4J3OH

Crystal structure of the fimd usher traversed by the pilus tip complex assembly composed of fimc:fimf:fimg:fimh
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimG
publication title Structural and energetic basis of folded-protein transport by the FimD usher.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion/chaperone/membrane protein
total genus 48
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00419 Fimbrial Fimbrial protein
H PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH02
5FX3A 1ZE3H 4XOEA 4AV4A 1TR7A 4XO8A 1QUNB 4AVKA 4XODA 4CSSA 5JQIB 4AV0A 4XOAA 1N0LB 4LOVA 4CA4A 1KLFB 4AUUA 5FWRA 2UY7B 3BFQG 1PDKB 2J2ZB 4X5RA 5LNEA 4J3OG 3ZL1A 5AAPA 4ATTA 4X5PA 4AVIA 2WMPB 3BWUF 4X5QA 1KIUB 5F3FA 3RFZA 4XOBA 2UY6B 4CSTA 4BUQA 3JWNG 3ZL2A 4J3OF 4J3OH 5FS5A 3JWNE 4XOCA 5AB1A 2XG5B 5LNGA 1N12A 4XO9A 5IQMA 2JTYA 4AVJA 2VCOA 5IQOA 4X50A 5CGBA 4AVHA 5F2FA 4AV5A 2W07B 3BFWA 5IQNA 3ME0B 3ZPDA 2XG4B 4AUJA 3SQBB 5FLUA 3MCYA 3JWNH 5AALA 2JMRA 1UWFA 4AUYA 5ABZA
chains in the Genus database with same CATH superfamily
3V4PB 4HBCL 4TNVF 2PCPA 3OKDA 3GBMH 1E43A 4FQ2L 5I8EA 4WUKL 4LCUB 5ANHA 3IDMA 2YK1H 1LD9B 5ISZB 4M6NH 2X40A 5AUMA 3V79C 3MV8A 2DRUA 5I1AA 2IWKA 1T83A 4PRPB 1CFQB 1KB9J 1MJUH 2J56A 2NY6C 3IMTA 3U7YH 4E5XA 2EZ0C 4GAJH 3WNNA 4NNPL 4TUOB 1YNKH 2R69H 4P8QA 3CJJA 3PJSA 3IE9A 1A0QL 1GGIH 4OKVA 1R3HA 4ODHL 4G5ZL 3S36H 1YQ2A 1Z66A 4JRYD 1Q0EA 5EIIB 1F2QA 1EA9C 3IMWA 4AH2A 1MI5B 1DQDH 5GGUA 4AYFA 3CXHK 1FL5B 5C0AB 3OZKA 1BP3B 2WN2A 5A3IC 3AMLA 5AOMA 5I1HH 5DEFA 3QDJB 3O6KH 3PWLB 4N86A 5TDNA 5AWNH 4LCUA 1JDAA 4MD4A 1EH9A 1RPKA 4R4FH 1LD9A 4PJ9D 1XV8A 1I9JL 2HWZL 3AROA 5CXPA 1I4FB 1KIRB 2BC4B 4AM0Q 5CZXC 1CFQA 4XCYB 1SN2A 4UTCA 2EO7A 3SPHA 4JFUA 4TUOA 4OCMC 3QUMH 4FP8L 3ZHLA 4A39A 1LL1A 4MJJA 4MZRA 2J73A 2VDKL 5G4NA 3AS3A 3CFQA 4TYUA 4J1UB 2NXYC 2JTYA 4YDKH 5IB4B 5IMOB 3H53A 3ZIMA 2VISB 3MJ8B 4AEHL 1MI5A 2PXYC 3NCWA 2FCBA 1FL5A 2F9BT 5C0AA 2OL3B 1W8NA 4OZFH 5BO0D 1F4XL 2XQBH 3JWDC 2EIMB 2ZG2A 1CIUA 2ADFH 2CBOA 1VKXB 4MJID 5HDOA 3QDJA 4MAUL 4W6WB 3PWLA 4QRFA 4L3FA 4HFWA 3U0WL 1M56B 2ZYRA 4K3HA 5E8DL 5L6YH 1SY6H 4OJDH 4OT1H 1KIRA 3OKOA 3FTSA 4PJXE 4XCYA 1I9IL 4CVWA 1K6QL 4L5FE 4X6BB 4DQOL 1KSRA 3LDBB 3PPEA 4Y88A 4IIQC 3WIIL 2ADJB 4HJ0D 3FO9B 2E9WA 1CF8H 3CZKA 4PGDA 3S3PA 5AW1B 3VB8A 4U33A 4AGQA 5IB4A 5IMOA 3SE8L 1TYRA 4MKMA 4Y2NA 5C6WH 2AAAA 2OL3A 4CMMA 1H0DB 1ZTXH 3BX7C 5DR5H 1UD8A 3JWOC 4K9EH 3B2DC 4DP8X 3VXPA 4Y1SA 3SE9L 4ERSH 4R0LC 2HTKC 5DURD 1CQYA 2A9BA 4FQCL 3FRPB 5F3BB 4ZMLA 2R0KL 1WZLA 1NBZB 2R2HB 4LEXH 2JQZA 3KYMB 1A64A 1Z3GL 3O3EB 4OQTL 4X4YB 3QDMD 1MCJA 3AUWB 2YLKA 4NOBA 3GKWL 2ED7A 3I3BA 2AQ2A 5GS2D 3HC3H 4X6BA 5B3JF 2IIJA 2NT1A 2H6UA 3SYCA 4X5RA 2ADJA 1WCQA 5IB2A 5I24A 3LRHA 4H88L 4J8RB 1W0WA 4LLMB 4YBQC 1OP4A 2ZP0T 4NENB 4OB5L 2EEDA 3UTSA 4PWGA 5BQ7A 3NTCL 3RX8A 2PYEA 4FZ8L 2L8AA 5K33A 4PWJA 5B7MA 4APQB 4AEIH 5F3BA 2EDMA 3FRPA 1NBZA 2R2HA 2XXFA 1I8MB 4DGVH 1JERA 3L3IB 4H0IA 2EDTA 3EOTH 1T3FB 4LLYA 5F89B 4PN6A 1U0QA 3BDYL 1A6WL 3CDGB 2HFGH 4X98B 4YPGB 1G0DA 1NC4B 2CHDA 3RE0A 4CDGC 2HJLA 4D3CH 2FX8L 4CSZA 2QQKL 1L3WA 5KVDH 4FDWA 4LESA 4X0KB 2VUKA 2DTSA 3LNFA 1CVSC 1OCWH 4XMZA 5HGHA 1JPST 1IL1B 4UB0H 1FH2A 2EE6A 1LQSR 4LLMA 5FHAL 2QHRL 5CKGA 4NENA 4GG6F 1M9SA 4G70B 4BHUA 5JHDD 1SOSA 1WFMA 3Q2CA 3MGOB 3IPBA 4UQBA 3VD7A 3O3BB 4N8UA 4PW9A 2QGDA 3K7UA 3QPXH 3VXRB 3BE1H 3CFDA 1G9NH 3R7RA 4Y16A 5CD3A 4UQCA 1M3IA 5CZVH 3G5XB 3X3FH 2CJ3A 5CUSH 2DQGH 1I8MA 4W1TA 3SDYL 3QDGA 1NCTA 3LXUX 3D2TA 5F89A 1CDBA 2J8UF 5EORL 2OYLA 1CE1L 2VZUA 3CDGA 4G11A 4AK1A 4X98A 4LLDB 1D9KD 4BHUI 1HJBC 1NC4A 5FYKL 3V4PL 1W16A 3UZEC 2BP0B 1KJMB 2A4ZA 4PJDF 5DHYA 1JCVA 9CGTA 3O8XA 3W57A 3JWNH 4JFED 1BX2B 1AMXA 3QCUH 1NIEA 3FQ4A 5GISL 1YYLL 1IL1A 2JF1A 1S7RB 3F7PC 2ZCZA 1XH0A 4PJCE 5E4OA 4B5EA 1O7DC 3T0EB 1U8OB 5JA8B 4MA7L 1P4IL 2CIKB 4EI6B 2VR8A 3VXRA 4ZW3A 3ATBA 3PL6D 1MW2A 4LP4A 5T1JA 2EDWA 4LCWB 1R24B 1NMBH 2WWOA 3KPRA 2R56L 3G5XA 1LEIB 3L4CA 5DO2C 3L4ZA 1F2XK 1R75A 2C1OB 4RRPA 4JE4B 2BNUA 4M1GH 2X6UA 2XPZA 2DQIL 4Z9KB 2A9DA 3PGCB 3REVB 3SGDI 3TESA 4X9IA 5D7IE 4N6RB 1KJMA 5DC4B 3MLWL 1X9QA 4LU5L 3L3JB 2MQCA 3QIBC 3HG1E 2IDTA 2NDFA 4FFZH 4HIJB 3OF6A 1F42A 3E6HB 4GKZB 2YBRB 3D52A 1ZRUA 1E4KC 4H8UA 4ZS7H 3C6LA 3IDGB 4DZ8B 2FE0A 4BQBA 1U8OA 4DPAX 1CZ8L 1KCSH 5E2TH 3S97C 3KJ4B 1E4JA 4LGSB 3I9AA 1YAIA 3FFCA 1OSPH 4BZ1A 5FFLA 4LCWA 1R24A 5CBAA 5ILTH 1LEIA 5F7EL 1JGLH 3I50H 1PLCA 2OL3L 1UFUA 3PGCA 2JKRM 5HDLA 4FQJL 5CAYB 4YFLI 4I9WD 3QUYB 4N6RA 1PW3A 5CINL 2V4LA 2XBDA 1BVKB 4HUKB 3V6BR 4HOZA 4K4KA 2IAMC 2ESVB 3D0AA 2HMIC 5GGRY 1NUNB 3ZKND 5CD5C 3FOMA 2VDQB 4HIJA 4GT7A 2YD3A 3MLUL 2YBRA 1FDLL 1WBYB 4JHAL 2LE9A 3IDGA 3FN3A 3IJYA 1OZTG 1DSFH 2HB0A 3TURA 3V6OA 1O6VA 3FMGL 3H3PH 1II4E 3IGFA 3R1GH 5F7YC 3W3BA 6TAAA 4YDMA 5D2NC 2HT3C 3CSFA 4GJTB 3O6FD 3ME0B 1FHNA 5SWZB 5I82A 4MMXC 2X70A 4PR5B 3VO0A 5JW4R 2OMXB 3EJUA 1QACA 3D9AL 1K5WA 4IU3A 1RJLB 3G6DL 3QUYA 4J12A 5EO1B 3ENEA 3SQBA 4AI7A 1A22B 1BVKA 1F8TL 1BVLB 1B2WH 1P0SE 4FN0A 4XGZB 1M42A 1P5UC 