R7QA 4JHBA 3RNQB 4A7GF 3BH4A 3FSAA 4M9OA 2V9QA 3WMQA 1DDTA 1Y07A 3RDTB 5TGBA 5IOKA 2RJMA 5G2NA 5CFAA 5E4AA 3D0VA 1XF4A 5F89B 3FHQA 2RA1A 3Q2NA 3RFZA 1CFQA 4ANUA 4A2GA 1N6QH 1FYTB 4X8JA 2VN5A 3EH3B 4XN5A 4L1LA 4NCDA 4BFFA 3CC5A 2WWKO 4BFJA 5LO7A 3W0WB 4GIPD 1OARH 1ZIBA 5AB9A 1AANA 2JTYA 3TBVB 2H0FA 3OF6D 1AZZC 1PX4A 4JFHD 1HXYB 4M6OL 2P5PA 3IDNB 3NYKA 2DLEA 5EBLB 1CICD 4HISA 5BMFL 1T7YA 1KNOB 4QHKI 4ZUVA 4Z7IA 3MNWA 1GR7A 4L9LB 3D7PA 5FLUA 3DVNA 4Z7VB 5DZNA 3IFLL 5F9OH 5CZVH 1JN6B 3VFSB 5I6PA 4OZHF 1N4XL 4X5XB 5JPNA 1PIGA 3MR9B 2YXMA 5JIQA 4U0RB 2VC2H 1CGWA 3B5HA 4QXUH 3SDCB 5ACZA 2N1KA 2IQAB 3JBG7 3O4OC 4MSWA 4K71B 4GW1A 4JQIA 4NN6B 2CM6A 4XR8C 3T08A 3TBWA 5IROC 2I7OA 1ES0B 1TVDA 2IBGA 3L3KA 5IB1B 4ZD3L 1VHPA 5K93A 2JB5H 1SDYA 4KNQA 4APQC 4EIZC 1YNKH 1UM5H 2Z3FA 4X9YA 1G9MH 1HOEA 4W9EC 3QRLA 3BZ4B 1LK3L 4PRDA 4YPGA 1R1CA 5I26A 2BFVH 1VGKB 3C5ZB 3OMZA 3MBWA 4G1MA 1Q9LB 2R8SH 3O6FA 2IG2L 1A14H 2EE0A 3KJ4C 2VW4A 3MJ6A 1CE6A 4JDTL 4A04A 4TNFA 3SZ6A 3NIFF 2I24N 4RFNC 4LIQE 1OY3B 43CAB 4C83B 1J0YA 1FE8L 2W9EH 2J8UF 3AVEA 5HDRA 3RB5A 4Q4IA 5DTFA 4LHQB 1J05B 4JREC 1P1ZA 1IO4C 3ARBA 4P9HC 3H0TB 2WXRA 3L4WA 2X4SA 4ZPTA 3OHXB 2EZ0C 3V4VH 3B2PA 1EEYA 1WISA 1IQDB 1ZPUA 2CBOA 1IV8A 4JFOA 5JORB 3OC8A 4HJTA 1G6VK 2BSEA 3QR2A 2A5UA 1U8NB 4YK4B 1SVZA 3Q3GB 5D2NC 2EDKA 4UTAA 1MCOH 4UANA 3DO4A 4BH8A 1MJUL 4J4PC 4WK4B 4ONFL 4IBYA 1BG1A 2J4WH 2NLJA 1VPOL 3OXSB 5I30L 5J6GA 4HIEA 5GSRB 3RJDA 1YMMB 1CLOL 2OQJA 2RALA 4C4KT 1XH3B 2YA1A 4FQQB 3IDXH 2FO8A 2WSDA 1U8CA 1NM4A 4HUVB 2HH0H 5AUMA 5EORH 5HHOB 4P99A 3RZCB 2W9DL 2FO4A 2GABA 1I1FA 2ILLA 4M1GL 2XKUA 4N90E 