4J42A

The crystal structure of a secreted protein esxb (mutant y65f) from bacillus anthracis str. sterne
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
80
structure length
80
Chain Sequence
KITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQFIPILEGISTDLKRIADKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a secreted protein EsxB (Mutant Y65F) from Bacillus anthracis str. Sterne
rcsb
molecule keywords secreted protein EsxB
molecule tags Unknown function
source organism Bacillus anthracis
total genus 32
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j42A00
4W4KA 4J10A 2G38A 4J11A 4J41A 4J7JA 4W4LA 4IYHA 3FX7A 4IYIA 4J7KA 4J42A 2GTSA 4KXRA
chains in the Genus database with same CATH superfamily
5KMGA 4NB5A 3RYCB 5L3BA 2WSSG 4OXSA 4EB6B 1XQ8A 1OCCC 4FZ0A 4DRXA 5GTHZ 5A9GA 1FJGB 4K0KO 3CS5A 2KSDA 2GDSA 3THOA 3DXRB 3JAKB 2P90A 1WLEA 4YJ2A 3L75H 2VQFB 3E8FA 3P3NA 2A7WA 1BT8A 3BA8A 1XL4A 1WPBA 5CA0A 1FYJA 1P84F 2RCVA 2YEVB 1K5QA 3H1HH 3JARA 4LF6B 2EILC 2JK5C 5KHKA 2X6BA 4LFAO 2QWOB 2F1MA 1XREA 4JI8O 2LFRA 2P06A 1N32B 4X89A 1NKDA 2NNUA 1GN3A 1JJOA 4B08A 3JSNA 3AG3C 2JJ1G 2QGNA 2YXLA 2P67A 4U3JB 2F4VO 4LF9O 4GKJB 3QG5A 2WLKA 5J2TB 1Y76A 2YIBA 3LDCA 4DR1B 4D7SA 3OGCC 2JIZG 2OIEA 2UUCO 1TVKB 3LSSA 4NTWA 4LP8A 3SR2C 1PKXA 1W0KG 3RVYA 3RYFA 3AK3A 5L3DA 1VIBA 3KG2A 2ZDIA 2Y0PA 1TAEA 4DR2O 3CRQA 3C3TA 1J5EB 2DQ3A 2Q69A 2WPDG 3K57A 3JD3A 4WBNA 3OTOB 4G2KA 4QPKA 3CEIA 4KFMA 1IBLB 1YTFB 2RDCA 4MTFA 1LNQA 4UCUA 3SPGA 5KHHA 1VQ6V 1SQGA 1IBMB 2IH3C 4X64B 2Q8VA 3BHPA 4O4JB 4UCTA 2EIKC 2ZM6B 3T2MA 1QLEB 4LNUB 1IX9A 3FKSG 3S3XA 2JS5A 1S5JA 1FJGO 1SRYA 3H1JH 4X1IA 2QA4V 3ZHRA 3VQVA 1SQXH 4FPPA 5JVDA 3FB8C 3ETQA 3ZMSA 2VQFO 3RYHA 4LFCB 2QDOA 3LSQA 1SS3A 3OFNG 2XUMA 4IIJA 2V7QG 3G6BA 4LBEC 1NZ6A 1JX9A 4LH6A 1PPJH 2CH7A 1KQSU 3HPLC 5LP6C 4LF6O 1O9GA 4UVBA 3STZC 1VQ4V 3JCUZ 2HKOA 1N32O 3T4DA 3H1IH 2ZIOA 3WG7C 1AROP 1YITV 2IJIA 3L9DA 1VF6C 4O2AB 2AHZA 4HNAA 3FAVA 5B5EZ 2ZNJA 2OCHA 4GKJO 3ABMB 3A0RA 3ML0A 4DR1O 2WLLB 3VOUA 1AJPA 2B1IA 4JZ2A 2XT9A 3QO5A 4PHZA 3H01A 1I0HA 1EZVH 5KX5A 1PL0A 4PD4F 2L35A 4B7KA 2ITCC 1PD3A 1J5EO 4DV7B 2OYQA 4BR6A 3OTOO 1YF2A 2QWQB 2YUAA 1IBLO 2W0FC 4DK1A 4YIPA 2X6CA 5KHIA 3C90A 3ETEA 4J41A 5IJ9B 3AG4C 3CJHA 3OAAG 1IBMO 5EZYA 2JEXA 2A0LA 4X64O 1EBOA 4ZIBA 1P4RA 4X20B 4DV3B 1SQVH 4KUMA 1TUBB 2ZM6O 1R6TA 4FLWA 4XDKA 2PI4A 4DV1B 2ZCEA 5L3EA 2QM8A 4AI8A 2FKXA 3CSXA 2PF4E 