3HN5A 3IEAA 1E2ZA 3LZFH 2OJZL 4NP4L 4Z7OE 1JVLA 1K8IB 3PF2A 4RDQF 15C8H 5CP3A 5HDBF 3IF1A 5FEBA 1GZHC 3MJWA 4P2CG 3VXUB 1UKQA 2DIAA 5GS1A 4HEME 2P5EE 1Z5LB 3WNKA 3TC9A 4WEMB 3L9RA 5LN8A 4HXBL 4FXTA 1JWSB 2C9SA 4A7SA 1UKTA 2PWFA 3FTVA 3MU3A 4XO4A 3IGAB 2BZ7A 1MG3C 1NCWL 1NGWB 2EABA 2JJSA 1N0XH 5GGTH 3KDPB 3N1MC 3ME0A 5CGYC 5F96L 2PWHA 2HJKB 3C08H 4MCZB 1BEYL 1ZLDA 3INOA 3SPCA 2OMXA 2WCGA 3CBJB 2NQ3A 4NQUA 4QXGH 1RJLA 4W6YB 3K72A 1BF8A 3VD3A 3A6CH 1KEML 1BVLA 3POCA 5KSBB 4XGZA 2WQXA 2YGOA 3FUEA 5ERWB 1Q8MA 2J6WA 2ZPKL 3X12B 5C0ND 3WTTA 1MW0A 2XWEA 4DUWA 1BDYA 4WHDA 3VXUA 3FQ2A 3DMMB 5J13C 1Z5LA 2H3XC 3ARBB 4XBPA 2H32B 5FUZL 2NX5B 5IBTH 3BPLB 2HT2C 1JWSA 5I1JL 1RCYA 4KX8A 2ZYSA 3IGAA 4HMCA 1IZJA 1MNUH 4DOHE 4LHUD 1YHPA 2CUIA 3T65A 2H3NB 4ZMTA 1RXLA 4F37K 1XGZA 4G71B 2ZQKA 4KFZC 1MRDL 1MHCB 4OCSH 4MCZA 5SX5H 43C9B 4ABWA 3S8WA 4M7LL 1HHIB 2IV8A 1S9WB 3ZYZA 1FC1A 3QI9D 1XF3B 3RPIA 1HKLL 5CLXA 5ERWA 4R5TA 1IBGH 3X12A 5CBEB 3O9WC 1T1YB 5AG8A 5J6HA 4F8OA 1GW0A 3UBXG 4IRJA 5D7SL 3DMMA 4PS8A 5AOIA 1MXDA 3VXSB 1TSHA 2H32A 4FQQB 4XVJL 3RVTC 2HG5B 2XZQL 4GBXC 1BEXA 5L7XL 3UTQB 1BA9A 1Z9LA 1HN1A 1WEJL 3MBEB 4MNGA 4P57B 4NQXA 5DLMH 5ALBL 4WRLA 2NY2B 1MDAA 3VU1A 1ZLSH 4UILH 3K6SA 2RMNA 1SF3A 1LK2A 2VJXA 3ZTJH 43C9A 2ADGA 4M4PA 5TE6L 2ZCHL 3ZIYA 1HHIA 4QHLA 1G94A 2RD0A 1S9WA 2ZXAA 4LSRL 3P3TA 1ADWA 2NR6A 4K5PA 3MOQA 5B38B 1UWFA 3KPPA 2BSCA 4X5XA 1RIUL 3QORB 4M43H 3GZPA 2X5PA 4PWFA 2DWDB 2CM5A 5CBEA 1THCA 1T1YA 3WKPA 3RKPA 3KWTA 3A6BL 1ZE3H 5C9JB 3VXSA 2WAHA 5F9WC 4XN8A 3U2SA 3W11C 1R17A 2KI6A 5AW7B 4FQQA 4RGNB 3CE1A 3X11B 2W9EH 4UMGA 3UTQA 3MBEA 3V55A 1W72B 5HJ3B 4P57A 4QXUL 4P9HH 2N7AA 3WGVB 1AZVA 4Y9BA 1RJZB 5DD0L 1FYTD 2WKOF 3VI3E 4GSRA 4RX4A 1FWXA 3Q6FB 5DU7A 4L8BB 4RETB 5L4FA 5ID0A 3U9UA 4X9FA 4OW6A 3IJ8A 5JQHC 1NCDL 4FFTA 3WSQH 2Q3ZA 1OAYL 4G7VH 2ZXBA 3SHSA 1QRNB 1OTUC 2ICWB 3UO1H 3QORA 3VFVB 3FT2A 3O2VL 1E3FA 1E8ZA 2DWDA 2XQYA 4O9HH 4ZFOB 1NGQH 3N85H 4D8PA 2YBGA 3U83A 4X5QA 5DJ0B 5DT1L 5FYLH 2NY6D 3K4AA 4JFDD 5E24E 1V7NH 3UP6A 3KHOA 4GQZA 1PLAA 2FEEI 2HKAA 3E8UH 4IEFA 1XMWA 3X11A 2VDQL 3NK4A 1H15B 3LY6A 4PGEA 5HJ3A 4B9JA 3UZVB 1J0JA 1T7ZA 5DHVH 4FQXA 2D9CA 4I48B 5EULV 3KD4A 3S35X 3I2CH 4KY2A 2XOTA 4L8BA 4MDJB 1J10A 4YXLL 3NEEA 1NCIA 3QWNA 2FJUB 5A3ID 2VYRE 4GSXA 3D3VA 1U8NB 3IJSB 3TO4C 1P84J 3V0HA 1A3LL 3COOA 1QRNA 2APFA 5DHDA 5HP5A 2DWSA 2L0DA 3DXAA 2Y7QB 4LSSL 5IKCB 4ZW5A 5F1SA 3ULVH 1K5NB 4L4VD 2AABL 3ARFD 4ZFOA 5AKVA 4AGOA 3SY6A 2BSDA 2IAND 1ULVA 5CZXD 5DJ0A 3X1GA 3DO3A 2N7BA 1H5BC 2R2BA 4F7MA 5IOPB 1MVUB 3BT0A 4OIIL 5DZNA 5GGRB 4XB3A 4IBZA 3GGWB 5JUEH 2P8MB 5D1XE 1J1PH 2BFVH 5BV7H 5INDB 5KJRL 3DVNA 1OGTB 4I48A 2NXYD 3WIFB 2CXKA 2OCCB 1AO7D 3P1VA 4W4NA 1U8HB 4Q9QL 2ZD0A 4H2CA 1B2YA 3PWPE 5E4AA 3RIKA 1U8PA 4LPTA 4ADJA 4DGYH 5MENE 3CHRA 4POUB 3AREA 4KQ0A 4LVOC 4KPHH 4N90D 3V0GA 3D0LA 1CJYA 5F0MB 2PPCA 2Y7QA 3BT2L 3WFZA 1IBDA 2YAFA 1IGIH 1PQZB 1RZKL 1K5NA 4KVCH 2APWA 5F0PB 1A21A 1J11A 3DARA 5IBLC 3S8FB 2BVTA 1JPTL 3C12A 3LYRA 1LDPH 3V7AE 4LSQH 4I3RH 2TRYA 3RU8L 3N44B 1DQLL 3HW7A 1MVUA 2CWRA 4PJXB 3PWNA 1N0LB 1AXIB 2A6DB 4ICXA 4JFSA 4ZTEA 4YDNA 3VG0H 3V5HB 3U1SL 5HYJE 2VUYA 1JZ4A 4M6MH 5INDA 3EO1B 1WIOA 1KGCE 3WIFA 1ZV2A 3UMTA 4C54A 5EC1B 3VA6A 3MA9L 1I7RB 2EDRA 2FWUA 4FKKA 1QEWB 2VJ8A 4CKQA 3EOBA 3SDAB 3LQAC 4L8SA 4QHNB 5JOFB 3RGBA 2J88H 1T7WA 3TEZA 1NFDF 2KERA 5KBDA 2BDNL 1JYXA 5IJKC 1DVFC 4ZMWA 2IPUG 1NM9A 3HKFA 1FGVH 4Z78B 2HTKD 3OQRA 5D5MF 5DYFA 1PQZA 2G30A 1WP6A 4PV8B 3FT3B 4ZAKB 1XZ0A 2F08A 2COQA 1A5FH 2OXHB 4H26B 2WZPD 5CEXB 4HWEH 2BO0A 2E27H 1BM3L 3AS1A 1HIMH 1UB5A 3GWJA 5CFHA 5CKAA 3QJTB 5KG9A 1N0LA 5EBMA 2VQ4A 4NJ9L 3GLDA 2KDYA 3V5HA 2Y0SA 4I5BB 3EO1A 4JPWL 1P7BA 4EZKA 1UH2A 1MCQA 4YBQD 5EC1A 5IZ7A 1EZVY 1QEWA 4P2OB 4NCC1 1AZNA 2CBMA 2PTTA 1NFAA 1KELL 1XTMA 5D72L 1FV1A 1MCDA 5HVFB 5JOFA 1U8MA 5EEYA 4KZDH 3MXVH 2BOLA 1XIWC 2R0ZL 3L5XH 2A6KB 4KGJA 1JNNL 4YBLC 3HC0B 5F1OB 3RHWK 4Z78A 3EDEA 3ZE2F 4JFOB 5HVHC 4E9LA 4I3SH 4N0RA 2X2UA 3SZKC 2DLFL 3RY6A 4IRSB 3H2PA 3S3CB 1WDAA 1SN5A 3NSJA 4N2CA 4H26A 4JL2A 4RDQG 4GMTL 4RMQA 4YHOL 5H35B 5J5EA 1GGTA 2XC8A 3D85A 2AK4A 4FFVD 1TCMA 1EEQA 3R7QA 4AG4L 4Y2OB 4BFBD 1QSFD 3H85A 1BMWA 4LMQI 3K8LA 1JN6A 3KGRA 2I9TB 1JZEA 2WYIA 2Y3NA 3K6FA 2XXGA 3P2BA 3QIWC 5IVXE 3RPKA 4P2OA 3K46A 4LOFA 2GC4C 4WNSA 1RIHH 3NJIA 4KMQA 2Y1AA 1W72L 2D03H 1I8AA 3NCMA 4FI8A 2VZVA 3ULUH 2YPLE 3P73B 2A6KA 3NZUA 2UZXB 3HC0A 3H9SE 4OF7A 1S7XB 4JFOA 4R8WH 1YUHB 1EEYA 1L3NA 2CHZA 3HEIB 4Y5VA 5BS0E 1RMFH 5E5RB 1YMMD 5IV2A 4MJ2A 2D2OA 2Y2YA 5C2BH 1OO2A 4EUPA 4E9XA 4DEPC 2YQ3A 2PP8A 4Y2OA 2EDOA 4M9OA 4KRPC 4N2OA 4OCRH 1GTNA 1NAMH 4MD0B 5A2FA 5LVEA 1GMIA 1R5VA 4X83A 3U6RB 4KDWA 4N8VB 1XD0A 3FPXA 3SB3A 2CBPA 3DBXB 1KXTB 5GJTH 1AQKH 5FF6B 2F1EA 3EBGA 4PJCB 3FB7B 3TL5A 2P43B 1GH7A 2OMUB 4XPTL 5DVPA 2CLVB 2FR4B 1JFQH 3VSVA 4I1RA 2XWDA 2KZBA 2UZXA 5DO2D 2H8PB 1S7XA 1X4YA 2BIMA 3L3OA 1C5BH 3WKYA 1YUHA 2O61B 5T3XH 2N1TE 3RWCB 4XZUB 3BAEH 1AI1H 3BPOB 3MACH 2Q3AA 5FS5A 4YX2L 1QUPA 3B56A 2F58H 2IGTA 5CN1A 5D7IB 4NZDA 3VD0A 2ITFA 2YHGA 