4J3OH

Crystal structure of the fimd usher traversed by the pilus tip complex assembly composed of fimc:fimf:fimg:fimh
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic basis of folded-protein transport by the FimD usher.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion/chaperone/membrane protein
molecule keywords Protein FimG
total genus 48
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00419 Fimbrial Fimbrial protein
H PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH02
2J2ZB 2JMRA 4AV4A 5FWRA 2XG4B 4XOCA 5F2FA 4J3OG 5LNEA 4AVKA 4XO8A 4CSTA 5FLUA 5AB1A 1KLFB 3JWNH 4XOAA 4AUJA 4J3OH 5F3FA 4BUQA 4CSSA 1ZE3H 3SQBB 3ZPDA 4AVJA 1KIUB 3BWUF 4J3OF 4X5RA 4CA4A 1N0LB 4X5QA 3ZL1A 2UY7B 4XOEA 1TR7A 5CGBA 5IQOA 1QUNB 3JWNE 4AUUA 4X5PA 5FS5A 4XODA 5ABZA 2WMPB 4XOBA 5IQNA 4AVIA 4XO9A 4AV5A 2VCOA 2W07B 1N12A 3JWNG 4LOVA 2JTYA 5AALA 4AVHA 3RFZA 3ZL2A 3MCYA 1PDKB 5LNGA 2UY6B 3BFQG 3ME0B 5FX3A 4ATTA 1UWFA 4AV0A 5JQIB 5AAPA 5IQMA 4X50A 3BFWA 4AUYA 2XG5B
chains in the Genus database with same CATH superfamily
1QA9A 2NXYD 3QAZB 2BNRD 5L2KD 4P3CL 1CD8A 3QHZL 1P4UA 4UYQA 4ZUSB 4B7IA 3GEWB 4Z6AT 4P2OB 4PJDB 5I75C 3MGTA 4CN1A 1TYJA 4CGTA 5CZXC 5HD8D 5CSZB 4LSPH 1AQ8A 4HCRA 4ODBD 5D6DC 4MJHA 3X1FA 1B4RA 4M8VA 2PWGA 2VMCA 2K7QA 2P46B 3L13A 3TU6A 2GBAA 4NNXA 1NMAH 5G4MA 4MAZA 2H32H 1UWGH 2X9XA 1UD6A 4P46C 4HXAL 1E40A 4OZFB 2DJUA 2ZX8A 3LQAC 3AZUA 4LNRA 3B9VA 2FO1A 3DX1A 4TQHA 3DSFL 3L3IA 3BP5A 4OLEA 3RA7H 1F58H 2A6IB 2CDEA 3KXFB 2H1PH 1E4XI 2R27A 4R2GB 1CTOA 4PP1C 1DVFA 4WWID 2IQAA 5IHUH 1T6BX 3HZYA 5B22A 5EEVA 1UZ8B 1YYCA 2DF3A 4JQVC 2XJLA 1JGLH 3SJVB 4JKPL 1GKEA 2OMBA 4BFNA 1J9SA 2PCPB 4RNRB 1A9BA 1ZLSH 4QHKJ 1SUHA 4Z95H 3U46B 5DEGA 4N2IA 1D5ZB 4BZ2A 5IT2L 4TTDC 3JVFC 1IGJB 3B43A 4N8VB 5FV2A 2O1AA 4BSVA 1U36A 4JK0D 2FT8A 1RCYA 2I32A 2DH3A 2GI7A 2HRGA 1EHKB 4XMZA 2VLRE 3MYJB 1KTKE 3M1BB 5IVOA 1DQJA 4IRSB 3L1FA 2MNUA 1OGTA 2A9DA 4HUVB 3VRLF 4DVRL 2X89D 4OIBA 4AJYV 1KCRH 1KTDB 3IT8D 4H13C 2WVUA 3ML8A 3QULA 1TVBB 3FAWA 5BMFH 2LVCA 2EH8H 1KGCE 3J27A 2HSIA 4P49A 4DAGL 5I1DB 3N43F 3TH4T 1BXXA 5DRXA 1TMQA 4X98B 1LYQA 5C70A 2CCWA 1A7PL 2VWEE 3MNMA 3T65B 3T77A 2SODB 3KLHD 1J5OL 1SUJA 2R15A 2WQSA 5KSVB 1NMCB 3ZL1A 4J28A 1DJSA 1JPGB 4BHUA 4O2CA 5LCVH 3WTUA 3G7TA 3Q2VA 4FNLH 4UDTA 1GZQA 1SDDA 3GBLA 3GJFH 4EOWH 1TG8A 3GRBA 2NXZC 5TGBB 4KQ3H 2C9XA 4R7LA 4KNSA 5J6HB 1IAMA 2NY7L 3HB3D 1O7SA 4N2EA 4IOFC 4X6DF 4YPGB 4GQZA 2XQ0A 4LK4A 4BK5A 1KPRA 3BD5A 4Z7QB 3NVQA 1EBPA 4GIOA 4P2OC 5CFHA 1RUKL 3BSZL 4NO0D 5IFAL 1ZE3H 2RFXA 2BNRA 3IXAA 4K8RL 1OK0A 3MX0A 5EU3B 5I73C 4KDTA 5CGBA 1JZEA 5EU7E 3ZDZB 4HAGA 3IS1X 3NJKA 4OJAA 1W72B 4TYUA 4ZMYA 2A0LC 2ZKYA 1YN6B 5FDYA 1E5YA 4AX3A 3WFEH 4AYFA 4LSTL 3P30H 4E42B 2XBDA 2DM4A 1FPTL 1ZEAH 4HUCA 1JZ7A 1Q94B 3OLIA 3VNZA 4UYPA 4KK5C 3L2LA 4D0CB 3SCMB 4I77H 5C2BH 3RLSA 1SHXA 4L2YA 2AEQL 2FQFA 2OCCB 3AG1B 1TFHA 2FATL 2B1AH 3KS0H 4HETA 4Y89A 3TVMD 1FNGB 2ZP9A 3IDIB 3S34H 2PO6A 2OTUB 3EF4A 3RIAK 5KW9L 2VKWA 3OAZH 4JFFB 4JRXD 5CGMA 3BCDA 1NDGA 2BK8A 2EIBA 2L04A 2ZUTA 3TBVA 1R33A 5BPPA 5HDQL 3EYOA 3C5ZD 1LEGA 3MROB 1FYHB 1QYGL 2K6ZA 3AM8C 4Q9QL 3W9DA 3SD2A 3KEDA 4JZJA 2JKSA 3RBSA 1KYOK 1J9RA 3QCTL 3LN5A 2ZONA 4WJ5A 1RL1A 1FGVH 2P48B 1HESA 4FFWD 3PQYD 1E9OA 2QFPA 5KJRH 4BGLA 4QWWD 3FTZA 4P3DA 5K9JH 1RUKH 4LEXH 5IFAH 5DZOA 4LHJB 1RU9H 5AKRA 5C8JA 1U8NB 1MW0A 2IG2H 2K3HA 1JHKL 5GRZA 1KJ2A 1TQBC 5C0CB 4Z7OB 2EJ1A 3MJ9A 4EI5D 3C09B 2X6AA 1G6VK 1E5AA 4NKDA 3UO8B 4NZRH 4JDEA 4FI7A 1ZRUA 1SZNA 2XCMC 5BXFB 3N9GH 1QVOA 1UB5B 5CS7A 5CSZA 4TOYH 4RX4A 2KDYA 1ORQB 4JJOA 4P2YA 3TA4D 2WXRA 2DH2A 3KPTA 2F53A 3Q5TA 2R1WA 4KO7A 5F89B 1MIMH 1TZIB 4B6ZA 4WHCA 3KXFD 3RNKB 4KNQA 4HCRL 4K9EH 4BUHA 5C07A 2HMIC 2IH9A 1FVEB 4PMEA 4RAHA 2HA1A 4M6AA 3GHBL 2ZSVB 4TXVB 4YNYB 5DO2C 5F97E 1UFGA 1KGYE 1GS6X 5IW1B 1HSAB 4PJHF 5L6YL 5FV1L 4URKA 4YDVA 3OKLB 1OOWA 2AQSA 4ONGL 2KH2B 3SGEI 3P9MA 2ZCHH 3ZYJA 4I85A 5F1IB 4YWGL 3FS9A 5K59F 2RIKA 2AEPL 4L23A 2IGFL 2EIKB 2OX5A 1MHHA 3K6FA 4FG6D 4P59H 2OK0H 1A7RL 2WB1A 1PKOA 5HHOD 5T5NG 2JIXB 4PLOB 1K4CB 1MDAA 4H44C 1NGZB 3KYKL 1SHSA 3FPXA 3STBA 5C0BA 1JFHA 2VERN 1FCGA 5D6CA 5E2UL 1LK2A 2LAGB 3O4OC 3N1PC 5D1XB 3X11A 4F92B 1KNOB 4X5LA 1RZJH 3GGWA 4ORGB 2CBOA 1RZJL 4OCSH 3US1A 5I5JA 4NQCD 1IC7H 4B3EA 4DPAX 1LE5B 5AKTA 4HKJA 4U05A 5AVTB 5I1IL 4FTVB 3RAJH 5KAQF 1IFRA 4LZKA 3RP1A 4Z3HA 5IV2B 5DQJA 3DX9A 1R3HA 4IGBC 4NEHB 4CVWA 1IZJA 3KJ4B 4MXWH 5JW3L 4DETA 1CICB 3E1ZA 4N8VG 1N26A 1YEFL 2VM4A 1MCHA 3C8KB 4LOUC 4UM8A 2VDOL 5L2KB 1PQZA 4JANB 4LPCA 1Z9SA 3VFTA 1PZ5A 3IEAA 1G6RL 4JFWA 4UM8B 5L2KA 1QATA 2EVHA 3CFCL 3N42B 2FJFB 5JIHA 4QRPA 1BLNA 3ZQWA 4DVBB 1H3WM 1XF2A 3V0VA 3P77A 3FTYA 3QG7H 4U6VL 1HILA 3ILPB 2C34A 5EBMB 4B9JA 1Z5YD 1ZDQA 2H9GB 2VLJB 3V4LA 1DBMH 1K8IB 2ZPKL 4NOFA 4TRPL 1XMWA 3NCFB 5F3HA 3FO0H 4O02A 4HUXB 4HLZH 1QKZH 2OTWA 2R1WB 3ARBB 2A1WL 2XWBB 5AW9B 5KVGH 2W80C 4HUXA 1HIML 1TZOA 1G5GA 2BSED 5H37A 2E76C 4BUGA 4AM0Q 4KVNH 1KIUA 3MRDB 5DHYA 1S7TA 2JQMA 1MCOH 4D7PA 1LE9A 3G5YB 1HJBC 2A5UA 3TEUA 2A73B 5JW4M 