5EBLC 1PNMA 4RQEA 3DTUB 4X1KB 5JQGA 1L0LH 1RFYA 2DYSC 1FFXA 3R65A 2EULA 2Y69B 3WB0A 4LFCO 1F4MA 3SJCC 1H2SB 1WA8B 1K8AW 4YJ3B 4TQFA 1Y6XA 4RUEA 3ZX6A 5BMVB 3CC7V 5DECA 1HNZB 2ZKOA 3MDSA 4ABMA 2HR3A 1KD1W 3GWKC 4JTCB 1ZSPA 2Q5ZA 2DYRB 2E74B 1HNXB 4JAVA 1XOUA 1OZ0A 4AQYB 3J81N 4TT3G 3T1YB 1V9PA 1IURA 2D2CB 3K9AA 1VEWA 2IJKA 1NS1A 5KUKA 4LC1A 4PDVA 4IHJA 4Q20A 5B3SB 3H1LH 1P49A 2P7TC 3CD6V 3OEEG 5GW7A 1AILA 5KHJA 4B7EA 2DE0X 2Q73A 3UCSC 2X0LA 1K3EA 4JPRA 1RSOB 1HR0B 1CXZB 2UXXA 1D2DA 3APOA 1K92A 1OCRC 2WA3A 1YTFD 4MTGA 2ZE7A 3JYCA 3GB7C 2IJHA 4DV7O 4NTXA 1ZL8A 1V55B 4RUFA 2HFEC 5IJ0B 3E8HA 3A0BZ 3QVNA 1QLNA 3HKEB 2GUZB 3JD1A 2LP7A 1GM9A 3ABKB 2CAZC 1GK9A 4DV3O 3SPHA 2QWRB 2ZR3A 3ZIAG 4JGSA 1US6A 2QKAA 5L3FA 4DV1O 3K04A 2EIMB 4JZGA 4O4IB 5F2VO 5K1XA 1YZBA 4BIOA 1AR4A 1K7DA 4I0XA 4GCZA 3TK1A 4IT5A 2FYUH 2Q7EA 4X9QA 1K33A 1RPRA 4WFEA 1HNZO 1R1BA 3T4ZA 4PELA 5IYCO 1HNXO 1R73A 4I55A 1KBHA 4AQYO 3OUSA 1BGYH 2LFSA 4K8XA 5KA5A 2PYJA 3T1YO 1Q82W 2ZR2A 3K0DA 4BW5A 5KAFZ 3G71V 5EBMC 3ABLC 1QR8A 1I94B 5LA6A 4YIOA 1QHTA 1DK1A 1JMKC 4MW3A 4TUYB 4DUZB 1HR0O 4JI4O 1Y67A 2A9HA 3K5NA 3SGIA 3U10A 1W2BU 3AG2B 1R3JC 1IBKB 3JD2A 3TGUH 4PI2A 1BS3A 2JGDB 1SA0A 5KMGB 3NR7A 4YY3B 1JR9A 5AG2A 2NN4A 1KKDA 3W7WA 4FLXA 3AG1B 1MZEA 2EIJB 4H37A 4W4KA 4DRXB 1JOYA 1IVSA 2BTQA 2W6IG 2B1GA 1FPOA 4JTAB 4FLYA 5EC1C 2H94A 3A0HZ 4J80A 4YJ2B 3CC2V 5LP6A 1JQ0A 1F23A 2EJRA 5H9CA 3D3IA 1WNSA 3WB1A 1HP8A 5CA0B 2YC0A 4KP4A 3OR7C 1THZA 3T1CA 1M5IA 2R72A 3ASNC 2ZT9B 1VF6A 3JARB 1K4DC 4LH7A 1XHZA 2Q6AA 1VQ8V 2A3QA 3IGAC 1B6QA 4I9QA 1VQNV 4LFBB 2Q0OC 2W0XA 4QE7A 4MTXA 2WLIB 1Y76B 3K79A 3E89A 4ZHQB 3UQ8A 3OM3B 5L3CA 3ZMUA 1Q3EA 4JI1B 1Q86W 1YCIA 2EINB 1QQCA 3W7UA 1NR1A 4ZI7B 5J2UB 2VWKA 3T1HB 1HW7A 2CE4A 4B3TB 1I94O 3P30A 4QE9A 5LHGA 5FLXN 1GN6A 4DUZO 4TV9B 3CMEV 4GKKB 2UUAB 3ETGA 4UCOA 4CS3A 4CH3A 5EK0A 5JH7B 1P7GA 2AHYA 1P7BA 1IBKO 1KUQA 4QGPA 2ADPA 4OX9B 4B3MB 4MVSA 3RYIA 4FM2A 5KLVH 2JS3A 4YY3O 3BPZA 2GHYA 5EYPA 3N2GA 3AK1A 1W0JG 4X1IB 1FAFA 1QVGU 1XDCA 4FFBA 1N34B 3CX5F 5H2FZ 1M90W 1LUVA 1FKAO 2LQTA 5JVDB 5IE9A 4GX5A 1LR1A 4F6EA 1GTOA 1Q7YW 4LF5B 1E79G 2XHBA 3RYHB 2Y4UA 2DJVA 4PJ0Z 3G67A 2OT5A 3SYAA 5D5QA 4LF8B 4IIJB 2Q68A 3FD9A 4BIZA 4JV5B 2CH7B 4CZZA 4FVMA 2NR5A 1PNLA 4BIUA 5LMUB 4DK0A 2L6LA 3M7MX 1SQPH 2RN9A 4F6RB 4LFBO 2E5LB 4FLUA 2CGOA 5LGTA 3MHSC 1KB9F 4HNAB 4MVRA 3ZRVA 1I5XA 3N27A 3F5WC 2QM7A 3HKBA 1M57B 3SYPA 4UB8Z 1PL4A 2H8PC 