3ZQXA 3BWAA 1FI8C 2R9HD 3KLKA 4MD0A 2E47A 3HG1B 1BOGB 1JHLH 2A5UA 2Y7OA 3HB3D 4N8VA 5KS9E 4YAQB 3BOVA 2ATKA 3VH8G 1G4MA 4U1JB 3R06A 3ISRA 2X1PA 3NABL 4PJCA 3FB7A 2MEJB 2OMUA 1E4XH 2AXFB 4NRYA 4PBXA 5H37A 1TLMA 4D7BA 5I19H 5E8OA 1A6UH 2GIMA 2NLJB 2DH3A 4OGYH 4QNPF 2O61A 4LLVB 1U6AL 2GEEA 1TQSA 1S5IL 1G1KA 3RWCA 1UGKA 1ZT4B 4XZUA 3ARXA 3ZPDA 2HTLC 2X4NA 4PRIE 1K72A 3AQDA 2IAMD 2A6JB 2HMID 4Z7AA 1B4JH 4FMVA 4NFBA 3HZMA 3MFFB 2ZF8A 2Y1ZA 3UADA 3K5RA 2OI9B 3PDOB 3Q8FA 1UD5A 3HG1A 4XPBL 1J0ZA 4YSSA 3MMEA 2C3VA 3N1PC 5C09B 2AJUL 3H9ZA 4YAQA 4JFXB 1PKQE 2ZX8A 5SX5K 4U1JA 5T3ZH 3TJHC 2ZYIA 2DV6A 3PIQA 3RWGA 4ELMA 4UT6H 4L5FL 4JREC 4R96A 3KBFA 3C8DA 2AXFA 1A7NL 1ORSA 2NNFA 4XP6H 4RIRB 2DM7A 43CAB 1UB6B 4HD5A 1HSBB 1FZKA 3MCG1 4QXTB 5IBUG 1FVCB 3QR0A 4LLVA 4PCYA 4XMKH 1MCOH 5G2NA 1OANA 2CG9X 2YUXA 4N2BA 2Z7YA 4Y4KD 3SPIA 2ED6A 4NYLB 4K71B 1ECZA 1QFWM 4M93B 5I0WA 1EAOA 4XAWH 4ZO7A 4BRJA 2A6JA 2AJXL 3ESOA 3K8KA 1IO4C 4J3WA 5C86A 2WXQA 3EBIA 4GLRI 4MSWB 3MFFA 2QMKA 2XYCA 4P2AA 1OGAE 3RNQB 1ZHBA 5ITFB 2DLIA 3UFIA 3AQYA 3GZKA 1W0YT 1WSST 2Z31B 1ZPUA 2NDGA 2PKDA 5C09A 4JFXA 4JPSA 5E2JA 1NM4A 4ETQB 1A6AB 2WIMA 2R1XA 2P42B 1CL7I 1RUPL 4JO4L 5I6MA 2BHZA 2YUZA 4OCXH 1EBPA 3E9UA 4CU6A 1UA6H 1S78D 43CAA 3L5IA 4QXTA 5E1GA 2Z8SA 4A6YL 1OWWA 2NRDA 4YEFA 3MOBL 1BFSA 1KYFA 1YEFL 4HLEA 3ZT7A 2Y5QA 2ZF9A 2BXYA 4HJUA 1I1YB 2GY5A 1HH6B 2Z9TA 4KXDA 2OR9L 1D5IL 3ELAT 5EZJB 3B2VH 5DMYA 1A6VL 2WIIB 3GEWB 1WFJA 5K9JH 4G82A 1I3VA 1WA1X 2WXGA 3OSVA 3SCMB 5BW7A 5I18L 4BK4A 1A6AA 5CNHA 4FLOA 3JWOH 1F90H 4XNDA 3TP4A 5JHMA 4WI3A 1F5WA 4X2UA 4MA3B 3ABKB 3QB7C 3HI5H 4DOHB 4IJ3C 1F3JB 3N0PB 4GRLA 2WD0A 1ADQL 1SDDB 3O2WH 2K78A 1OOAA 4U1NA 1FFNB 3BJ91 1M9WA 4YGVA 5K1VA 4UM8B 2GABA 1NUGA 4S11A 2BVYA 3UC0H 4UAOC 4M00A 2L7UA 3U30B 1I1YA 1HH6A 1NLBL 3MODH 4FJ6A 4UV7H 1CK0H 3O9WD 2APVA 4NP9A 3U6XS 3O6MH 3MUZ1 3ILDA 3G08A 3MLVL 3N1GC 2VMCA 1QNZH 4R7DA 2WIIA 5D8JH 4RA3A 4HSAC 3RVTD 3SCMA 2XTJE 1IT9L 2VAAB 4ZX5A 3N55A 2AC0A 3GDCA 2MIZA 5E9DD 3PXLA 2Z3FA 2ZX7A 4IRZA 1NWPA 1AOHA 1Q90A 4FHBD 4A38A 1A6TA 2YGQA 2N01B 3VE0B 3AG4B 3BUTA 4IYKA 1BFTA 1ROWA 2WANA 3KAAA 5LBVA 5I1DA 5F1IA 3J27A 2YARA 5EUOE 3QFJD 3X14B 4F2ME 4AT6A 1DFBH 2H47C 4UM8A 4IMLB 2OKMA 4RNRB 3T5WA 2J4WL 3H4FA 1MHHA 1J88A 1JDDA 2R0WL 3GS0A 4P3DA 5AW6B 4JM2B 1P9MA 4QOKE 1Z2KA 4NM4L 1CE6B 3BCFA 2GITA 2VDLH 4LB8A 4G42A 4H13C 4M6OL 5EU7E 2D2CC 5KUMA 5GRUL 3W0WD 3LDBC 1EK3A 2VAAA 2BVPA 1P1ZB 5DK3A 1DZBA 2B8OT 3JT2A 3X3GL 1OAZL 1FAIL 1QFWI 2PCXA 4Y9EA 5B7EA 1GCYA 1OHZA 4JB9H 3ESUF 3HRPA 4HT1L 4RDBA 4TPRL 5IFHL 2DTML 3VE0A 3J07A 4F20A 3VI3B 5AB0A 2A9NL 2I7OA 2ICEB 4TUKL 4IMLA 3AM8A 2YUVA 4RNRA 1XF1A 4S1QL 3RY4A 1OTUD 4X7EC 1LNUB 3GJFH 4XMUA 3S5LB 2X53A 1VEMA 4E42B 1MJ7H 4AXWB 4JM2A 4L2LA 5HHME 5C0RH 2C7FA 3OAWA 3BCDA 5HPMB 3U7AA 4NQDE 2YIHA 2YAOA 2OX5B 1M71A 3KE0A 1AE6L 1P1ZA 1X4XA 5EN2A 5I1EH 3PU7A 5C97A 4I1PA 1JXDA 4UNTA 4I0PD 5J1TC 1JK8A 4LZKA 2XA8H 2XHNA 3NJNA 4HC1H 1TEGA 1O5PA 3E7JA 4E41E 4EMZA 2FEDC 2JVUA 1HCVA 1F1GA 5IQNA 4KRLB 4M62L 4HKXB 3DUHA 4MZ2A 2J6EL 5T5FH 3VI3A 1IEHA 2GJ6D 1AGEB 2D7OA 3B6SB 5HYSB 2ICEA 3TO4D 3UTTA 4I77H 4KUCD 2NZIA 4APQC 3SKNB 1A9EB 2JJTC 4U3HA 1LNUA 2BIQA 3S5LA 1RZJC 3SKUD 4P59L 4AXWA 1VCBC 4X4XB 3WHXB 2RB8A 4YHNB 1BW8A 1OP5K 5HPMA 5ICYA 3LS5L 4PQXA 4EI5A 1ETB1 1S46A 1ED3A 3HMXA 2FECL 5I23A 2NXZB 1TETL 1D5MB 1OARL 4FL4B 2Q5BA 5AZ2H 4RSVA 3SGJC 4WGWB 3L13A 4ZNEA 1AZZC 3TV3L 1C9SA 5D1XB 1C16B 5A2IH 2WBJC 5TE7H 2E7LA 4XNXL 4HKXA 3CZUB 4L23A 1AGEA 3B6SA 5EIIG 4HUWA 5I0XA 3PWPB 3F12B 1P7KB 3RG1C 2P24B 2W92A 1RQ5A 2AI0H 2YD0A 3HFML 2VXVH 3V52H 3SKNA 2XV2A 2ZXQA 1T21B 4P3WA 1I8UA 1OIOA 2E75C 3GO1L 1JOIA 5IBLD 5HGBA 4WU5A 4RMBA 3LJ3A 4KDTC 4YHNA 3NZ8A 1ZTXE 1QPPA 2R15A 3QQ9C 3C6EA 3ZHKA 2H41A 4NXKA 2UVFA 4P5TD 4AQZA 3UAAA 4WHTB 3CFNA 3KS0H 4APXB 2E56A 1DLHA 5HBBA 2CBQA 3GS7A 5KSBF 3LKPB 2XWTA 1D5MA 1JWUB 1TMCB 2G60H 2NY5L 2YXMA 3ZTDC 3SQOH 1DL7L 3WKQA 4HSQA 5E23A 1R4XA 1OHQA 2DQUH 5HYJB 4KKLD 3EJYC 4RWYH 4L29A 3BSZH 4ZQKB 3EGXA 1DJYA 3OJ2C 2OPCA 1NCNA 5LNGA 3B9KD 3KPQA 3TZVB 3FH5A 1DVFD 4HAFA 2XTLA 3CLFH 3L3KA 3OVUB 3DV4A 1T21A 1OXYA 4A66A 5DVNA 2VC2L 2KPWA 2CDEB 3PV6A 3QUZD 1A1NA 4YBHA 2IPTH 4FULA 3BZEB 2EDJA 4TMPA 5H8DA 4JANB 1QFWL 4HU2A 4KK8C 3NA9L 3NIDE 4LGRB 2VW6A 4K7PX 4ZOEA 1BIHA 1JWUA 3GNML 5DRXA 1T5KA 1JZDC 5T1DH 3RNKB 2V6HA 4NKDA 2XKUA 2QSCL 5TD4A 1TZ8A 2X4QA 5KVDE 4KJYB 4ZSOE 2JWYA 2BP3A 2X4SB 4OKDA 7FABL 2ZSVB 5F1NB 1XIWD 2Y23A 3GHEH 3C5XA 2G5BA 5EZOH 5C8JB 5DS2A 4PTTB 4JM4H 5FKPA 3EAKA 4Q0XL 1PPIA 4WQOA 2AJYL 1VFAA 4JKLA 2CDEA 2ZKHH 2VL5B 3FRPG 4WWOA 3OGCB 3QUHA 1E90A 2C7UA 4CADB 3BZEA 1P2CB 3VFNB 4C4UA 3WIAA 4NQED 4JANA 1C5DB 3EUUA 5DD6B 4U1HB 3MUGB 2Y7MA 4PJBE 3OR7B 5MEQB 5AAWC 4N2MA 2BCKB 2WUBH 1EBAA 2G4EA 4PJ6A 1CYWA 4Q58C 4XNBA 2FB4L 1HNYA 2CK0H 3RNKA 3QIWD 2BK8A 4D0CA 5B1KA 4LAJH 3IETB 3MLYL 3EXJA 2NTFA 1T1XA 5IVXB 1YEEL 3U4AA 1RLBA 2BIOA 3QFDA 2JXMB 4KJYA 2X4SA 4A2GA 2ZSVA 3PHOA 5IM7B 1GC1C 3WJMB 2ZKWA 4DVRL 5C8JA 4ZUTB 2A74B 1S3KH 4P5MB 2WJ5A 2YPLB 1SGKA 4AJ0A 3AABA 4EZLA 2HUHA 