4J3OH

Crystal structure of the fimd usher traversed by the pilus tip complex assembly composed of fimc:fimf:fimg:fimh
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
279
structure length
279
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimG
publication title Structural and energetic basis of folded-protein transport by the FimD usher.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion/chaperone/membrane protein
total genus 48
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00419 Fimbrial Fimbrial protein
H PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4j3oH02
4J3OG 4BUQA 1N12A 4J3OF 3BFWA 1QUNB 4AV5A 2XG5B 2VCOA 4AV0A 4X5QA 4XO8A 1PDKB 5FLUA 4XODA 5AALA 2JTYA 4XOBA 4J3OH 3MCYA 5AB1A 5FWRA 4X50A 4AVKA 4X5PA 3ZL1A 4CA4A 3JWNG 2WMPB 1TR7A 3ZPDA 2JMRA 3SQBB 4AVHA 4X5RA 2W07B 1UWFA 4XO9A 3ZL2A 4AVJA 5FX3A 4ATTA 4AVIA 5IQOA 2UY7B 5LNGA 2XG4B 3BFQG 2UY6B 1KIUB 5ABZA 5IQMA 4AUUA 5LNEA 4AUYA 4XOEA 5F3FA 4AV4A 3BWUF 3RFZA 3JWNH 1KLFB 4AUJA 4LOVA 4CSTA 1ZE3H 3JWNE 5F2FA 5AAPA 4XOAA 5JQIB 5FS5A 2J2ZB 3ME0B 4XOCA 4CSSA 5IQNA 1N0LB 5CGBA
chains in the Genus database with same CATH superfamily
4BE6A 2PO6A 3U4EB 3VFOA 4ELMF 2NMSA 2BNRA 5GHWH 5C0JA 2IC2A 1Q9WB 3VXSD 4APXA 3T4YB 2MPVA 1AS8A 4ZOEA 3FK3A 4X6FA 2PWFA 3NCYS 3TJHD 3MOAL 1VESA 4J1UB 4P5MA 5C0RL 4IW4C 3K2MC 2HZHA 4PJ6A 1SDYA 1QA9A 2X4OA 5DZAA 4AENA 3VG9C 1WZ1L 4BFNA 3FBQA 3MZGB 1A7NL 4GKZB 3UZVB 4H0GA 4A37A 5JHBA 4WCYH 5ENWA 3OKLA 4AKPA 4V2CB 1C08A 3R0NA 3MA9L 4ZNEA 1GA2A 4XBMA 1EFQA 1HILB 4LFHD 5EFIA 3MDJA 1PL3A 5D5MB 1KIPA 3ABZA 2MH4A 1HJCA 5EUKB 3O2DL 1G1OA 4YSDA 3VMNA 1MAKA 1T5WA 3SGDH 3WL9B 1WC7A 3PYCA 5HY9B 1IC7H 3KYMB 3LYRA 5DS2A 3TCLA 1VERA 4WO4B 3CPUA 4Z5RA 3ILPA 1XFPA 3TO4C 4RQQA 4KO7A 3R7QA 2VW7A 2E7LC 2F5AH 1MCBA 5B7EA 4H26A 4B9GA 4Z7WB 4YPGA 4RFNC 1KB3A 3KR3H 2DM2A 3GSNA 5DZLA 4Y4HD 3JWNG 1E4WL 2FCBA 2W59A 1DO6A 5DHMC 3D07A 4X5RA 2VN7A 1WICA 4JM2F 2AQRA 3AVEA 2J20A 3S96B 5DWPA 4J3XA 1A6WH 2J8UA 2C26A 3PWPB 4HT1L 4WV1B 5CEXB 2FSEB 5LBSA 3K6DA 5C07E 3P9LB 5D6CB 3RAJH 2Y7LA 2CXKA 4NKIH 3WD5H 5E9DD 2DRUA 5ESVA 2AV1A 5EC1A 2V2WB 1WD9A 5FYJU 1ECYA 4JZJC 1YPZE 2EE6A 15C8L 1U8IB 3LEVH 4JG0L 5LKNA 3LKQB 4WSKA 2A6KB 4OSUH 5CGTA 2W88A 4DEPC 2GHZA 4OAWA 5EU3B 2VO5A 2NT0A 4PGEA 4XPTL 4ZUUB 2HVBA 3MV7B 2DB8A 3D09A 2VDPH 1OAYH 4XOAA 2K78A 2A4ZA 4MRBA 3EBAA 1ZT4B 1JWMA 3DX6B 3GRWL 4HZLA 4TSCL 4R0LC 3DIFA 4XX5A 2EE2A 5HHQA 1Q9OB 2FWOB 4P4KA 5A43C 5DCCA 1R3KA 3Q48A 1ZLWH 2EEAA 1JGIA 5C0DA 5KSVA 5B4MC 4L8CB 3L48A 2NNAB 3WMSA 4YQXH 4XAKD 1B90A 1RHHB 4WHCA 3WNJA 1KXQE 1SDDB 5CP7A 1RJZB 4OUUB 4OR1A 3MLRH 2IAMD 1KLFA 2EDJA 1H0DA 4LOEA 3ZL4H 5KBPA 1EEQA 3I6GB 4PGBB 2N01B 4AKQA 1FL6A 2P7TB 3IT8D 4JKPL 1SBBA 3QB7C 3BE1L 1H9VA 1QBLH 2XYBA 3GLEA 4ODBD 4PRHE 4ZW7A 1E9PA 3D0VB 1P4IL 1YQVH 3TBYB 2W80C 1CD8A 2YC1A 5CEYB 5LAXB 2MCG1 3BSZL 5EIIG 1UM4L 5IQ7L 4MQXD 2QQQA 3SJVD 2VXTH 4TUOA 3L9RB 1PS3A 3ZGHA 2HYMA 2O1AA 2NXYB 2ZKHL 1E6JL 5GS0L 4IBTA 1RZIA 1KTDA 1IZKA 4RFEB 1CTMA 3QUXA 2X4RB 2YQBA 1D9KB 3IU4H 4Z7VE 4GP4B 1YNTA 3L5HA 2EIBA 1I7RB 5AG9A 2JKXA 3WTXA 4UQ3B 1XEDA 1D5XA 5KVDL 5LXVA 3HR5B 3O0LA 1OM9A 1JZIA 2KPWA 4XCCH 1R3IH 2YPVH 1URZA 1JFQH 3QIUB 3QR1A 1BP3B 3WN5C 2EDDA 3EJRA 2A38A 4UDUB 1T3FA 2MKLC 2NQ3A 2ZX8A 3GI8L 4X5WB 4AVJA 1HQRA 1P4UA 4N68A 1OB1B 4QYAA 2FEDD 4IBUA 4M6OL 1LEGA 1XBRA 1UFUA 5I5MA 3MRLB 4PRIA 2APTA 3U0TB 3NJHA 1JWSB 2Z92B 2DH3A 1V7NL 3PQYD 4F58H 4EBQL 1GYAA 1G94A 2GSIB 1CLOL 3ARQA 1UZ6F 5BO1L 3QDJD 3QZNA 2VLRD 4FQJL 1E5UI 3ZYZA 1XL6A 2IDUA 3NSYA 4OZFH 1WAPA 4DPBX 4KITB 4Y2DB 4DIXA 4ZTOH 4JMXA 5DFTA 2QKSA 5ILTH 3AT0A 2VAAA 3PWVA 4WLCA 2DMGA 2CDEB 2Y06L 1T1WA 4OW6A 1BVNP 1CJYA 1I1AC 2IOMA 5T1DL 3GSRA 3BKYH 3LPPA 1UEYA 3BQVA 1UWYA 3SE8H 2RQ8A 1NICA 1WBXA 1NL0L 2WSKA 5E6RB 1AC0A 2HT3D 4LCCC 1G7MA 4LCWB 5IB3B 5IMOB 3WTTA 3QHFH 3V4UL 3T2OA 4ELKB 3HN8A 3HRPA 4G5AA 2ZSWB 4ZS6C 3T6WA 1SHMA 5HHOA 4R3SB 1IO4C 1KT2B 2FEEI 1P4LB 3X1EA 1XF4B 2IG2H 3QZBA 4H88H 3NIFB 1N4XH 4OCWH 5DJYB 2Q2LA 3D52A 2EEBA 3NCMA 4GXUN 32C2A 4N8VB 4PRPA 5TDPA 3RZCC 4XMLL 4EQ3A 2DYPA 1TCMA 2F6AA 3PFUA 4ONFL 1F13A 5FUCC 4GFXA 1M7IB 2BSCA 2PWHA 2GUYA 4NC1E 3T1FB 1DEDA 2VC2B 4UWQB 3WJJA 4JFSA 4Y19D 4Z7NE 1I7TB 1UCBL 3AACA 5D2LB 1UD4A 2CJUL 4FXGC 4H40A 1UT1A 1K8IA 1U95B 4FQ2H 1AHWA 1QHQA 2BC4B 3FL7A 1NFIB 5TGBA 5DWUL 3WTWA 3QEHB 1LO5A 3G5ZA 5JXED 4W81A 1BAGA 2N4IA 2BSED 1IAIL 4XAWL 1FORL 3NFSL 3D33A 1E65A 2X28A 3FT2B 4O5LL 1WPCA 4FQCL 5EN3A 1UWGH 3L81A 3WE1A 5EC2A 1MWOA 4UMGA 1ZLSL 3Q1SL 4YL4A 4OQTH 4F8LA 4LRNH 2CK0H 1UJ3A 5DRWA 2V17L 4X98A 1CK0H 5D7KD 1KXTA 2X4QB 3LRMA 4EOWH 1U8MA 3K6OA 2QQKH 3C2AH 1ML0A 4MMZB 2HAZA 4JO1L 3HZYB 1SXZA 2XXGA 3NGBB 5FGBA 1OCWL 4QRUB 3ARBD 1GC1C 3DX7A 4U31A 2F1AA 4TXVB 4BQ8A 1T2JA 5E94B 2P45B 4JJ5A 1SJEA 4HOMA 2CKBA 4NRZA 5F1KC 4UMSA 1GOFA 2Y1YA 5IFJB 3NJJA 2CO6B 4NJ9L 1FO0B 3B9AA 3BVXA 1NUNB 3FFDA 3C8DA 1SHSA 4FZEL 1XH0A 3QDGE 2CJSA 4PJDA 4OZHB 2ATPB 2O5XL 2LFGA 1EFXA 3V4LA 2PYEB 1S9XB 1M1SA 3O6FA 4JX0A 3ARVA 4MZ3A 5EEYA 3WTSA 3QXAA 4J23A 3CSBA 3W39A 5F88A 4O2EB 3SKNA 