1NI8A 2JJ2G 2AZ0A 4DV5B 2HP8A 3CXHF 3FYIB 5EIBD 1FXHA 4P9OA 3VQYA 3ABMC 3CWBH 3J80N 1EN5A 5KX5B 3K06A 2HEPA 4JI1O 5B1AB 2GBOA 5B1BC 1S3JA 1NR7A 2R9AA 2WA4A 4ASUG 1UJWB 3T1HO 4B3TO 5LYJA 4XBFA 3OW2U 4GKKO 2UUAO 1V54B 3CJHB 3BFRA 2Z5UA 3JAMN 4P30A 3X2QB 2ZIMA 3CP1A 5EZYB 4OX9O 1WP8A 4B3MO 1MZFA 2HVJC 5FNVA 1OHHG 1XMQB 5C8YB 4J7KA 2Z3YA 1SETA 4K8ZA 3L73H 3ASOC 1GH6A 4TV8A 5IY5B 3H9VA 2UU9B 4JI3B 3DC6A 1GM7A 3ICXA 4B3SB 1N34O 4U7OA 3D36A 3K5LA 3CCLV 4YHHB 2IM9A 5JQGB 1VQ9V 3PJSK 2XOKG 1K9MW 4JI0B 4LF5O 1FFXB 2IH1C 2MW2B 4EFEA 4EEQA 4JI2B 1I08A 3L74H 3I5DA 4LF8O 4X1YB 4MT8A 2Y69C 2ZXWB 4JV5O 5LMUO 2YICA 3B8MA 4QJFB 1IZ3A 3UKMA 4PA3A 2BSKA 2Q7GA 1YXBA 1NTZH 2F66C 3VBBA 4RWUA 3OT7A 1X59A 2E5LO 2YIDA 1XL6A 4JI6B 3HKCA 5IYDO 5LBQA 1BQZA 2WLNA 1BL8A 1GN2A 4IHJB 1VF7A 3JSLA 2LGQA 3M8AA 3RVZA 4LCUC 4HYOA 4DV5O 2P22C 3OMAB 4QNHB 1M56B 3LDDA 5H6QA 4RO2A 2JDIG 1Q43A 2RJZA 3RYCA 1OCCB 2KKWA 3K9SA 4DV0B 4EB6A 3K5OA 4FK5C 4CH6A 3CPWU 1ZL8B 4JASA 4ZOLB 4I7ZB 2DWEC 4ICGA 4I4TA 4UCVA 1OJHA 1FD9A 2CK3G 3JAKA 1B3QA 1AVMA 3ABUA 2FL4A 4EFBA 2HVKC 2IU0A 1I5YA 3E8BA 2OTJV 2ZINA 2VQEB 1XMQO 1G6UA 2EILB 3CCVV 2IJJA 5BXZA 5ITZA 4J11A 1S76D 1H2NA 2UU9O 5DEDA 4DV2B 1NQTA 1HNWB 4JI3O 4B3SO 2PGGA 2N05A 1AI7A 4YHHO 2EX3A 3DC5A 2Z0AA 4JI0O 1RM1B 3ZHVA 3CYOA 3ZJZA 4PDLA 4JI2O 2UXCB 4JF3A 3UM7A 5J2TA 4LF7B 1M1KW 4J9ZB 2A79B 1XBLA 1AJQA 4PI0A 2RMKB 1TVKA 4UV8A 1OCOB 3AEIA 2EJ7A 2D3OW 4KHPB 3VQXA 2FMLA 3EXAA 4J7ZA 3ZMVA 4RQFA 1Y74A 2EZOA 4JYCA 3SDLA 3E22A 3SJAC 4JI6O 1PV0A 2HG5C 2LW1A 4CC6A 3ZS8C 2KG7B 3IJ4A 5LA6B 3F7YC 2ZE6A 3ZBHA 2XAHA 2UXNA 4GT1A 2EIKB 1GAXA 1B04A 2GTSA 4DR6B 4DV0O 1JVMA 4PA6A 1EFRG 1SA0B 4XDJA 4X65B 3SPIA 1M93A 4K35A 3P32A 1YJNV 4A5UB 4DO2A 4JI4B 2BE3A 2BTQB 3OTFA 2F23A 2OIGA 4RAIA 4MVZA 1Y4MA 2DW4A 2VQEO 3CC4V 3CCMV 5FPOA 4D7TA 3B09A 1XNQB 3ZHQA 4DV2O 5B1NA 1HNWO 3APQA 1YHQV 2IBZH 3WG7B 2GV9A 3E2EA 2UXDB 2B9ZA 4H13B 1L1FA 1GN4A 1NBMG 3EVKA 2ILMA 4TOIA 2PZSA 3W7SA 4P2ZA 3K59A 2ARHA 4U3FH 4JAAA 2WLHA 4O2AA 2PYLA 1QBZA 1M4UA 4L87A 2UXCO 3DSQA 3RW0A 4LF7O 5K1PA 1F7YA 4UXNA 2WLLA 2YIAA 4X88A 1AP5A 1Q6HA 1ZLZA 1O9HA 1R3KC 1WPXA 5H5NA 4GYCB 3JATB 1G8MA 4KHPO 1JA8A 1YJWV 2HLDG 2AZ2A 3UT5A 1G4YB 3P3PA 2Q67A 1FXKC 3AK2A 1PP9H 3I56V 1K34A 3AG4B 1KP2A 4GX2A 2E75B 1HDJA 3STLC 2ETNA 4FJCC 3CE2A 1OCZB 3CCJV 4JI7B 1YI2V 1XHXA 3LUTB 4MSWC 3RWRD 4O2BA 5LGUA 4EKWA 3DGEA 3F7VC 2BCCH 3KCYA 3LSUA 4UV9A 4DR6O 4G28B 2CTQA 1ZUQA 