4Q14A 4Y9CA 4DFIA 4YDVA 4F9LA 1HL8A 2YWYA 3HRZC 4XBGB 4AIZA 1EIBA 3GIZL 4LDEB 4DQOL 3HE7C 4X4YA 4OJDH 4O9HH 3TWYA 4I2XB 1KCBA 3LKPA 3VU1A 4FNSA 3NH7L 4O2EA 1YEDB 4ABUA 4PP1C 3BAEH 3KBFA 1KIQA 1EAPB 5HYSG 1BWMA 1NAKH 4I3GA 4JDEB 1JUFB 4UI2A 2CCLA 1XSIA 3BGMB 1HHIA 5A2FA 3WTUA 1X5LA 1G9NC 4AKPA 4PJCA 4JMXA 4FG4A 1CD8A 5TD4A 3SDXE 4KROD 4QY8A 3MKKA 3G5XA 4WUUB 1XF5B 4ZUUB 8FABB 4PY8J 4A68A 2Y1VA 4N2LA 2GSGA 3RFRA 1II4E 1P69B 5KSAD 1MUJA 4DNLA 3S36H 1TSHA 4P5KA 1N67A 2GI0A 3P73A 1HHJB 2QDVA 2XQ0A 4HBCL 4N2DA 5D7EA 2BWDA 4E36A 5CEZH 2AAVA 4M7JL 1T1YA 1A6TA 4WI0A 3U2JA 2XXCB 5T3XE 3FTWA 1UFGA 1J8RA 1W72L 2GCYA 3MV9A 4APQB 4O4YL 4KK6D 4NOFA 3JVGC 5MEPB 2IH8A 4XX1G 5B22A 1S7TB 3H9HB 3FF7A 1IAMA 1U58B 3AM8A 4NRXB 3VXSB 3CLFL 3DUHA 1PKOA 2IDCA 4F2EA 3DURA 1MWAH 3HB3B 3KJ4B 3FUFA 4G70B 5EFIA 1HH6A 2TSBA 1WZ1H 4PEEA 1B4JL 4N0UE 3V0FA 1BLIA 1WA0X 2FDBP 2P45B 4RFNB 5C6PB 3K72A 1A4CA 1U2HA 1NCUA 4GQZA 3DYMA 2WP3O 2Z8RA 5E51A 3B3IA 4KKCD 4NWUH 4RMQA 4G3YL 4OIIH 3MODL 4MJIB 5MP6H 2OP4L 3RA7H 1QRNB 3BSGA 3BQVA 4JRLA 4JREB 4FNPA 2QZQA 4PGZA 2VISB 4KJQD 4B9ZA 1GAFH 2FJGA 5BS0B 1BXVA 3PNWB 3OKEB 3VTAA 2FQGA 4JE4B 5HVHC 1RVFH 2XV6B 1A6WH 4ONOA 1MI5A 3RUGF 2HRLA 2J8HA 1BD2A 1MJ7H 2A6IB 3QH3A 1GOGA 5FM5O 3ZL4L 1FQ9C 2FHBA 1QSEA 3UBHA 2H5UA 4ZTOL 1EO8H 1KB5H 3CN4A 2Z0BA 2WIIB 1FNAA 1X5KA 3JWDH 3PV6A 1RZIB 3RGVB 4BGLA 2YD2A 3VI4E 2P49B 2DTSA 1XR9B 2QMJA 3EH1A 2NY7L 5D1QC 1QACA 3BCFA 4NDMB 3BD4A 2JCCF 5E6IC 4Y4HC 3U4EB 4A6YH 2EC9T 2BERA 4GSXA 2X09A 1N0LB 1UOLA 3SE3C 2WPGA 2EEAA 4I3RL 1FVCB 1XGQB 1YYLH 1MCLA 3K81A 1W8EA 3AQYA 3DETC 4M7LL 3ZDZE 2QQKL 2CHDA 