2BRRL 1FE8L 5EOCL 3CQQA 4XXDB 2VL5A 5BS0B 2R59A 4FXGC 4TV3A 3MLSL 4F2EA 3F7YB 3FHQA 3VFNA 2H3KA 1Q0XH 1A7BA 1CFTB 4PHXA 5DD6A 4U1HA 3D30A 4KRPD 5MEQA 1TJMA 1BLIA 1R3JB 2BCKA 2IBGA 4OLYH 1JGUL 1HSAA 4RFOH 5E99H 3BAIA 5EG6C 4EIGB 4Z8FH 5AAMC 3QJXA 3GMRB 3NACL 4HCFA 3CUPB 1E8YA 1AHWB 5I1KH 3FB5A 3DO4A 3P3SA 1YPZA 2DQDL 4CC0A 1KLUA 1D6EB 2JXMA 2J72A 1IGCL 3D0VA 1JPGA 4KWUA 5IM7A 2DQHH 4GO6B 4CMHC 1IFGA 2BSSA 3BVTA 5DVLA 4ZUTA 2A74A 5T1KA 1F6AB 1T2QH 3QZPA 3RIFF 1KXHA 2VLRE 4P49A 2XX0A 1PLGH 3ZKMC 1RZKC 4H20H 2CE6A 4KTDL 4PS4L 1EEUA 3G9VA 4F9LC 2BLFA 2QVKA 3VXMA 3IU4L 2ZKYA 1HZLA 3MRBA 4IHBA 3F7YA 4KOCA 4N1CA 3TA3D 1BBDL 1U3YA 1VAHA 4FQHB 1Q9KB 3B43A 4IKNA 3S5YA 1JZ6A 3MAWA 2Q8AH 4F58L 2B4CL 3DX7B 4R7LA 2HH0L 4MQSB 1IE4A 3JTSA 1A65A 1AHWA 3QP3A 2LAAA 3FL7A 1KCKA 5I6OA 2MKWA 5KS9B 5B3SB 1D6EA 4WW2A 1C1EH 2Q8BL 3U9WA 1HZHH 3IDIB 5LGHL 2YA1A 1J18A 2ZUQB 5K1JA 2VMFA 3MRQB 1AR1B 4JRYE 1KY7A 5F7DB 3JT0A 4JPVH 1YY9C 4XT1C 1BVNT 3KGTA 4JO2L 4AIEA 3C8KB 4PJ8C 5LO7A 1SXBA 5FO7B 3KPLA 4WDIA 3MV9D 4N1HB 3OM3B 3W2DH 4GAGL 1S9VB 5F71A 4N0CC 4PRIB 4KXBA 4RQQB 1GRWA 4A2MA 1KLFB 3DDFA 1AJ7H 3DX7A 1N10A 1FZMA 3TIDA 4NBZB 3FO0L 2VUOA 4LHQB 1X7QA 5KS9A 1QP1A 3DKHA 1DDTA 1PKQB 3LIZA 4P2YA 4PJXF 4G1MB 3B34A 3CVCA 4NO0A 2GTWA 1GAFL 3GXTA 5DO8A 3ABMB 3HRZA 2EEXA 3UYRL 1NCBH 3MRQA 1XCWA 5DQ9A 5FPIA 2GJZA 5F7DA 3KXFD 3VFPA 4BFRA 2WMPB 3QH3A 5FM8A 3UPRB 1G6RB 3QIUC 4HUMB 3VGBA 2EP6A 3C8KA 5FO7A 3B9VA 3F83A 3QUGA 4JHVA 4LNRB 1BQLL 4MJIE 2FT6A 1HEZB 4RGOL 5DQDL 4MXQC 2VIRA 4DGIH 3EYSL 3L9YA 3RGVB 1C08B 1MEXL 2YD8A 3FQYA 4U1GC 4PG9A 4K7PH 4CW1B 1JXKA 3BKJH 1OGAB 3EBAA 3QS2A 4QYAA 1TZHB 4YLQT 4RGNC 1EHNA 1PKQA 1TNNA 1MHPL 3D39D 3BPCB 5JYMA 3KCPB 1PD6A 1QMUA 3OL2A 4QRTA 2Z65C 4DKAA 1K4CA 4KNQA 3T4YA 4J5VA 3KW7A 3KEDA 3RX9A 1P4LA 2PCFA 3GQFA 5CLTA 1QI3A 2WBXA 2UXFA 3CQFA 3QG7H 3L9EA 1N64H 2V2XA 3S88H 1UZGA 4AMKH 5KBLA 5EZPA 4MS8D 1HX0A 2DWTA 5BXFB 1NUDA 5E4EC 3CU1A 3D06A 1J9CT 3RGVA 1C08A 4LRNH 1KCVH 4NNYB 4ZODA 1DO6A 3QDME 4PTUB 1G7JB 3DYPA 4ZMAT 4HKJA 4UUJA 3DSNB 3LQAH 5JHLA 5EEXA 3FO2B 3SDXE 4QRPD 5E2VH 1CWVA 2O6CA 3FUNA 1QQDA 4AX3A 3QPQC 4LAQH 3GJFK 3HZVB 5BO1L 4A68A 3GI8L 2VLJD 1MHEA 4N2AA 3ATEA 5AYUL 5I15H 1TKWB 1KWGA 4NC0B 4PM1A 4AV4A 3P0VL 3EOAB 1GCFA 1DBMH 2K3TA 3ZQWA 3K4ZA 2QPFA 3NIFE 4P23B 3K8MA 5AL8A 5I30H 5MHSD 5IT2H 3T71A 4J2QA 4LPYA 3X1EA 1MAKA 1AHKA 4X0NA 1J9TA 3SDDC 4DW2L 3LZLA 4NKOA 3PGDB 2GCYA 2JB6B 2WYHA 2O5ZH 4NNYA 2X6CA 2KL6A 1G7JA 1MUJB 4ISVB 1R0AL 4HGWB 2FNBA 2HVJA 1OP9A 1XSJA 2IG2H 2F5BH 4LSVH 4YHZH 1ZTMA 2ZP9A 4HBCH 4FQ2H 2FX7L 2YRZA 3HZVA 3NDYE 4WUKH 2A4EA 5JHDE 3CVHA 3FYIB 4Y1TA 5BVPL 3RWJB 1P6WA 4DP9X 5SWSB 3CN0A 4P46B 3VI4A 1UT9A 1TKWA 4PJCF 3TVMB 3T2QA 3VM7A 4NNPH 3K1DA 3MLRL 1ND0B 5DS8B 1TZAA 3VTTA 4F2MB 4WTZA 1A0QH 2GQHA 1INDL 2F53D 4ODHH 3PGDA 1H6EA 2RFXB 1BD2B 3BAXA 4MS6A 3VD9A 3DV6B 2DQFB 4HGWA 4QOKB 3PCYA 1B6DA 3CN4A 5D7IF 4JFEE 3WNLA 1E5UI 4X50A 2Y22A 2ZTBA 4H8WL 5A7BA 1KYOJ 3QCTL 5IB1B 1KLGB 3ZYOA 1FLTX 2WVUA 1I9JH 2HWZH 3ARDA 3F85A 5G55A 3SDAC 5SWSA 5DA0B 1WITA 3LIZL 4HCGA 4L8CB 2OZ4L 3TVMA 2XN9D 1ZVYA 4A2FA 3WNIA 5DS8A 1F3DJ 3Q2LA 2FQDA 2ZKMX 3EFFB 1F0LA 2VN4A 3KH4A 4AUJA 2BX5A 1UM4L 3UBHA 2YD5A 2PN5A 4WJKB 1CB4A 5J8OA 2VDKH 2RFXA 3HC2A 1BD2A 4LVHB 4X8JB 5B38G 3R18A 3VG9B 3EJZD 2P52A 3QE5A 3DV6A 2DQFA 5HHMB 2XQYG 3GXNA 4AEHH 4PI0A 3KCWA 5E6YA 4XO3A 1SVZA 2X3CA 1FBIH 1F4XH 2H0JA 1J5IA 4ZNCD 1FPTL 1EERB 4MAUH 3TNMB 4B96A 5JW4Q 1V7ML 4KZEL 1LE9B 4F1SA 4XNZC 5KVEE 2OSXA 5E2WL 2FEDD 4JRWA 3VD4A 1MAML 3VXQA 1U36A 3U0WH 2WNGA 3IU3B 4QJ5B 4M5ZL 5E8DH 2AJSL 4PBVC 4E41B 4PJIE 1KCRH 1SJXA 5ANMA 3WN5A 4L8CA 4NKQB 4QGTA 3QK0A 4PJGE 3A4FA 1I9IH 3O6LL 2R69A 1K6QH 3QUMB 5KTEL 3KBHE 4LPUA 4DQOH 4Y9CA 3DRTB 4NUGL 3RKDC 4AJYV 4XMTA 1EJOL 3X1FA 4G9FD 2M2DA 4I2XE 4U0QB 3SO3B 4DO5A 1G6RL 3MZTA 1M7UA 3ETBJ 3N2JA 3DIFB 4IRSC 5BZWB 4CDHA 2BNQA 3GMMA 1J12A 1MFAL 4B3VA 3L4XA 4I9WE 4KXAA 2VRQA 4YHKL 5B22A 1ORQB 5JPMA 1PX3A 3KWUA 4FRWA 1S7SB 3SE9H 3TNMA 4WEBL 2BY2A 2XWCA 3AS2A 4FQCH 5CSGA 4HG4K 1LE9A 2R0KH 3IFNL 1IBHA 4WV1B 2ITDB 2WBJD 4Z7OF 5I6XB 2LVCA 4AKPA 1NGPL 5DXWA 4YFEA 5IFJB 1M7DB 4E41A 4BFIB 1WFOA 3FW6A 4EPSA 3GKWH 3Q43A 3QUMA 3SPGA 3IYLW 4UQIM 3DRTA 3CDCA 2IVFC 3QNYB 1U92A 4YHIA 4G7QB 3DETC 3MGTA 4YQXL 3MA7B 2UYLA 3V0IA 3CU7A 3PAYA 2WQUA 3DIFA 4H88H 4PP1C 4B97A 2FWOA 1T80A 2ATPA 4NKMA 3UYPB 1RJCA 1ORQA 3GPEA 5E8PB 4OZFA 2GBTA 1L5GB 3NTCH 4TNWF 2GTZA 4G9DB 2H2SC 4MJ4A 3OB8A 5DI8A 2P80A 4YVUA 6PCYA 2VZ1A 3EJYD 1AYRA 2WSPA 4FQLL 3UJTL 2ITDA 4BWWA 4CVXB 1SY6A 1CICB 2EQDA 3B9DA 2PUQT 3POHA 5IFJA 3BDYH 1A6WH 1M7DA 3I6KB 3MNVB 1ETZB 1TU2B 5ITBL 2WBWB 2FX8H 4U6YA 5KYXB 1HYRC 3QNYA 2QQKH 1J5CA 4K3GA 2NY7L 5DUBB 3B9EA 3N6YA 4PWIA 2LAGB 1D5RA 4UT9L 4Y4HB 3SN6N 4XR8C 3ZL4L 2X09A 4F9PA 4AGPA 2OMTB 5FHAH 4LPXA 2QHRH 1WGOA 2QL1A 2IPUK 3ULVD 4AQ1B 4I3GA 4CSPA 1L5GA 4ZPVB 2EVGA 2AQ1A 5D93C 3CN3A 1PAMA 4WHCA 5FUCE 4WI6A 3NIDB 1XT5A 3ERXA 2DM3A 3NCCB 2WOYA 1SHWA 1U30A 1NBVL 5DFWH 2DLEA 4YHPB 4J6RL 2WUCL 3H54A 3SDYH 1CICA 4HPOL 1WPCA 1UT2A 1DVZA 1K9TA 2ZXDA 