1X4TA 4X65O 1A32A 3BA9A 1BE3H 2DYSB 3N2GB 2YI9A 1FS0G 4CC5A 3A8TA 1QU7A 4PA4A 4FFBB 4X62B 5IYBO 1CEZA 5BMVA 5CB4A 5GONA 4WFFA 1N4CA 1XNQO 2LJ2A 3RFRA 4R50A 1EM1A 3QO7A 1KKCA 1Z5VA 2F93B 1PM9A 3BABA 2ITDC 2UXDO 5H6RA 3JALA 4NXNB 5CBHA 3FB5C 1CPYA 3CMAV 4NKGB 4Z1MG 1JFFA 3SPCA 5JJEB 1KP3A 4N21A 4FM0A 3OGIB 4UCRA 5HFMA 3BRCA 2QM4A 3E86A 4LWSA 3IC9A 1GKFA 3UO2A 2DOSA 3OD4A 3SYCA 3D3QA 2QWNB 3CCEV 1M9NA 4NXMB 4FIPC 3ZRWA 2JGUA 1ZX3A 4IL6Z 4C7UA 4PA9A 3OMIB 3TXQA 3MHHC 5B1AC 4PA7A 4JI7O 5LYJB 1L8DA 3B2EE 1ZAUA 3HKEA 4DR3B 4XDLA 3N2KA 1E1QG 1LUWA 2PUSA 2R70A 4HAMA 4LR3A 4WCEV 1IXBA 5LOVA 3RYFB 1V54C 4H33A 3OR6C 4R7CA 1MSDA 3X2QC 1ZWIC 3OUFA 1XMOB 1AI4A 1BZKA 2KB1A 4DR4B 4WBNB 2ZNIA 5FL7G 1QVFU 4TV8B 1N8RW 4E4EA 1DF5A 3G4SV 5TISZ 3BCCH 2Q0AA 4MS2A 2CTRA 4X62O 4X66B 5JJNB 2X7RB 4O4LA 3JASA 5LHHA 1K5SA 5B1OA 3ZHUA 5E1AC 1QCEA 5LGNA 2Y0IA 4QIWF 1TUEB 5LHIA 1H38A 1AI6A 2HJDA 5IT9N 3O65A 4NXNO 2BSKB 5EBWC 1QLEC 1TGOA 2CDYA 5CA1A 1EN4A 2RQ6A 3ABLB 1H8EG 4WFAV 1VQPV 3TXSA 3O9OA 1XI1A 2ZE8A 4TUYA 4UB6Z 4FFKA 1Q81W 2RNBA 1B06A 2XAFA 3LNMB 4O4HA 1QR9A 5IYZA 4DV6B 5IWAB 2YDEA 3K08A 2IW5A 5LXTA 5L3GA 4NXMO 2E3CA 4UVAA 2JGDA 1ENVA 2HJFC 1RPOA 2Q7HA 1Q5OA 1R3LC 1M56C 3ZMTA 1NVPB 4K3AA 3IC7A 1NU1H 5LL6Y 3FAVB 1U96A 4DR3O 4HZ3A 4I4TB 5FPRA 2PI5A 2WAMA 4NVPA 4B3RB 5B66Z 1BSMA 5JCOC 4I50A 1MG1A 3G6EV 2DMXA 4DYLA 3B8NA 2B5UA 3ASNB 4PDMA 1XMOO 3K5MA 3CRMA 4DR4O 2DN9A 5ITZB 3JAWA 1SERA 1GRJA 3K0GA 3L71H 1VQKV 1UPGA 4I9WA 3ZHTA 4GX1A 2QTOA 1WJZA 1W59A 1AJNA 2N04A 4IYHA 2W6JG 4Z1VA 2BOCC 4X66O 4CH5A 1K4CC 2AXTZ 1FXVA 1K73W 4OPAA 3U0ZA 2BOBC 3EFFK 1RM1C 4FZ1A 2WLIA 2ZQMA 1FXKA 2XASA 4ZHQA 2XAJA 3F5TA 4L8JA 1EN6A 4J42A 3E8GA 1TA8A 1MABG 3JD0A 2QJ1A 1UFIA 2NLJC 1Y74B 3ZRSA 2N74A 1KYOF 4ZI7A 1OCOC 5J2UA 3E22B 4N23A 4JYYA 3Q4HA 4DXWA 4OGQB 3TCUA 1XEQA 3B40A 4TV9A 3CRRA 2ZE5A 1SQFA 1SZTA 4DV6O 5IWAO 5JH7A 4CBCA 2XAGA 1QNMA 1FFTB 1AR5A 2VRZA 3L72H 2DYRC 2QKCA 1NT2B 3SYQA 1AR1B 4JI5B 3BEHA 3ZN0A 2X6AA 2YIBD 3FX7A 1R6NA 3KKYA 2ADQB 2DQ0A 5J9PC 3HKDA 1COWG 3FB7C 4LF4B 5DM6V 1DTOA 1OV9A 2OCCB 1GMGA 5B3SC 4B3RO 4CS4A 3IFXA 4MVQA 3OMNB 3CCQV 2PTMA 5GTIZ 3R66A 1Q6IA 5EC2C 1KC8W 2ATKC 4JYBA 1SF9A 2CGNA 1N0NA 4G27B 4YXWG 4DR5B 2HHHB 3WU2Z 3B4SA 4NYKA 1H2LA 1ROPA 1V55C 3DXRA 3I55V 4F6RA 4CS2A 2UUBB 1VQ7V 3E83A 1XNRB 3HR0A 1MMMA 4DW0A 2ZD9A 3CRAA 4MW8A 4FLVA 3E35A 1WP7A 3ABKC 5LMNB 2P6JA 2M7WA 2YEVA 5B1BB 5IDJA 2R9IA 1YJ9V 2YSUB 2R9RB 