1S7TB 2RCSL 3TIEB 5DHVH 3CDYA 3UABA 1KG0A 3NACH 2NUTA 1GHFL 3WLBB 5F71A 5C0AA 3LKSB 5CEYA 3P9MB 1P2CA 2X88A 3UG3A 3X3GH 3S36X 3Q0HA 2L7JA 4L3ED 4PWIA 5AB2A 4XX5A 4P4KC 2ADJB 1KN4L 2RB8A 4K5MA 5FYKU 4UUJB 2Y7QB 4FFVC 4HLZG 1OB1B 3RIAF 3NIDF 1KIRA 3E6HB 1AQHA 4TL4A 43CAB 2OQJB 2JSFA 1A6ZA 2DN7A 3KM2A 1RKRA 1QW9A 3MLSH 3BISA 4L3AA 5F7FA 5BV7C 2FJFA 4IKLA 4KKLD 4MZIA 1QRKA 1T1YA 2J8UF 5F96L 3CFEB 4AVIA 1PNDA 1YY9D 2ISDA 2VQTA 4LSVH 5EU6A 1HDMA 2XWDA 2BXYA 3H7BB 2ZYHA 4FNSA 1CFTB 2FWUA 1H3UA 4UIMA 4N6QA 3V95A 1A47A 4G59C 3UTSB 3VWJC 1DJGA 4NWTH 1LP9E 2Q8BL 3RX7A 1R0AH 1NPUA 1PLGH 2WXNA 4M02A 4TN9A 1K85A 5EZIH 4EEEA 4XN7A 3AU0A 4MB1A 3WUZA 5IROD 4RRPM 3GHBH 3O8XC 2CBTA 1EJ8A 1BFTA 1NFIB 2E6QA 4I0PC 5A2AA 1ZLUH 3V5KA 1PEZA 4Q9RL 2Q20A 4W9IC 1YYLL 3DVNA 5LWYL 1OGAE 4UB0L 1RZGB 2DQIH 5GSRB 1R3KA 1TVHA 5CXPA 1E4XH 3ESNA 1IJ9A 4GFXA 3FT1A 3DUSA 2VAAB 4A39A 1S78D 1NKRA 4R26L 1EBAA 1F13A 1VFBB 3H42H 5HGDA 2X2JA 5CJXC 2VXSL 3SJVD 4A2FA 4YDIH 1YJDH 4FABH 1REIA 5C07B 2LOEA 1D5XA 5CN2A 3LTVA 1UACL 4Q58C 5CLYA 1XZWA 2BVYA 1SN5A 3VD0A 2X4UB 4JRFA 4P5MA 1T2XA 4YPGA 4XO3A 4CMHB 2FUTA 3UGXA 4V1DD 3KPLA 3L54A 2CO6A 1F6AB 1BZEA 4E36A 4AW7A 5MEOA 3SE6A 4PWEA 5J0BA 2QZQA 4MGXA 3OKLA 2VDPH 3F12B 3FCSA 4YXLH 7PCYA 4K23L 1L3NA 3GXTA 2FNBA 2A9ML 2NY6B 2VQ1A 5BQ7B 1YDPA 5FA4A 4QO1B 1GYAA 1HOCB 3D30A 2UZYB 3IKCA 3QPQC 3APDA 2I60H 2F19H 1XHHA 4MDJA 3EYQD 2DQGH 1DE4A 1HOCA 3RWEB 3LEXA 4XCNA 1N5AB 3VH8B 12E8L 3MJ6A 5KN5A 4G3YH 1LM8V 3SE3A 1GZHC 4DZ8B 1UOKA 3U4BH 3AXIA 3QUZC 4U1GC 3VWJA 4AK1A 4DEPC 2E7HA 2YWZA 2WJ7A 4ZFOA 1ZWIB 3UCQA 3JSSA 1GOGA 1JNNH 2Y1VA 1EFQA 3B2UC 3ZTCC 1AQDA 5AW4B 4LPXA 3EGXA 5FXCH 4UBDD 3MNVA 4DPRA 2V3FA 3QFJB 4NCDA 4W9EC 3K2KA 4BV1A 1FPTH 4FADA 4XMWA 1QLFB 3IMUA 2PO6D 1WFNA 5IESH 3L08A 4BYHA 3R06A 1MREH 2IO5A 4PR5A 2C7UB 2Y22A 4QAMB 3IFOA 4A63A 1ZV2A 2EYTA 3MCLL 3TO2A 4J3OF 3ZIMA 5IK3A 3QJTB 2A83B 5HSFA 5SWZD 3BZ4B 1LP9F 2G0KA 3WG7B 4K3HA 4HIHA 3IDGB 3OZ9L 1WD9A 1ZHLA 4NN7B 1VPOH 4YLBA 5B1JC 1ASQA 3VDCA 4G6FB 4C58B 5JXEC 1W6LA 4AG4L 3MNZB 1OPGL 2CLVB 4IBTA 2UUDK 3QWOB 4L4VB 2QLVB 3RL2A 4JGNA 5JO5B 1QEXA 2VSKB 2ZJSL 4ZSOA 1OGSA 4FX5A 4R4BB 4U3SA 4WI8A 2FL5A 1HL9A 5EN3A 1NGYA 4L1HA 4KQ3L 2X9WA 5EA0L 4OJYA 1SXNA 4GRWF 1YAIA 1LP9B 4GG8A 3NACL 3F58H 4KVCL 3CFEA 4JBSA 2DEYX 4I48B 2D7PA 1NCUA 2IPKA 4NBZB 2B2XL 1HSBB 1O9VA 3T4AB 3QEQD 5DZPA 4D0BB 3T3PE 4DP4X 2VMJA 1SJEA 3L6FB 1JYWA 1L9SA 4U1SA 2ADIA 2I7OA 4U49A 4P9HL 1SHMA 4PREA 5F7LB 2IF7A 2EYRB 1NCBL 1SDAB 3L7EB 5BRZB 3NCWA 1J5OH 3AAZA 4L5FH 1QZNA 4QRUB 5SWQA 2Y3NA 4IKIA 4DW2L 4XAWL 1HNGA 1G4MA 1PZAA 1EEUA 43CAA 5D71H 4UDTB 4OJFH 1MLBB 3MFFA 4EI6A 2K3TA 4ACPA 5CEYB 4FHKA 1QTYT 1EEQA 1UZ8A 7FABH 3H4FA 4Y2OB 3SYPA 3MXVL 4L4TD 2VXUH 1YMHB 4MX7A 3VMNA 3HS8A 2WVVB 4WLCA 2ZX9A 3CZLA 3IGUA 3JV0A 1CT8A 1OSPH 4M5YL 3CPUA 2WJ5A 3DVIA 5B38A 4IRZA 2AJZB 2EXYD 3DHPA 4F7TA 1CXLA 4NQSA 4KGLA 1Y07A 1N4XH 2IBZY 3H9ZA 3FQNB 1KB5H 3ECVA 4QHLA 4UT6L 4ZMXA 2WQ8A 5I76B 4P05A 4XP5L 3OJ2C 2XUWA 2WHVA 4JM2D 3IMSA 4FQIH 5IR1A 3QJQB 1HKFA 3MOBH 4L8BA 5CZRA 3VFOB 3VD1A 2QVTA 4Z77A 2M26A 2X9ZA 5GZOA 2W0FA 2F54A 2JIXD 4R0LC 3BCFA 3CVHA 3FAXA 3CZUB 3OX8B 1QBLL 3A67H 2DQTL 4UU9A 3A6BH 5FYLH 3Q1SL 4HPYH 1NMAL 3F6LA 4KUCF 2ODIA 2HRPH 2O93L 3MRHB 2V7NA 2R9HD 1PZ5B 5LQBH 4PBWD 2XWCA 1R3JB 1A7RH 4HWZA 4IBVA 2G2RB 1A0QH 4L5FE 4NO2B 1ZTXH 4N2MA 3EH3B 1HINH 1UHVA 4KOCA 1VSCA 3HAEA 5CR1A 3BN3B 1HCVA 1UEMA 3IDYB 3LVTA 4DN4L 2AERT 1OP9A 2VLKA 4ZG1A 4Z7VE 4R4NC 3ARGC 4LNRB 1MLCB 5DC4B 2QQQA 4NKMA 3WOVA 4OCLC 4X6CB 1QWHA 1QBAA 3T71A 2AEOA 4NDMB 4WW2B 1OAJA 1BPLB 5CSBA 4WV1B 3MCKA 4K7PL 1KFAH 4M93B 1XF3A 4LCWE 1LEIB 3QYNA 1F2XK 5K9KB 5C86A 4W9FC 1QBLH 4A37A 3UJTL 4UMSA 3NFNB 5GGVY 2H3KA 4KKZA 4GW1A 4Y9BA 2FLMA 1BVLB 2AK4D 4ILDA 4A7GA 5C3LD 2A74B 4JE0A 5DLMH 4WUUD 3CZGA 1CXKA 1AZRA 5F9OL 4X6BB 3VNYA 1ZLEA 1CD0A 4YGAB 5F9OH 4Z7WA 1NGXA 1NCJA 3NPZB 5IQ9A 1DJWA 1G43A 4ODHH 1JBJA 1S3RA 2GVYA 4JFOB 4F20A 5FIEA 1FE8L 3GLAA 1GOHA 4H0GA 5SWSB 1AR1C 4XVSH 5E56A 2ZCKL 2DQEH 4LCIL 1CGSL 4N5ED 3B3BA 5FO8B 4OLWH 2OV0A 1TPXC 2QQNH 2HN7A 3BUPA 4JLRA 4L9DA 5G5DB 2A6KB 3WMPA 2ZD0A 1GR7A 1RU9L 5DEJA 4Z7NB 1BQLH 2OFQA 5JLZA 1BAWA 2ZOWA 1EFXA 3P40A 4HP5A 4D8PB 3BQVA 4G7YL 3GSRB 4UQ3B 5FO7A 1QRND 4N8CL 1MCNA 4OFQA 3AROA 3MN8A 4MLSA 2D8KA 4PTUB 2EIMB 5FO2A 4AL8C 4CC1A 4GJTB 4C59B 5H37H 1I1FA 3SIKA 3RVXC 3W0WB 5SX5H 1R46A 1VGEH 2N56A 4Q9QH 1DN2A 1MHCB 1OO2A 4LHQB 4ZS7L 3BUTA 1GGBL 1S9YA 3VXRB 1HHGA 4RZCA 2K45A 3ALPA 5KVEE 3WIFA 2G4EA 3LRSA 3FFDB 1NL0H 2LHAA 3ZT5A 4KY2A 3VXNB 2GHWB 1NBQA 5GRXG 4CADB 5AL0A 1MHPH 3MV8A 5CEZE 2FO4A 2AGJL 5AUMB 5EOTA 2VOTA 2CBMA 1SLXA 6FABH 1U92B 4HF5H 1LQSR 4UOJA 5J1SC 2X0VA 5DVOA 3VXSE 5E1GA 1ZA6A 3RPKA 1JFQH 1GVIA 3QDJA 1OT2A 3TBWA 2DJSA 2WLIB 3GMMB 3ULVC 1TSHA 2NZ9D 2R29L 3VXMD 1HL8A 2OK0L 3S4SB 5HYJE 4LLDA 3R8QA 4F7CA 4ZMPA 4NQEE 4YHZH 5TF1H 4WO4B 1G7HB 2VXUL 1VPOL 3CSYB 3FFOA 5D7HA 2QKSA 3C60D 4F24A 4XCCL 1GGCL 1ZHBA 4KUZH 4Z18A 4P07A 3G5VB 1TJMA 3L6FA 3LX9A 1H3TA 3T6QC 2N01B 3H9SE 2ODHA 5F1NB 5DMIL 2X4RB 1AKPA 3VXTB 