3FHAA 5EORH 4YXHL 1CE1H 2WOBA 5HJDA 1IFHL 2ZOKB 3MNVA 1J1XL 1ETZA 1TU2A 5FYKH 2FGWL 2WQSA 3CFUA 3RVVC 3V4PH 1W8OA 2MCPL 1AP2B 4G1EB 4ZSOB 2XN0A 4LPCA 4WWID 4IM8A 3T0VA 1KIPA 4B0MM 3DGCR 3IMRA 2UY7B 1FO0L 1LVEA 1ITCA 2AEQL 4KVPA 3GBNL 1YYLH 4K8RC 3C5SB 4WKZA 1GHFL 3LRLA 3WXWL 1KJ2L 4OFDA 4AQ1A 2YRBA 1P4IH 4MA7H 1L9MA 1FVEB 3QZWB 3MCKA 4Z77B 2VR3A 1BXUA 4QHKJ 4J4PC 2C26A 5CZRA 4E9VA 4PJBB 3ECUA 2F7OA 3H42H 2R56H 4JM2F 5BRPA 2Z34A 4XI5C 3OQ3B 4YHPA 1BJ1J 2NNXA 4JY5H 5TQ2L 2G3XA 2DQIH 1IQWL 4E9RA 1BXVA 1OM9A 1D6VL 4J3OF 2SODB 2YD1A 4A2EA 2BVQB 2Y1VA 2YKLL 3M6DA 4BD4A 4LU5H 4PWEA 1ZT7B 5FGBA 1CT8A 3I6GB 3GINA 4DERA 2EO1A 5GIRB 1MJUL 3ZR5A 1G1OA 2GFBB 4GAJL 5BOJA 1KV3A 3SYQA 3VI3F 5H2BA 1CZ8H 1DSWA 2GT9B 3QQ4A 4N68A 3TT3L 1QBAA 1HTYA 4Y0GA 3NPSB 1SMAA 1XGUB 2YWYA 3TNNB 2DLGA 4PJBA 5JO5B 1XVSA 2Z31C 2I07B 4GINA 1S9YB 1XXDC 5F7EH 3GK8L 4AC2A 1BVNP 5J4MA 2XFGB 3FKUS 4JDZB 4FQJH 2MPVA 3L45A 2BVQA 4J27A 5CINH 3L1OL 3PP3K 1CGSL 3WCYA 3F6LA 4JDTL 3CH1B 1FYTE 2AJVH 2R1WB 3MSPA 4L1LA 2FO4B 4OFQA 5ACZA 4KZCA 2Y5TB 4B0MB 3I6GA 4U4BA 4LXFA 2V5RA 3MLUH 3T8VA 1FDLH 3MJ7B 2GFBA 4M7JL 2VLRB 2NY4B 4QAMB 4LLWB 1LK3L 2D7NA 3QAZC 3V9EA 3O45B 3J7HA 2XBTA 4FOMA 1IBFA 1Q1JL 4CC1A 3QULB 2ODHA 2W94A 1GGBL 1V8HA 4X4KA 4XE5B 5JO5A 5L2KB 1O5DT 3LKRB 4HDIB 4L9DA 2I07A 1S9YA 2YXVA 4K94L 1MIEL 3NT0A 4D9QD 4JFDE 3V0WL 4UDUA 1E4HA 2VN3A 5GZNA 1TITA 2ADFL 2VAJA 2VSKB 3D9AH 3IMSA 1J5DA 2OTPA 4JDZA 3G6DH 5B4MD 4AZ8A 2JI1A 1ID5I 1F8TH 4FTVD 3CH1A 4FFZA 2R1WA 1CGWA 4X80L 2FO4A 2XFXB 2Y5TA 3CPLA 2OJZH 5H37G 2H9GB 1YY9D 3MRHA 4L37B 1R5IB 1GYAA 4JRYB 3MJ7A 1HH9B 3ESVF 2MH4A 2VLRA 4PJ8D 4Z7UA 1J5OL 4LLWA 4QHMB 2OMYB 4U0RC 1UJTA 4HXBH 3O45A 2FYYB 4PV9B 4N0CD 1KGUA 3I9GH 5K59E 2X28A 4L4VE 3C6SB 3QULA 1WC7B 4CNIB 1NCWH 4KI5C 4YLBA 5EO0A 2IANE 5L2KA 4PJ9B 3LKRA 2VRAA 4U6XB 5F96H 3LVTA 1RUKH 4JHWL 4IGBA 4G59C 4U3CA 1ZTXL 4L4TA 4ZT1A 3QXDB 1OSZB 1F56A 2OW7A 3OKMB 4OGAD 4Q6IA 4G43B 1KCBA 1T7VA 1QSVA 1KEMH 2AGJL 3VFOA 3RYMA 1AO7E 4DHLA 2ZPKH 1IMHC 4W9FC 2H9GA 4XO9A 1T4KB 4L37A 3QIUD 3VWKB 1BPVA 5I71C 1FN4B 3LXAA 5CHNB 5JA9A 2JCCE 4JFPB 3ZDWA 1FORL 1LTXA 4QHMA 4WZ9A 3KYOB 3IKKA 1AGCA 4N90E 1PNCA 5FUZH 5BZXA 2YS4A 3W5MA 4PV9A 4MXQD 5I1JH 3PAZA 4MJIB 1NIBA 1IC5L 3C6SA 1WC7A 4CNIA 2N0KA 5FM4A 1OPGL 1DBBL 2ZCLL 4AQEA 2LW3A 1A4JB 1Z9OA 4PJ9A 4JZNB 1G9EA 1MRDH 3WG7B 4BYHA 3WY1A 5DLLA 4J3OC 4MNQA 1OSZA 3ECVA 4IOSD 5HHPB 4PB9H 3HNVL 1DVUA 3VCLB 3MRPB 1NIDA 1Q9LB 4UTAL 1W8EA 4XAKD 5E7BA 5DZPA 1HKLH 5AALA 3N43B 3DGDA 4X7SH 4R97C 1HKFA 5I1LB 4YZFE 4U6HB 1TT6A 2CH8A 3GJEB 4GXFA 3VWKA 2F8XC 1CLYL 4RMTA 1FN4A 1RU9L 3BYTA 4F57L 5E08L 5D7SH 4JFPA 4D0DA 1YNTF 3IRZA 3T8XB 4XVJH 5A6MA 2XZQH 3EF4A 3UAJC 4EIBA 1EV2E 1T66C 1DSYA 3D7PA 4O2CA 3SJVD 5C0FB 5L7XH 1WEJH 4MJIA 1BZEA 5GGTA 2B5IB 4GFXA 5DURB 4FXKB 5ALBH 2OJ1A 5E6ZA 5D7JC 2XKSA 1MF2L 4NN7B 1XH1A 4XP4L 5C07A 3JVGA 4JZNA 5EZIL 3QDMB 1FAKT 2Z1PA 2JIXD 3WHE0 2KDGA 2RQEA 2IBBA 5CLYA 5TE6H 1NGYB 2ZCHH 3REWB 5IQ9B 4JG5A 3PQYD 4LSRH 2A4CA 3VCLA 1FSKC 3MRPA 3SDXB 1Q9LA 3QPQD 1R19A 3MRIA 1IU1A 2FLRT 2VQ1A 3L6FA 3HHRB 2WY3B 2OMZB 4PAZA 3FUMA 4R4ND 5I1LA 1IGJB 4M56A 1EEZA 2MCMA 1ET8A 1G7QB 2XX1A 5IVXF 2E6JA 4O2EA 2F8IA 5IROA 3BAWA 3M86A 1JXJA 4JN2B 1SBSL 3KLAA 4MAYD 5CJ5A 3BVDB 3T8XA 4ABUA 1FLRL 3QCUL 3VYNA 1U9KA 3BN9D 4G83A 3MR9B 3NIFB 1KB5H 4LRIC 3SDDD 3DECA 1FNEB 4FXKA 5DD0H 5C92A 1TQCB 1R33A 2P49B 2B4CC 4UV4H 5I17A 2NYYD 2WCSA 2HX8A 2UUDH 1W6WA 4N0FB 4I7ZC 4JMXA 5HDQH 3HI6L 3M1BB 1VGEL 2VL4A 1GYVA 3I75A 1YYCA 1NMBL 1OTSC 2RIKA 1QSFE 5IQ9A 2NXZC 3REWA 3SPVB 3DX4A 3RWFA 1F97A 3SDXA 2I9LA 1BZ9B 1PU0A 4FLSA 2LTQC 3O2VH 4EAEA 1YEIL 3B2UD 5J3HC 1ZHNB 3TPUA 3QYCA 1JD9A 1VZHA 3KPNB 3LCYA 5JHDB 1DJIA 5DT1H 3FK3A 4JN2A 5DSCB 1HL4A 5F8QC 2OMBA 3OR6B 4R90L 4XPGL 4XNYL 4MBRA 1EDYA 5HI3C 2VDQH 3MR9A 1D5XB 4DH2A 2WLJA 3F64A 1FNEA 1YG9A 1U2CA 1YMME 3PHAA 4A2LA 1OD7A 4KKBD 5DVKA 4CC4A 1QD0A 2FHFA 5DMKB 4PRDA 4YXLH 2EE3A 3OHMB 1D9KB 3WFDL 4OZ4A 1OSPL 1MY7A 1E5ZA 3M1BA 3UL4A 1Z32X 1DJZA 5ILTL 3WYRA 5HD8C 4XN4A 3RL2A 3V5DB 4PJ5D 1A3LH 4JFEB 3RL1B 3C5ZA 1BZ9A 2J1YA 2FBOJ 3DX3A 3T3PF 4LSSH 1O7DE 3L5JA 4YC2C 5K9OB 2GJRA 3ASWA 3DHMA 1LO3H 4XBGB 3WIHL 2AABH 1PL3A 1EXGA 4S1RL 1A4KB 1OV8A 2Y7NA 1KTBA 3KPNA 5KS9F 4FC3E 5DSCA 3KLDA 4Z3GA 3O4LA 4GXUN 3PL6B 1VF5C 3NDZE 1RPUA 1YMHB 1UWEL 5DHVB 4J6IA 3S6CA 1JZJA 2EDEA 2W9LA 1AD0B 3BIKA 1PVHA 1DANT 4ANUA 5KJRH 1DUYB 1F1AA 3EKCA 1OEZW 3H3PL 1T1WB 4DN3L 4Q9QH 3OG4B 3R1GL 4DGWC 1D9KA 4AENB 2X4PA 4HZ1A 1H3GA 5AYQA 4QXWA 3FB8B 4AYSA 3QQ3A 2A73A 3OMNB 1EX0A 3EGSB 4J3OG 4JFEA 4NUMA 5EBGA 3BT2H 1OLZA 3FYEB 1RZKH 2V8MA 1LHZA 3FSAA 4MYWB 4ATWA 2OP4L 5I73C 1JPTH 2ROXA 1NC2A 3WAJA 2KLTA 1OT2A 4AIZA 3RU8H 2LR4A 4PJIB 1DQLH 4XP5L 4UCFA 2ZE0A 3ECBB 4KHTL 3Q06A 1YMHA 4PJGB 4Y1AB 1SHSA 1OAKL 2CHWA 1HCZA 3IM1A 4R2GC 4KKNA 5DHVA 3U1SH 3BC9A 2VTFA 2WXLA 1C8QA 5M94B 1AD0A 4N0UA 5F6IC 5DGQA 3GRWL 4I2XB 1SYVB 3MA9H 4X99B 1DUYA 3D2UD 3S5LG 1RD6A 4IOFC 5E8EA 5C0CB 1OM3L 1T1WA 3V0DA 4TQ8A 3FCBA 2Z7WA 3E2HB 5F7LB 2BDNH 3ZE0E 1M7IA 4HOWA 4LOEA 3EGSA 1OE3A 1I1AD 