4R26L 2EDWA 4PJ5E 3HE7B 5AWNH 1NFKA 1M7IA 4W9LC 3KEHA 1E7UA 2W0FA 4FABL 3CBRA 4H5SB 5L2KD 1THAA 1USQA 3FTSA 3EF7A 4GUPA 1BJ8A 3DDFA 1I8AA 2HKAA 3GLZA 3GMQB 3L54A 4Z5RB 5F96L 4KQ4H 3VXOA 2EEDA 3LQZA 3UAJD 3V4LA 1U8PA 2E6QA 2EDQA 3FCSA 3NTCH 2A6KB 2A74A 3SE9L 2APTA 2PN5A 5GGVY 4Z7QE 2FH6A 3GTTA 3DTUB 4PS4L 4WUKH 3MREA 4XVOA 4K3GA 4W70A 2HKHH 4PJ8D 3FB5A 3AXHA 4JN2B 2HFFA 2F7OA 3NJXA 4U1JA 4MJ2A 2N7AA 2GT9B 3LEVL 1YJDL 3ZKMD 4OGYL 5D9SA 4EOWH 3HFFA 1H15A 2CH8A 4NLAA 5DRZA 1QO3A 3UGXA 1MH5B 1S78D 4X8GA 4NNXB 4WW1A 1MJ8L 1KC5H 3O8XC 3ZKND 1NGZA 1IKFH 4X9IA 3U79A 4F15B 2GW5A 4X4XA 1F90L 1AMYA 3GSNL 2CZNA 3KL3A 5BCAA 2R4SH 3GF8A 3QWOB 5FOJA 3JWNC 4LCUB 3VI4F 4FL4B 3OPUA 1J9RA 3NCCB 3VVVA 3EFOA 3LHAA 1ETJA 1DVQA 2YRLA 4NKIL 4XBPA 3FUIA 1NGXB 1OGTA 1A1OB 3H85A 1MFBL 4UMSA 1WZMA 3UGUA 5C8JA 4OM0H 4FKEA 3BUDA 3CZFB 4MAZA 3QFDB 3E8UL 2QELA 1JK8A 2VIRB 1F18A 1KJVB 2ZXDA 3QRBA 4EVNB 4DP1X 1FFQA 4EN3C 1RZFL 3ZDXE 1P5UC 1HK6A 4DOHE 3P77A 1I8KB 2OYKA 2HG5A 3HAEH 2IMMA 4L5FL 5IBUG 5DJZA 3Q44A 5I1IH 3SDDA 3UEZA 2GFBB 4WTZG 3Q05A 4LP5A 1H3GA 1MW1A 2AJYL 3VRJA 1CGSL 1G7LA 5FCSH 4ZFOL 4FZEL 3GBMH 1MLBB 4UM9A 3ULVC 4WFGD 2BNUA 1PZ5A 1KJ2L 3O2VL 2D03L 2YFOA 1OP5K 5H2BB 2NPLX 1M53A 2FJFA 2K9UA 2OCFD 3EH4B 5CS7A 4FNUA 4JHWL 4UWQB 2F74B 3FN3A 2XVBA 3OMNB 2R51A 1A22B 3UJIH 3BKJH 5H4YA 2XTLA 5I71C 5E6IB 3IN2A 3CH1B 4PCSA 4R97B 3TNMB 3QDGE 4EI0A 1U95B 3ZR6A 5BQ7B 2OMYA 4GMSL 4HDIA 3GJFB 3QUYD 3C6EA 5I6KA 3MV8A 4Y2DD 4AX3A 1S5HA 4P23A 3HBPA 4PJ7A 1P7HL 4JM0A 1XF2B 4APXA 2ICWJ 4J1UB 3UBXB 2X2HA 3Q9PA 2XG4B 1Z7JA 4ZTEA 5B21A 2P28B 3P30H 4YO0B 1HCFX 5A3IC 4N24A 