1P7QA 3HI1A 12E8L 5JW4M 1NZRA 1SEQH 1OAXH 3S37H 3G5WA 3BXNA 4AM0B 2WAHA 5KSBB 4JHBA 1F1DA 3T77B 3IMSA 5E2TH 4CSSA 4QAMB 2X4UB 2KQNA 2OSLB 4HSCX 5L4FA 1MCFA 5DJ6A 2ITCA 4RFOH 2RALA 4PJCE 2G5BB 1YEIL 5KVFE 3DMMB 5K93A 3BHBB 5FM8A 2DWSA 4YHYC 2QHRH 1UA7A 4B96A 4Z7VF 4FG4A 4W4OA 1A7RH 4KKNA 3OR7A 1I8LA 3MV8D 5K9KB 1D6VH 2IGTA 2VDQL 4HKZA 1XCXA 1XCQB 3HPLB 3BUYB 3NJXA 2Y6SD 2HRHA 4PTUA 1ZSDB 3FOMA 1GYCA 4N8PA 4EIGB 5KJRL 3CK0L 3TBWA 2CIIA 3SBQA 4AMKL 1JZ5A 3HAEG 4LEXH 3GRWA 4G6JL 3OLGA 2R29L 4NIYE 1GXEA 4P2YA 4Y1AD 5EORH 1KUMA 1XGRB 5GGUA 3U9UA 2JB5H 1CE6A 1JZFA 3ZTJH 1I9IH 1KEML 5DUJA 1NUFA 1A9BA 1I3RB 4FD0A 3FPYA 3P0YL 4U6XA 3VSTA 4X5PA 1OL0A 2D9CA 3CPLB 5F0JB 3RKDC 4L3EB 4MAZA 4MS8C 4JK0D 4IBWA 1UB5A 1JDCA 4BFEA 1B9ZA 1FWXA 4JZOA 4GB9A 2Q1EA 3NJVA 4WWNA 3VFPB 3SYOA 3M07A 1MW1A 2V5TA 1KV7A 3F7RA 4GIOA 4AJVA 1BIIB 3QUYC 3CSGA 1ADQH 3K5RA 4NQUA 4WK0B 4JHAL 1VENA 5EU5A 2AJVH 2DWDA 2WQXA 3AXIA 3W2DH 1N64H 3OL2A 4BV1A 1INDH 4G59C 5LAPA 1CBJA 3O81A 1TTAA 1JZDC 1GYWA 1UZ8A 4IRZH 4JRLA 2NY2C 4QRPB 1F8TH 5EBGA 1X5KA 3UJIL 4Q14A 4LAQL 4HJGA 1U3HB 3MLVL 3H1ZA 3STLB 5BUPA 4N0UA 2J4WL 3HZKB 3WFEH 2OYMA 1S5HB 1NIEA 4LLVB 3ESOA 3BQUB 3CAFA 1UCTA 4HIHA 1BQLH 4WEBL 1C5CL 1Y18B 2CBOA 4D9RD 4EIBA 1NGYB 5GZOC 4G9FA 4NB7A 3ARWA 5IT2H 1W9XA 1WWCA 1DE4B 1QBMH 2XQBH 4JB9H 5CD5D 2F1BA 1PZ3A 3ILEA 1PZBA 1KN2L 1WZKA 1JNLH 5TQ0H 3BZ4B 2QR0A 1B4JL 4Z7NF 3II3A 2BP8B 3FT3B 1G6RL 3GO1L 3PWLA 4NKMA 3N5AA 3O4LA 3SKJH 3ES6A 4CKQA 3HE7D 3NFPA 3G6DL 4C57C 2WTRB 1U8PB 1WIUA 2YD0A 3BVNB 3D4YA 3LH2H 3GM8A 3TS8A 4FTVA 4ILDA 1FVEA 4JN1L 4I88A 4UIKL 1YYLH 2VDNB 4XPGL 5HHXH 3CSTA 1MHHB 4HJTA 1SJHB 4JO5A 1R1CA 4L4TE 1ONQB 2R4RL 3PL6A 1XF5B 3OKEA 5B1JC 1A4KB 5TF0A 4KUZH 3TX4A 1MHEB 4Z95L 2MHAB 3RTLA 3TA3C 4W9EC 1WFMA 4LCUB 3SHSA 1TQUA 1EO8H 4QTIL 4UTAH 4NBYB 1HCYA 4HD9A 3BEWB 4DP4X 4XWGH 3Q8EA 1KIQB 4W93A 5TK2A 4ORGB 3VYNA 3HCVA 4KY1L 4PCYA 2PETA 5T1LD 1GOHA 2DKMA 5KSAA 5D70H 2WTPA 3L5XL 1S7QA 3CVHL 2JTYA 2HKHH 4TS6A 3S36X 3BIKA 4PJIB 2B4CH 3ZDYB 2PYFB 1MCPL 4BWUA 1OP3K 4H0LC 1X9QA 3OG6B 2UYLB 2OMWA 3RJDA 3QYNA 2YD8A 4J2QA 3N1MC 3B5HA 1LNUB 4WWKC 3PXLA 2I69A 3TBCA 5D5ME 4JFZH 2BCKA 2BOBB 2APBA 3LKNA 2HMIC 4N9OB 5C0EA 3BKCH 2O30A 2HKAA 4DVBA 1OP5K 5A2FA 3FUIA 3IKKA 3IDMA 3MRQB 1A8ZA 5F9WB 3L9YA 1WUZA 4G8GA 4X6CF 4Z7WE 4UTBA 5I30L 1FBIH 1ORQB 3JWDH 1AQMA 1UXSA 1XSJA 3BYTA 3JTSB 4W68A 4M1GH 5IHZB 3T6QC 4LT7A 2WBWB 4TSBL 4KXDA 3FUKA 4QCIB 1Z3GL 3U4BH 4UILL 2PWGA 4QT5A 4JPKL 4I0PB 1O75A 3PWPE 5DO2C 1EXUB 4CNIA 5LG1A 2K45A 3JV4A 4XOEA 5EUOB 3RIAK 3UCRA 2XZCL 2V7NB 2X1XR 1XV8A 3MCG1 4PJCF 3CXDH 2XBTA 4FFZL 1D3CA 4X0KB 4KQ3L 3IMUA 3VFGL 1DJSA 1X4ZA 1MF2H 5DD6B 4APQA 3TBBA 1H8SA 1CFTA 4Q6IC 5IEHA 1HZHH 4HF5L 4P3DB 4AT6B 4NZ8A 1Q9KB 3R4DA 3C5JA 3PU7A 3MTXA 1R0AL 3VB8A 3C08H 1A1NB 5JQIB 4AJYV 3HFML 5C8JB 1BQHG 3L2NA 4G1MA 4GMTL 1KELH 4AH2B 1IILE 3G6JB 5I71C 4RGND 5FC9A 3MV7E 1RVFH 2DWEB 4RDQF 1WH0A 1F1AA 1OAQL 3BCDA 1Y6KR 4XGZB 2CA4A 4OCSL 1MEXH 1RP9A 3OPUA 4J4PA 1DBAL 3K6IA 4X7FC 3VA2C 1K3ZA 5JQ6L 2GJZA 4PUBH 4BZ1L 1JHTB 4L1TA 1QLRB 3BPLC 2Q0ZX 1MJJA 3FAXA 1I7UB 3MUGB 1X9RA 1LP9A 3GBNL 3SYAA 1BJ8A 3HS0B 3I02B 3IXTB 2GJJA 3VFTA 4NWUL 2ZF9A 3LNFA 3VFSB 1WWWX 1IGTA 3F83A 3L9EA 5F89A 3QFJD 5I1LA 3T0ED 4ZO9A 1JMZA 3E3QE 5F9AC 1JNNH 4MAYB 2ZJSL 1GCFA 2HN7A 1WEJH 3DRQA 3H53A 3V6BR 3ARDB 1IM9A 4FG6D 3OMAB 3BVVA 1GAFL 4LSQL 3TIDB 2CO3A 3VI3F 4JL2A 4XOBA 1HDMA 3PFQA 5C97A 4HCRH 1G7PB 4JPWH 1KF9B 1O7SA 4LLWB 4OLVL 3LRSA 4NWTH 1NBYB 1BFVL 4JG1L 4XT1C 4GUCA 2AXJA 2H26B 4IRJA 5D4JA 1U6AL 2VDMH 1CGVA 2EXTA 3EJQA 5K1VA 4DQOL 4DKAA 1CD0A 4U1KA 4CJ1A 3VD4A 3ZPDA 1EMTH 2OQJB 1FF5A 3WNNA 1IKNA 1IBDA 3VXMB 3EYUL 2R23A 1FNFA 1NMAL 5IROA 2FLMA 1PEZA 3NEOA 3PGFH 1P1VA 4MDIB 5FYJH 4RETB 5ISZD 3EDKA 3H3PH 1L9SA 2JE8A 2DQGL 1NIBA 3E0GA 1MQKL 4LSVH 4GBXB 1YEKL 3BUDA 4E41B 1PJWA 4WU5A 4J3OC 1BIHA 2N56A 3SDCC 3FQXA 5AW3B 1U3JA 1VEPA 4M5ZL 2NTFA 2GTWB 4NQTA 2C3GA 4GT0A 3AFLA 4L23A 5BW7C 3CV5A 1UH2A 3AREC 4L4VA 4M62L 4U6YA 5GISH 3J2PA 1IFHH 5IJDC 1TQVA 3N42F 2YRZA 5I73C 5I75C 3G04B 2B5IB 1BZOA 2DBLL 1NM4A 2ZF8A 2Z91A 3INUL 3DX4A 4NN5C 1HKLL 1XH1A 4XZ4A 3D3VA 4M6NL 3PHQA 4LOUD 4GW5B 4QRRB 1NLDH 5E99L 5DTFB 2Y7OA 3W9DA 1MRDL 5IOKA 4OIIL 5MENA 2O6EA 3UG4A 1XR8B 5FB8B 4P5TD 4F92B 3H9SB 3IDNA 5IHBA 4D7BA 1M05A 4KMLB 1N18A 4YSEA 2WXFA 4P3WA 3MRDA 2H32A 1IGML 1T4WA 5D71H 2ALWA 4N9GB 2Q8BL 1KJ2B 4S0TD 5J8OA 4LCWE 4JM0A 1F2XK 1QFWH 3QEGL 4P05A 3CN4A 4U1MA 5ITFB 3SY0A 2FT8A 5FDWB 3SPVA 3VXUD 1NCCL 5INCA 3SY6A 1LO0L 2B1OA 2WXPA 2YN3A 3S2CA 5DHYA 4U1HB 2Z8RA 1PGRB 4ETQB 3NIFE 3P11L 4ODWB 5BV7C 3D85A 4OKVA 3IWVA 2VR5A 5DHVH 1NGXB 1S6NA 3O6LH 5E1HB 3WENA 5AALA 3SDXF 4YHML 8CGTA 5JW3H 3KWXA 1FRGH 2COVD 4YGVA 4Z7WF 3QRGL 3N43B 4BK5A 2JKIS 1T21A 5IREA 1QG3A 2X3AA 2Z4QA 3T8MA 5C1MB 3I3DA 3SQOL 4IEFB 5LWYH 1FL5A 5D2LE 2AEWA 1DDHB 4PCSA 5DJCB 3VFNA 3ZZQA 5I1EH 3TBTA 4U3CA 5A7EA 4PI2A 5IESL 2HG5B 1URIA 3K4ZA 1A7PH 1P5VB 3Q0HA 1X5JA 4ZX4A 2FL5B 2F74B 3CUPB 4I77L 1LK2B 2VN5A 1NBVH 2QVKA 1TQSA 3QIBB 1AQKL 1RZQA 1B88A 3FN9A 4UYPA 4XHJC 1OGAB 