3WHE1 3HZYB 1DR9A 1G9MC 3WUWA 4P9ML 4EIUA 3E3QE 2MNJB 3G04B 3HG2A 4BH7A 1EQWA 5BQDA 2HPTA 4DIXA 3RTQC 1CLCA 4JPQA 1BM3H 3MJ9L 3DX6A 4ES9A 4KJPD 4ZUSA 1ACYL 3I6SA 2Q86A 4PJGA 4Y1AA 4LBAA 4H5SB 4NJ9H 4JGMA 5HYSG 2C1PB 3GXIA 4PI2A 3GMOA 2VMDA 1CG9A 3D50A 4JPWH 1KDJA 1ZSDA 4PP1D 4I2XA 4X99A 2KUTA 5C0CA 2EH8H 2DL9A 2YOCA 1KELH 5D72H 3WJLC 4ZFFA 4E0RA 3KGSA 2C9XA 1MNUL 3T8MA 3KLQA 4HX1A 2D3LA 4TSCL 4OIFA 2VB5A 2FWSA 5CWSB 2R0ZH 3QJUB 4F93B 1JNNH 2BRQA 3KWVA 1E9PB 2DLFH 4L1DA 4NM8L 4JQIL 2G2NA 4JAMB 4YHOH 4GMTH 1BGXH 3QS3A 2P5PA 4TUJB 3FFDA 2RCSH 1TLKA 3GSXB 3LH8A 3E6FB 1RULL 4X8XA 4AG4H 5IMMA 4DPRA 3VUAA 1DTUA 3BXNB 3VDBA 1KBBA 2C1PA 2ZONA 3BMWA 1MOEA 3DX8A 4UTBH 1MREL 3ES6A 1CFVL 3VFSB 1GPOL 4YS4A 1LO0L 5HI4C 4ONGL 2YAMA 1T6BX 2DMCA 2XPYA 2YEZA 1WF5A 5PAZA 1W72H 1OAQL 3IWVA 5FYJD 3H56A 4YVNA 1LWHA 2ERJC 2F7RA 4PU2A 3WEXB 3V7AG 1FJ1A 2QR0B 5IWLC 2ZOOA 1BOYA 3L7EB 4GUPB 3QZNA 4JK0D 3EZ8A 1N7ML 3RVVD 4DKEH 5KYWA 1BREA 4HIPA 4NNXA 3GSXA 3EYOA 3BRDA 5D1QC 1AGFB 4LBEB 1UD6A 2XUWA 1J9QA 4LHUB 1OOWA 2VMEA 3NCFB 1L7TL 4Y9FA 4K8RD 2P8PB 2WGXA 4C83B 4QRAA 2XVLA 3IFLL 4GEIA 1FFOA 2NY3B 2W9EL 4F5CE 4AKQA 4KV5F 2BHFA 4IOIB 4XPTH 4Y4FC 3QI9B 4J4PD 4TQEL 1HT6A 4HF5L 3X17A 3ZRSA 5DJZA 3WEXA 4KMLB 3FF8A 2QR0A 3ARGA 1IAIL 1EZUA 2KS0A 2QZQA 3Q01A 1V55B 5F9DC 4YJZL 3TF4A 1BZOA 2R29L 5F3HB 1DJWA 1MQ8A 4MAZA 4R7NB 4KXCA 4G7VL 4NEHB 3O3UN 4U4IA 1I3GL 1F13A 5E9DE 4YX2H 6FABL 3CX5J 2XIBA 1MJ8L 3ZKSD 1MWAB 1AGFA 4LBEA 4GUCA 4MJ6B 4Q2ZB 4KRNA 1FIGL 4HU8A 3N85L 4LHUA 3KVPA 4F80A 2WXKA 1HK6A 3P4LA 4P4RA 2HXAA 4C83A 5EPMB 5F7AA 4S1DC 5IP4A 3QFJE 2AQSA 2DMKA 2WTPA 3MPCA 5FLUA 1UCBL 1I1CA 3E8UL 3BDXA 4QTIL 2N59A 2IOIA 5IK3B 4IOIA 4PSRA 3BQUD 4FG6C 3QI9A 3OC8A 3I2CL 5I0ZA 5TQ0H 4N9OB 2F1BA 3N1FC 2J57A 3L95B 1IKFH 4N2FA 4ZPTA 1U6AH 3W0WE 4KRMB 1S5IH 2H0PA 5F3HA 4WFED 1MCPL 3V6FB 4NWUH 3VRIB 3U6XA 3HE7B 3CFBA 2A9CA 3SDCC 5TDOB 3EGDB 3K1KC 2Z8WC 4Q74A 4NQCD 4NIKB 1JZHA 1NAMA 2O72A 4M7ZC 1FYTB 2QKSA 1QW9A 4OLZL 4KOBA 5KVEL 3H9YA 4XPBH 1OP3H 1U3HB 3PDGA 1WUNT 2RBLA 2AJUH 3Q8CA 2A38A 3O3AB 2J2ZB 1NZRA 3TBVB 2SEBB 4ZXBA 3FOLB 4ZX3A 3H9HB 3RTLA 4QTHB 4L5FH 5AAPA 2VQUA 2LVEA 3EH4B 3QYNA 1A7NH 1S8DA 3WXVL 4OI8A 2OV0A 1YAZA 4YE0A 1DE4B 4JFQA 3BWUF 3TA4D 3L95A 2H6PB 4GQRA 4PSPA 3X1BA 2NY6B 1UWXH 3R4DA 4XOBA 4G8EA 2XA3A 4FYRA 4JFDB 1TQBB 2CNYA 1MCSA 2IGFH 4Y2DD 5INCA 3V6FA 3VRIA 2BW4A 3HE7A 4ZMVA 4LNVA 3EGDA 4QMEA 1EMTL 2AJXH 5F0LB 3MBWB 2AANA 3UCRA 4JKMA 4Z3IA 1S9XB 3VSQA 2BSRB 1LDPL 4XXCA 2HLFC 1U3HA 2GJ6E 1Y6NR 5TF0A 3S98A 4KAQL 4WSGA 3FQTA 4U1MB 1J9RA 4HZLB 4QCIB 4P23C 5IUSA 3IDYC 4U1SB 3FOLA 4PJFA 3ARYA 5FDWB 4EZMA 4QTHA 4OVUA 1SLXA 4DUVA 1EFXD 2DM2A 2ZWSA 1RUPH 4JO4H 4KI5D 2IADA 4M3JA 4JPKL 5FGCE 2HRHA 3KYKL 4GMSL 1MFVA 4L4VB 3L54A 2PPAA 1D5ZA 3ARFB 2D0HA 1ZSHA 4MCYA 4UM9A 4AQAB 5FGSA 4A6YH 3QG6B 4OV5B 3OAUH 2G4GA 2V9TA 3MOBH 4EN3D 1GXEA 2XTJC 3FB6B 4AITA 1YEFH 1E4XI 4FNSA 3FNKA 4WFFD 4P2RD 5AENA 5F7BA 1D5IH 1S9XA 1RY7B 2NXYB 1A5FL 4G6AD 5C0BA 1AZUA 2A0LC 4P46C 1HIML 2YEQA 4Q6YA 4FFWD 4AGMA 3NH7L 2UUDK 1A6VH 4U1MA 2G3NA 4HZLA 5G5DA 4BQ9A 1AMYA 1PZ3A 4UT6A 8PAZA 5I18H 2VDMB 2BJML 2OMWB 5DD1L 2JCCB 4U1SA 1GA2A 3JTBA 5JYLA 3U4EA 4RISL 3C6LC 1T5WB 1YA5A 3DVGB 3L4WA 1KBPA 2YO3A 1E65A 4N6QA 3DUSB 2G5RA 3EFOB 1Y18B 2X4OB 4H7VA 4AQAA 1ADQH 4GAAA 5ENWB 3ZDXE 2LABA 2YD9A 5KANG 1R3IL 1WS7A 2Y2WA 3NIDF 1RURL 1SDYA 1YN7B 3GMLB 5IEHB 5M7QA 3D25B 1T2JA 2GI0A 2IH1B 1IEBB 2X4UB 5LWYL 4N20A 3ROOA 2RHEA 3X13B 5I5IA 3SY0B 1M3JA 4DGUA 4GO9A 3MLVH 3QXAB 4BZ2H 2PXYA 3EG9B 1U33A 4X7DC 3CLEL 4FQ1L 2W5PA 2VDNH 4NUJA 4A7GF 1IT9H 4JJOA 3S96A 4P06A 3N06B 4R0LB 3DVGA 1NCAL 1KYAA 5D7JD 4LVHC 2VDOB 3DUSA 4B50A 1OCOB 3VG9C 1EHKB 2HYMA 1X5XA 4I18B 2LOEA 4MQXC 1ZS2A 4YWGL 5K1NA 3L3HB 2D03L 2X1OA 4TOYL 5E6UB 1YDPA 3G5WA 2VO8A 1ECYA 1H8NA 4HMDA 4IIQA 2J4WH 5IEHA 4PJBF 2DIEA 1ZXKA 1QLFB 1RMFL 2M1KA 1SFHA 2ADYA 5MI0C 3G6AB 2CGYA 3DJ9A 2X4UA 4EEEA 4Q52A 3BZ4B 3X13A 3BP6B 4NM4H 3SY0A 2WPGA 4X9BA 1A4AA 2YAQA 3QXAA 3EG9A 4M6OH 2LT9A 1ERNA 2Z93B 1MWAL 5D7LA 3OMZA 5GRUH 5DRNB 3UO8B 2ZOTA 4OCRL 4JVUA 5I0YA 2WVTA 3CSGA 3X3GH 2E9IA 1OAZH 4R0LA 1FAIH 4JNXA 3HIZA 3QW9A 1AQKL 1U8IA 4WI0A 4F7CB 4JFHD 4HT1H 3MUY1 1UWYA 4XX5A 4TPRH 3S35L 5IFHH 4K94C 4JKPL 4H4NA 4NQEE 4ZDHB 2AS5M 4ANVA 4F7TB 2A9NH 5FA4B 1FVDA 1RIVH 2B08A 4O02L 5KBPA 5KJ4A 1HS6A 1VFUA 3GSVA 4S1QH 3OZ9H 1QSFB 2NOYA 2NY0D 4WV1C 3G6AA 5I6XC 2VM3A 4QRQB 4OLVH 5IVZB 3ULSB 3BRFA 1OE1A 4M7LT 3ZUNC 3BP6A 3OJMB 5F0JB 2G0KA 3IGLA 1UD3A 5I1CL 1BQRA 2F58L 4RMSA 4C8XA 4G72B 1FG2B 3GMPB 2OYKA 5HI3D 5DRNA 1SMDA 2CKBB 3T0BA 3H8NA 3CVIL 4WO4D 4QRSB 5GS3A 4WO0A 3HAEB 2QKIB 5J1AB 3QT2A 3UG3A 7CGTA 1QYGL 4WTZG 5AVUB 4F7CA 3UTOA 2GEQA 1IM3D 1YMMB 4OZGB 3ILPB 3LKSB 4R26L 3QJSB 2J6EH 4F7TA 5FA4A 2FQEA 1WUZA 1BPLB 2RH0A 1KCUL 4GT0A 4NB7A 4QAWA 2Z92B 1ZLVH 4JZOB 4EXKA 3W39B 3TJEL 4ZX6A 5BJTB 2EDHA 1QSFA 3IDNB 1KN2L 1IUZA 1M4KA 1PDKB 1XGYL 3ALXA 3CFKB 4P59H 5IVZA 1N18A 2VMJA 3PABA 4EQ3A 4OZIE 4NT6A 3JZ7A 3LS5H 4HV8B 3GMPA 2ENYA 2Q87A 1S2EA 4QRSA 4IRJC 1OARH 2NW3B 3FRUB 1PZBA 5J1AA 