1EFXA 3QIUB 5DWPA 3FJTA 1GPOL 2VL5B 3D69A 4FXTA 5JTWA 1JNHB 4L4VE 5MEND 1KBWA 1Y0LA 3UBFA 1DBJL 2BVTA 4G43B 4TSCL 2XIBA 2ZXWB 2MH4A 1HN1A 1YYML 1FYTE 5ENWB 3ZDXF 3IMTA 4F8PA 1R5WB 4H8WC 4Z23A 3PHAA 2FEDC 3ROLB 5C0NC 1H6TA 2OMZB 4HKJB 2BY0A 4S0SD 4MTMA 5JXEC 2OM5A 1K8IA 2XETA 5D4HA 1FZKA 3L5WA 4M6OH 1ZAGA 2C7FA 1NZRA 3ABKB 6PAZA 2IVFC 2AV1B 5BMFH 4HCIA 1AD9B 4K9JA 1DSWA 4NQCA 3N5AA 2HX8A 5C07A 3ARFC 4NI6A 4Z7VE 3FO2A 3IFLH 3KYOB 2YUZA 2H6PB 4X5PA 3ULUF 4PV9B 1WD9A 1N70A 3EGXB 5LN4A 1UA3A 4P4KA 4Z3HA 1N4XH 1V3MA 2WB1A 3MMEA 4I18C 2TRYA 4TUUA 1MDTA 4X8XA 4NO0D 3H54A 5SWSD 3CN2A 2WXPA 2V8MA 1MHCA 1O6SB 3GXFA 1H5BC 1SDDB 3U6XA 1VZHA 4UZGA 3BPCB 2WNGA 4N8PA 2YAOA 4W68A 2C26A 4X98B 4ZD3H 4HPOL 5J56B 3M17B 1MCPL 5GZNC 1MW2A 3MLTA 1DE4A 4YR6B 2IDUA 2VDPH 4EN3B 1P5UB 2D2CC 1LK3H 2XJKA 3QNZA 4WJG3 1U8OA 1UA7A 5F8QC 3UG4A 2MNUA 3HNSL 5GPRA 3HHRB 1GHFL 1QLRB 4EDWL 4DIXA 3KAAA 3QW9A 4XMTA 1WUZA 5LN8A 4U1MA 2MKLC 3PNRB 4JDTH 1GGBL 4OZIA 4NFBA 3N55A 3NIDF 1G0XA 4JE0A 3LPOA 1TUPA 3SGEH 2VABA 4JFDA 1FE8H 4KMTL 4IBTA 3GMNA 1PAMA 3BIKB 3VI3A 2KZWA 1MPAL 5FGSA 1R5VA 4W9KC 4BFRA 2X7LA 3LX9A 4H2AA 6TAAA 2CM5A 4CVZB 4J3VA 4IEFB 3STLA 3FKUS 5JW4Q 3DX2A 3ZUNC 2AAAA 3IMVA 5I8KL 3EYOB 4U1IB 1R3KB 5BVJA 5AZUA 1KIUA 3NSCA 2EDRA 4IRSA 5ALCL 5EU3B 5I66A 2L3BA 2ZP8A 4H4NA 5JO5B 3SD5A 1KTDA 1MJUH 5IESL 2EVFA 4U1GC 4ONFH 4R5VA 5INCA 4PMEA 1VPOH 4FF9A 1RZJC 4HZLA 3VFNB 4QXWA 4PJXF 3G6DL 4W93A 2VMJA 3S37L 4DCQA 1CLOH 2YMXL 5AVVB 2XKNA 1OTUD 2ESVD 4NAMA 5KTEL 4N6RB 1QQDA 3VRLE 3E8VA 2TAAA 2KMWA 2X0UA 2ZKHL 4Y4KC 4B0MB 5EEYA 3KLHD 2XN2A 4PJ8A 3VW3L 1S4IA 2W9DH 2FSEB 1KB3A 