4XVJH 3ASNB 4L4TB 1M57B 3VW3H 2PKDA 4YSDA 3QWQB 1QLEH 3E38A 2Y4SA 3FSVA 4HC1A 4YX2L 4JPVH 4KK9D 3L8QA 1U42A 2DM2A 3C5XA 1KCUL 4LPVA 3B6SA 3VFPB 5JUEH 3VG0L 5K69A 1UGNA 1DEEA 4CSTA 3OBAA 4M1DH 4U33A 4JY4A 4UTBL 1A4AA 1UXMA 2FBJH 1DDHB 4XNQA 5HJ3A 3GMRA 3ATDA 1BVKA 1FC1A 1MWOA 3QPXH 5EBLA 3UTZB 4L4VA 1U8MA 3FT3A 5I9QB 3BVWA 1NWPA 2OYLA 3HBQA 4OM1L 1R5WB 1KIPB 4NQDB 3GT6A 4AGLA 4N2GA 1KEGL 3S98A 5JQ6L 3B5TA 3LD8C 1Q8MA 5C0IA 4U2ZA 1K4CA 4G7QB 5I0DA 4M61A 4HHWA 3P69A 1RQ5A 5DD5L 4A6YA 4WJG3 1JHLL 2GPZA 2C9RA 1QLEL 4OF6A 1BOGA 1WG3A 3T2OA 5FYJE 1QHOA 3FO2B 4XPBH 2VUYA 3CHXA 5DXWA 5DRWB 4G8GA 5TGBA 3TJPA 1L3WA 4JZNA 2R7EA 4U3HA 2XA8H 1GYWA 2VABA 5DHXB 2IFGA 3CH1A 3OR7B 4BELD 4F8LA 3VYOA 4JFUA 4A7VA 5CBAA 2Y23A 2Y7OA 2NY1D 4JQIA 1WAEA 3N06B 2BINA 4PV8B 4TLTA 1MFNA 4GMSL 2O5YL 2EVFA 1H6FA 1JWUB 5HHME 2EEAA 4Z95L 1QR1B 2J8OA 4XMPH 5DD3H 2G75B 2X12A 4NPKA 1Q9WA 2WWOA 3BH4A 1JF1A 2EEDA 1YYLH 1M6UA 2ATKB 4YOKA 4MB5A 1HQRA 4QRPB 5D1ZA 4YXHH 4B9IA 3UZQA 5ICYA 2HLAB 2R69A 2YAOA 3UC0L 2DIJA 4QNPE 4PGJA 5EBGA 1DFBH 1I8KB 2Z8WC 1C7SA 2R1XA 4X80H 1RJYA 1P4LB 4A1RA 1VADA 1DVQA 5D7KE 3GRWA 2QSCH 5E8EA 1DN0B 3WEXB 2GSGB 2ROYA 4S1RH 4FERA 3MLTA 4UTAA 4PIBA 4M5SA 1JTTA 1IGJA 3UX9B 1R17A 2LLGA 3ESUF 4HJJL 4NN6C 1QSFD 2JLLA 1OK8A 3IJYB 4UT7L 2C1PA 4Z7WB 2BP8A 1GTFA 3GQFA 3T4YB 3U7AA 1T20A 2PNDA 2ZF9A 5DHEA 5BRPA 1PG7X 4IJTA 2MQ0A 4NNPH 5DD5H 3BGMA 3ZU8A 4LRNH 2ZG2A 3BGMB 3EYSH 5DVKA 3VU2A 1FQ9C 2QGBA 4GO9A 1BM3H 1KMGA 3U0PB 1UA7A 1XH0A 2NR6A 3BZ4A 3CBJB 1Z9PA 4AV0A 1IAIM 1S3KL 1E7VA 1ZDSA 1T5WA 5ANME 3ULSA 4FABL 3EJCA 2CAKA 4XGZB 2WBJD 2J8HA 3O6LL 4OAWA 3PYCA 5FFOA 1JYNA 3S4SG 1BQKA 4KC3B 3R8BB 5E1AA 3TA3B 4WKZA 3H9YA 1E4XL 3PFUA 5CZVL 5ICXA 1KEGH 4NGHL 1EH9A 2DLFH 1QI3A 2OPCA 1T3FA 1M6OA 1KF9B 3DXAE 2A38A 4PRBA 4L8CA 5DZ9A 1WTGT 5ELIA 3BN9C 5HYQA 3LKOB 4ELMA 3G04A 2FBJL 2OKMA 4HMEA 3K1KC 2D0FA 1DQIA 4QT5A 4GEIA 2FB4L 5IB2B 1VCBC 2FQDA 2GI0A 4UU9B 3HPJB 2HG0A 3BLPX 2YAHA 3LEXB 3NP3A 3UACA 2A1WH 2AJUH 4KUZL 3BJ91 1IAII 1PG7L 2WWKT 5IOKA 2HX9A 3CX2A 1B0WA 4UNTA 4C47A 1KOAA 1OTUD 5T5NF 1FYTD 5DMIH 2E9GA 1YPZE 3UMTA 1MUJB 2O5NA 4EJ1C 2HJFB 1GC1L 4OGAC 5FK9A 3O4LA 3HEIB 1L0YA 2TAAA 3BOVA 1EXUB 5IROC 1CF8H 4HS3B 5CINL 3G5ZA 1SFDA 3MJ9L 4R97B 1OCWL 3NZUA 1TQCC 5CP7B 4N25A 4TQIA 1R34A 2IWEA 3MOAH 2AK4B 3G5ZB 4KUCD 5E2TH 4AQEB 1MY7A 1RUPH 4YBQC 1OAQL 3B7YA 4CMMB 5JHDE 2FX7H 1QO3A 1OGAB 2LE9A 1GZQB 1UZ6E 3SYCA 4AIZB 5J12B 5JIMA 2R23A 2G9HA 3SEPA 5HYFA 4RDQG 4I9WD 1I82A 1HEZA 5F44A 1EEYA 4PLJD 1MI5B 3IJYA 1WK0A 3N40F 4KMQA 3GK8H 1LJMA 5E2UH 1SEQL 2V2WB 3WGVB 1U3HD 5ADPL 4GG6B 3QQ9D 3OPUA 2JELH 3OKMA 4ZW8A 3QO0B 1FNGA 4MYPA 2CJSA 2YXMA 3VO0A 2HP4A 1F4YL 1L0XA 1KYAA 3V10A 4ABUA 4XH2A 3MYJA 3KCWA 3MBXH 2MMXA 4G7YH 2EDBA 4DH2A 4IK7A 2VDKH 4U7SA 1OT4A 1Q94A 3NH7H 4XBGB 2WWMC 1N9PA 5BS0A 1JD9A 1G7HA 5CFAA 3EKCA 1WAAE 5T1KA 3HZMB 1IQDA 5A2FA 2OA9A 5DMGC 1AS6A 3EGSB 3BW9A 5EZPA 1ETZB 4JFZH 3CFCH 1BPVA 3K4ZA 1FLRH 2CJUH 3OJDB 5SWSD 1XIWA 1NA8A 3CTTA 2MHAA 5DVLA 4IRSC 4QTIL 3OKNB 1PDKA 4R9HA 3ZVVA 1M71B 4FXGA 4ZMNA 3ULVH 2KMWA 2GJZB 5DTFB 3OLDA 1ZSDB 3B5HA 1YQVH 3CUPA 1Q0XL 4PG2C 1G6RH 4UDUA 5C0AB 5F1NA 3WLBA 1U92A 3HLAB 4W70A 2HT3C 2XICA 1A4CA 3CK0H 5DR5H 4B7LA 2WXGA 3FRPG 4P2RA 3WL9A 3L4CA 1BFSA 1S4IA 2YHGA 3FU5A 2DLFL 3STZA 4ZZFA 5FB8B 3K8LA 3MLVH 1ICTA 3OGOE 2R2CA 4WEEA 4Y5XB 5LG6A 4U1JA 3L45A 5I6MA 3VFUB 5E24E 4FLRA 3G6AB 4G70B 3Q2WA 2OI9B 1TYRA 3WV0A 1ZS2A 3AB0B 5C0DA 1A4JA 1O7VA 2FVNA 2XZCH 2Y2YA 4PB9H 4IS6B 1N0XH 4DOHB 4YHOH 1JPTH 5DJYA 1BD2D 2D3LA 3ATAA 3MLZH 3HPJA 4KQ0A 1OY3B 1X4XA 2UYLB 1G9MH 2H2SD 5CD5D 4WVRA 1IBDA 1JV2A 3G6JB 4JRYA 5B39G 5L0QC 5F0LB 2SEBA 4IU2B 1X9QA 5DD1L 4CVXB 5EEUA 4PJ5E 4X5PA 5DFVC 2XC8A 5DUML 2B08A 3H9SB 4JG5A 3W2DH 4PBXA 4PP2B 3MGAA 1ZTXE 5IESL 2EAEA 1TZAA 5GSVB 4WO0A 4N1EA 1WAAF 1ZSHA 2Q0ZX 1G1YA 2LVEA 4ZW5A 4TMPA 3BRDA 4H26B 2XN9E 1RK0A 1UH2A 2UZXB 3O2VL 1UD8A 2XG4B 1OCOB 2FBOJ 1HZKA 1CLVA 7TAAA 1T5WB 1OLLA 1F90L 3FBKA 4XXDB 5E6RB 3L4WA 3MUZ1 4X99B 4IRJA 4NO3B 1XGQA 5HGDB 3UJJL 3V0WH 1TZ8A 1WPCA 1YRKA 3ILQD 3L5IA 3PV7A 5AWNH 3ALWA 4WWOA 4BCXA 2HN7B 5CUSH 3R1GH 1NMBH 1H19A 1HKLH 4WHYH 5KYXB 2IQAB 3DX6A 5EZLB 1NUNB 1U8MB 1C8QA 3DX0A 1JTOA 2BS71 1M7XA 4JVUA 4MMXC 4KJQC 1JXDA 3BKJL 4P2QE 4EXKA 1C5CH 1YEIL 5EO0B 1K2DA 2ITFA 3EJRA 4P0DA 5JIQA 4U6YB 3PF2A 3T0AA 4WHDA 5DRZA 2XWXA 4LSRH 4TNEA 2OI9C 2P44B 3KBHE 4OLYL 5DWUH 4ZW7A 3RKDC 2WO4A 3L4VA 4GAGL 1JL8A 2XZAH 4M1CD 4G43B 2Q3ZA 5KTEL 4PRIE 3VE0B 1GZHA 1HDMB 2J3SA 3BVTA 4X8JB 5GZNA 5D7IF 1JV5B 3MRHA 3F7RA 4ES8A 5E4EC 5FYJD 4NZUH 2XZQL 2PYED 2C3XA 3BPLC 3FB7B 2GSIB 4H1LA 2ATKA 4AK2A 2SEBB 1OTSC 1IC5L 2CALA 3BFWA 3SDDD 5JPNC 4OIIH 32C2A 4XP1L 3AS0A 2WLJA 1UXWB 5JNYB 1CE1H 2XFXA 4YHLL 4MXQC 1E6JH 3NIGB 4KK6D 4U6XA 4FQQB 3EO9L 3RWJA 1OLZA 4OKVA 2YSTA 3AWGA 4GRLC 3CXDH 1FZMB 3I6LD 3PIQA 5KVEL 2OM5A 4PJXB 1AP2B 3WHE1 5D7IB 2AVGA 3VXQA 4ZX3A 3B9KB 1AGFA 4DP1X 4E9LA 1F45A 2BVOA 2VZVA 2P43B 1CZ8H 5EUOA 2B9AA 2VN5A 3DUHA 4HWEH 4MNQA 5EOTB 4GAYB 5TD4A 5AB9A 2EDJA 2XIBA 2CLRA 3V0AC 3EDDA 4BM7A 4R0LA 