1X7SA 1YEKL 3IK2A 3WL9A 4GS7C 2J1ZA 5F3FA 3NVQA 3TV3H 1A4CA 2CMRL 2GK0B 2Y06L 3O4OC 3QO0B 2QV2A 4IW4C 4DP2X 3I9PA 4OZGA 3AQZA 5EWIL 3LKSA 4Y5XA 2BMKB 1H6UA 3TBWB 4K5MA 3UZEA 1F11B 5KSAA 4JZOA 3FULA 3HFMH 2EXTA 4XOCA 2IF7A 5BJTA 5ICZB 2YAHA 4XMKL 5EU4A 5CGMA 3GO1H 4XP1L 2NR6C 4YSDA 5EF1A 2XACC 3FBKA 3DVFA 1XCQB 1B4LA 2TSAA 2QT6A 4HV8A 2AEOA 3Q5YA 3GSUB 3BVXA 3BUIA 1DVXA 2RACA 1M05A 3DURB 3V2AR 4M4RA 1G4RA 4PBWD 5BUPA 1RJYB 4FD0A 3TCLB 5F2FA 5MEPB 3WDHA 2NY5H 3FRUA 1A9BA 4HC1A 4RGMC 1DL7H 4OF0A 3IJEB 4HIIB 4ODUB 2YXFA 4HJIA 1GZQB 2GK0A 3F62A 4IOFD 5EZLB 3MV9E 1M2OA 5DJXB 5T5FA 2VDML 3JWDL 4HFUL 3RZCA 3V0VB 3TBWA 1FZOA 2GIYA 1OT1A 2CBTA 4XX1E 2A83B 2HP4A 3MLZL 5DD5L 5ICUA 5E2UL 1USQA 1F11A 2IAMB 3UBXA 3QIBA 5I1IL 3HPJB 4X4ZA 5ICZA 2DI7A 3ZE0B 2OJEA 4PD4K 4Z5RB 4LDCA 1E4KA 5ETUB 1G7HB 1B0GB 3G5VA 4KGLA 3TV8A 5C0DA 2MTAA 2VC2H 3IVKA 3AACA 3OWRA 4K7PY 3RTQD 5DMJB 1L9SA 2A1WH 2DI8A 3W5NA 4Z76B 3ZYJA 4NSKB 1RVFL 3MV8D 1LQBC 5CN3A 3NA9H 2F7PA 3UBXI 3KXFE 4F91B 1RJYA 3N43F 4GKSB 4R7VA 3RIFK 3GNMH 3GSOB 3N5AA 4HIIA 4ODUA 4XHJC 2NNRA 1RZQA 3RDTC 2QSCH 5DJXA 3FU7B 3TX4A 3V0VA 4Y4KB 4OJYA 7FABH 2A83A 3SIKA 1QUNA 4AYMC 3AWGA 1AQMA 2VDOL 1P5UB 5I5RA 1Q1PA 3BVNB 4IBUA 2JCWA 3NIGE 1VLXA 3X2QB 2I32A 2AJYH 4S1SL 2Z8VC 3LPFA 1EIBA 4Q4IA 5IQ7L 5D4JA 3LRMA 2MCG1 3QJHB 3D39E 2XPGA 2IPKB 5IJDC 2P28B 3CBRA 4NSKA 4ZMXA 3SDXF 5D2NA 3VDCA 1A66A 4F1ZA 1E7VA 2Y6SC 5MERB 1U8KB 1RHHA 2FB4H 2XJLA 3GSOA 5D8JL 4MMXA 4U05A 4WW1A 1SJHA 3BSZA 3MLYH 5HI4D 3HUJE 1LXMA 4J3OH 1YEEH 4UYPA 4Z7WE 4TL5A 3AXLA 4NPKA 4C55A 4DEWA 1BFVL 4QD2E 2CCLA 1KPUA 6PAZA 3NIFF 1A6PA 1P5UA 3T2LA 4DVRH 3FQXA 1R3KA 1KJVA 1PBYA 3H55A 5C0AD 3NP3A 2E8ZA 3LKNA 3WTVA 4EDXB 1CFMA 5FW6A 1GZHA 1QA9A 1DEEA 3KPSA 2YXWA 4GG6A 2BRRH 5J13B 1FE8H 3AREC 5EOCH 3HS0C 3FTGB 1CQKA 4QRPE 1KMGA 3FSVA 3MLSH 5K39A 2IPKA 2XRAL 5D1QD 3WNMA 1WA0X 4HULB 2V5SA 2H5UA 3NJVA 4NZJA 5A1AA 1AY1L 2VLJE 5DZJA 4G3YL 5FO8A 5MERA 1JGUH 3QCVL 1U8KA 1U3NA 4JY4A 1N8OE 5GJSL 2J8UA 3SBWC 4AMWA 2B77A 3NACH 2FDBP 3HPLA 4S2SB 5ABDE 5MHSE 3UDWC 1UWXK 2DQDH 4PJDA 2CKBL 1FGNL 4S10A 1IGCH 1K3IA 4Y4FD 2IGLA 2GJJA 2XIIA 1VFOA 4OIBA 4A7TA 4KXZH 2DWEA 2CO6B 1V3KA 3O9WB 4L8SC 1AZRA 3Q6GL 2WLIA 2DLHA 4WHYG 4KTDH 4PS4H 3FTGA 3T77B 2I85A 1MH5B 3BISA 3IU4H 5E9NA 4QPEA 2BOCB 4KKAD 5E56A 5C0RL 1BBDH 3BZFB 5E9DB 5CCGE 2P5WA 1S7UA 4TLUA 4GP4B 2OXGB 4BE5A 4F58H 2Z0BA 5BOPA 4S1DD 2B4CH 1CF1A 2CALA 2HH0H 2YUWA 2E4TA 4JE0A 4TVPD 5I1EL 1SEQH 1UURA 1EO8L 4V1DD 4F5CA 1Z0NA 2F53E 3WD5L 5LGHH 4AYID 4HUXA 4N2GA 4F15C 3U48A 3QZWG 4JVWA 3UTSD 3O9WA 1JK9B 5T5FL 3ZN6A 2DMGA 4HJJL 2PYED 1B0WA 5CLZA 4LCCB 4Z7IA 1F18A 1GGYA 2AV1A 1A1OB 3BEWB 2W59A 1GJIA 5F9WB 4M8UA 1K2DB 4EOWL 3P77B 4KQ3L 4WI7A 1MH5A 2CQVA 4GBXA 3G3LA 3W0WB 3VX0A 3NMEA 3MLTB 1BFOA 2BOCA 4GAGH 4MFHA 1LILA 5E9DA 3SKJH 4LF3A 1G7LA 1TO4A 1Z5HA 3LNDA 2OXGA 1MFUA 3JWNG 3GSRA 1UACH 2XN9E 5IOKA 1MFCL 1H3TA 1QFUH 3O2DH 3W82A 3FO0H 4PJIF 4RMUA 4YSOA 5FYKU 3U9PL 3T04D 1SOXA 4PJGF 4G6KL 3LKOB 4N0YH 1GAFH 2PW1A 5E95B 3NAAL 2DYRB 2QQNL 5HDBB 3UYRH 5DA4A 3L5HA 1HHHB 3STZA 4Y16D 1G5GA 2EYTA 3P9LB 4PJAE 3OHXC 2VRKA 3RB5A 3P77A 2H45A 2VXVL 1TJXA 2YPKB 1BQLH 3MLTA 4YEEA 3QDGD 4RGOH 5DQDH 2AF2A 3BEVA 5G4OA 1YC8A 5GRVL 32C2B 4I0PB 1TEFA 3VNZA 2VR4A 4IKJA 3EYSH 3UC2A 1MEXH 2CA4A 2HLFD 3BJLA 2YOAA 3O8XD 3IB4A 1EO7A 4FZEL 1CN4A 4DFHA 1TTUA 3ZT6A 3EDJA 1KBGH 4AGNA 3TO4B 3U0PA 4G9FE 5ESVB 3HA0A 5LGYA 3TYGL 3DVIA 3OKKB 3AGVA 3SKMA 1LWJA 1QPXA 2W0LA 1AIZA 4B95C 1ACCA 4RWYL 4I13B 5FGCB 4L48A 4P48A 1HHHA 4MB4A 5C3LD 1S7WA 2W0FA 3LN4B 25C8L 3KPRD 1H5BB 4DKFL 4JZJB 1NH6A 5HYIA 2ZUYA 2E9JA 1P6AB 3L3OC 2YPKA 2L7QA 1ZK5A 3GTTA 1X9RA 3MJGX 5E1QA 4WNQB 4BK5C 1G5AA 2ENQA 4N2DA 3B5GA 2P26A 5IMLB 3OTTA 1XSIA 3NESA 4JCWA 5E6IC 1N19A 4W68A 4PPTA 4ZBJA 1HXYB 3OF6D 3SKOB 1TTBA 1RUQL 1A3RL 3ATDA 1SDAB 4MQ7A 4QLRA 3TO4A 2W65B 3C6LD 4LVOB 2NZ9D 1HWGB 3BI9X 3OAYH 4LCYB 5DQJB 5T1DL 1MFEL 3P4MA 4PY8J 4BQ8A 4ATTA 1A6ZB 2AHIA 3FFCD 2NPLX 2K9FB 4UQ9A 4Y5YA 5AYUH 4LCWD 5TJWK 3LN4A 1H19A 3VTMA 4P5TB 1V10A 3WEOA 3TFBA 3P0VH 3ZDXB 4YO0B 1W15A 5EU6D 3BLPX 4CKVX 4PJ7E 4LSTL 2ICES 4G8IB 2GAZB 4RMRA 2ZKHL 4IQHA 1RLWA 4WNQA 4DW2H 3TASA 4DQAA 2O6EA 3ARTA 4TKWA 2FWLB 2M83A 5IMLA 1R0AH 1RV6X 3WY2A 2AMGA 1HXYA 2BSTB 1ANUA 4ZTPL 3SKOA 3DX0A 3FTYA 4I1NB 3B9KB 1RAMA 2WUBL 5TH2A 1JAEA 2W65A 1DVFB 4JM0A 1ZLVK 1N4XH 5GQBA 2CK0L 1TDQA 4I89A 4NAJA 1XF5B 1JGDA 2VXTL 4XP9L 1N2RB 4MB1A 5IJVB 3OJDA 4MQXD 1A6ZA 1T20A 3ULVE 1DQVA 3SD2A 5BVPH 1UUNA 1T7XA 3V4LA 5AOLA 3QUZB 3GZOA 1VRSA 4B9ZA 3LRKA 4YO0A 2QV4A 3H1ZA 2JLPA 2VSDA 1G7IB 4AYBA 1N59A 3L8QA 4XNAA 3VD2A 4NQVB 3VH8A 3GSQB 2NCEA 1VPOL 3ZO9A 4G6FD 5D7EA 1INDH 4YE4L 4QIRA 3QUYD 1J87A 5AD0A 1RUAL 1CLVA 1KTDB 1WZKA 4HS8H 2BHYA 4L3EA 3WS6C 2YFNA 1Q0XL 3D48R 2FRGP 5IMKB 2BSTA 2FUQA 4MHHG 4X6FB 4MMYA 3UGUA 1G1CA 5E99L 2Z0UA 4DK5A 1XIWB 3D4YA 5IJKA 1DVFA 2APSA 3HTLX 4YBLB 3VDAA 5HVHB 3TEYA 4H8WH 1XF5A 3QCTH 4ZUUA 3HVNA 4Z6AT 3FUKA 1HXKA 2FSEA 2EYRA 2OZ4H 2C9RA 1DBJL 4Z7VE 4NQEB 4TNWK 2CLRA 3RRQA 1TJGL 1TVBB 1T2QL 3ZKNC 1ID2A 1PYWA 