5CA3A 4IGGA 4NR1A 3AG3B 1MOFA 3UT5B 3CXCU 2EIMC 1S0VA 5KUMA 2V1DA 4I0XB 2EZPA 4ZBMA 4UFZA 4WFGA 4U3JA 2BTOA 1Y66A 1PNKA 4PDRA 5HFLA 1DLBA 3CCRV 1OCZC 1NVPD 4O2BB 4F4LA 2KQXA 3QNEA 4I55B 2VWJA 3VQWA 3ASOB 1WAZA 1GM8A 5C8YA 3B77A 1EZJA 4IYIA 4JI5O 3LDEA 3W7TA 2K9PA 4UCSA 2Q4PA 4H44B 5E79Z 1DF4A 4LF4O 3NXSA 1URFA 5EIBC 1L0NH 3BY6A 2FTKA 1VF5B 2JEUA 2WLMA 4O4JA 1Q6UA 2G38A 4FLTA 3AG7A 4X1YA 4JTDB 5CB4B 5GONB 1K97A 2JVDA 1JCHA 4LNUA 3ZN1A 2C2AA 3AG2C 3HB3B 1SZXA 3TETA 4DR5O 2HHHO 3BAAA 3IAYA 2UUBO 3JALB 1BQ0A 4D6TH 4JAUA 3AG1C 5CMUA 5CBGA 4GLXA 2JRIA 3RT3C 1XNRO 1IDSA 3ZRXA 2EIJC 1S72V 4UVCA 2QSAA 1JFFB 4CH4A 5LP6B 4WF9V 1Z2GA 3QTCA 4U7NA 5LMNO 3PN1A 1RP3B 4JYAB 3RN4A 2O57A 2P5OA 2UXBB 3W7XA 1F4NA 4LWSB 4MVMA 2LO1A 5CBFA 2EBOA 1R6KA 3QO8A 4DW1A 2GTAA 1S5HC 3ZRWB 4GX0A 3CHXA 2PY5A 4ZOLA 2CUGA 5JCOA 3JD4A 3LNNA 1NH2B 4MVOA 3SYOA 4TSFG 1T5EA 2VS0A 3K03A 1WN7A 3N2KB 4GUNA 3CB2A 2DWDC 3CCSV 4MVUA 4FM1A 1H2MA 1AP6A 3OE7G 5LOVB 1N36B 5C93A 4UUJC 2XAQA 2EINC 5IJ9A 3L70H 1VMGA 2ZDIC 5BZBA 1KECA 1HWYA 1YEWA 1JPXA 1MA1A 1Z5WA 5A2QN 2QE7G 4X20A 4AILC 4MTOA 4O4LB 1D5AA 1TUBA 3JASB 1SQQH 4DR7B 3D36C 3D8CA 1SQBH 3RYIB 1H2GA 3J7AU 4DUYB 3G80A 2ODMA 2YI8A 3TJTA 4AHCA 1WB7A 2CTPA 1ORQC 4R8CA 3ZMZA 4TWKA 5EYPB 1S77D 1N33B 4X1KA 2P4VA 2AW9A 1XUQA 2Y48A 3MD0A 1MSWD 2QKSA 5CA1B 2OWOA 1WA8A 4W4LA 4YJ3A 3CRCA 3SPJA 4TQDA 5KA6A 2KG7A 2Y4TA 3SJQC 2QEXV 3WFVA 4FLZA 1Q8IA 4JYAO 1YDXA 2UXBO 3JCZA 4O4HB 1NTMH 5IYZB 3C3SA 3UO3A 5BR8B 1JJ2U 3FB6C 4E2LA 5LXTB 2QTSA 1BCCH 1KMIZ 2H3OA 3WB2A 1BMFG 2OTLV 1D5NA 4J7JA 1DGSA 1F51A 5KAIZ 1VQ5V 2XNDG 1ZTEA 1RSOA 1OCRB 3EHBB 4X8AA 3HKBB 2IU3A 4WFHA 4DV4B 1Q90D 2FB5A 1VP7A 1I7FA 4I50B 1M57C 3RGBA 2M6YA 1VARA 1U97A 1N36O 1H2KA 5IJ0A 3KZIZ 5JWPA 1N0JA 4OPHA 1AB3A 1R3IC 3ETDA 3JAWB 1SESA 2GUZA 3ZHSA 4K0KB 3FYEB 2LGWA 4PV1B 3K58A 1XILA 1WB8A 1KU9A 4QPJA 2V4DA 3SJBC 1H8HG 2YXYA 1NTKH 4J10A 3CCUV 4R6ZA 1SKVA 1VQOV 1G1XB 3A2FA 4Z2WA 5CN0A 4WFBV 1CP9A 4DR7O 5FNVB 4DUYO 1IXMA 3OEHG 3H1KH 4ZKIA 2E76B 3JATA 1YVWA 1FXKB 4O4IA 1N33O 1VQLV 3M99B 3S3WA 1S5LZ 2P4KA 4LFAB 3GWOA 5IY5C 4JI8B 3FFQA 2A06H 1AI5A 4Q6GA 4BW9A 1J95A 4BWAA 2YS8A 4P9PA 2AGAA 3K3WA 3KCXA 3Q4HB 1GO3F 4BAYA 3ZEDA 2F4VB 5BY1A 4LF9B 4GZRB 1SC5B 3U11A 4NTYA 4FMTA 5BR8O 2ZXWC 2UUCB 3GVMA 2CTWA 4KL1A 4I5SA 1YSCA 2F95B 1NH2D 3MAQA 4DR2B 1YIJV 2WWWA 2F43G 1MNGA 3HKCB 1BHAA 4H0LB 3HKDB 3ZCCA 3QF7A 2YXHA 2QR4A 3BVOA 1VQMV 4KXRA 2WLJA 4HBNA 2XTAA 1BHBA 4DV4O 2K1EA 5DN6G 2LW7A 2MK3A 1NJIW 1E1RG 2GSMB 3RBZA 2OCCC 5D5PA 5KHGA 2Q9LA 4J9YB 5JJJB 3ABTA 2QWPB