5ACLA 3BDYH 3GGWA 4N8CL 3P2TA 3K91A 4HLJA 2WVTA 4HX1A 2TRHA 4IIQA 2UZIL 3RX7A 5D9SA 4MJHA 1Q0XH 3QVAA 1AO7D 4FA8A 5HDQL 4UQEA 1S7UB 1FZMA 2NY1B 2K6YA 5I1CH 2H3NB 5HVHC 1XDTT 5C09D 5H8DA 4CDGC 4I9XA 5B3NA 3C60A 1R34A 2H41A 4JO3H 2BFVL 4G8FB 3X3FL 5J11B 4FNLH 4A2HA 2XWTA 3WNKA 5B1BB 2X70B 2ZCLH 1AFVH 3QT2A 3QWRD 4WEEA 2RIKA 4CSTA 2OJEB 1BZ7A 3ZTCC 1U58A 2B15A 1HHKA 3RGVA 3MXVL 2P8MA 3NAAH 4PGDB 4QRAA 3LXUX 2VC2L 3NTCH 3B2VL 3QWNA 4FOMA 5ESQA 3ULSB 2QQNL 1S8DB 2WVSA 4JZNA 3KLHD 3ARGA 4HKXA 2YK1L 3ISWA 3C87A 4XPBL 1A6ZB 4OZHE 3MRFB 4DO6A 3C5SB 2PYEE 3F58H 5F9JB 4IS6B 3RTQA 4MMXC 4YE4L 3SDCD 4PLNC 4Y2OA 4X4ME 5FHBL 1JK9B 5BXFA 1Q0YH 4BDVB 5JORA 3HG5A 3FQRA 5KSBE 2TRYA 3C75A 5IEKA 4OD2A 4PJBA 1KJVA 4RGOH 4LQFL 1JZ4A 3MCKA 1KDJA 1U92A 2HLAB 1QSEA 4UB0H 1KTKE 3T4YA 4YHIB 5I8CA 2JI1A 5HI5D 4FFZA 2VDRH 3PXJA 6PAZA 4JFFA 2ICEB 1JF1A 2V3FA 3FXIC 1YEDB 2AP2A 2X6UA 5DYOA 1GKOA 4LHUA 5DI8A 2GG1A 2PLTA 4KZEH 1ID2A 2J2ZA 4N26A 5F1IB 1MLCA 3UZVA 4QRBA 1LYQA 1PZCA 3TZVD 3MODH 5L7XL 3QQXA 3WKNA 1PJ9A 2AABL 4NRXB 2OCCB 1OLLA 4UANA 3QHTC 3V0VB 5A6LA 3OX8A 1PKQB 4HJ1A 4F2MA 3DGGB 1RIVH 1KGYE 4M4RA 3GSUA 2WBKA 5C0CB 2YRLA 5GRYA 4DQAA 3UFIA 3LPGA 3KYMA 4HWBA 4UIMA 2YD9A 5E08H 3LDBB 2EYSB 2UXVA 3ULVC 1HZLA 3KVQA 4J6RH 1U8HB 2J8OA 2Y7SA 2R2HB 1I8UA 3KPSD 2A0LC 4H20L 4PRDB 1R9FA 1QR1A 5CN2A 1S3KL 2WXNA 4KKAD 1E7VA 2YD6A 3KH3A 4NKQB 3HG1B 4HKJB 1EQWA 3OMNB 4OLYH 5C0FA 4PWJA 5KOMC 4UBDD 2N59A 4LPTA 2YSSB 3CE1A 4HUCA 4CU6A 4L3EE 3PWPA 5IMLB 2VJ8A 1LO3L 2F8OA 2ZCHH 4N1EA 4RBPK 1DR9A 4UQ2B 5MI0C 1AOHA 4N86A 2ADJB 2IPKB 4FQ1H 2NPLX 4NLHA 4UM9D 3V0WL 2NY4C 1KNOB 2JTDA 2KC0A 4BZ2L 5K9JL 4JFXB 3AU0A 3GTVA 3US9A 3DSNB 3P2DA 4C56B 5IOPA 2AJ3B 3X12A 4MD0A 3O9WA 4AI7A 2ADFL 2M83A 4QRPE 2AQNA 1SVZA 2BNQA 3LH8A 3UBGA 1UOWA 4MJID 3MNMA 4Z7UB 1FSKB 4HGKC 4FF9A 3K1DA 1NGQL 1NAMB 3MREB 3EUDA 5HYFA 2ZUQC 1NFKA 1JXJA 4N87A 1ZT4A 4PVLA 1OGTA 3A21A 3PJSB 3MKKA 3MGOB 2FWOA 5CJBA 4QEGA 3MC0A 4DUVA 1A4JA 2RTTA 2XPGB 4OZGF 4XBEH 1XF2B 3ROOB 5K9OB 2I5YH 5AOKA 2NNAA 4WGWB 3CFEA 4AZ8A 1NLBH 5D2LF 5ICXA 4A38A 1X5HA 1MH5B 2IANB 3BAXA 3F12A 3H4FA 3KGUA 3D0LB 3T4AB 3R1GL 4JO4H 4K3JH 5KAQG 2WKGA 3SDAA 5KN5A 6CGTA 1K6QL 2R9HD 4BGDA 4L2LA 4FQXA 2K4AA 3APNA 4G9DA 2PABA 4P2OD 4F7KA 5BZDB 3FO0H 4OGZA 5G55A 3WXVL 3HHSA 2E7CA 4I5BB 5IB1B 3PHOB 3TBYA 4TL4A 3D2UB 2ATAA 2Z7WA 4H5SB 4WI0B 5LAXA 3HN3A 1F3DH 5DGRA 3MNDA 1DJXA 3CFMA 4UQ9A 1EHLL 3GTTA 4LF3B 1HXYB 4BKLB 3MRHA 3L9RA 5EU6B 4DO4A 4TQHA 5AAMA 3DK0A 2HTLC 4R7LA 1MW3A 2EADA 5E2VL 4UOZA 2H2SC 5I0DA 1U2HA 4QUOA 2OW6A 2AGJH 2DQIL 4PJIE 4RFEA 6PCYA 2XWJB 4NQEB 3ZDYE 2ICWA 4XN4A 5CU9A 1SBSH 4TV3A 4KKRA 4F3FB 1FYHB 3E6HB 5AW2B 4NKOA 4J27A 3UGUA 5TQ2L 3UABA 2MFNA 3VYOA 5J57B 1AOZA 1MI5D 3QIUA 2CDFA 2YBRA 3D69B 4JKLA 4LVNB 2X44D 5HTSA 4IOFD 3THML 3POCA 4K2UH 4ESKA 1FN4B 1J0HA 5BMFH 4X5WA 2CNZA 2QV4A 3RX9A 1U8QA 2HG0A 3VU2A 5AVQB 2ZCZA 3U0TA 1R3HB 4NGHL 1TTGA 2Y5QA 3CBRA 1ZT7A 2R2EA 3UTPD 5BRZD 1T7YA 4JG9A 2VDLH 1I1YB 1RZ7L 4KK8D 5T1KA 3JYCA 1KC5L 3KVPA 4KGJA 4DKEL 2YJQA 2F7RA 2H8PB 2VDNL 3IRCA 1OXYA 2A0LD 25C8H 3RU8L 3DPBB 5JNYA 1S5IL 1GGCH 5KSBF 2W9DH 5HYIA 3BOVA 5DZ9A 4QPEA 1OTUC 1GY1A 2WXLA 3PRZA 3L3HA 4AE0A 3C2SA 1GRWA 3TBVA 1WAAA 1TU2B 3O6KH 4QHMA 3MRKA 2CKNA 4ADJA 5EUOE 5T33L 1JYWA 4BUGA 1FL3B 3V7AG 5G5DA 1IL1B 1PBYA 1I3UA 4YXLL 2ZNWA 5E8OA 3BEVB 4X4XB 3W0WB 2AFNA 3G5XB 3DRTB 2GUOB 1ITCA 2IPUG 2DIBA 3I2CL 4RMVA 4Y5VC 3VCLA 4BH7B 5JW5B 1LEIA 2FD6L 1S78D 1YEWA 1LE5A 2NY4D 5AUMA 4JFED 2J3SA 5TPWL 4Q9QL 2Y1AA 2E46A 5CR1A 5I8EA 1B4TA 5AG8A 3VXSB 3UZEA 3FTZA 5BZWB 3G6JE 2FBJH 1N8ZB 1P4LA 4RLDA 3NPSB 4X80L 1RK0B 1ZHLB 5CJ5A 1P84J 4FP8L 1T0OA 4WAFA 3UBXB 5H37A 1UYWH 1JPFA 4MB3A 1FV1B 3ZDZB 4IKLA 3MJ9L 4EI5D 3KJ4C 1V8HA 4X5LA 1HESA 5JPMA 4KKBC 2BXYA 2MKWA 4P9HL 2OL3B 5FYLD 3RL2A 4MAUH 3B7TA 5B3JF 1EGJA 3M8OL 4LSTL 2VW6A 4WW2B 3SCMA 4GSDH 5EH1A 2XZQL 1BG9A 5D72H 1U0QA 4N3TA 4UZSA 3WFCH 2ZWKA 3AY4C 1XIWD 4XC3H 1SM3H 4XBGB 3PJNA 3AU1B 1G9NL 4WI4A 1BDYA 3EF4A 2NY6D 5E4EB 4MXQD 4ODHH 2DM4A 1XGTB 4Y4HB 4JRXA 3CFJB 1OW0A 2FJHA 4KY2A 3ABMB 1SLWA 1XTMA 3ZUNC 3IJYB 1JUFA 4GXVL 4A7GF 2V5YA 4P46D 3TV3L 4RCAA 3QXVA 1AGFB 4B5ZA 2UVFA 1I85C 4YDLB 4WI6A 5KJ7E 1I8IB 5ECJE 3V4PB 2QVTA 3U2JA 4XNXH 2J1XA 1EPFA 2BIPA 1XGPB 3O2VL 1X5AA 2FYVA 3KCPA 5K39A 5E9DB 3HZYA 3VXME 1QRND 3IMTA 5GZNA 3NCBB 1YJDC 2HTLD 1D2PA 4X9IA 2QSVA 3RVUC 1MKFA 4XVSH 4JREB 2NZ9D 4QTFA 4QXTB 2EEDA 5HJ3B 4Y5YC 1ZWIA 4A7VA 4IK6A 3QQ4A 3SBPA 1PLBA 1P7HL 3S4SG 2Z35B 3GK8L 5AL0A 1E2WA 4E41E 1JRHH 2ZOLB 1RUAH 2AQQA 3EOTL 3BGMA 2ATPA 3KNBA 5D55A 1CS6A 2XWZA 2C4FT 1R75A 1FFTB 5KYYA 4NCC2 4P59H 4N25A 2X4NA 2A6IA 3HMWH 2IH3B 4GUOA 2G2RA 3L6FA 4PWFA 5DFVC 1T1XA 1OF2B 4BFBD 3CSYA 4PJEB 4B60A 3A67H 1T6VN 5CUSH 3UTSD 3GHEH 5CF3A 2A6DB 4KPHH 3T77A 2AXWA 4J3OG 5DJ0A 2FWUA 3BKJH 1ET5A 4GKNA 4EN3A 3DNKA 3ZYIA 4HUXA 1HTYA 4QRRE 3DVGB 2IAMB 5JA8B 3EADA 3QZWA 1I9EA 2RHEA 4ZSOB 1GGYA 3OKNA 3H9SE 5C08A 3O11A 4PJIF 4BZ2A 1GYVA 3ZDYF 1T0PB 3NK4A 4HCFA 4F1ZA 1F97A 2EC8A 4OM1L 1BF5A 1R3JB 3HPLA 3ML9A 2VN4A 5DJ8B 1IV8A 2CGYA 2F5AL 3CLFH 