3R19A 4I1NB 3PRZA 5GZND 1BVLA 5DQ9A 2OMVB 1DUZA 1E30A 3TNMA 4ZAKB 2ICCA 2CDFA 1KGXA 1PG7W 3IF1A 3V0HA 3T0ED 2QGDA 4DGYL 3GMLA 1VAHA 2QTVA 2VO8A 4FCAA 4NAJA 2YMXL 2QQLH 4ODXB 4AYMC 1PD0A 3T2LA 3WFHB 4D2NA 2HFFB 1T2JA 1O6SA 3MV9A 3CGTA 4PPTA 3GB7A 3HMXA 5HHPA 1S9KC 4GKSB 4B60A 4UANA 5ANMB 1KXVA 4FMVA 3HMXH 3BAWA 5D55A 5G5DA 2DQHH 2E46A 3DTDA 5C0FB 2IXQA 3LPGA 4KHXL 3RVTD 4YBLC 4QOKA 1C08B 2ESVA 4ZNEA 4LF3A 3OR6A 3TJEH 4YXLL 4YL9A 4NQDE 4H8WC 1PQZB 4JANA 1FL5B 2BSSA 3CX5K 4N2OA 4X9GA 3GXDA 4XXWC 4HGKC 1FAIL 4HJEA 2FGZA 3HE7C 4PLKC 5AZUA 3U79A 4F37K 3SE8L 2YGOA 4AIEA 3T3ME 4F8QA 4HWUA 2PUQT 3KW8A 4GG6A 5DDHB 3TF4A 4XP6H 4EIBA 4ES9A 4U4BA 4GIAA 2DMGA 5KZCB 1BDYA 4D0BA 1OAUL 3BMWA 1KWKA 2XN0A 3U6XA 3MUJA 1FFOA 3DXAD 2CA3A 2E56A 1FNFA 2ID5A 3RI5F 3T8XA 1IGMH 3N1GC 4JO8A 1MJUH 1BJMA 1Y18B 3P0GB 3MX0B 1BD2A 3LHPL 3MNWB 2NYYD 2YARA 2UV3A 3Q01A 4KROD 1J8RA 4QHMB 4PJCF 1IBYA 2YRZA 2DWEB 2I5YH 4X42A 5HHOE 4HLEA 3HRZB 3CPLB 2X4NA 3OM3B 4Q6IA 2Q9OA 4LAJH 2X1QA 3KPRA 3RTQD 4HCIA 2DLGA 3OAUL 3HNSL 4XVOA 2MPVA 1CR9H 2PMZA 2QL1A 1T66D 2JJUA 3GO1H 5I8EB 2WW8A 3BIBX 3MRLA 4ONHB 2IOMA 4NXKA 4J3UA 5EC1B 3CSFA 3V6FB 5KN5B 1F58L 1SLWA 4S1QL 3VM7A 4GUPA 4FC3E 5L4FA 1C5BH 4P2OA 4PJDA 2FGWH 2V3DA 3AC0A 4IOIB 1BX2B 4PR5B 5GS0C 4U1SB 4M6OL 4GKLA 4AT6B 2NY2C 2ENSA 3VFMA 5ITBL 2DPKA 4YLQT 4QT5B 1FVCA 5F72S 2C3VB 2FAUA 4L29A 2X4QA 3GWJA 4KKQA 4ZD3L 3PHQA 5F9DC 3VM5A 2PW2B 4TV3A 3QQ4A 3U6RB 4G1MA 1RUPL 1MCLA 2K8QA 1MRCH 1T22B 1V3KA 3FH8A 3Q5YA 3BKYL 2PW2A 4GBXB 3ZDZE 1AZVA 4ODUA 35C8L 1QEWA 4FAAB 35C8H 3D52A 3PCYA 2XXMB 2OMUB 3H56A 3TA3A 4ICWA 4M8QA 3IFLL 1JXGA 2GG1A 5H8DA 3SGKC 1IBHA 2XLLA 1W0WA 2VZUA 5DEGB 5EC2A 2AJXL 3Q1SH 4HPYL 1ZA3A 5FCSH 3VQ1C 1BBDL 4XVSL 4FEIA 3EJTA 3Q43A 1OL0A 2BO0A 4KI5D 2D3JA 1RHFA 3IU4L 3V5KB 1ZA3B 4F80A 3MLUH 3D08A 4KX7A 3K7UA 4L18A 1JGDB 2DTML 4K7PY 5T5FL 2AC0A 2AXHA 4NDMA 4RGNC 4HCRH 1RK7A 2ICWI 2R59A 4MBOA 2MCG1 5F21B 4CKQA 3N5AA 1OSYA 3R06B 5DUJA 2CM6A 3SKOB 1DJYA 4B0MB 2EEBA 2WWNA 2WSDA 3N40P 3QYCA 4NZTL 1WWWX 3JV6B 1UYWH 3FK3A 3JV6A 5D2NC 2ENJA 3IXTB 3DHJA 3ZGIA 4OLZH 3QE5A 3I2CL 3RX9A 1W8EA 4G6JH 5IQ7H 3VQ2C 1QFPA 3VA6A 3KPQA 4H8VA 1ERNA 2EDMA 4HKXB 3DX8A 5FF6A 4NUGH 3DX8B 2DQJH 4HJIA 5A16B 3VUAA 5LGJA 1SXAA 5C7XL 5F7DA 3RWGA 4AJVA 3KPMB 1L7IL 4NBYB 3LHPH 1X9RA 4LLWB 3VFMB 1SN0A 4H8HA 1D2OA 2MOGA 5AAWA 1KPVA 3QC6X 5KEZA 4MDJB 4GKNB 2ZIDA 1IFGA 4M4RB 5D2LF 3L5WA 2MJWA 3VX1A 1T04B 2UZPA 2X0UA 5JOFB 5IROA 5I8OH 1O6VA 3HLKA 4HT1L 3RFRA 1UD4A 2BHZA 3MGOA 3R7QA 1KTLA 4P06A 3FQ4A 4UNIA 4XWGH 5D93C 3SPHA 1N68A 3ME0A 4DCQB 1BG9A 1PU0A 4OU3A 3RVVC 5KG9A 1YECL 1JN6A 1TR7A 2A9AA 4KHTL 2AF2A 2KLTA 4ACTA 4ADGA 2Y07H 3CFMA 1J5IA 2FTAA 4H20L 3VXMA 2H1XA 1DQLH 1K4DB 1WGOA 4IHOA 3E6FA 2BVQA 1L9OA 2YD5A 2AQQA 3NCEB 2BP0A 3QDJD 5IIEA 2N1TE 4R0LB 2BNRB 4G5ZH 4K7PX 2X4PB 4J4PD 1IGIH 4JHAL 3HC0A 5BZZA 1YNLH 3UTSE 2OXGA 1M7DA 2WLLB 2YFOA 1T22A 1FIEA 4IKJA 1WH0A 4BFRA 5D2LB 1RURL 4AGPA 5CINH 3CSPA 5IB4A 1BFVH 2VR6A 1A1OB 1N4XL 4PJXA 4UV4L 5TH2A 4XXCA 5A2BA 1SOKA 4JPKH 5E2TL 4NUJA 1T21B 1DJXA 4HHAB 2VDOB 2WVSA 1L7IH 5AAMA 1IGTB 1MJJB 2IGFH 4ZODA 2YRBA 2D0GA 1JUFB 1MCPH 1OCRB 4NUGL 2RACA 5CLXA 1B2WL 3BWSA 3QDGD 2DBJA 3QI9D 1CE6B 1PCXA 4WFFE 5ISZE 1J9QA 3FU7A 1EFXD 4NIYE 5TPWL 4POYA 3L1EA 3RWIA 1SHWA 1Z3RA 2BVPA 1E2VA 4UZGA 2XOTA 2RGSA 3FHEA 4N85A 5D71L 1PEWA 4Y0GA 4F57L 2OR9H 3VXUA 3GZOA 1C16B 3GDCA 2BW5A 4LCUA 4K71C 4F2ME 1RH8A 1AVAA 5LDSA 1RJZB 4QYAA 4K7FB 4O02B 3TTSA 3QUXD 1A1MB 1S5HB 4PJFE 1NFKA 2GBUA 4S0HA 5J89A 3ATBA 4MJIE 4OD1L 2YEQA 2IADA 4TLUA 1ZT4A 4PJEF 1ZY9A 4AYDC 5K5YA 4CN6A 4PY7B 3KPOA 4G3YL 5I19L 4RFNC 4DVBA 2IALB 3X13B 2X70A 3FOLA 4J39A 4LEXL 1NFIA 4NJ9L 1E27B 2DQFB 4WUUB 3GLDA 1AFVH 3Q3GA 5EFIA 3WNIA 4HX1B 3P0VL 3QIUA 2VLRD 2Y1YA 4XTRC 3PE9A 2MFNA 3O6FC 2VZTA 2NLJB 4X5XA 1MHHB 5FWRA 4AEEA 2QSQA 3AG4B 5A7EA 4NIKB 2BCKA 3X3FH 3U1SH 1SMOA 1JPST 3QB7C 3ZHLA 1MEXL 4FQ1H 1CIUA 2DJ4A 3KJ6H 3BAXA 3U4KA 1IAKA 3TV3H 2JB5L 3AB0C 3QHTC 3HG5A 4I0PD 4TQEL 1RIUH 1A4BA 3BP4A 4M43L 3M17B 3IDUA 4XCNB 1LO3L 1AD0B 2ZWNA 3VMOA 3CC1A 3AWEA 2QJDA 4MMZA 4UWQB 3SDDA 5BOZG 1WSST 4X99A 4FMFA 3WFDL 5FOBA 4GQ9L 3I3EA 4G9DA 5F0PB 4RMVA 4CSSA 3ZT6A 4F9PC 3SD5A 1FO0H 3GXUB 1AE6H 1KBGL 4MXVF 5HI5D 3QISA 3ZR5A 4WI2A 5I1HH 1R75A 1T0NB 3DBXB 2E27L 2NDGA 4WTXA 3ZE1B 4KRPB 5GSVA 5IJBC 4U1GB 1G7LA 3MRKB 4NQUA 3UTTE 3LZFL 1QHPA 3RB7A 4Q6IB 4L37A 5D2LE 5IJDC 1CFSB 5GGUB 4S2SB 3EBHA 5LAXB 5I1LA 2BSRB 2E7LA 4YO0A 3VDAA 3VFWB 2Z7YA 2QQKL 1M9WA 2KYIA 1AHWC 1G7MA 1NIFA 4OV6F 4FYSA 4G80B 4HVBA 3SO5A 1TITA 3LMJL 3MVSA 4RWYH 4IMLA 4UTAH 4DF9A 2I9LA 4PJ8A 3WIHL 5MHSD 5AVRB 2R4RH 1ORQA 2EXTA 2X0WA 3NK4A 2BHYA 1Q1PA 5H4YA 1OM3L 4MQSB 3TA3C 3G6AA 5IMMB 1AY1H 2VSMB 1O75A 2N4IA 4ZFFA 3CXHK 2DMCA 1XL6A 2WSKA 1KLFA 4XAKE 5ACZB 1B0RA 3IB4A 4R96B 2O6PA 4HJSA 4U1LB 1KELH 4BDVB 3KBFA 4XP9H 2R69L 3MREA 2ITCB 3NEXA 3MFGB 5C0CA 1AIFB 1SVCP 5IEHB 4HWBL 1KBVA 1ZLWH 3DGCR 3JVGA 1UB6A 3GSQA 4FLOA 2IBGA 5C0JB 2OXHA 3CV5A 5KVDL 3UMNA 2PTTA 3AT9A 2JCWA 4IU2A 1IT9L 2L8AA 2XWJA 4I2XA 4Q4EA 1KCLA 3OHXA 