chains in the Genus database with same CATH topology
4W4KA 4J10A 2G38A 4J11A 4J41A 4J7JA 4W4LA 4IYHA 3FX7A 4IYIA 4J7KA 4J42A 2GTSA 4KXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4K A;  4J10 A;  2G38 A;  4J11 A;  4J41 A;  4J7J A;  4W4L A;  4IYH A;  3FX7 A;  4IYI A;  4J7K A;  4J42 A;  2GTS A;  4KXR A; 
#chains in the Genus database with same CATH topology
 5KMG A;  4NB5 A;  3RYC B;  5L3B A;  2WSS G;  4OXS A;  4EB6 B;  1XQ8 A;  1OCC C;  4FZ0 A;  4DRX A;  5GTH Z;  5A9G A;  1FJG B;  4K0K O;  3CS5 A;  2KSD A;  2GDS A;  3THO A;  3DXR B;  3JAK B;  2P90 A;  1WLE A;  4YJ2 A;  3L75 H;  2VQF B;  3E8F A;  3P3N A;  2A7W A;  1BT8 A;  3BA8 A;  1XL4 A;  1WPB A;  5CA0 A;  1FYJ A;  1P84 F;  2RCV A;  2YEV B;  1K5Q A;  3H1H H;  3JAR A;  4LF6 B;  2EIL C;  2JK5 C;  5KHK A;  2X6B A;  4LFA O;  2QWO B;  2F1M A;  1XRE A;  4JI8 O;  2LFR A;  2P06 A;  1N32 B;  4X89 A;  1NKD A;  2NNU A;  1GN3 A;  1JJO A;  4B08 A;  3JSN A;  3AG3 C;  2JJ1 G;  2QGN A;  2YXL A;  2P67 A;  4U3J B;  2F4V O;  4LF9 O;  4GKJ B;  3QG5 A;  2WLK A;  5J2T B;  1Y76 A;  2YIB A;  3LDC A;  4DR1 B;  4D7S A;  3OGC C;  2JIZ G;  2OIE A;  2UUC O;  1TVK B;  3LSS A;  4NTW A;  4LP8 A;  3SR2 C;  1PKX A;  1W0K G;  3RVY A;  3RYF A;  3AK3 A;  5L3D A;  1VIB A;  3KG2 A;  2ZDI A;  2Y0P A;  1TAE A;  4DR2 O;  3CRQ A;  3C3T A;  1J5E B;  2DQ3 A;  2Q69 A;  2WPD G;  3K57 A;  3JD3 A;  4WBN A;  3OTO B;  4G2K A;  4QPK A;  3CEI A;  4KFM A;  1IBL B;  1YTF B;  2RDC A;  4MTF A;  1LNQ A;  4UCU A;  3SPG A;  5KHH A;  1VQ6 V;  1SQG A;  1IBM B;  2IH3 C;  4X64 B;  2Q8V A;  3BHP A;  4O4J B;  4UCT A;  2EIK C;  2ZM6 B;  3T2M A;  1QLE B;  4LNU B;  1IX9 A;  3FKS G;  3S3X A;  2JS5 A;  1S5J A;  1FJG O;  1SRY A;  3H1J H;  4X1I A;  2QA4 V;  3ZHR A;  3VQV A;  1SQX H;  4FPP A;  5JVD A;  3FB8 C;  3ETQ A;  3ZMS A;  2VQF O;  3RYH A;  4LFC B;  2QDO A;  3LSQ A;  1SS3 A;  3OFN G;  2XUM A;  4IIJ A;  2V7Q G;  3G6B A;  4LBE C;  1NZ6 A;  1JX9 A;  4LH6 A;  1PPJ H;  2CH7 A;  1KQS U;  3HPL C;  5LP6 C;  4LF6 O;  1O9G A;  4UVB A;  3STZ C;  1VQ4 V;  3JCU Z;  2HKO A;  1N32 O;  3T4D A;  3H1I H;  2ZIO A;  3WG7 C;  1ARO P;  1YIT V;  2IJI A;  3L9D A;  1VF6 C;  4O2A B;  2AHZ A;  4HNA A;  3FAV A;  5B5E Z;  2ZNJ A;  2OCH A;  4GKJ O;  3ABM B;  3A0R A;  3ML0 A;  4DR1 O;  2WLL B;  3VOU A;  1AJP A;  2B1I