4DCQB 5HYQB 4RMTA 1UD3A 3SJVB 3KR3L 2C9RA 2R2CA 3F8UB 3ZHLA 2AK1L 2JELL 4TNVF 2IWGA 3L17A 2PTTB 1U8OB 3AITA 5F97E 5FO2A 2WWOA 4POZD 3CFCH 2A9NH 4L9LB 2Z7UA 3KWWA 4OM0L 1A6WL 1K4CB 4FEIA 3P3RA 1U2CA 4KK5C 1ZLDA 2VJ0A 4KRPC 4MKMA 3VXNA 5JW4R 1I3RA 4LHQB 4HVBA 4NKIL 2Q87A 2QMJA 1KOAA 2WIIA 2JCCA 5KW9L 2UX6A 2XX1A 4KDVA 5J1SC 4KTEL 1L9OA 4U1NB 3BZ5A 2ZUSA 3P4OB 4AYFB 2WANA 4PRNA 1IGYA 4UV7H 5EUOF 4M02A 3APDA 1JHLH 1O9ZA 4WTZA 3LKPB 3OZ9H 2V4LA 4WHTA 5I6OA 3E8UH 1OCRB 3PQYB 4YK4B 4EN2A 2CQVA 1EEZB 3QPXH 2V9TA 4JM4L 2RACA 1NEZB 2CIKA 3BT0A 3QDJB 1OGAE 1AXIB 1TZHB 2MOQA 4EXKA 4RGMC 2PO6D 2H7WA 3UPRB 3ZVVA 1MRFL 2J6EA 4X9YA 4BD4A 1KJ2L 2OMXA 4TTDD 4L18A 2AANA 3IFNH 5D2NB 3KPRA 2ZXBA 5BQ7B 4PI0A 1IC5H 3AQXA 2IPTH 3HRZA 1U3HA 4LLQA 1T03H 4BCXA 2FO8A 1I7ZB 2GY5A 1S5HA 1RURL 2OMTA 4DW2L 1A6PA 4YQXL 1R33A 1CICA 1D6EA 4I48A 1VEOA 3S6CA 3KHQA 5IHHA 2H2PD 2VAJA 2GB2A 3GSQB 3BD3A 1L9TA 3QNFA 4L3CA 1ZSHA 5T1MB 3M88A 1PLAA 4JZJB 2P5WA 1T7XA 4YHOL 3M86A 2YAQA 5A2BA 3GS7A 3B56A 3IFPA 1OE2A 5I0ZA 1KCRH 2XQ0A 5J6GB 4IMKA 5DRNA 4HYTB 2XLLA 3QG7H 4L9DA 1NJ9B 3CX5J 2P46B 4XCFL 1H6FA 1RZKL 3EH4B 1U8PA 1EWHA 1AXSB 4JCLA 1AXTH 5KSUB 3CDZB 1NCDL 4R4BB 3QUZC 1NAKH 3P3SA 5CO1A 3MACH 5A1AA 2KQMA 3ZZLA 3A4FA 5TDNB 4FXTA 1OOWA 5DJZA 5LGJA 2YSTA 4PVMA 3NZ8A 2DLGA 1CQKA 2R69A 2AV7B 1OOAA 4Y19B 3GHBH 1A4KA 3OHXB 4FLQA 4I3GA 5E70A 5CEZE 2EKJA 3UO1L 4LCUA 1JS4A 3HMXH 4NQVB 1KIQA 2CBQA 3OJMB 4OD1L 5DEGB 4LCIH 1KYOK 1S7RB 1EJOH 1AD9B 5EU7E 1IB5A 4MA7H 1WZLA 1GH7A 1AACA 1QD0A 2R2BB 3MRNB 4O51A 2JJSA 3OKOA 2PYFA 3M45A 5FIEA 3QPKA 3C5ZA 3QORD 3CMOL 3S88H 4G43B 2QKIA 3II1A 1EEUA 4XH2A 5I2IB 4Y8DC 5ICZB 1N3NB 1PKQE 4KKLD 3RWEB 2IAAC 5JHAA 4YVNA 1F00I 2XYCA 4IBYA 5C0CE 2VLJB 2ITFA 3NJMA 5HGDA 3MCLH 5F0LB 1WZMA 4I85A 2VMJA 2WZ0A 4ZTPL 3MJ9A 3OKKA 1MCQA 4LESA 2VL5B 3ARBB 4NUJB 3WIFB 4FHBD 4QLWA 2YGPA 5IIEA 3KLLA 1JPST 4P4KD 3RVWC 1KCWA 2D7TH 1NDTA 4KUCF 3V0JA 3W81A 3TN0D 5LGYA 1AHWC 5AW4B 3OQ3B 2K8MA 3HG1E 1X4XA 5F7MC 3KMDA 2AJUH 4MWFA 3T3PF 3GEFA 4I0PA 2GSGA 4BHUI 3JWNH 5FFOA 3QG6A 3V52H 1EXUA 5CEZL 4XP5L 4EMZA 1IJNA 1NCJA 4RISH 4Q8BA 1BM3L 3FB5B 4OF3A 5DF0A 3QHFL 3NSXA 3HLAB 2R0ZH 4U1GB 4LDEB 2OS7A 1I8AA 1P6AB 4A63A 5D4IA 5GGTA 1JTPA 4P3DA 3MFFA 3IDYB 5DMJB 4XRCB 1DVFD 4C56E 1A1NA 4P0DA 2YLHA 3IGFA 4IKIA 1SYSB 3CU1A 4OCWL 2LHAA 4H1LG 2QZ5A 4B53A 3IDGB 1KY7A 5FGBC 2B3IA 3S5LG 3HTLX 3HNVL 4KMTH 2YR3A 4ZFQA 1B4RA 2NOYA 3P4MA 1G9ML 4Z7UE 4O02H 5I74B 4DVRL 1N9PA 3BN9C 2BWDA 3I6KA 4Q6KA 2R7EB 2Z64C 4GRLA 4LPCA 4PB0H 3QUXD 2WB1A 4XGZA 3SE4A 4D0DA 5L88L 3QI9A 3UGEA 1SLUA 4JKMA 4Z78A 1SMAA 1E0OB 3MROB 3N43F 5DJXB 2ENJA 4EJ1C 3NABH 4V33A 1JGEB 2VXVH 4FFYA 2I9TB 2JJWA 2VH5L 2VSCA 3P4NB 2WINB 5E00B 2IANE 3KG5A 2JK5B 2X09A 1AIFB 4GXUM 3V6OE 3BUQA 1QYGL 3IJSB 3NJLA 4MAYA 4ZPTB 3BISA 4G80A 3ILQC 3OB0H 4OQTL 4PRID 1TFHA 4LRNL 4F8PA 4Y1AB 2E27H 5L4JA 2ATKB 5H4YA 5CD3B 4MNHA 4ZMYA 2Y25A 3NJGA 4EOWL 2BIIA 2HVKB 2AI0L 3HW7A 3M46A 4LLWA 1I53A 1BQKA 4HUMB 1E28A 4P5KB 4KJQD 2XNAA 5ECGA 1XMEB 3ZO9A 1QRKA 3A24A 1GL4B 3LN4A 3Q5OA 4U3SB 3E80A 3LXAA 2XA8L 4HC1H 5IG7B 1PZUB 2L7JA 3B7YA 4M4PA 1HCZA 5EU6E 4W4OC 1MCCA 4XZUA 1QLEB 3VWJD 4FXGB 3VH8B 1XGUA 3LQMA 3SGKA 3FYEB 2I60L 3EJTA 4N4YB 4IGBA 5JHDA 4L37A 1UOKA 4NQEE 1XH3B 5CILL 5B38B 4Y2LA 3CFKB 2WLMA 2XACC 3FT1A 3VTAA 2LAAA 4WNQB 2XG4B 1WITA 4MDIA 4ZW8A 3DUSB 1MUJB 4OB5L 3N1QC 5C71A 3FOLA 4N1HB 1N5AB 3NCJL 3KPOA 3G08B 4U3XA 5CJXA 4TVPD 4N5EC 4F8OA 1TQTA 4JR9L 2DLHA 1Y7VA 4A1RA 3S37L 3V5KB 1QQDB 4YAQA 4NPYA 4YR6A 5AKSA 1AZCA 4PRPD 3S3JA 4KH2A 2DYPD 3SO3C 1LO4H 5DMKB 3K71A 2R56H 3IJ9A 4R2GD 2EO1A 1DQTA 5DJAA 3FTGA 4LLYB 4K9EH 3WXWL 3GHPA 2Y07H 4NQDB 2FATH 3QISA 5FECB 3HNTH 1IBHA 4LDCA 4NZUL 1RERA 2WOYA 4AYSA 4R7DB 5DTFA 2ZAIA 4BK4A 1HEJC 3ARTA 2I7OA 4MA3B 3RLSA 3FRUA 1B3IA 1MJUH 3U0PA 3KPLB 5FYLH 3P0VH 4WFGE 4IRSC 3PWUB 3W0WE 1W6WA 5CBEA 4P9ML 4L1DA 4Z1PA 3WFBH 4K8RD 3LV3B 1MN4A 1QSFA 5CINL 2UWEB 4N24A 3P73A 4DERA 4LEXL 5GS0C 4I3RH 3ULUD 1KJ2A 4KI5F 1DCEA 5EORL 3CBKB 5FDYA 2ESVB 2HJFA 5L2KA 1QHOA 2IFGA 2ZXCA 5DU7A 3GSWB 2LABA 4NI3A 5FA3B 2NQCA 3VXSE 5EHFA 2H0EA 3CX5K 2X2UA 2A1WH 2BVQB 4XO8A 4YNYA 5T1LB 2LLGA 2QV2A 1NAMH 4M1CC 1E9QB 3JTBA 5D1XA 1HYSD 3WBDA 4F33A 2AQ1A 3ZDZE 4DJMA 5LJYH 5FOJA 3BFOA 4YDVB 4YHYB 1QATA 1EHAA 4X8XA 3MX0A 4RAUB 3UGXA 4ABVA 1MWAH 3GT6A 1I8KB 3MRPB 2RH0A 4X50A 1QUPA 3PWNB 1OT2A 1LEKA 1A2YB 3CLEH 2P3YA 4ZDHB 1ADQL 2XKNB 1EFXD 3O6FD 2MOVA 1N64L 3KD4A 4PG9B 5GRVK 5J6SA 3TVMC 4CMMB 4M43L 3MV9A 2HT4C 4IRZL 3CZFB 3IEAA 5FOBB 1F8TL 1E50A 3VXOB 1P7QD 2DICA 3L2LA 1D5ZB 1UACH 4KFZC 2NCMA 2E7HA 3VXPB 4NZJA 5E5UB 1MPAL 4GI8A 2Z31C 1IEAB 4WI5A 2PP8A 3OJ2C 4OLZH 2CLRB 1R5WA 2UZYB 3MHZA 5L6YH 2E9GA 1CF8H 4OI8A 1D5MA 3ULAB 5IT2L 1K5NA 4JB9L 5EO1A 1S7UA 4UAOC 2G9KA 1JNLL 2AVFA 5D7HA 3TPKA 4MDJA 3DX2A 3Q8BA 5E9DE 2E56A 2N7BA 4AJWA 3MLZL 4Y7OC 4MA1C 3SKJL 3WGVB 2BZCA 2A9AA 2O72A 3OMIB 1OGPA 4ZPVB 2HJKB 3V6FB 2OJEA 2NX5A 2ZNXA 2EIZA 4IQHA 3OKYA 5A2AA 4EUPB 3WLWC 3MRJA 5AKVA 3MRMB 2OL3L 1MCIA 2RCSL 3KBFA 4UZGA 1YUHB 1EX0A 1UH3A 4XP6H 4WI3A 2YMXL 4RGNB 3D0AA 