4KAQL 2IAMB 1OXYA 5IBTL 1X5YA 3VG0H 1NGWA 1P6AB 4JFDA 2C1PB 4YSEA 1ETZA 1KTRL 5LXGH 4P5TB 5AW2B 3RNKA 1B2WH 4KJPD 3QXUA 5IVXE 4ORGA 2XG4A 2WLNA 3GNMH 3J2PA 1I9IH 2ZXAA 4Y9FA 4ZNCD 2A2QT 5FGBC 2OTUA 2BDNH 1I75A 5DJ0B 5C0BB 3VH8G 1Z5LA 5D4IA 1DO6A 3QS3A 5KYUB 3OHXC 2X2IA 3EFDH 3GRWL 4HEPA 2BSTA 4HWEL 4XRCA 1FGNL 3L3HA 1XGTA 2JKJA 4N0FA 4RDQF 5B38B 1NAKL 4KZEH 4QLWA 4FFWC 4ZRGA 3LAFA 1QFWH 1TLKA 2E6JA 5TQ0L 3Q7JA 3T4AC 3TV8A 4Y2DA 4HJ0C 3PGCA 3BI9X 1YMHA 2K6YA 3FU0A 4M7LH 4MX7B 4AMKL 4MXWL 3ET9F 4APXA 4YJZL 4HALA 1AS7A 1KPUA 4KJQD 1GGUA 1KN2L 1F4HA 4NAQA 2VXQH 1ITBB 1LO2H 1TQTA 4ERSL 1HHKB 1Y0LA 3EFOB 4X0KB 2NOYA 2OL3H 4EZLA 1T89C 1YNLL 5JIPA 1BIHA 2QDVA 3HE7A 3X12A 1YEGL 4G1EB 1QO3B 1MHPL 1MRFL 4AV4A 5DUPL 4LLVB 3FO2A 5B7MA 4J2QA 1CGXA 1JZGA 2EYRA 3QNZA 4RFOH 3RX8A 3PABA 3APNA 3FB7A 4H1LB 4WENB 5JHDA 4UQ2B 4B95C 1SMAA 1X3DA 3LRHA 1W6WA 4LSRL 3VFNB 3FTSA 2J25A 3C8KA 4GMTL 2FEEI 3VFUA 3VRJA 4MYWB 3WEMA 1NUGA 3IJHB 4WFHE 3VFRB 4DIXA 2Z34A 4MXQD 1PDKB 5MEPB 2ZZUT 4L0YA 1UXSB 3FZUC 5CU5A 2VLKD 2IDTA 4OAWB 2I07A 5E03A 2K8MA 3BVNB 4HWBA 1GC1H 4XNQB 2VH5L 3V7MA 4E5XG 4IIQB 4UDUB 4XNXL 1G84A 2I07B 5E08L 1A9BB 1DQDH 3ZHDA 5CIPH 3NCJH 1A3RL 2VE6B 4HXBL 4XBGA 3TBTA 1HHHB 1P1VA 4JQIL 2I26N 3SJVA 4J5VA 3RHWK 3UJIH 1PW3A 2F8IA 2GW5A 4RGOL 4WI5A 1GOFA 1HCZA 1S9VB 1HHHA 4OLZL 4QRTA 2ZT9C 4GKZB 3KE0A 2F54D 2JIXA 3CCHB 1G1CA 3QUHA 4WEMB 3GBML 1HXKA 5BS0E 2PW1A 3MRBB 3U36A 4OW6A 2J1YA 1D6VH 3LKNA 2UZXA 3NPSC 4PJFB 3LKNB 4X7SL 1AGBA 2ZOLB 3W9EB 3F64A 4QAWA 1MF2L 3PDGA 3RJQB 3HPLB 4KXBA 5B7FA 2ATPB 4FZ8L 4Z7NF 3D0AA 4YDMA 3DOSB 4JN1H 4BWUA 5T3XH 3VI4F 3EJYC 1J5CA 1T7YA 1UKTA 3F6JA 4ZFOB 4LVHC 1ZLWK 5C09E 2EIZB 4C4BA 4FKHA 5EB9A 1F4YH 3N1QC 4BCZA 1AQMA 4DP0X 3WEOA 4L8SC 2ZWSA 4LSSL 1KXTB 3F2LA 2YPVA 1F0LA 1H0DA 5ITBH 2Q3XA 4IRJC 3BC9A 3OC5A 1AJ7L 3K71A 2F2HA 3CZSA 4IMKA 4WEUD 4TLSA 4QEGA 1ZKAA 5MEPA 2VQ1B 5TE4H 2G9HB 2YGQA 4ODSL 2Q1EA 1AGDA 5ALCL 3NZ8B 3BHBA 3IDXH 2WM0A 1ONQA 2G3XA 5AB0A 5FYJL 4PB0L 2XWTB 4A6YH 5HY9A 3E2HC 1K8DB 2A7BA 2E8ZA 3MJ8A 5FB8A 4OR1A 4K9EL 2ZYSA 4N0CC 3AQYA 2XIIA 2Y06H 4A6YB 1IKNA 3K1DA 4JJ5A 3QNYA 4NHUA 3KHQA 1S9XB 5E99H 3OKOB 2EDTA 4GKZA 4I0KA 1AD0A 2LFEA 4XMLL 5KYYB 1U91B 4PJ5A 1JGVL 2BJML 2A0LD 4F58H 2ALWA 2UZIL 4Q2ZA 3H53A 2L0DA 3NPSB 1IGML 1MWAA 3KVPA 4Q9RH 4H25A 3FQYA 1UB6B 4ONOA 4A2GA 2L7QA 3FCTA 1U8HA 4WGWB 5AOLA 3TT1L 4U1MA 5HGHA 3HNTL 2V9QA 2NT0A 5T1KB 3L3GA 1U0QA 3D7PA 3I02B 4IOSD 1XBRA 4M6NH 2BVEA 1GYCA 3RY6C 4P4KB 1IIIA 1BZ9A 3BGFC 1JERA 3RYMA 4JREB 4APQC 3ULVF 4CBPA 2Q2EB 4LPWA 3V6ZA 3EYSL 1QUNB 1LO0H 3HG3A 5F6HJ 4IRZL 1N7MH 1T1XA 4QRPD 5E8OB 5GS0D 5K1NA 3OJMB 1NQBA 5D9SB 4OGYH 3PHAA 3VWKB 4W68A 3D12B 3NUKA 2NZ9C 4ZMLA 5K59E 1E6OH 4P2QA 3LPWA 4X6CA 3CLEH 2R2EA 1ZHNB 3UDWC 5EIIG 3KG5A 2V2TB 4XNAA 2XA3A 3LZFH 2X2UA 1S7RA 1CU4H 1U30A 5I28A 1MCWW 2ZUUA 3VWJD 4X80L 4C8XA 4E68A 1WUNT 4G8GD 1ZVSA 3UROR 3SY0B 4TTGA 5A43C 2EH8L 1T0NA 3KPPB 3KW7A 4POZC 4Y2LA 4Y2DB 4PGEA 5J56B 3L3IB 1GCFA 3BGAA 5JHLA 3MCG1 2Y25A 4X6DE 4NN5C 5E8PA 2B59A 1CDGA 4HUUB 5E6ZA 2Y2WA 2MNWA 1SEBB 4NYLB 4GAJL 5EHFA 5DHYB 1EHAA 3SQOL 1AOZA 2GK0A 1XO8A 2D31B 3VXRA 2X4SB 2X7LB 4J6RL 4LLDB 3RPBA 4PJIA 4GW4B 3MLSL 3BXNA 5IR1B 5CCKH 3F7VA 5IMMA 1Z5LB 4ZX5A 2BOCA 5ANHA 3ULUL 4PCKA 3AY2A 1LEKA 4K3EH 4PJAB 2X05A 3H9HB 1Q9KB 3MLWH 3VTMA 2NY3D 4L9LA 1DQML 1I1RA 2I9LB 4HS6B 3B9KC 4I3SH 2UVEA 4A2DA 3HG2A 5DJDA 4W9ZA 1W72H 2RH0A 5E1HB 3ZO0A 5IG7B 2LFGA 1THCA 3E7JA 3QXAB 3T0EE 1BFVL 2G75A 4WK2B 3DARA 3OZKA 5AW3B 2OMZA 3FMGL 3L3HB 3ZZQA 5KSBB 4A7GF 4YVNA 3DSFH 3HW7A 1S9YB 4NENB 4Z3IA 2OZ4H 5GGTH 4NZUL 4LVOB 3NESA 4JW3A 5I6XC 2GFBA 4Y4HC 4AZ8B 5KSBF 4X4ME 2NY1C 4NN6B 1M9SA 1P4BH 2V17H 4FQXD 3KJ6L 4FG6C 4KPHH 1YUHA 4FQ1L 4ISVA 5FLVA 1MELA 2VR7A 5FYKD 3UIZA 4C57C 1INQB 1NC2A 1XXDC 4R7NB 5F2FA 4DNLA 5T1JA 1NIBA 3HVDA 4RH4A 1DBKL 3CCHA 1X9UA 3QEGH 3WNLA 1KDIA 1E90A 1IJNA 1FN4A 4UT6A 2WUCL 4GW1B 4X5RA 5FM8A 3SKNB 2X44D 3WFZA 4DGWC 4YQXL 2GJ6E 1SBBA 2D7OA 1TU2A 2X70B 3SSGA 4CC0A 3X11B 5GGRB 1QW8A 1S7WA 4I9XA 3ARFD 1E3ZA 1FZJA 1WLHA 2N1KA 1WEJH 4KK8C 2Q7YA 4I0PA 1NCAH 2ZWYA 4IDJH 4MDRA 1JMXA 5IW6B 4NRXB 4J3TA 3IDJA 3M8OH 3V0DA 2FO4B 3BVNA 1ZHBB 4M9PA 4NRXA 4NUPA 2FJSA 2WXIA 5JA9A 1FE8H 1KJVB 4JFPB 2EDDA 1TJGH 3MQIA 2MOQA 3KL0A 1BM7A 3IGFA 2NYZA 2C5DC 4K94C 4R7VA 5KVGE 5CEZD 2HKFL 1XGUB 5IFJB 4L0PB 4LKXB 4UZUA 1BVNP 2WV3A 4YDVB 5B3JE 3FU7B 4S10A 1XWVA 3PUUA 1LO3H 2ZAHA 3RUGB 2PLTA 1DSFH 1QFOA 1RZKC 3H4HA 5FO7B 4F1SA 4NN5B 4R6UA 3CSYA 2GKIA 4MD5B 3MI6A 3T1WA 3O6MH 2W0FB 3LXBA 2BSEA 4Z7WF 4NZDA 1M56B 3LNDA 2YQ2A 4LSVL 4L3CA 4P5KB 5DVNA 2LGNA 3OG4B 3OL2A 2C9QA 4KRPC 2GUOA 1R9FA 4L4TE 1HCFX 1IFHH 4MB3A 1E5UI 3QH3B 1BZ8A 3QUXA 5FW6A 3B9AA 4K9JA 4M7JL 2AXJA 3L4YA 1U95B 1M05A 2WCSA 2DYRB 4HWZB 4B9KC 2HLFD 5DZVA 4NNYB 2Y0SA 5C07E 4K3JH 4Z78A 3MUHL 2DWXA 3D69A 4BH7B 4N0UE 3Q8EA 3QCVH 4GS7C 1BJ1J 4BJLA 1A14L 3QDGA 3WS3B 3NIDB 1RUQH 3QIUB 5BZXA 4HFWB 4JO4L 4NO0A 5FCUL 2F1AA 4PGBB 3CC5B 2XVKA 4FZ8H 3L17A 4JDVA 2ZG3A 2HKHH 4WCYL 2DQEL 1DANU 3H3PH 4FD0A 3GBMH 4K5OA 3RURA 3V7AE 3VRIB 