A;  4JZ2 A;  2XT9 A;  3QO5 A;  4PHZ A;  3H01 A;  1I0H A;  1EZV H;  5KX5 A;  1PL0 A;  4PD4 F;  2L35 A;  4B7K A;  2ITC C;  1PD3 A;  1J5E O;  4DV7 B;  2OYQ A;  4BR6 A;  3OTO O;  1YF2 A;  2QWQ B;  2YUA A;  1IBL O;  2W0F C;  4DK1 A;  4YIP A;  2X6C A;  5KHI A;  3C90 A;  3ETE A;  4J41 A;  5IJ9 B;  3AG4 C;  3CJH A;  3OAA G;  1IBM O;  5EZY A;  2JEX A;  2A0L A;  4X64 O;  1EBO A;  4ZIB A;  1P4R A;  4X20 B;  4DV3 B;  1SQV H;  4KUM A;  1TUB B;  2ZM6 O;  1R6T A;  4FLW A;  4XDK A;  2PI4 A;  4DV1 B;  2ZCE A;  5L3E A;  2QM8 A;  4AI8 A;  2FKX A;  3CSX A;  2PF4 E;  5EBL C;  1PNM A;  4RQE A;  3DTU B;  4X1K B;  5JQG A;  1L0L H;  1RFY A;  2DYS C;  1FFX A;  3R65 A;  2EUL A;  2Y69 B;  3WB0 A;  4LFC O;  1F4M A;  3SJC C;  1H2S B;  1WA8 B;  1K8A W;  4YJ3 B;  4TQF A;  1Y6X A;  4RUE A;  3ZX6 A;  5BMV B;  3CC7 V;  5DEC A;  1HNZ B;  2ZKO A;  3MDS A;  4ABM A;  2HR3 A;  1KD1 W;  3GWK C;  4JTC B;  1ZSP A;  2Q5Z A;  2DYR B;  2E74 B;  1HNX B;  4JAV A;  1XOU A;  1OZ0 A;  4AQY B;  3J81 N;  4TT3 G;  3T1Y B;  1V9P A;  1IUR A;  2D2C B;  3K9A A;  1VEW A;  2IJK A;  1NS1 A;  5KUK A;  4LC1 A;  4PDV A;  4IHJ A;  4Q20 A;  5B3S B;  3H1L H;  1P49 A;  2P7T C;  3CD6 V;  3OEE G;  5GW7 A;  1AIL A;  5KHJ A;  4B7E A;  2DE0 X;  2Q73 A;  3UCS C;  2X0L A;  1K3E A;  4JPR A;  1RSO B;  1HR0 B;  1CXZ B;  2UXX A;  1D2D A;  3APO A;  1K92 A;  1OCR C;  2WA3 A;  1YTF D;  4MTG A;  2ZE7 A;  3JYC A;  3GB7 C;  2IJH A;  4DV7 O;  4NTX A;  1ZL8 A;  1V55 B;  4RUF A;  2HFE C;  5IJ0 B;  3E8H A;  3A0B Z;  3QVN A;  1QLN A;  3HKE B;  2GUZ B;  3JD1 A;  2LP7 A;  1GM9 A;  3ABK B;  2CAZ C;  1GK9 A;  4DV3 O;  3SPH A;  2QWR B;  2ZR3 A;  3ZIA G;  4JGS A;  1US6 A;  2QKA A;  5L3F A;  4DV1 O;  3K04 A;  2EIM B;  4JZG A;  4O4I B;  5F2V O;  5K1X A;  1YZB A;  4BIO A;  1AR4 A;  1K7D A;  4I0X A;  4GCZ A;  3TK1 A;  4IT5 A;  2FYU H;  2Q7E A;  4X9Q A;  1K33 A;  1RPR A;  4WFE A;  1HNZ O;  1R1B A;  3T4Z A;  4PEL A;  5IYC O;  1HNX O;  1R73 A;  4I55 A;  1KBH A;  4AQY O;  3OUS A;  1BGY H;  2LFS A;  4K8X A;  5KA5 A;  2PYJ A;  3T1Y O;  1Q82 W;  2ZR2 A;  3K0D A;  4BW5 A;  5KAF Z;  3G71 V;  5EBM C;  3ABL C;  1QR8 A;  1I94 B;  5LA6 A;  4YIO A;  1QHT A;  1DK1 A;  1JMK C;  4MW3 A;  4TUY B;  4DUZ B;  1HR0 O;  4JI4 O;  1Y67 A;  2A9H A;  3K5N A;  3SGI A;  3U10 A;  1W2B U;  3AG2 B;  1R3J C;  1IBK B;  3JD2 A;  3TGU H;  4PI2 A;  1BS3 A;  2JGD B;  1SA0 A;  5KMG B;  3NR7 A;  4YY3 B;  1JR9 A;  5AG2 A;  