1LQSR 4OZFA 3RWHB 5ETUB 3D1MC 3ZYJA 4YLCA 2ZX5A 4TNGA 1FFQA 4KUZL 5EOCL 4GG6B 3X3GH 3BUBA 4A2LA 4IIZA 2KZKA 3B2MA 1TITA 2NXZD 4UU9A 4Y5XA 4MMYB 5E6YA 5JR1H 4MB4A 5EO9B 5EG6C 4XWGL 1IGCH 2CU9A 5DGQA 2YEQA 3IPEA 1EZLA 3BD5A 4PJEE 1KCVL 1UH4A 3IJ7A 4AEHH 2JKJA 3FF8A 4XAKE 3JWOH 3AXLB 1OARH 4S1SH 5BS0A 3HG2A 1LGVA 3OAYH 4OJAA 3L3JA 3T0EB 5F7EH 5AZ2H 2GI0A 4ZSOE 4JJHA 2WYHA 2ICEA 1UA6H 4Z0XA 1MREH 4J8RB 1NIFA 2ZWYA 5D7IB 4N2HA 4YEEA 3L7EA 2HWZH 3UROR 5HI4D 2G75B 4IBLT 5ALCH 4GW4A 5F1IA 2VSKB 1PF3A 3DI2B 3GMOA 5IW1B 1IM3D 1F11B 4WI8A 5GIRA 1A47A 1T7VA 3NZHH 5GS0D 5IJKA 3KAAA 3SJVE 5F44A 1PD1A 2G5RA 3JWDL 2E0PA 3AQZA 4FL4C 1XCWA 2C3VA 3S97C 3UYRH 4NC1C 2QSCL 3WO3B 1U8HA 1QBBA 2DQUH 1T20B 2Z34A 4G9FD 3SD2A 4K5MA 4JMNA 1UOLA 1U33A 4R8WH 2XRAL 1QP1A 2AAAA 4WHYH 1HSBB 1IQWH 3HAEH 4RRPM 1OTSD 5ISZB 3WEBA 3TEUA 5HDBF 2UY7B 4NOBA 1MF2L 1KBPA 3DROB 1CYWA 3O4LD 4NSKB 1RH8A 1EIBA 2EUZA 4CL7A 2HPOA 4X99A 3VRIB 3SEPA 1CXHA 2DF3A 4OQTA 2V5RA 5TD4A 3TJEH 3MRRB 2YKKA 4NO3B 1L6ZA 2O5NA 5MHSD 3L1GA 1HEHC 4FTVD 2BY2A 1JSYA 4HIQA 3PQYE 1DTUA 2X41A 2WXOA 3TC9A 3FU3A 2WO3B 1KNOA 1ZE3H 3QDJE 4EKXA 4M5YL 4G6KH 3PL6D 3UEQA 4D9QD 1MCDA 4ZUVA 1X7SA 5DRXA 5IB5A 3CZLA 4H25B 5AAPA 3BP5B 1E6OH 4U6VL 5DD5H 1PKOA 3D25B 1L7TH 1RSFA 1R4XA 3MJGX 1NGWB 3FMGH 2YLKA 3IN0A 5IKCB 2WC7A 5D2NE 2CGRH 3LB6C 1N6QH 3M1OA 1G0YR 3ZUCA 5IROC 1PNCA 2WOBA 5KSAD 1IC4H 3CHPA 4P5TB 1NCNA 4NUQA 4PJ8C 5IVXF 3MREA 4HHAB 4BFJA 3PDOB 3MKGA 1J88A 3FO2A 3R8BB 4Q0XH 1JNNL 1O9VA 4LKCB 1SOXA 1J1XH 1DJGA 3DX9B 4U1SB 1T2XA 1TJXA 1U8LA 4OFYD 2NY3C 4R9HA 4WW2F 5SWSA 1MG2C 4YZFE 3TTSA 3VXUB 4AC2A 4ENED 4O2CB 1IRAY 1KGCD 3FZUD 5ANMA 3KXFA 1CIDA 2H5UA 1SOKA 1DQMH 2Y7MA 2DH2A 5FFLA 5L2KB 4G8GD 3EGXB 1E4XL 4UAHA 4OF8A 3IJHB 4OGXH 2CR3A 2Q7NA 3PP3K 2E86A 2B59A 2YPKA 1YN6B 1INEL 2ZWLT 4I5BA 5IB1A 5M7QA 4QRQA 3LNIA 4CGTA 4Y19E 4H5SA 1N59B 1EZVY 1F18A 1X5ZA 2IDQA 4WI0A 4WW1A 5ES4B 3WHXA 5CCKH 4M00A 1FH5L 4TPRH 4F7PA 3DTUB 1IGIL 5HDOA 4L8DA 4WFFD 4PD4J 2AJSL 3OGOE 1NC2A 1FGVH 1QVOA 3JV0A 5FYJL 3Q05A 3PG2A 4OBRA 2OR9H 3LIUA 5E4IA 4ZUWA 4APQD 1SHWA 4C4KO 3TEZA 5LVEA 4YSPA 4UINH 3RPKA 1DBKH 1FYTA 1KPRB 3P9MB 2APVA 3ESMA 5KOVC 5C9JB 4ZMZA 3UDWA 1V3LA 3L2MA 4PGZA 4GW1A 4CMHC 2NY0C 4HEMA 5C2BL 5F6IB 2B16A 1ET7A 2P5EA 1WCQA 3F05A 3U9WA 1ERNA 3QJTB 4UT7H 1AO7B 1CFSA 4X7TB 3T0WA 3PDGA 1ZPLA 5D7KE 3DBXA 1AMYA 2UY6B 4QKTA 2VLJE 2Y5TA 1HWWA 1S46A 1XWVA 4TRPH 4KU1A 3VRLE 4WF7A 3GUFA 2Z7YA 1K4DB 5C09B 4BK5C 3VX0A 2XN9A 4J4PD 1S7WB 1CR9H 1MQ8A 4AQ1A 2DDQH 3GXUB 3RBGA 4M29A 5FW7A 5IW6B 1I1YA 3EYSH 1JVLA 1J9SA 3N44B 2MQ0A 4HFUH 4MZRA 3F62A 4PJEF 4WI9A 1ZVNA 3AUVA 3EGDA 4HPYL 4N0YL 4N0RA 5D1QB 1Q8MA 4FYQA 3DPBA 4H0IA 3RY6A 1ADQA 4DGYH 1ORSA 3US1A 2VE6A 2ZWSA 4JAMB 4W9JC 1XT5A 4PRAA 2VIRA 2W81C 2WXQA 4KROC 3CDFA 4PS7A 5I0VA 4IRZA 5I19L 4OH2A 1FL3A 3IB4A 4MA8L 2Q3XA 4P04A 2YPLD 1W91A 5DQ9B 4D3CL 4L0PB 4P2QA 3SDCB 5LHDA 5B39A 1AP2A 3D39A 3HB3D 2L7UA 2XJLA 1X5FA 3RDTD 4TOYL 2LVCA 3C8KB 1KDIA 1UJTA 2ZIDA 5DK0B 2VMFA 1BJ1J 3R8QA 3T1WA 1VKXB 1NFDB 4IRJD 3TWCH 5ITBH 4UOQA 2Y22A 5JDSA 4PGCB 5AEAA 3STZA 3O6LL 1U8NB 1F6LL 1A6VH 3K6FA 3L4VA 1FRGL 2OMVB 4G2AA 3QXTA 4KGLA 1LDPH 3VXSA 1ZV5A 1UASA 5IBUG 1F6FB 3CFBB 5FKPB 1IKFH 2BFGA 3UBXA 3I9AA 4ODTH 3X14A 1S9KC 4S1RH 3CLWA 4UQBA 4ZOCA 5JW4Q 1HT6A 1FZKA 5I1EL 3LX9A 1RJLB 2H9GB 3ARGC 2GT9A 3ATFA 5GRJH 1MFUA 3TZVB 4CVZB 2F5BH 1A6TA 1ZHNA 1FGNL 2OL3A 4X6CA 3D87B 2EYTB 2R39A 3KPMB 3U0WL 5KEZA 2G4EA 3KGTA 5J4MA 3VI4F 1AS6A 2VN6A 4ALAL 5MP6H 2YEZB 1QACA 3LS5L 1FFRA 2ID5A 3NQKA 5J06A 4I7ZC 3KPPA 1J1OH 3U30C 2NY3D 4HIEB 5IBTH 4Y1AE 3SN6N 3QNXA 5CBAA 1KYFA 5I66B 4E68A 3GJEB 3FU7B 2FUTA 1FNGB 4KHTL 2WGNB 3IJEA 4L4VD 3KPSB 2ROXA 4YSQA 2IIJA 1USZA 2HRGA 4Y4HA 4M3HA 5F1NA 1ICTA 4I8DA 4X5XB 5F3BB 3VW3H 1F4WL 2EDYA 2JI2A 2NLJB 4FYRA 3HE6A 1E5BA 2VR6A 4XR8C 5FUCE 4KQ0A 3D3VD 2K4WA 4ATTA 1AHKA 2LQRA 4PTTB 3IK2A 1SGKA 5MEND 4NRYA 3BPCA 3RWDA 2JKWA 3OSKA 1V05A 3ASNB 1SOSA 3NTCL 4LSUH 3I9GL 2G60H 4C54A 2D3VA 4UM9B 1JPGB 5C7ZA 3RGBA 4LEOA 2DEXX 4PY8I 1OSYA 5C0GB 4R96B 3QO0A 3R7RA 3GXFA 2WNGA 4HGWB 2SEBA 2W0LA 3TP4A 2W07A 3QO1B 4WO4C 3MMEB 1ACCA 3FB6B 2NYYD 4LPXA 1EAQA 4JPVL 2Y2WA 4Q2ZB 3T2PA 2A3TA 2F9BT 4MJIB 4YZFF 4F2EA 2GEQA 5B21A 4YL9A 2WY3B 1N2RA 1YY9D 5BZXA 4D9RE 2DMKA 2MSPA 4BJLA 3RUGF 5IK3A 2JKSA 5J3HC 4A39A 3RNQA 3UADA 2AJYL 4JFPB 1IC0A 4RNRB 3VD9A 5B8CB 1UQSA 4XNZB 3VI3A 3U6XS 4YHZL 3ZRFC 1F5WA 5M94B 4Z77B 35C8H 4NQDE 4Z7IA 5I1AB 4X6DA 3TF4A 4NBXB 4RDBA 4M7ZC 1FC1A 4PHXA 3VDCA 2RGSA 4MFHA 4CVWA 2A74A 1QNIA 3MBXL 2DQTL 3IN2A 4ZZKA 4KROD 2B1AL 1MAJA 4JQIL 4UV4H 1JXGA 2CCVA 4F57H 4P2OB 3O9WC 4M61A 5AW8B 1YDPB 2NUPB 3ZT5A 4CVXB 3FN0L 2GK0A 2UWEE 2YAPA 2B2XH 3MRBA 3H4HA 5E08L 1GR7A 2K3HA 4ONHB 1DBBL 2ESVE 4KHXH 1P0SE 2DMHA 4OZIF 5HYQA 5EWIH 1DLHA 5JLZB 3FC8A 1NUGA 4W9FC 1YMHB 2BIOA 3VRLF 2O4EA 1FFOB 1PIFA 3TH3T 3QUKB 4U7MA 2BIQA 2EVHA 3C60D 3W37A 3QJXA 3OVUB 4IOSD 43C9B 4XN9A 3L16A 3A6CH 3Q6GH 5DD0L 3TYGH 1WSST 4NAQA 4M48H 1L7IH 2HFGL 4LKXA 4N2CA 2NQDA 1IAII 5J6HB 1BVKB 1QEWA 3BMWA 3FFCA 4U6HA 1DQVA 1TZAA 2KDYA 3RGVD 