3ULUD 5K9KA 5FO8A 3PP4H 3WGUB 5ID0B 3R0NA 4GG6F 2OMTA 3TFKC 5D7LD 4FQHB 3GLEA 4HUKB 4MAUH 4OGAD 1RUMH 1SJHA 1U4EA 4NRYA 2V37A 3T1FB 3DOHA 2CZNA 2X4UA 4D8PA 4GAAA 3LS4L 1J87A 3E8VA 4QRRA 4ZXBA 5DJXB 3ARWA 3IJ9A 3B6SB 3MUY1 1KCKA 2FK9A 3AT0A 3ARFA 1P7BA 4PVMA 3D0LB 5DI8A 4J4PA 1BQLL 4N2DA 2VR9A 1R5VB 5AL8A 1YY9C 2W8CA 2WTPA 4WDIB 3B7TA 3HA0A 1DDTA 4GSUA 4NT6B 3DX2A 1GJWA 4BQCA 3G6DH 4E5XB 1MCWM 3ESVF 4YHZL 1YAZA 1DQDL 4GG8B 1OWRM 2NY1B 1EEZB 1I7UB 3PAVA 3S3JA 2ZOOA 4G11A 5GZOD 1YEFH 2BOBB 1FH5L 4IU3B 2F74B 2AK1L 4LHUA 4Y1AE 5EORL 5EEXA 2R2HB 1YEEH 4WWKA 1W9XA 5AG8A 2JCCE 3UGUA 3ABGA 4M8QB 3QP3A 2BOLA 4K0OA 4WI0B 4Y4HA 3TPUA 4CVZB 3FQ1A 3INUL 4PCTA 1CXIA 3UTTB 5E5LA 3CFKA 3UYPB 4WI4A 5B1AB 3WE6A 3LQAL 1F1GA 4NWUL 4PJEB 4ZUWA 1D5MB 3FJTA 4ZS6C 1SFHA 1I3UA 3LH8A 4IMLB 4W9JC 3ZSSA 1I9EA 3W37A 2BNQA 3VXOB 1NLBH 1DJZA 3SN6N 4PGDB 4WGKA 5TDOA 1YNTB 2C7UA 1DBAH 3IFPA 3NIFE 1J1OL 2E6PA 3U9PL 4BEIA 3R4DA 2EXWC 2YBRB 3VVVA 1H15B 4O02L 2WXMA 3E3QE 3FT9A 4N22A 4W4NA 1T1ZA 1OB1A 5SWZB 3AGWA 3FT2B 4UUJA 1OARH 4MJ6B 3H2WA 5E2WH 1EGJA 2C1OB 2YAFA 3IDYC 4ELDA 4QJ3B 3KLHC 1Z9OA 3RIFK 4BKLB 3QEUB 5HDBF 2G5UA 1FSKC 3MJ7A 4JMNA 1TIUA 2E74C 3N6YA 1PPIA 3ZBMA 4HSAC 1DLFL 1VJSA 4Y9CA 4EI5A 1AQKH 4R97C 5IF0A 2G4GA 5FUZL 4K73A 1VCAA 5FM5O 1KYFA 5K9QG 2HYMA 1B4JL 2DLTA 1V54B 2YXFA 1A8JH 1EO8H 3DPBA 1NANH 3M6DA 2XNAB 3QDMB 4DOHE 1TQVA 1F11B 2YN3A 3MRLB 1UM6H 4GAFB 4UILH 4UOQA 3JXAA 4B41A 5I18L 4OT1L 3VXMB 1U9KA 3QG6B 3SKUD 2VMDA 4GSXA 5HDRA 3JWNG 4FYRA 3C5ZA 1P9MA 1GY2A 4RBPH 3S7GA 1ODUA 4XC1L 5EIVA 4FQJH 2PXYB 1P1ZA 5AFAA 4NGHH 5SWQB 2CBQA 2R2BB 5DDHA 3SB3A 3ULAB 3GEFA 3S3PA 1QSED 4KJYA 4Y2DD 3Q3GB 5EFIB 5KJ7E 3MXVH 2AHIA 3EOAA 4TSBH 5B4MD 3Q2NA 3BIKA 3ISYA 4OM0L 3C08H 1Z3GH 2V8MA 1CLYH 2A9NH 5L0QB 3EOAB 1EO7A 1XF3B 5I1AB 2GQHA 3HHMA 2CR0A 3HI6H 5IMLA 5JR1L 1OGPA 3V52H 1N0LA 4UM9B 4PJFA 2ZJSH 4GRWB 5BRQA 4C54A 1U3JA 3HI1B 3L3JB 3WDHA 1CLOL 3KPRD 2D7TL 1JXKA 4HJTA 1SM3H 3QGVA 4UNUA 5DJXA 1JHTB 2EVJA 1QNIA 2PCFB 2ZCZA 1QYGH 3EH1A 3GB7B 1O6TA 4P23A 4X6EB 4PI2A 5IGXL 5L4MA 3US9A 2JF1A 5GJTL 4L3FA 5G4OA 4OLUL 1V27A 3RVWC 5DZNA 1JGDA 2DQCH 5IMKA 1JZ5A 2GJ6B 5C0AE 2WLZA 5HVWA 2JJSA 2VXTH 4BK5C 3QR2A 3SDCA 3QUMH 5IREA 4N9GA 1UWXK 2WO3B 2CKBA 3MGTB 1UWFA 3T9WA 5CJ5A 1YEJL 3RWCB 3HRPA 2DMKA 4U3XA 5IKCA 4X4ZA 5JOPE 4MQ7A 4R3SA 2ZWZA 1WT5C 2ZE0A 1IL1A 3GSWA 5HI4D 1NBVL 3NIFB 5GGSB 4AE0A 5FYLE 5IHUL 2IFFH 4H26A 4HUMB 1R1CA 1J8HA 2YRPA 3G6JF 3I84A 5H35B 2O26U 5CIPB 4XT1C 3LV3B 1NLDH 3RY4A 1C1EH 5KSBE 1F3DH 1SQ2N 3B9KA 4G1MB 1KG0B 3PIQB 1OP4A 1M7DB 2QELA 4HV8B 5JDJA 2LTQC 2O4EA 3DXAB 4TVUA 2HFEA 1CT8B 2QSVA 2CO1A 3T0DA 1A7OH 1OTSD 1RFDH 3MYZA 3PQYE 2HMID 4R8WL 1XT5A 1S7UB 4AL8H 4UV7L 4XNYL 3ZDXB 2YA1A 2FWLB 3AWFA 1NCBH 4X8CA 5DO2D 5AOIA 5IB5B 3TFBA 3QHZH 1RMFH 2N0MA 4X8JA 1UURA 2XPGA 3G9VA 1CMOA 1QVOB 1UB5A 4LPTA 4TQPA 3TL5A 1HNYA 5I8EA 4PP1D 3SGKA 5A3ID 1HEJC 4BXSV 4BE5A 1YJDL 3QORC 3II3A 2ZSWB 1F3JA 2ADIB 5AVUB 3QWRD 3BWAA 3TZVA 5LHDA 1F6LL 3EADA 2JKWA 2X4TB 1UUNA 5ENWA 3U7YH 1BQRA 1X7QB 3BZFB 3P9LB 4AMWA 4DAGH 2GIMA 4K2UH 1NFDB 3UERA 3ARRA 3DIVA 4TTDD 3WHXA 1XSIA 2LU5A 3VWKC 3BD4A 5I2IA 4K94H 2YGNA 3O4OB 2FZ3A 3WE6B 3RWFA 3EXJA 4KVNL 2NNCA 3O3EB 4WJ5B 3FU3A 3NCBB 3PPSA 4NERA 4KTDH 4L3CB 5JW4Q 3D85A 5D7SH 3MLXL 2H9GA 4FF9A 3G6JE 2BSCA 5EBMA 4JE4B 3D4GA 2WZ0A 3LB6C 4M6NL 4Y5XC 4AM0A 3DC0A 4FQHA 4QTIH 4BIKA 2WN3A 5A6MA 1BA9A 1YUHB 1MCPL 4NBXB 2BY2A 1N2RB 3S3SA 2H32B 4UILL 1GTNA 5CN3A 1SY6H 5E00A 4UT9L 3QIUD 1GA2A 1XR9B 2VR3A 2KPWA 3RVTC 1OD9A 4ETQA 2DQIL 1RSYA 2YD8A 4D3CH 4YGVB 5IVZA 3ML9A 5A2JH 3DMMB 4EDXB 4IBLT 4Y4KD 2YPVH 3QDGB 2BRQA 1TNMA 1T89A 1CYWA 4Q6KA 4U1LA 4XE0A 4AUYA 4XAKD 2MCMA 1L7TL 3HE7D 4PLKD 3AVEA 3U0WH 5KYWA 2P5WB 2C3HA 3EZJB 5AAMC 3LXAA 3M1CA 1PMYA 1Q9OB 2HFFA 5I23A 2VGLM 5T1LB 2VDLB 1U8HB 1JOIA 1KNOA 1HH6B 3PGDA 1WA1X 3CSBA 5BZDB 1TENA 2DZEA 4JB9L 3SHSA 2VZ3A 3WTTA 4PJCA 1YY8B 5CR8A 4DZ8A 2ZSVA 1T80A 3GJEB 1UWEL 4LLYB 2YKKA 2J20A 5CMAB 3UAJD 3JV5A 4M8UA 5AEAA 3THMH 5DQ9B 1MCOL 1WBZB 2MQ3A 3ZUCA 3VYNA 4QKTA 1TEGA 3P77B 5MERA 4P2AA 2R4SL 5TDPA 5D1QA 5JIDA 5AW5B 2VZOA 1D7DA 4H20H 4L37B 2H47C 2H6PA 3JWDL 5D1XE 4YEEA 5C3TA 2NUPA 5IHHA 4CDGC 4ZUUA 3LV3A 2GFBB 2NUPB 1C5CL 2NQ3A 1ROCA 3ZDYE 3GINA 4PS4L 2FT7A 4YLCA 1T83C 1IAIH 2EIJB 2F08A 2AJYH 2OTWB 2E4TA 2E7DA 1ZANH 2IANE 4KMTL 2XYBA 1CDCA 4K15A 5DWPA 2VQUA 3FTWA 2NR6C 1IC4H 1IBGH 2J44A 2VDRB 4YIQB 2F58L 5JNYA 1TPXB 1OP3K 2PPEA 4GS7B 4L05A 2CG9X 2VTFA 4HS8L 1UA3A 1RZGA 5GSRA 3L5HA 5IEKA 4LDEB 1M71A 4HKBB 2D4FA 3PXJA 3L9RB 1RLBA 2LV4A 3MACL 5BXFA 2P4AB 2ATAA 1NCDH 4N3UA 4G9FD 5AZ2H 1L4IA 2BMKA 4XXDA 1QKZL 3HPLA 2X4SA 3IRZA 3MV01 3EXLA 2DYPB 5I1IH 1W2KT 3QFJE 2CUHA 3ZTDC 5EN2B 1N5YL 4LIQL 2HWZL 4R7DA 3MLUL 1B2YA 5JORA 5I66A 1JRHL 1AKJA 4ZTPL 3GI9H 4XB8A 3NH7L 2BIHA 3OD3A 4B3VA 1AHMA 2Z31B 1DQTA 1U3HC 4JO4H 4KKCC 4Z0XA 3VD5A 4AVHA 4MS6A 2EO1A 2WN2A 3HI5L 4F2FA 2VLME 1P5UA 3NIDE 4ZQKB 1G9NL 5I5IA 2UXGA 1VFAB 3QJFA 4P2RE 5CHNA 4AOFA 5DJYB 2PP8A 1EAPA 5CP3H 1ZHNA 4IS6A 3A67L 4Y19B 5J1TC 3L1GA 1KJ3H 2FX8H 