4M1GH 2MQCA 2PXYB 3BWSA 3HG0A 4L1BA 3KYAA 1U30A 3GIZH 4GI8A 4FTVB 4BRJA 4BXVA 4DQOH 4R4FL 2J1KA 3IGAB 4OZFB 1C08A 3MUGB 1FAIL 4B9IA 3AXLA 3TO4D 1P0SE 2UZYB 3M46A 3VB9A 3NH7H 1QFPA 4YH6A 4Z0XB 4HZAA 3RIKA 3BUQA 3FB8B 2GJZB 5IOPA 2F0CA 3UPRB 1V3JA 3SOBL 3V6ZA 4ZMZA 1QBLL 1CK0L 2VSMB 3SKOA 2VJXA 2XWRA 3DXAB 3IJYA 4AYFB 2CK2A 4ZXBC 1XCXA 4EDXB 4FQIL 3KM1A 5E94A 5ETUB 2B8OT 2E9JA 4HT1L 1UM4L 4LU5H 5DFVC 5HHQA 3T0EC 4U1NB 3EIFA 1BBDL 4I18B 4WUUE 4LNRB 4PD4J 1U4EA 3V7AE 1MW0A 3I6LD 4AYEC 2OMVA 1WS7A 2ORBH 5INDB 1Z9MA 3PU7A 5AOLA 5ERWA 3NZ8A 1H5BB 4V11A 3FO1B 2R2BA 4P5TC 5BRZB 2R1YB 2XT1B 2VR8A 4GW5A 4HBCH 1VACA 1RK0A 4RQQB 4M7JH 4S1QL 3AU1B 3T04D 1U21A 2UXGA 1T1ZA 1W72H 5A2KH 3D05A 2VZOA 4O4YH 2L7QA 4AQ1C 5IB5B 1JG9A 1UOKA 4I89A 4XOAA 1MDAA 3VXSE 3ZTDC 1ILSA 4BCYA 4LCWB 3CLFH 4QYOB 3IFOA 4XT1C 3WO3B 1DJSA 5HY9B 3QZPA 2F8OA 4L8CB 4XMLH 2B59A 3MCYA 3SN6N 1P5VB 3TH4T 4WWKA 1B4JH 2VLMD 4WJKB 3D0AA 2K7QA 4TYUA 1A4JA 1HYSD 3QUHA 2O4EA 1BF8A 3KPNA 4YHZH 4L8DB 4G3YH 1TZAA 4FQXB 4MJIE 3MODH 2OP4H 2R7EA 1D5XA 5T3ZD 1CVRA 1EXUA 3HHSB 3MNMA 3KYNA 2IH3A 3MO1B 1S9XB 4JGMA 2IFGA 1XAUA 2NY4C 5BS0E 5IB3A 3MBEC 4F5CA 2WW8A 4PM1A 4LEXL 2EIBA 3H9SA 4NZJA 2FBJL 3UBXG 1ROWA 4GT0A 2QV4A 1UC6A 3ZL4H 2A3TA 3ECBA 2BY1A 4ZTOH 3D3VB 5DHVB 5IK3A 4YDNA 4N2MA 4ZUWA 1BQHG 4MDRA 4MNGA 3AY4A 4O51B 2LFEA 2AQSA 3QEQD 1I1YA 2NY7H 2M26A 3VO0A 3K8KA 1KYUA 5IBLC 5EOTB 1OOWA 4Y4KB 2ED8A 4B9FA 4JZJC 3NCMA 1ZT7A 5D5MB 4E42B 1TQTA 4CGUB 4JFWA 1AGFA 2BOBB 1X9RA 1SXNA 4I3RH 3VGGA 4M7LH 4WQOA 2QQKH 4N68A 1NC2B 4R26H 3VCLA 4Q9BA 1AHMA 2XBZA 1A4KB 3P2DA 1ND0A 4NNYB 1PLCA 2OBGA 2DTML 