4PVBA 3E3QC 1BBJA 1MI5B 3SDAC 3S9DB 2PN5A 2HVJA 5F21B 3GBLA 3ARGD 4ELDA 5CN1A 1BVZA 2K7QA 2BY1A 3MRGB 2WUBL 2VB5A 2ADYA 2GW5A 3AG4B 4FQXC 2KL6A 1ZS8B 2FJGB 1BYNA 3SKUD 2ERJB 4Z0BL 3LKPA 4PCKA 3RTQD 2EIMB 1NGPL 1ZA6B 3GXIA 4ZO7A 3C6SB 4GJTB 1YNKL 1A8JH 5BRZB 2JI3A 1EEZA 2MWCA 3BO8B 1AJ7H 5D7SH 2YD3A 5K59E 5EIIB 2VLRA 5D7JA 4A6YH 4JHUA 4ADGA 2G9HB 1QO3A 4QOKA 5AENA 4AMXA 2X4SB 2NXYC 4U4IA 1PW3A 1PD0A 1Q1JL 1HIMH 4GYBA 1CTNA 4UNIA 1QSED 3EH1A 1T1YB 2VXSH 4U0QB 5MERB 4B9PA 1QI4A 3LXBA 5BQ7A 1D9KC 2L7EA 2Q2EB 3EDFA 4JFFD 4BSVB 3FO9A 4MNGB 3L8QA 2W95A 4WFED 4YDZA 5LG6A 1JPEA 1F58H 5TE4L 1VZIA 1ZT1B 2HA1A 4LHUD 5I18H 4ZOAA 4GG8A 1JPTH 3BH8A 3B8SA 3QNZB 3QIUC 3MLTB 4JO4L 3KW8A 4FLRA 5MI0B 5T1MA 2JLLA 3GBMH 2NY4B 2NW3A 2E7DA 4JFEB 5EBLB 4XCYB 2X3CA 4HEPG 4HJUA 4EVNB 3IS0X 3AQYA 1KGJA 1KB5B 1SN0A 4RGNE 2DL9A 4DK3A 1CGSH 4KJWC 4GQ9L 1XGYH 4GG6E 1BVOA 1O6SB 4ZYKA 1DO5A 3F7KA 1FLTX 1ZEAH 4X8JA 4EI5B 4KXAA 2IEPA 2F18A 2O5ZH 4JDVA 4GKSA 4Y2DC 1FCCA 2FJSA 3KHOA 4PY7A 4IHOB 4HQQH 1GC1H 4KO9A 3MOBL 3MTRA 3OGCA 1YYML 1AGDA 2AGJL 2V37A 4JVWA 4PJGB 3H9ZA 2V7HB 5FF6A 1FLRL 1L9QA 3FH8A 5IMMA 4M93B 2PPCA 3MJWA 4FJ6A 3T0EE 3VFMB 2D3LA 2GIYA 3ARYA 5FWQA 4NN7B 1FPTH 1XIWB 2FZ3B 3Q5TA 4FFTA 5D7IE 4PV9A 1MCSA 2NY6B 1XL4A 3OR6B 5EZJB 3TESA 3RIAF 2R2BA 1TLMA 4HWUA 5BMFL 2E8YA 3GRGA 4B9IA 5DHVA 1H15A 3BMVA 4G43A 4GKLA 4AGLA 1E5CA 3FULA 3B7RL 3MO1A 2OP4H 3GJFH 1RZJL 3O9WD 3QPQD 1FNEB 3FH5A 4B9FA 5ICZA 4P46B 4AG4L 5EV7A 3QAQA 3UP1A 1C12B 1F3JA 2BVOB 2BNQD 3QAZC 4S1QH 4CC1A 3W5MA 3LEYL 1KPVA 5AVSB 3BWUC 2DJMA 25C8L 5DJ2A 5JPMC 1QRNB 2X7LB 4M7KH 1P53A 2A6JB 5IF0A 2XOTA 5L0QB 2HX7A 4X9FA 4NQSB 1BXXA 4HIIB 3FONB 4LZKA 2R0KH 2WGXA 4N2OA 5ISZE 3QULA 3EJPA 2P5PA 1XXFC 2W60A 4K07A 2ZSVB 3PV6A 4FLHA 1TKWB 3PV7A 1EDHA 3WY1A 4KC3B 3ZTJG 5B1AB 3NK3A 4WUKH 2NR6D 4ZUSB 5IB4B 3F7YB 3SDAD 5GJTL 1OAJA 4G5ZH 4K7PH 4BWTA 1OW0C 4HXBL 2YFNA 4FQXD 5MEPB 1B2WH 1S9WA 8FABB 2OX5B 2EXSA 3VX1A 3W5NA 5AVZB 1VSCA 1ZPUA 4XXDB 4AXWB 3SSGA 2UWEF 1CDYA 5CM1A 3V8OA 1ZKAA 1GZPB 2MEJB 3S35H 1R17A 3LY6A 3UTSB 4MZ2A 2KI6A 1BFTA 2AK4B 1MFBH 4HJIA 3QSKB 4NHUA 1XVSA 2D4DA 5E7FA 1YUKB 3FT4B 1U8CB 3NGBC 3QCVL 1C1EH 1HQ4B 3IFOA 3V4VH 4OCLC 4UT6H 1F45A 4JFDA 3FUHA 4Z3JA 2F68X 3VTMA 2X3BA 1NC4A 4RZCA 3I50H 4WK4B 5SWZA 3WUWB 3K0YA 2LTQC 3O45B 1HHGA 3FUEA 4FCHA 5DMGC 5A2KH 4GSDL 5FO7A 1M7DA 4BCZA 3MV8A 1R5IB 1JWUB 5B39G 5DJXA 1K2DA 4R6UA 2F54B 5DEZA 1MIEH 3Q7JA 2OXGB 2D31A 5CHNB 4MCZB 2CO7B 2WINA 3K2KA 1P5UB 3VXUE 4C4BA 1AKJD 2CMRL 3BWZA 2XY1A 4YDIL 3HC3L 1XAUA 4UOJA 5FO8B 1U3ZA 2IH8A 2WP3O 1OD7A 2LGNA 3Q6FB 3ROLA 2VR4A 4V1DD 2ATKA 5J1AA 1D5BB 2FBRA 2Q8AH 4CC4A 5K59F 1LWRA 4K3DL 4XNXL 3U2SA 1FZJB 5LXGH 5CGYD 1L9PA 1TR7A 1EO7A 5CSBA 2MQGA 1EHKB 3L1OL 2IBBA 4U3SA 5JW4N 4XP9L 2D8KA 4AL8L 2DD8H 1L6XA 4H8WL 1JZ2A 3OC5A 3B6SA 2I25N 4N90E 1E5ZA 1TQBB 3IU3A 1J9CT 3BH9B 4JQIA 5E9AA 7TAAA 1GGBH 3EGSB 3FRPB 3CSFA 3HLKA 3LIZH 3GSXB 4EI6B 1PIGA 1AR1D 2O26U 3QA3B 3PNWA 3ZMNA 1FQ9C 5B38A 4N2DA 4R4NC 3HHMA 5JYMA 5IJVA 3DTXA 3DUSA 3TNMA 2PO6B 2IMNA 5GRZA 1YEHH 2BNRB 3MLWL 1NH6A 4P59L 4APXB 1AO7E 3HMWL 1S7VA 5B7FA 4YXHL 1Z2KA 4X6FB 2XX0A 1Q1PA 2QPDB 1A7QL 3BW9A 4L5FE 4P5MB 3F7LA 5C09E 4OT1L 4XVJH 4FCAA 4RIRA 5CUSL 3KDMA 1OLZA 1QA9B 2X4OB 3QRBA 4N2BA 4AENB 3VQ2C 4ZMTA 2OW7A 5DMKA 4YIQB 4OD3H 4F20A 2JKRM 3K4DA 5ENWB 1TJMA 3C6LA 2I24N 3OKLB 5AVYB 4A2FA 1C08B 4HK0A 4RDQG 3PGDA 5TF1L 2EDOA 2CUMA 5D1QE 1KIPB 4EZMA 2BSSA 1JXKA 2GSMB 3NEEA 4TLSA 5FYKD 1T5WB 3SCMD 5ALBH 1WC7B 1ZCRA 1CBVL 1RULH 3QUMH 5EOTA 4Y9CA 3TCLB 3HE7A 2Z7ZA 2A77H 2MPAH 3ILPB 4MA3A 3UTOA 4Z5RB 1R46A 4RQQB 4GS7C 1JG9A 4CSPA 1PAZA 4TF4A 3V0HA 1DBJH 4H26B 1HNYA 4YPGB 2F7QA 2HLEB 3GSNB 3MPCA 4JRXD 4HG4J 2WCPA 1CD9B 3LV3A 3QR2A 3MLUH 4ICXA 4QTHA 5C0BA 2HXAA 3CN1A 2VLME 3ZX1A 1U3HC 3LRHA 1YA5A 4IBSA 1HH6A 4OUOA 3X17A 2J8UB 3DHJA 3BQUC 1X5YA 3DPDA 4MSWA 2XPZA 4G6ML 4HAFA 4XNMA 1CICC 1NCGA 4K71B 3PABA 5ESVB 2AV1B 1OSZA 2ZYIA 5EC1B 5GZND 4R5TA 2YZ1A 4DGVH 1TJGL 3QFDA 1JN6A 4GSUA 5H35A 5K69A 1YN7A 2ADIA 4PV8A 5L4MA 1JV5A 1D5IH 4IMKC 3VE0A 3C9NA 3QORB 3MLSH 3T0XA 5HD8C 5I1IL 5DMGD 3ZL1A 4XMUA 4PHZA 1CVSC 5DMIH 3E8UL 3O2WL 4OAWB 4TUKH 5E2UL 5I8OH 1PZDA 4KVCH 4PS4L 3RI5F 4PGEB 1A2YA 4C4KT 4ZDHA 5C3TA 2XUWA 2W0KA 5IBLC 2C3XA 4OJEH 1BPLB 4XC1H 4NHCL 3ZL2A 4HZLB 3M7OA 4GAYA 1X7TA 4CMMA 2YGOA 4GXFA 3DIFB 4WNSA 4MCYA 3CBJB 3IFNL 3VXOA 3KPSE 5HHQB 1HINH 2KPNA 2QJDA 4GPVA 5BRQA 4P4KB 1IC5L 1R3KB 4NQCD 1YRKA 1QW8A 5C0DB 2ZUYA 1SEBB 5KSVB 2FB4H 3PPEA 2R0LH 5D8JH 2HFEA 2O61B 1G7LA 3O3DB 4TUJA 4EN3D 2I26N 1KLFB 2XVGA 1H0DB 5ANHA 2XTJD 4HXAH 2JJSC 1FL6B 2AJXL 5DURD 4PJAA 2FO4A 3C5ZC 2P28B 4M6ML 2EIEA 5C08D 1I9JH 3FTXA 3JTTA 1ZGLM 3U7AA 2H3KA 1UC6A 5JTWA 5EU4A 5DZVA 4RBPH 1E9PB 1OSPH 1W16A 3MXWL 3ZIYA 3T65A 1CL7L 2YC1B 2HJKA 1OCOB 2XWBA 1BJ1H 3FHQA 1UT2A 2G0LA 1NAKL 4LLAA 2W38A 1TNNA 3WOVA 3U7YL 4N22A 5T3ZD 1QABA 1SF3A 4OLUH 5C6PB 1BLNA 4TQPA 1LE9A 4MJIE 3AS2A 1RZIB 3QRFM 1KTDB 3U9PL 3QK0A 4P9HC 3Q44A 3U2IA 2VLLA 3QUXB 4FFVD 3X1FA 4DZBA 4GG6A 2EDRA 1JNHA 1L3WA 1YNTB 5DLML 4R90L 2Q7YA 2CSPA 