2DF3A 3UABA 2X4RA 4H20L 1ZWIB 3GSQA 1YEWA 1WA2X 3CFJB 4L0PB 2X6VA 3QIWB 4UNIA 4Y7OC 2YMOA 3BFQG 3WV0A 1UXLA 3NCBB 5IVOA 4BH8B 3DPBB 1MKFA 2WWMC 3WO4C 1MNNA 3O6FC 4U1KB 5CJ8A 1FPTH 3OKYA 3ECQA 1V7MH 3K74B 4KZEH 1KTLA 3S48A 3RURA 2Y36L 4PRHA 1MAMH 5CZKA 5F7MC 2AJSH 1HZHL 3LSOB 3PWVA 2GSGA 3UYOD 2UY6B 4NQEA 3O6LH 5EU3B 3ZTJG 5KTEH 4HH9B 3V4VB 3W38A 5F7WC 1TVBA 1FFPA 2WXFA 3LD8C 4GRLC 2DOCA 1EJOH 1GS8A 3CZEA 4KRPB 4NUGH 1I53A 3ZL2A 3H2QA 4NPYB 3CFJA 1G6RH 2BWDA 3QIWA 4X4ME 5FOJA 2QSVA 5E8NB 1IGFL 4MKTA 3BIAX 4YHKH 2FYVA 2VLMD 3IJ9A 4BH8A 4OD2B 4OZIB 3DPBA 3FN0L 1SM3L 1B0IA 4IRJD 3IN0A 4HJ1A 4BCXA 4WEBH 3IFNH 4GSUA 3IMUA 4R9HA 1NOAA 1NGPH 2I69A 3VW3L 5KOVC 3FT4B 3WFCL 1E6OH 3QFGA 2FO1A 3A21A 2UY6A 5EU3A 3UTZB 3LV3A 3OG6B 1XR9A 3DTXB 5I8KL 5FUCC 3NCYS 4NI6A 3WFHA 4NPYA 2XG4B 4D9QE 1PFCA 5DJDA 5EV7A 5HHOA 2NR6D 3VFRB 5E8NA 3STLB 4NJAL 4PFEA 4MDIB 2ICCA 4QF1A 4QHKI 1B9KA 4FTVE 4QUOA 4DP7X 2CGZA 4BIKA 4K7FA 1LP9E 3VD1A 5EOTB 5T1MB 1DCEA 2X10A 2UV3A 4BWUA 3UJTH 4FQLH 1JYWA 3CZGA 4CAGA 1H3VA 3VQ1C 3LN9A 4HBQA 2BZCA 2QQQA 3FT4A 1IC7L 1ZIAA 3MV9B 4LDOB 2JCCF 1XH2A 2Y3AA 5ITBH 3CN1A 2NY1D 2WLNA 2CLZB 2IQAB 3RWHB 5DJYB 1E0OB 1CDIA 4I85A 4Z95H 5EF3A 1EDQA 2NY7H 3GC3A 4BKSC 4FKEA 4UT9H 4P2QD 1EXHA 2FJHB 3CQPA 4YNYA 3T0AA 3ZL4H 3S88L 1N64L 3STLA 4AMKL 4Q9RL 5DZAA 4GW4B 2OMVB 1E3XA 3QDAA 4N25A 3WE6A 2PF6A 5D5MA 1NCHA 3N9GL 5B1CA 3HCVB 3TN0C 1D7CA 2F15A 1F6LL 2J25A 2F7IA 5EOTA 5T1LA 4XHJD 1NBVH 2VABB 2F61A 3LQAL 3LNIA 2WUCH 4NXSA 4YZFF 3RDTD 5IEKB 4HPOH 4K07A 4YXHH 4FQXD 1BWWA 1ZK9A 3PP4L 3P4NB 2FGWH 2ZUXA 1VEPA 1IIIA 1WISA 2CLZA 2LU4A 2MCPH 3MRNA 3RWHA 1MFBL 3V10A 4FHJA 5DJYA 1Q0YL 4LASL 3G5YA 2OSLB 4X5WB 3VFGL 1FO0H 4LVNB 2IXQA 4TTDD 2AEQH 3D3VD 3GBNH 2FUTA 2FJHA 3NIGB 4PLKD 1EAPA 1BVOA 1GHFH 3TBYB 5I30L 3DXAD 3WXWH 1KJ2H 5CJXC 2CJUL 2CKNA 2FGZA 2NQCA 2OMVA 4XAKE 3D39B 3KPTA 2VZTA 2IH3B 5A6LA 2O5ZL 2Y6SD 3ILEA 4NAQA 5ESQB 2J21A 1CGTA 3AY4A 3IRPX 4RA0C 3HCVA 1YY8B 1F1DA 2AXGB 1DDHA 4XCNB 5FFGA 3IRCA 4PLOB 3IGKA 5IEKA 3W56A 3RWDA 1IQWH 2IFFL 3GUFA 5I74B 4L9LA 3SJVE 2BP5M 3H7LA 3P4NA 4URTB 1LO2L 2CA3A 4Z7WB 5PCYA 4Z0BL 2YKLH 3BP7A 4EI0A 3TYFA 1BYOA 4AY0A 3HNTH 2DEWX 1BZQK 4FA7B 3ARED 3O3DB 4UBDD 3MCYA 1GTFA 1TQBC 3PQYE 4CU8A 4J7RA 4F7EA 3M1CA 5JHAA 3TT3H 4UQ2B 5JOPD 3FU3A 3D39A 4FG2A 5JLZB 2CPCA 5FECA 3BMVA 4XRCA 5J06A 2W81C 3O11B 1YY8A 1TJHL 2AXGA 2VLJB 2X1QA 4G2AA 4IJ3B 5FV1L 5FX3A 4WUUA 3QEUB 5BZZA 2FH8A 4BDVB 2XICA 3VVVA 2EINB 4YIQB 3GK8H 3M17B 5LQBL 1YO4A 4HIXL 3V4PA 1RP8A 4UAOB 1Z6JT 4QXVA 1YQVL 3L1OH 4Z7WA 1KWKA 1CGSH 2E46A 1OF2B 4L18A 3C8HA 4JDTH 5ISZA 2DLTA 2X44D 3ARFC 4J3VA 5TK2A 4HJEA 4PRPA 4OZGF 1V3JA 4M7JH 4RAUB 2DKSA 3SGKC 3AU1B 3ASOB 1LK3H 3V4VL 3LQMA 1XCTB 1VFMA 4BE6A 1NSNL 3GMNB 3UXFA 1Q1JH 1UGNA 3RUGE 1GGBH 5EIIA 1Q38A 2VLJA 1JZGA 5FO9B 4BDVA 4LHUG 1BSIA 4OBSA 2QVIA 1MIEH 4K94H 5ID1B 3QJFB 3V0WH 1IC4L 1FBIL 2NUPB 4YIQA 3M17A 1ILUA 2NTSP 2WTRB 1FFRA 1TZIB 2GUOB 1VCAA 4LEOB 1JF5A 1S7VB 2DDQL 4PRAB 1GVIA 3FHEA 1OW0C 4XVSL 4X80H 3LXBA 2F53B 3PYCA 3B7UX 3GEFA 1I4FA 2BC4A 3IBEA 1AVAA 1IC1A 1KCRL 1MIML 4N3UA 3HZKB 3MREB 2GVYA 2YC1B 2ZNWA 1X7TA 2X4TB 2EJ1A 1J5OH 4ZO8A 4GIPD 3CMGA 2ZWYA 4PJ5E 1B4TA 1ZJAA 4XCEB 5D96C 1GW6A 4LARL 5L9DL 4J1UA 2R7EB 3D34A 1XAUA 3D85D 1UXSB 2VISA 2AK4D 3MJ8A 4RMWA 5SWQB 3IPEA 4JHWH 5ID1A 3MYJB 3LB6C 5B1BB 4BSVB 2AW2A 2XN9B 1YSOA 1VKXA 4LEOA 3QHZH 4LDLB 3N1QC 1HVXA 4PRAA 1DEDA 1U3JA 3WLBB 2NUTB 5CM1A 2AGJH 2CCWA 3EH2A 1KY6A 3D4ZA 4F7KA 4I18C 1VACB 2ALAA 4ZTOH 2MNWA 3HZKA 3MREA 3WKNA 4N85A 2YC1A 2VZ3A 1XEDA 4PW3A 1FORH 3ZDZB 4PJAB 3ILQD 1DN0B 4XCEA 3AG2B 3FO9A 4FADA 1D7BA 2VERN 4GP5B 1IC5H 3NSYA 3ZE0F 1PS3A 2R7EA 1NFIB 1OPGH 1DBBH 2ZCLH 1UJ3C 4XXWC 1UXSA 1OAUL 4U6VL 4S0TD 1NDGB 3GFUA 3JSSA 4OFIA 3MYJA 2CUMA 4BKLB 2X38A 1H0DA 3SE4C 5AZUA 4BSVA 2XN9A 5ECGA 3VRLE 3HNVH 1TIUA 3APCA 2EC8A 3FZUC 2EUWA 2F6AA 4WHYH 2Q3XA 4UTAH 1YUKB 3DROB 3WLBA 3I02B 3EOYG 3KYMA 1GYCA 2QVMA 4R3SB 3O3EA 4G8GD 4X4YA 4G7RB 4JFYB 1B3IA 1G87A 2GB2A 1CLYH 1UADC 1RU9H 3TCTA 4F57H 3NN8B 5E08H 4WI8A 4FFVC 2XN1A 5C1MB 3QDHA 2XLLA 3L2LA 1DN0A 3ABGA 3L7FB 4MTMA 1I3RB 3ISYA 4NFDA 4NOFA 4YLCA 1UD2A 1OD9A 3MO1B 1MCLA 2VERA 4J8RA 1CYGA 5DUML 4Z7NB 1U2YA 1DBKL 4M5TA 1MF2H 4AYGA 2WBJB 2PYFB 4XP4H 5TDPB 5E6ID 2ZX5A 1NBQA 1U95B 2GG1A 3LQZB 5EZIH 4CJ0A 1G43A 1SZNA 4KNTA 3D4CA 4YDJB 4H0GA 3MRLB 1QNIA 4APQA 2EIDA 3EYVB 1J8SA 2JJTA 2QKIC 3O0RH 8CGTA 4BSWB 3L3IA 4KHXL 1T3FA 4UINL 1DYZA 2B15A 4WW2C 1E4WH 1D2PA 1I9RL 3UOAB 4YPGA 4DAGH 2WVSA 2GJPA 4D9RD 4G5AA 1QWNA 1SBSH 5FWQA 1IILE 1UYWH 4X0KA 1FLRH 1UEYA 3L7FA 3T08A 1I3RA 3MO1A 3SGJA 3BRGC 2X3AA 5F93C 4PJ7B 3BVVA 1WZ1L 3APFA 2ZUWA 4IS6B 3BFWA 1IE5A 4YUEL 1MW3A 5L4MA 1UENA 3MGOA 1J0IA 5EOQL 3O3BA 2OK0H 1U95A 4KKCC 1ES0B 1MFMA 3HI6H 5D7KD 1BWMA 1VGEH 3H42L 4ZFZB 3U1PA 4NZRL 3EYVA 1D3CA 3N0AA 5FUOL 4DK6A 1SYSB 2ZIDA 4BSWA 4ZMNA 4JY5L 3MUHL 3MROB 3F7QA 2WBKA 1YEIH 2H1PH 2EIZB 4KDTA 4LLDA 1KGJA 1QBBA 2X7LB 2ZAIA 1B0RB 2XWJB 3MV7D 2BP0A 5GZOA 5J11C 4FI7A 3HRZC 5FYJE 4NZUH 3G6JE 2M8XA 4XPGH 4R90H 4WI4A 3NJFA 4XNYH