1VJSA 1UASA 3EJYD 2O5NA 4FABH 3NJHA 3MFFB 3BEWA 2G5UA 2X4OB 4FXKC 4PJ6A 4U1SA 2XA8L 5AG9A 2BVOA 2NMSA 2OKMA 2E86A 4KI5D 5F96H 3EOBB 3EH5B 3LZOA 4EI6B 4ELKA 3F12A 3QAZB 4FOMA 3SE9H 2CGRL 4ZXBB 5B7EA 1G0YR 3LXBA 3JWNG 5C0JA 2Z9TA 2BNRB 4U7KA 5T8IA 4NHUB 2UUDH 3D39B 2EDOA 3CBKB 4PS4H 4XHJC 4CMHB 4IRZL 3T0EB 4G80A 5I2IB 4K5NA 2HT3C 4RNRB 2EXWC 2MIZA 4N2OA 1EO5A 1IFRA 4F57L 2P8MB 2ZWKA 5LGJA 4UINL 3DGCR 3LEVH 1IGJA 1YJDH 1FLRL 4JANA 4OGYH 1UTDA 4KRPC 4P5TB 4N2IA 4WI6A 1RIVL 4UTBL 1SYVA 5IG7A 2V9TA 1YPZB 1MJ8H 3QDMD 1YHPA 4QHNA 1IM9A 2A9CA 1F90H 1OXYA 1W80A 4CILA 3GSNH 1Z1WA 4XGZA 4PWEA 4G8GA 4OT1L 3ZR5A 4IOIA 12E8L 2YKKA 2FHFA 1BVNT 3NJKA 3VXTB 3FQNB 3SB3A 2CA4A 1L9QA 3EJUA 4AM0B 3APNA 4MNQB 4NKIH 2NSMA 2D7MA 4P2OC 2VDLB 3IKCA 3GSVA 1SLVA 4LCVA 2NOYA 5DO2C 2E5EA 3MRJA 2FJSA 1NGPL 3C5SB 3E8UH 3KYMB 1IKNC 3WHXB 2R4RL 3O9WB 4OZGF 3V0EA 2G3ZA 1DN0B 3LKNA 1AJ7L 1RZFH 4R5XA 1HL5A 1IEBA 3QDJD 4F7MA 1FFPA 2JJSC 1M57B 2PCFA 3MBEB 4ZOBA 5FB8B 5EIIA 1F5WA 4L5FH 3TN0C 3HNVL 5D4JA 2GTZA 1F86A 3D4CA 4NGHL 2AJYH 5EZOL 1CGSH 1ORQA 1NDGB 4FZEH 4MQ7A 4QEGA 4L3EA 2V8LA 4ZBJA 4X5WB 4A6YB 4Y19A 1KJ2H 3O2VH 4URKA 1AIFB 2IDTA 1YLBB 2D03H 1TEGA 3FH7A 1J0HA 1K5NA 4KTDL 3BGFC 4JHWH 4RGMC 3BZEB 2ZWLT 4OFKA 2C7UB 3MUUA 4NKOB 4U6VL 3IMWA 3O2DA 4LEEA 5KBPA 1PY9A 1GYUA 5DHXB 4AJWA 1GL4B 1GC1C 3OVUB 4GMSH 4OZFG 3FOMB 4PCKA 1X6LA 2NR6D 5JYMA 4G6KL 1ZVYA 4GRWE 1P4LB 4Y16C 3WGUB 1RU9L 3MRKB 2R23A 4FN0A 3MRPB 2YUWA 5HYJB 1JTOA 1OGPA 3KXFE 3IWVA 4N2BA 3LZPA 3U4KA 1DDHA 1JTPA 4KV5E 2R2HB 1N6UA 4XO5A 2IH9A 4QHUA 1H3TA 3JWOC 4FXKB 2WBWB 3WY4A 1VA9A 3G6AB 5T1KA 1GPOH 1XQ4A 5SX4I 