1D5XB 3IMWA 3ZGIA 4I0PC 4WI7A 1SQ2N 2Y69B 3EFFA 3OJDA 1AE6L 4FNTA 1G9NC 4JQVC 3JV6A 1E4KC 4D0CA 1FHNA 3GYRA 1ZK9A 3AWGA 5FLUA 1HQRB 2WLIA 2Q3AA 3QFJA 4FNPA 1CDBA 1LEGB 4PRIB 3RP1A 4QXUL 1HEZA 4RRPA 1QOKA 1MOEA 4J3OH 1H3VA 1MIMH 3DJ9A 2JH2A 3OZLA 2EDWA 2I9LA 4TULH 3HBQA 3FQ1A 4FFWC 2G75A 3MYJA 1KIRA 3WV0A 1OKEA 5HDRA 3LHPH 4Y0GA 4ZS7H 3ZE2B 3EFDH 4PLJD 3WSQL 3FDWA 3OAUH 3QEQA 1QUNA 1KB9J 4BQ9A 4RWYH 3WEMA 2IOOA 2WAQA 2DS4A 1SJVA 4X2UA 3KPRD 2FHFA 4Q9BA 1RFDH 1ZLUK 3SE4C 1LDSA 2VAAB 3PWVB 3PNRB 2UUDK 4R4FL 2D7TL 4HJJH 3VWJB 1T1WB 2N1KA 3ARRA 3DVNA 5GRUL 5KS9A 2J5LB 3GSRB 1ED3B 2OV0A 3NMEA 4OFDA 4DN3H 4HW6A 1BWMA 1CICD 4HKBA 1E8ZA 3SDDA 1BYOA 2BRQA 1WBXB 2GFBB 3V52L 5HPMA 3BT2H 3BAIA 4MNQD 5D1ZD 3PHAA 3HS0C 3WLBA 4EAEA 1G7MB 5ADOL 3WFHA 5ISZA 3UACA 2WZ6A 3H2PA 2X42A 1J0ZA 4WY7H 1XF3A 1FJ1A 1RUKL 4P2RD 2UY7A 3ALWA 1MI5E 4MAYC 3EYQC 5DZPA 3ARDC 2V2TA 1DL7H 2ENQA 1AD0A 5AB0A 5D7LA 4X83A 4CAGA 2HRPL 2J5WA 1WLHA 1EANA 3TT3H 1BXVA 32C2B 4FE9A 3MBWA 4HIPA 4PRPB 5DVMA 5TDPB 2DYPB 3AZUA 5F2FA 5BRZE 5BV7H 4MRCA 1CQYA 4PJXF 4O02L 4ZODA 4E9QA 1TTFA 2XWRA 2Y2TA 5FS5A 1UVQA 3UPAA 2K6ZA 3R0MA 1AHWB 4IGBC 4JVPA 2BY3A 3LPWA 4IKNA 2WUCL 4MNGE 5TGBB 4E9VA 1OPGL 1LO5B 3G5ZB 3NABL 1Q72L 1T89A 3T6ZA 2EZ0D 3LKRA 3OV6A 3PDOA 1BD2D 2EYRA 3CZKA 2CHNA 2RFXA 4PR5A 2FIKA 4D9LH 1DBMH 2V3EA 3PAZA 5EC2B 3VWKD 4YUEL 2VSDA 5CJXC 1CB4A 5F96L 2VDOH 2A5UA 1SVCP 2WVVB 1H19A 1UJ3B 5DRWB 4JFEE 5E6SB 1Z32X 2WIMA 4X98B 1KXTB 3N50A 1JOIA 1LWHA 4ZZFA 1U8MB 3BSGA 3VXUA 4W6XB 2BHZA 4DN4H 2VR8A 4WRLA 3NIGF 3VD0A 2DQHH 2WXKA 4GAGL 2DQMA 3DX7B 4KJYB 5AYUH 2HCZX 3V0FA 1HU8A 2OULB 1A6UH 4JJ5B 2B5IC 3WNLA 1TYRA 2CKBB 1J1PH 4NRZB 5DEFA 2F7PA 2X4TA 1TQCB 5J1TC 2D4FA 5BVJA 2CJTA 2H1PL 1B6DA 3FFDB 1SXBA 4PJGE 4GKOA 2Y24A 4MQ7B 3L7FA 5DRZA 4PJDB 3Q2LA 3VQ1C 3G9AB 3RIKA 4PN6A 3SIKA 1EFXB 2ORBL 3O6FB 2V5MA 4JDTH 1F0LA 2R1YA 4XMKL 3SDYL 4DESA 3CH1A 2QLYA 1NCHA 3KCWA 3K0WA 3QXAB 4P4RA 3W39B 5F88B 3GBEA 1P7QB 3GPEA 3HI1B 5T3XD 5EIVA 3RGHA 5F1OB 4XTRD 4RZKA 4CKVX 4KO6A 2EO9A 5IQOA 3BXNB 5H4ZA 1EZSA 2D3NA 5E1QA 3QNYA 2P42B 3RB7A 5D1XC 3IF1A 5LNEA 3ZDWA 2ITCB 1RK1A 1NSNH 1B0IA 4PRBA 3NCCB 5HYSA 3D50A 4HOZA 3KS0H 4GRLD 2OI9B 1KB5L 1MHPH 5T5FL 4Z3EA 1A3LH 1J18A 1P9MA 1QRNE 4FXKA 3QI9D 1T5XA 1RUQL 2H6PA 1JPSL 3OR7B 1EXHA 3L95A 3FTWA 1JJUA 3LNDA 4HKZB 3QWRA 3CJJA 5FAAA 4X4KA 2EVGA 1QPKA 3SGEI 3J27A 1RZKC 4HMDA 5JPNA 4HUUA 4KJPC 1E8WA 3IS1X 3QCUL 4PTUB 3VG0H 5HGAA 2YS4A 5FYLL 3P0VL 4IDLA 4N8VG 3ZKNC 3V9FA 5IVNA 1ILSA 2XV0A 3R19A 4FERA 5DQDH 3TBWB 2B39A 3WFBL 2CIIB 3QIBC 1E9OA 3N2JA 3QEUA 1NDGA 3HIZA 2P8LA 3K2UH 3O41A 5GGUB 3U9UB 2A9MH 1CE6B 3FB7A 2NXZB 4G71B 4OCYL 5EEXA 2BP0A 5CWSB 1QFUL 2KYIA 2P9RA 2H6UA 4NM8L 1A9BB 2A1WL 3ULVH 4YDJA 2LLNA 2D7PA 2XV2A 2YD7A 1VPOH 3EG9A 3H2QA 4ACTA 1WBYA 1NFDA 5A2LH 3UTSE 3OLDA 4LARL 2AK4E 2V2XA 1GTFA 4LSPH 1UB5B 3QHZH 2CRYA 4Z76B 5J11C 5HYJD 1JHKH 2WZ5A 4JZOB 4KKZA 4J3SA 4H1LH 5IFHH 4BYHA 1A5FL 5DZNA 1W0YT 3CWGA 5JHDD 1LMIA 2DQCL 4XMVA 3PP4L 5KBNC 2BIMA 5EU5B 3P77A 2DWDB 1RJLA 4IDJL 4YHPA 1G7JA 5EZOH 1DJZA 3TZVA 2F54E 1DQQA 1UZ8B 3RVVD 4PGJA 4PWGA 4Y4FA 2OMZA 4BWWA 3REWB 2XQYA 1X4YA 4XXCC 2PCPA 3TFKD 5DDHA 1OAUH 1W72H 4Z3FA 1C8QA 4CA4A 5F7YC 3G7TA 4N0UB 3RWGA 1RJCA 1JD7A 4QRSB 4HIHB 1WQVT 3IAGC 3N85H 3OM3B 5K1NA 4FHKA 3BGAA 1YZZA 3H6AA 4GRWH 4CUCA 3U6RA 5GGQL 3HMXA 4G9FB 2JV6A 4JO2H 4BFIA 2FR4B 2BHUA 5BOZG 4XPAH 3L4TA 3CXHK 3GRBA 2PF6A 3ULVF 5F3BA 3OAWA 2KZBA 2CO4A 1A14H 3PWLB 4NKMB 3O4LB 1BEYL 2ICEC 4M7JH 3GS0A 1EAJA 5J56B 1XMWA 3GBDA 3TH2T 3UEZA 3HVNA 3NFPB 1A4CA 4XNUH 1WT5A 3U82B 5KWYC 1P4BH 4Q4EA 5TE6L 4PP1C 4AC4A 4FTVB 4PLKC 4ZMQA 1FVEB 2VITA 3ZR6A 5DT1H 3PWJA 1R19A 1HI6A 1U8KA 1G7HB 2AEQL 3QGVA 1QSFD 2FH8A 3EYFA 5FYKH 3ZBMA 1G9MC 3PL6B 3OKEB 5KVGE 3BPOB 2PP7A 2D9QB 1QAWA 5I0XA 1WFIA 2BNRE 3UJTH 5L2KD 2VM9A 5CCJA 1CWVA 5JUEH 1BV8A 4FMFA 3FB6A 5JR1L 1U3YA 2N7AA 2BDNL 5HXMA 4NP4H 4DTGL 3HCVB 5KSAB 1S7QB 5D1XD 1T66D 5BPPA 2C3HA 3BIKB 1G5GA 1H8NA 1IQDA 1GCYA 3ASWA 3T5WA 3P9WB 1GGIL 1KY6A 4S1SL 1JI2A 4UAOB 3S36L 5IUCA 1TZIA 5KYXA 3BZEB 3U25A 2OMWB 2WKOA 5F7EL 2WQVA 2OJZH 3LVTA 4H8HA 4JPQA 4R26L 4ZNEE 4MA1B 1BX2A 1UZGA 4IKKA 1DQDH 3DX0A 1NKRA 4KZDH 2BCKB 5EDXA 5LDSA 4QNPE 5L9DH 3LKNB 5I1AA 3CVIL 5FCUH 4Q58C 5C0EB 1Q90A 3FAWA 4LSSH 4DVBB 3HUJA 3ZK0A 3MV9D 3A4EA 3IDMB 1IT9H 2XWEA 3AADB 3K6SA 4G8GB 3MN8A 1CXKA 4IOIA 4O02A 4FA7B 1MDAA 3P30L 1E7UA 2NUPA 4CVXA 1G5AA 3BIAX 4QT5B 1FSKC 4K7FA 5KVGL 4ONHA 2J8UE 4B9ZA 5JLZA 2H3XC 4CNIB 2MMXA 3JV4B 4LAJH 1FFPA 1SMDA 1FNHA 3L9BA 2K8QA 5ABAA 2VXQH 2ZONA 2BP3A 3OLEA 4APQB 2GBVA 4GQRA 43C9A 4FKEA 2QQLH 1CFTB 3ZE1B 5IEHB 2IQ9H 1FHGA 1XHHA 4LNRA 3UAFA 3GDBA 3NCWA 1NWPA 1GSKA 5E2JA 1WD8A 2ENPA 3C5JB 2X12A 3B2UC 4Y89A 1AQDA 2NX5D 2XFGB 3TJEL 1AQHA 2BRRL 3ARFA 3KWTA 3DTDA 2AZUA 3U1SH 4G1MB 1WZAA 1KN4L 1FNSL 5FM5M 4ISVA 4EDXA 1H8OA 5CU5A 3QZOA 4IU2A 3NG5A 3NSDA 1QLFA 1E6OL 2QELA 3PIQA 1MAML 3QWQB 3A6BH 3NRFA 2GBUA 5I1GL 1X3DA 3C6SA 1KBGH 1NM9A 1QZNA 2GJZB 4KWUA 1U36A 2FTAA 1MJJB 1TVBA 4NCDA 1RPKA 3GMPA 1G9HA 3IE4A 5ACZA 3S3DB 4PJHA 1LP9B 4LNVA 