4XNMA 1YEHH 1KZYA 4ISVB 2W9EL 5HY9B 2N7BA 4ALAC 4EQ3A 3D34A 5LQBL 3UG5A 1N5YH 1M53A 2VR4A 4HJJH 5D93B 2W07A 5IBLC 4JRLA 3RL1B 3BYTA 3BKML 3VD7A 3QEQE 4M7ZC 3HJEA 1ZGLB 1DQLL 3FFCA 1HYSC 5JMOC 2DDQH 2FGWL 5CN1A 4K3DL 1DQQB 4MZ2A 5K39A 1QACA 1IEAA 2ZUSA 5BZWB 1FG9C 5IHLB 1QFWL 5TQ0H 3DRTA 1MIML 4I1RA 4PRPE 1HXMB 4LRIC 4U1MB 5HGHB 2P26A 1OCWH 3VA2C 1JP5A 1BECA 3LZLA 2XWRA 1PYWA 2X6MA 2DV6A 1S5IL 5J3HD 2EDRA 2F53B 3PJSB 4JFEA 2HT3D 4NC1C 5I30L 3N42F 1MI5D 1M6OB 4P5SA 1OSPL 3PJSA 2DLIA 4M5YH 1Q4NX 2VMEA 4WTZA 4XMPL 5DD3L 4A7TA 4U1HB 2YC1B 2P24B 4WW1A 3G08B 3BPCB 4WKZB 4UBDC 3PGCB 5C0EB 5IB2A 4L5FL 1QP1A 1XF2B 3I75B 5LXGL 4FZEH 4HV8A 2J5LB 2Z31C 2FSEA 3LZPA 2ORBL 1XSOA 3FU9A 4HDIB 3KCPA 4KPHL 2BC4B 4YPJA 1L6PA 3NZ8A 1BLIA 3QIWC 4G43A 3BZDA 3IDMA 1MUJA 2IQ9H 3O4LD 1YMMA 1DBJL 3C60B 4PJEE 1EA9C 4K2UL 2VE6A 1JPFA 2J6EA 4KRPD 4JDTH 3RY6A 5TF0A 2BP8B 3A6CH 1A6AB 5E0QA 2P5EA 1HX0A 5MEQA 2CKBB 2YPLD 4MVBC 1MFBL 3VXUD 3P3SA 5F7BA 1MCDA 3P3UA 4A68A 2J8UE 3NFPB 5GS2H 3MRPB 2VL5A 5TJWK 4Q2ZB 1N8OE 3QI9C 2ED7A 3F58L 3FUHA 3WMSA 3MOAL 1U8CA 4GFTB 4M8RA 4KDTC 3DJSA 2NY5H 3O9WD 3WJMB 1XCTA 5ES4B 4Z7UF 3B2PA 3S35L 5ENWB 1MZYA 4EUPA 5ICXB 1ZLVK 1I3GH 4ATTA 5GJSH 1G7QB 4IQHA 1G4RA 4YC2C 5DS1A 4ECNA 5L6YH 4IGBA 4XVTL 3OPZH 1JYXA 2K9UA 5K9OB 3ZDWA 2OMTB 2AMGA 2RJMA 4UOW1 1NGPH 5ERWB 4AKPA 4X4YB 3EJPA 3DJTA 1NUFA 5I24A 3BN9D 1FFQA 3O6ML 3SODB 5IQOA 3FSWA 5BUAA 2DLEA 3TBWB 5EPMA 2V5MA 4JFQA 4NXSA 2HCZX 2YUVA 3CN4A 4B97A 3K72A 4LGPB 3CH1B 3OR7A 4G8IB 4DUWA 2VB5A 3CXDL 3RKDD 4QOKD 5KVEH 1TCMA 1OOAA 4YFEA 4JKPH 2OSLB 1XB3A 3BAKA 2DD8L 1CR9L 2KL6A 3OXSB 5A2LH 2BNRE 1OE3A 2M2DA 15C8L 3QIBB 4GQ9H 1QR1A 4AWJC 4BZYA 5F89A 1ET8A 3VXNA 1RULH 3LIUA 2H1PL 3CZNA 2VLLA 2F7PA 1LXMA 1UD3A 1PJ9A 2EXYC 3CZEA 3QC5X 2DYPD 3CZKA 3GBNL 3P3TA 3WN5B 4AV5A 4OGYL 4XN1A 2D7TH 2YIHA 5GIRA 2ENPA 2APVA 3GS0A 3PU7A 3ZL4H 1HXYA 2XY1A 1NAMA 2FIKB 4FTDA 3ARGB 3CVDA 4QRAA 4M1DL 1SY6A 4ZSOE 5TDNA 1CG9B 4NC1E 1EJOL 4XWOC 1VGEL 4JREC 1Z0NA 2A6JA 1A64A 4G7SB 4AENB 3BQUD 1SJXA 5E5MB 3PHOB 4MA8H 1RZIB 4WGVB 3VGFA 3IU3A 2AS5M 1F2QA 5HI5C 1J05B 1QZ1A 3EFFB 3E8UL 5DC0A 2EXWD 4Z7UE 2E0PA 1X6NA 4RGNB 3TONA 1T3FB 1AC0A 1YO4A 1GGTA 2Q76B 4MJ6A 4PRBB 5G4NA 4BFJA 1D2PA 2XKNA 4OLXH 4KTEH 4PQXA 1JHTA 5ERWA 5EDXA 4HJGA 1A6UL 1AIFA 1QMUA 3GBNH 4AKQA 5E6YA 4C56D 3LKQB 1FRGL 2Y36L 4NO5B 1TNNA 3MRQB 2ZCKH 3M46A 1ZLSL 1NC4A 1A3LL 3ZX1A 5ACZA 4NQCE 3V4PB 15C8H 3L2NA 4H8QA 1CFMA 2AV1B 3V55A 4ZZKA 4RAUB 1OGTB 1L9MA 2YA0A 3PDOA 2RQEA 1OAYH 4I3SL 2PWHA 3WELA 2WWMD 2X2YA 3JT0A 3FF8A 5IVXF 1U4FA 1U8PB 4M5ZH 3GZPA 5AVXB 5DQDH 3TA3D 2DMHA 1DLFH 2AGJH 1QOKA 1ESOA 4WSKA 5DD1H 5DMGD 5IB3A 4XOCA 1AZZC 4J3OG 4KWUA 3BP5B 2WOYA 4P5TA 1P1ZB 4GRWE 3LIZH 3MRNA 1NGPL 4WY7H 2FX9H 1NDMA 4MHHG 5TK2A 4LASH 3C5ZB 4K4KA 1JS4A 2Y6SC 4K3GA 2OJ1A 1OP5K 4Y5VC 3QI9B 3HAEB 3BPOB 2R29H 2W38A 3CZFB 2WY3B 3X14B 2A6IA 2ZTBA 3D06A 1JZ8A 3ES6A 4JN2A 3IGAA 4GINA 4LSSH 4ANKA 5AUMA 3QXAA 1CLYL 2A9NL 4KV5E 2JKLA 1D5IH 1Y1UA 1XGTB 5F6IC 3HHSB 3VI4E 2PTUA 4IBQA 4DP9X 1EXUA 2VISA 2FHBA 3FB8A 3KYMB 5MI0B 1N6QH 3CN1A 5TFSH 5BO1L 1AMYA 2N7AA 3KGRA 3HE7B 3BP7A 3UZVA 4MWFB 3O4LE 3A3YB 4Q89A 4WUUE 3RVXD 1Y0LB 4X0KA 1DUZB 4WUKL 4FFYH 2IAAC 4ZS7H 2AI0L 3FRUA 4KJWC 4AEHL 5FUCE 2YPLB 2OL3B 4MJ2A 4NLAA 2VRAA 2WXLA 3CXHJ 4N0UA 2B59B 5F1SA 3WFBH 3NJGA 4TS6A 2K9FB 3HBPA 1LDPH 5AW7B 1T66C 4XO8A 4L3EE 5GRVL 2BY0A 4NQEB 4I2XB 1KLGB 1OVZA 1T4KA 2FSDA 2PYEE 3MV7E 3PV6B 4X83A 3KH4A 5TPWH 5I8KL 3KDMB 3VXSD 3FXIC 1Y7VA 1UJ3C 4U7KA 5F1KC 1URLA 5CD3B 1EXGA 1OAZH 5JHLL 4BA8A 1ZGLP 1O7DE 1PZCA 4O58L 2V33A 2IWKA 3BUIA 1EWHA 4RA0C 1NDMB 4I5BB 2F9BT 5DJ0A 4ZT1A 2CPCA 4HULB 5H35A 4KXZI 4MAUL 2R2EB 4L48A 3F6IA 3DGDA 1HE8A 4GH7B 1ETJA 2J21A 4JM4H 1JGVH 2BJMH 3ZKXB 1PZUB 2OZNA 2QVMA 1A5FL 1I7RA 1T04A 3ILQC 2Z93B 2FR4B 3UJJH 4M4RA 3U2SA 5D2NA 2O6DA 4JRXE 4UOW0 5HHNB 3CSGA 4G42A 3U9UB 1SOXA 5DVMA 2V9RA 3L3KB 3LN4A 4I7ZC 3HG1E 4YDKH 3ILEA 5B8CA 3HC3H 1CK0L 1ZAGA 5ISZB 3WTVA 1LVEA 2OCJA 3V7AG 1KJVA 3TCLB 3T4YA 3GPSA 3RIFF 2ZUWA 1RZ8A 2KLRA 4PG9B 1EAJA 1P69B 4PRDB 3S35X 5TFSL 5IQLA 5DA4A 4K55A 2VQ4A 5DUMH 3W2DL 1XIWC 2ITCA 4H8WL 1RUQL 1C12B 2IEPA 4ZO6A 5HBBA 2LU4A 3N41F 3WDIA 4HOZA 2YPKA 3Q2LA 3BWUF 3SBWA 2R0WL 1KY6A 5EOQL 1OEZW 1BCIA 1F4AA 1PGRB 3TJHD 1WS7A 3WIHA 4B5ZA 1YNKL 4P8QA 1ZTXL 5DJZB 4M7KL 3EFDL 2L7UA 3K0YA 5C0BE 1KC5L 4ZO9A 3AG3B 3BVVA 3WY4A 4S1SH 1LWHA 4U6HB 2PPDA 3HHSA 4A38A 1EMTH 4LLMA 2XY2A 3RILA 3SO3B 1KTBA 2Y5EA 1IU1A 5GHWH 2XN9D 1PZ3A 1DVFC 4PW9A 1IGCL 1ZT4B 4J7RA 3VWKD 5M95B 3PWPB 3ARGA 2AJUL 3P4MA 4YDZA 3RDJA 3WO4C 1NH6A 1YEKL 2XPZA 3GMQB 3D39B 4L8DA 3V0EA 3MCLH 2VIRB 1XD0A 4ODUB 4L9LC 2NY5C 3FB6B 1UJTA 1OAYL 5IWLA 2BS8A 4NJAL 1NCCL 3WFBL 1FIGH 4H88L 2Q5BA 2R9HC 2X87A 3VWJB 2DQMA 3ARTA 1RP8A 2ZXDA 3Q6FB 4LLAA 1P84J 1IGYB 5BRZA 3MA7A 4RAVB 5ABAA 1SQMA 5EEYA 5D7JA 5TK4A 4EAEA 1ETA1 4NB7A 4NP9A 4CRPA 4HOXA 4MMZB 4ZJ9A 1MCCA 1V7ML 1BGXL 3DECA 2PP7A 3ASOB 3UO1H 1AXTH 2NDFA 4MA1B 1QBML 4FJYA 1I4FA 2V5TA 3BXNB 2ENQA 5CLZA 3K5RA 5AW6B 4AC2A 4BKLA 3LD8B 1ILSA 4PJBB 5FEBA 3OKKB 