5H4ZA 1AR2A 4JKLA 4HLJA 4HWEL 1CIDA 1DBJH 4AYGA 1YYMH 4JVPA 4MQXC 3BYYA 3P0GB 2W88A 3LNIA 1XF1A 4JZNB 5JIDA 4PJIA 2X6UA 1MEXL 4H0LC 5KSBA 2FNBA 3LRHA 1H0DA 5J3HC 1I4FA 2DQFB 5G5DB 3QIBC 4KRPB 1DP0A 2EO9A 4MA3A 4Z7UB 4PGDB 3D50A 4JO5A 4N28A 3HZYB 2AXJA 5DJ8B 3MU3A 3SE4C 1FFNB 3EJCA 1OAUL 1EWHA 1A7RH 4QRPB 1T6WA 3BPNB 2PW1A 3B3BA 3GI9L 1WT5C 2A0LD 2B1HL 1UXSB 1OAXL 3N43B 1UH4A 5F7HA 2UZXA 5CILL 2W91A 4K3EL 3LKRB 1U8KB 3OB0H 3PWJA 3TCLA 5FF6B 4DGVL 1YRKA 3CXDL 4FMKA 1RSYA 1X5HA 1HILA 4R7DB 4QHLB 3TA3B 1CS6A 4Y9BA 3KR3L 5I8EB 4GRWF 3RURA 3F6JA 5ITFA 2WAQA 4PJGE 5DEZA 1XZ0B 2IQ9L 4HPOH 2D0FA 4ZZFA 1MCPH 2AJSL 5I18L 4CVXA 2NY0C 5FPIA 4WVRA 2BO0A 3O3BA 3FS9A 1ZS2A 3FFCA 3M7OA 3VDAA 4D3CL 3GSOB 2KT6A 2V2WA 3F8UB 3WIIL 3KPTA 1XDTT 1RPKA 3G9AB 1PQZB 1GHFH 2EYRA 2VQTA 3DO3A 4EDWH 2B16A 1ZV2A 3TN0B 3TPKA 5IEHB 5I17A 3F3HA 1FVEA 1R24B 1SM3L 2FZ3B 3ASOB 4BCZA 1JV2B 3TIEA 4NRYB 3OB8A 2QHRL 1U8MA 1QVOB 4C56B 1H3XA 3QEQA 5DK3A 5C0AB 3U6RA 4KMTH 1YUHA 4UAOC 4FQHA 1MPAH 1N68A 4QF1A 4RGMB 1I85A 1TTCA 3E7JA 4H13C 4P5SA 1DQQB 1ODAA 1L7IL 3SODB 1IFGA 2EDMA 4QUOA 4FKKA 5CKGA 4J23A 5I8KH 4W4OA 5E7BA 5GXBB 5JW4N 3IVKB 2J71A 3I6GA 5ALCH 3R8QA 5DZPA 4Z8FL 4U1KB 4XO8A 1NKRA 3CFDB 5IESH 1IAII 4PGBA 1JBJA 1Q9KA 3NFNB 2BFGA 4UUJA 4WIQA 2XYBA 4OD1H 2J56A 1CPUA 4P9HH 3G6DH 3OKDB 3S37H 3ZL1A 1OAZL 1XGZA 2YMXH 2HFGL 5KTEH 1S7XA 2AP2A 1F45A 4PJGF 2V7HB 2WLLB 3FU9A 2ZKHH 2ZX5A 3VW3H 1QFUL 2HJKB 5EU4A 1I1AC 3IK2A 3B9KD 3VFRA 5L6YL 1KG0B 5JW5B 4ZMXA 4WW2C 1B0IA 1U3JA 4FTVE 3ETBJ 4Q7DA 3TJHC 2Y7NA 4R4FH 1H8OA 4OCWL 3C8DA 1FAIH 3EDJA 1MWOA 3GXMA 1CFMA 2HN7B 3QIBB 1N7ML <