2YXMA 2ED9A 5BS0D 1XZWA 3VFTB 1FFNB 2JSFA 1X7QA 1IGTB 5I16A 5I1LB 4DGIL 4IJ3B 1OT4A 3S34H 1RMFL 2HN7B 2BLFA 3DRQB 2GEEA 5DUMH 4OCRL 4G1EA 1IM9B 3GI9H 4HPOH 4MNGA 5LBSL 4M7LT 4BEIA 2ZXAA 3UIZA 1RKRA 1URLA 2CBPA 2YPLB 4ERSL 3F5WA 2FGZA 3GINA 3FQTA 3EOYG 1HDMB 1U4EA 2O93L 1CU4H 1F42A 3D4CA 3B9KA 3HB3B 1UWEL 5IHUH 1UXWA 4WVRA 3QNZA 1M1XA 3UPCA 4NXSA 3QYMA 4S2SA 4LL9A 4LVNC 3AXHA 4XP1L 1ZLWK 1CE1L 4WEUD 4IRJB 3LJ3A 1UKTA 2WCSA 2P1YA 2MIZA 5HHVH 4BUHA 3KLAB 4Z7AA 1QSZA 2F8IA 2NY5L 4NOFA 1J8HA 5T5FA 4AQ1C 2E7MA 2E7BA 1MCLA 4B9JA 4HHWA 4K5LA 3OQRA 4HWEL 3INOA 5TFSH 5CCKL 1CYXA 2PCYA 1OD9A 3VSVA 4L48A 2VDQB 4TQEL 1Y6NR 4BBWA 4WHDA 4GUQA 1PX8A 3ME0A 1M6OA 2UX7A 4FQIL 1YJDH 1CC3A 5B3SB 3RHWF 4ZD3L 3CCHB 1IU1A 4XI5C 4UTCA 1TEGA 1RLWA 4UINL 1BSIA 4I13B 1OF0A 2P24B 2OSXA 4L29B 1PY0A 1UM5L 1OAZL 3K80A 3ZKMC 2DPKA 3FQXB 1IARB 3N6YA 5AVTB 4PRIE 3RPIA 3TCTA 2NY3B 1XIWA 5D6DA 2HT2C 2NTFB 1RU9H 1J05A 4L4VB 4U6YB 3GSNH 5AW7B 5C3LD 4TRPL 3TNNA 2FVNA 4KDTA 1P6FA 3ZE2E 2WZAA 2Z91B 3L3GA 1F3RB 3TJHC 3D3VB 3NPSC 1G9EA 3PHQB 2DDQL 4J3BA 1TVDA 2B14A 2HP4A 1MWAA 3W9DB 2L3BA 2WN2A 3NH7H 4M6AA 4TNEA 1BW8A 4YDKH 5I15H 5MENB 1QFPA 5GSVA 1JZ3A 5EF1A 4U7SA 3TIEA 1MLBA 5ID0A 5I1KL 2F7OA 3UBFA 3ETBJ 3MRDB 3HPJA 3QJUB 2H32B 2X1PA 4HUWA 1AYRA 3MBED 3BC9A 4LOFA 4KXZH 4MASA 2CHZA 2TAAA 1MVUA 4F9LA 4U1MB 3SY0B 3KBPA 1AZNA 2C9XA 2ZSVA 1ZVSB 3SPVB 4QNPF 5HHOE 5DD1H 5INCB 2D73A 1MNUH 4TVPE 5E4EC 5IVZA 4PCTA 1CMOA 5DHYB 1BECA 3A3YB 3KXFD 5SX4I 1OP4A 1VA9A 3D85B 4OKVB 1S7TB 4Y4HC 3TWCL 5EF2A 4PWHA 3AM8A 3NSFA 4PRPE 1Z9OA 4WGKA 1RZGB 4AQ8C 2FJFA 4ZAKA 2PW2A 4IHBA 4BCYA 4PJFA 4NM4H 3QQNA 3VGFA 5DD3L 3CN0A 1T21B 2CDGA 3VJ6A 1JVOA 2Z4QB 5GRVL 5E8DL 1FL5B 2GYSA 2X53A 3KYNA 1QKZL 3EHBD 2J8UF 1KCUL 3VFNB 1F4XH 1XAKA 1L0QA 3ZTNH 4GEIA 1NC2D 5EEUA 5AB2A 2DQJH 3WE6A 1GHFL 1QFOA 2F5BL 3FCTA 1JGUH 4JREC 1OM3H 2EC9U 3PY9A 3Q2CA 1FYTD 4KROB 5A3ID 4O4YH 3MNZA 3BUPA 3HI5L 4GUPA 3QJOA 3JWDC 3GGWB 1R5IA 4Y88A 3S4SB 5E6ID 5EBMA 4HX1B 1JE6A 3QIWD 2OTPA 2UZPA 3TPUB 3ULUE 2PXYD 4IIQB 2P5ED 2G30A 1OE3A 3EYVA 2O6CA 5D9SB 3RL1A 3FUDA 1HHIA 1BHGA 1WFOA 4EI0A 1NQBA 1FZMB 1XZ0A 3LTVA 3HHRB 3II2A 3TOPA 2DQEH 2ZUTA 4A2DA 3C60B 2XN9D 4TVPL 1OQOA 4FYSA 3N04A 1CLCA 5ID1A 2Y9RT 3F00A 1MFVA 2XWTB 1ZTXH 4G82A 1H9DA 2ZTBA 1RSYA 4JHWH 1KG0A 1QZ1A 4F9PC 3ZQWA 4GY4A 4OTXH 3DHPA 3U1QA 1BZ7B 4G6AD 1U58B 1HHKB 2MJWA 3RGVB 1AGBA 2P8MB 4LLDA 2QMKA 2IAMC 5SX5K 2J1ZA 5ESQB 5GS1A 3VMOA 4NNYB 4LSUL 4JZNB 4K5PA 2G60L 2APWA 3ARGB 3PUCA 4HKXB 1Z9MA 4PJDE 1D7BA 3E2HB 3WKMH 1MG3C 3RTQB 3UMNA 3ZKMD 2XZAL 2IH1A 2GKIA 1MCWM 4Y2OB 1DFXA 3D39D 4U2ZA 4WDIB 2G4GA 1BEXA 4LVOB 1IGFH 4C59B 3V10A 5BXFB 5IVXA 4FXLA 4MQXC 2K70A 4DH2A 2DJSA 3LMJH 5JORB 2J88L 1FIGL 2YWZA 3FQRB 1RJYA 1O6VA 4K8RL 4M1DL 4WJ5A 4DPRA 4OD2B 4PJBB 5IEKB 1KJVB 4LPVA 4ZG1A 4HS8L 2WMPA 3V0GA 3ULUL 3MCKB 1NIDA 3FQYA 3HAEA 1U92B 4L9LC 1QSEB 1B0WA 4XB7A 3SBRA 4HOWA 2BMKA 1ILUA 5E56A 4ODXA 5I8CB 5JYLA 4K3GA 4JVUA 4MJ4A 2VDKH 4JFFB 2QVMA 1KJMA 5HSFA 1JYVA 1WAEA 1H6EA 1F4YL 1JF1B 3ARUA 5DYOB 2F2HA 4LHUB 5DI8B 4B97A 3EUUA 3NUKA 3IDJA 4XX1E 2J2ZB 3MNWA 4YIQA 4E0RA 1MLCB 1KEGL 2E74C 4QHNA 4TSAH 2FX8H 1IKOP 4FX5A 3HC2A 2CKBL 3ELAT 1XR9A 3FF7A 4JY5H 3OX8B 2BP5M 4F2MB 2FEDC 2IMMA 4M4RB 2E6QA 2F53A 3GSUB 1FE8L 1MXGA 3SBWA 1FIEA 2HFTA 2X5PA 4YK4C 4UIMB 2EACA 1YG9A 3ZXAC 3W1ZA 4DKFH 1P7BA 3HBGA 3ZKSD 5D7JC 5ESAA 4X7SL 5EWIL 5FXCH 3RWIA 3APFA 1QR1B 2WHVA 5GS2H 2B20A 3MJ7A 1ZANH 4MKTA 5D2NC 3HE6D 2Q3ZA 3IPFA 5C0FB 1I9RL 1ES0A 3D06A 2KUTA 4YEFA 3TYGL 3A6CL 1PU0A 3UX9B 5FHAL 5CN3A 1L7IL 5EZIH 2WCGA 3O6ML 1MJ8H 2AQTA 3QCTL 1MCHA 1XGQA 3NACH 5AW6B 4O9HH 1HHJA 2X6CA 5F7DA 2PR4L 1PY4A 4M7ZB 2HT3C 2YMTA 3TJPA 3SGJC 4JFOA 2ED8A 3IMRA 3DIDA 1ZJAA 3QORA 5IOPB 3X12B 2WBJA 1HX0A 1NANI 4MD0B 4G7SB 4JDZB 3TBSA 3O9WB 5AZEL 4Y16A 3DIVA 3MOAH 2BNQB 2Q7AA 4I4WA 5D7SL 5C0RH 1ZGLA 3AQDA 3L3DA 2C7UA 4NNPH 2WPGA 4N0UE 4A6YL 1CI3M 4LBEA 1P2CA 4DSYA 1KWGA 1WZ1H 1A7NH 4YVUA 1CFQA 5JIDA 1OGTB 5KVDE 5CJ8A 4NDMA 4G9FE 3FTUA 3OHXC 2VXSL 3MA9H 4K15A 3SKOA 1N5YH 1A4JB 4GAFB 1OAKL 3U7WH 1YEJL 1XGZA 2EQDA 2IO5A 4WZ9A 3TN0A 1SEBA 3O2DH 3L3KA 4D8PA 3CFEB 4AZ8B 4F15B 1A7BA 3QR0A 5ICXB 4FAAB 3FQ4A 1J0IA 3IFLH 3O4LE 2WO4A 2O61A 1JPTL 1SYVA 3F12B 3O3DA 4U33A 5JXEC 4K4KA 4L1HA 3SDAB 5KN5B 4OCXL 4LLMA 2ZXEB 2WQSA 2EH7L 3EO0B 5I8KL 1DLFH 3B8YA 4FTVE 4FQXB 1J48A 2X0VA 1E4WH 4G9DB 4FKHA 3UYPA 5J0BA 3HHSB 1A3QA 1S3RA 4PJ9D 3LNGA 4PBWD 2OZ4L 3LNHA 4P5RA 1DVFA 3LRKA 4D9QE 1U91A 3KBHE 5CCHE 4HT1H 1AG0A 4DUWA 3QUGA 4G6FD 3MRHB 3RJOA 5HI3D 1T6BX 2O5ZL 2AEOA 3ARBC 3M1CA 4BQ6A 4YXKH 4KKPA 5FA4A 3VI4A 2EDTA 1PLGL 4JG0H 2ICWB 2P80D 4JFWA 4RH4A 4ALAC 1Z5HA 1AGEA 4GI9A 5ERWA 4NKOB 1U3NA 4QWWD 3FFCD 5IB2A 3TXAA 4DGWC 1AZRA 3BDXA 2P26A 2CDFB 2YBRB 4XPTH 3TO4A 4WUUA 3VSUA 3CHOA 3MRIB 1XBDA 4N5UA 4U1GC 1WGOA 2E7LA 4PJDF 4BK8A 1AKJB 2Z6FA 2M26A 1H3TA 2K6WA 1U8QB 4G7VL 4H8PA 5LQBL 4TSCH 3IDYC 1ZT7B 3CN3A 4G8GE 2R2EB 2VQUA 4V1DB 1AI1L 4L1SA 7FABL 4HA1A 5T1KB 2GJ6D 4J39A 1BQHA 3G6AA 5D7JD 4YJZL 1YEEH 3COOA 1YNLL 4QOKD 3S5LB 5JNYB 5AW5B 3O3UN 5I74C 3H6JA