3H55A 3WNOA 2DWYA 1EK3A 1RZKH 2WAHA 3STZB 3GXNA 1ZIBA 3KLKA 4FYTA 5E8DL 1F4WL 1PIFA 3QJRB 3HS9A 3QXDA 3BAYA 4FL4C 1F41A 1FDLH 1JXJA 4AIOA 1XAUA 3P2BA 2EP6A 3APFA 4JPIB 4KKPA 3Q8AA 5HHXL 3NJJA 4X6DB 4RGMC 1DR9A 3MODL 4ABWA 5I15L 5JHBA 1N0LB 4UM9A 4WQOA 2WP3O 4FRWA 1GIGH 1ORSA 4FULA 3VJ6A 2WBKA 4ZMWA 1NCGA 3E9TA 4PRAA 3ZE2E 2OMWA 3QI9A 5L8KB 2X4RA 2XN2A 5DK2A 4Z23A 3QEHB 1MCRA 2DD8H 5C9KA 3FTUA 2GJRA 2FATH 3PP3K 5E5MA 1MFVA 1U93B 2FYVA 1W72L 3CXFA 1PSKL 3HG1B 4XPAH 3OB0H 3GTTA 2YK1L 4GUOA 3V9FA 3CVHB 2DBLL 5I6LA 4AM0B 1RPKA 3BIAX 2H7WA 2R2BA 1E0OB 4B9ZA 1KTJA 1UQSB 1U8LA 3D18A 3NCMA 1DSYA 4HBCL 4XMTA 1JJUA 1JWMB 3BEWB 1ZHLB 4XXCC 2DKMA 2X1PA 3SDCC 1GS7A 4DO4A 5FM5M 4KRLB 5FUOL 4XVTH 4HSCX 8CGTA 2NR6D 4X6CF 3NSDA 4WW2C 4M4PA 3MXWH 3CHPA 2OMXA 3VGDA 2XVGA 3C87A 3GSUB 1OB0A 5DC9B 1KCVH 3I75A 2ILLA 3KD4A 1EHNA 1I3RB 4Y16A 1QLFA 3V0IA 4F3FA 2L4OA 3DX3A 1JE6A 1KTCA 4MAYD 3FF7A 2YPLA 2M83A 4TQEH 3TO4C 1KXHA 3MV9B 1PG7H 1IKFL 1YQ2A 3QR1A 3GDBA 4XTRD 4LBEA 4NUJB 3QQ3A 4GQRA 3O6FD 3WNMA 3NK3A 2WCPA 3QJOA 4DGIL 1KFGA 4MB4A 4EOWL 1H3XA 3NAAH 4JFXB 4X4YA 2G0LA 3QQ3B 1CBVL 3MRMB 4AYBA 1E6OL 1YUKB 2H5UA 3KBPA 4F7TB 3GSRA 4PEEA 3UC2A 4ESKA 3QNXB 5EO1A 2WLKA 5SWZA 3LOWA 4HZ1A 4P4RA 4JR9L 4GKNA 3UTTD 5AD0A 1ASOA 1T5KA 2V9UA 2IH1A 5BQ7A 3B1TA 5D7JD 1FV1A 5ITFA 3FT0A 3WJMA 4YBQD 4OM1H 4OCYH 4YE0A 4P57B 3WUWA 3OSKA 4FXKB 2WTRB 2BFGA 3O0RH 5HDWA 3SGEH 2VSCA 2Q8AL 3B2VL 3QUXB 1CCZA 3PGFH 2XBZA 2QQLL 1RY7B 3H6AA 2GTWB 5FECB 2P5EB 3D18B 5MEQB 4JFED 5DRNB 2ORBH 3DO4A 2CKBL 1TZHA 2HTLD 3D6GA 1UA6H 3OHXB 4Z7OE 3HNVL 5K39B 2EEFA 5J4MA 3B2XA 3PAZA 2FUQA 4O2FB 4ADJA 3KL3A 4F2MB 3QZWG 1MW1A 2EVIA 4YDNA 1H9DA 4ZPTB 4MMXB 4S0SD 1ACCA 3FT4B 4AXWA 1WCBA 1A2YA 3GJFA 1HWHB 3BDBA 1MXDA 1LEIA 2AQ1A 2A83A 2FJUB 1I3GL 1XTMA 4AIXA 1AGBB 1S5IH 3EOBA 4B9CA 1BVOA 1IEBA 4JFPA 5EN2A 1AD9B 3OMZA 5J3HC 1Z66A 3ZTJH 2AJ3B 4JG1L 2YC1A 1B0GA 4WW1B 5DJ2A 4HK3N 2DS4A 2E9IA 1T0MA 3QWOA 4V1DE 4KH2A 4A6YL 4WHTA 5CO1A 1KSRA 4MNGA 3UYRH 3Q9QA 3PHSA 3LJ3A 4KO6A 4Z0BH 2J1ZA 3QQXA 1GZPB 1YN7B 1TO5A 4PWHA 1GGBH 5J06A 1HE7A 1K72A 2OS7A 3LPOA 5MP6L 3QUML 2P8MB 3FNKA 2XZQH 3CU1A 4TUKH 1GW6A 2Z7UA 3QDMD 1ZIAA 3FQ2A 1WBXA 3QUZD 3MA7B 4KXDA 3NZSA 2WD0A 5I8OL 2OMUA 3C60A 2W9DH 2JKIS 3RNQB 4KHTH 3WJLA 1ES0A 1CLOH 4OD3L 4PJAE 2XN1A 4N28A 2ZOTA 2FE0A 4U1KB 1U95A 4NQSB 3VDBA 2X1OA 3VFNA 2NUTB 4XVUC 3U1PA 3X2QB 5EU6D 3PWVA 3HC4H 5CCJA 2BSBA 2X4QB 2J56A 2DWEA 3I3DA 3RWJB 3OKEA 2FYYA 2P49B 2HT2D 4K5LA 1KGIA 1SMDA 5CUSL 4F7MA 5I8CA 1BJ8A 4ZFZA 3CHQA 5I16B 3T8VA 3IMBA 1EAOA 1NCCH 4GG6E 2XZZA 1LDPL 4LMQE 3I6LE 2FDBP 3L3OA 2XXCB 4N2BA 4XC3L 5DLML 4F8NA 4J3XA 2YD0A 1Z9SB 2QSTA 2DM3A 1YG9A 5H94A 3UAAA 2GIYA 3I85A 5L2KE 3R4RA 2EDEA 5ACMA 3U7WH 5K9OA 3TCXA 4HIIB 3BDYL 2CO6B 2VM9A 1INDH 3CJJA 2KQNA 4MRCA 1R3LA 3HRZA 3MOQA 3D3VE 1CD1B 1S7VA 5AQ0A 3U36B 3UYOD 3S36L 5T5FH 5PAZA 4AMXA 5HPMB 2UY6A 4HFUL 3EG9B 1KJ2B 2CM5A 3FSOA 3HMWH 2K4WA 3N2JA 4Z76A 4KRMB 2O6FA 1EHXA 4I0PB 4JEGB 3JV4A 2AZAA 5T1MB 5L88L 4JZOB 1QX1A 3SOTA 4BFIB 2D4DA 1OP3H 3NFSL 5CJQL 3M7OA 1DCEA 2BIMA 4MCNA 1QSFA 1Z32X 3QUXC 4DO6A 2AAVA 4XZ4A 3JVGC 4FXKC 3V8OA 4Z7WE 3MV9D 1TQWA 3QIWB 1A6AA 3QSKB 4MD0A 2OYMA 5IFHH 2V2XA 3BPNB 3QIWA 1FZOA 2WCGA 4BZ1L 4ERSH 3LH2L 2HFGH 1GHFH 1RK0B 4NI6A 1AO7E 3RE0A 4RFNB 1VZGA 3EYFB 4X4XA 4BQBA 2AFNA 3O2DH 5E9NA 3FOMA 3W11C 4XWOD 2DQ6A 4UT6H 2P8LB 3FL7A 4HISA 1D9KB 2AQ3A 4OQTH 5F9WB 2Q3AA 3HN8A 4F91B 5DU7A 1BEYL 2VLJE 5JA8B 3PREA 4GAYA 1ZT1B 1A65A 4AZUA 5GZOC 2AABL 3U30B 4LSUH 3EYUH 5T1LD 4DEWA 5ACLA 4CW1B 4U1HA 4TVPE 1WZKA 4HS8H 3FO0L 2OMYA 3HOGA 1RZPA 2GITB 4NOBA 2ADJA 4CC4C 1WFJA 4BFOA 4JM4L 4YH6A 3VI3E 2WUBH 1JNJA 1S2EA 3IF1B 5EU6E 5BV7B 5D6CB 1IM3D 4GRLD 1U2CA 1GPOH 1QUPA 1G7PB 4XCYB 5F3HB 3RU8L 2DWDA 4MJ5B 1HXMA 3W0WE 4G7RB 2DQUL 2P5WE 4YDLC 3BPNC 4DERA 1J9CT 2OJZH 3ZHFA 1QD0A 4YIQA 1CGYA 1S6NA 4PRPB 1EVUA 3BQUA 4LVHB 4PRPA 4E2OA 1F3JB 2VDLH 4KDVA 4OFYD 4G6JL 3DV4B 1CFSA 2HJKA 5AVVB 1L9RA 3QWRA 3ZQXA 2Z4QA 2CR6A 1JV5A 4FOMA 3TXAA 4PBDA 5KJRL 1IE5A 4P3WA 5HJDA 4MXVE 3H7LA 2E47A 3GSVA 4AGNA 1ZSDA 4AQ1C 4OZIA 5D7IA 3SPJA 4KZDH 1NSNH 1QLRB 4HEMA 1HSAA 4FN0A 1AXIB 3N04A 4R4ND 5IBUB 4HPHA 4AGQA 2MHAB 3AGVA 1KBWA 3ABLB 4P9HH 1M7UA 3D2UB 5E9DB 4JB9H 1EZLA 4PJ9C 5LBVA 1NEZB 4JFVA 1RIHH 1JDAA 2KERA 3LSOA 4I3GA 3ARVA 3G3LA 1LO5A 1R24B 1FHGA 4JG9A 4ZK8A 1MAKA 1PIGA 2XQYA 4ZMTA 3EOTH 5I75B 1KCBA 5FGCB 4EKXA 1WTLA 3KPNB 4GXFA 5HTSA 3IAGC 4JHZA 4KZEL 5JXAL 3D4CA 4E0RA 3MLWL 3MRJB 3OF6D 4OFDA 1NGZA 1T0MB 1YC8A 2GK2A 3L9YA 5JORB 3BEWA 3JTBA 4GQQA 4NNPL 5I0VA 5A7BA 3TN0A 2P5WD 1JGUL 1XH3A 4PJ7F 5GS0H 3HR5A 1EERB 3K2UL 5EV7A 1RFDL 1XFPA 5FGRA 4XGZA 4HX1A 2IOIA 2XETA 4TULL 2WKLA 5I1HL 3E2HB 3N55A 1QNZH 3ESOA 2ITDB 4ELKA 5I1GL 3ZK0A 4CVXA 5DJAB 5GS3A 4PJXE 3FULA 1N3NA 2CO7A 2YAMA 3TYFA 2VLJD 2WWKO 3T2NH 1FVDB 1DFBL 3EOTL 2GJ6D 2O61B 3OJDA 3FB5B 5I0YA 4AEIL 1A4KB 2FYYB 4U0QB 1BZDA 2AJ3A 3FUIA 1HL5A 5DZJA 5E94B 5GGVL 1DYZA 4ZAKD 1JZ4A 1DBBH 4A55A 1UASA 5L2JB 4PJBA 2QVFB 4D9RE 3BE1L 1DN0A 2BVPB 1SDDB 4K5NA 2QMKA 1DBJH 5F9AC 4PRIB 2C4FU