2NN4 A;  1KKD A;  3W7W A;  4FLX A;  3AG1 B;  1MZE A;  2EIJ B;  4H37 A;  4W4K A;  4DRX B;  1JOY A;  1IVS A;  2BTQ A;  2W6I G;  2B1G A;  1FPO A;  4JTA B;  4FLY A;  5EC1 C;  2H94 A;  3A0H Z;  4J80 A;  4YJ2 B;  3CC2 V;  5LP6 A;  1JQ0 A;  1F23 A;  2EJR A;  5H9C A;  3D3I A;  1WNS A;  3WB1 A;  1HP8 A;  5CA0 B;  2YC0 A;  4KP4 A;  3OR7 C;  1THZ A;  3T1C A;  1M5I A;  2R72 A;  3ASN C;  2ZT9 B;  1VF6 A;  3JAR B;  1K4D C;  4LH7 A;  1XHZ A;  2Q6A A;  1VQ8 V;  2A3Q A;  3IGA C;  1B6Q A;  4I9Q A;  1VQN V;  4LFB B;  2Q0O C;  2W0X A;  4QE7 A;  4MTX A;  2WLI B;  1Y76 B;  3K79 A;  3E89 A;  4ZHQ B;  3UQ8 A;  3OM3 B;  5L3C A;  3ZMU A;  1Q3E A;  4JI1 B;  1Q86 W;  1YCI A;  2EIN B;  1QQC A;  3W7U A;  1NR1 A;  4ZI7 B;  5J2U B;  2VWK A;  3T1H B;  1HW7 A;  2CE4 A;  4B3T B;  1I94 O;  3P30 A;  4QE9 A;  5LHG A;  5FLX N;  1GN6 A;  4DUZ O;  4TV9 B;  3CME V;  4GKK B;  2UUA B;  3ETG A;  4UCO A;  4CS3 A;  4CH3 A;  5EK0 A;  5JH7 B;  1P7G A;  2AHY A;  1P7B A;  1IBK O;  1KUQ A;  4QGP A;  2ADP A;  4OX9 B;  4B3M B;  4MVS A;  3RYI A;  4FM2 A;  5KLV H;  2JS3 A;  4YY3 O;  3BPZ A;  2GHY A;  5EYP A;  3N2G A;  3AK1 A;  1W0J G;  4X1I B;  1FAF A;  1QVG U;  1XDC A;  4FFB A;  1N34 B;  3CX5 F;  5H2F Z;  1M90 W;  1LUV A;  1FKA O;  2LQT A;  5JVD B;  5IE9 A;  4GX5 A;  1LR1 A;  4F6E A;  1GTO A;  1Q7Y W;  4LF5 B;  1E79 G;  2XHB A;  3RYH B;  2Y4U A;  2DJV A;  4PJ0 Z;  3G67 A;  2OT5 A;  3SYA A;  5D5Q A;  4LF8 B;  4IIJ B;  2Q68 A;  3FD9 A;  4BIZ A;  4JV5 B;  2CH7 B;  4CZZ A;  4FVM A;  2NR5 A;  1PNL A;  4BIU A;  5LMU B;  4DK0 A;  2L6L A;  3M7M X;  1SQP H;  2RN9 A;  4F6R B;  4LFB O;  2E5L B;  4FLU A;  2CGO A;  5LGT A;  3MHS C;  1KB9 F;  4HNA B;  4MVR A;  3ZRV A;  1I5X A;  3N27 A;  3F5W C;  2QM7 A;  3HKB A;  1M57 B;  3SYP A;  4UB8 Z;  1PL4 A;  2H8P C;  1NI8 A;  2JJ2 G;  2AZ0 A;  4DV5 B;  2HP8 A;  3CXH F;  3FYI B;  5EIB D;  1FXH A;  4P9O A;  3VQY A;  3ABM C;  3CWB H;  3J80 N;  1EN5 A;  5KX5 B;  3K06 A;  2HEP A;  4JI1 O;  5B1A B;  2GBO A;  5B1B C;  1S3J A;  1NR7 A;  2R9A A;  2WA4 A;  4ASU G;  1UJW B;  3T1H O;  4B3T O;  5LYJ A;  4XBF A;  3OW2 U;  4GKK O;  2UUA O;  1V54 B;  3CJH B;  3BFR A;  2Z5U A;  3JAM N;  4P30 A;  3X2Q B;  2ZIM A;  3CP1 A;  5EZY B;  4OX9 O;  1WP8 A;  4B3M O;  1MZF A;  2HVJ C;  5FNV A;  1OHH G;  1XMQ B;  5C8Y B;  4J7K A;  2Z3Y A;  1SET A;  4K8Z A;  3L73 H;  3ASO C;  1GH6 A;  4TV8 A;  5IY5 B;  3H9V A;  2UU9 B;  4JI3 B;  3DC6 A;  1GM7 A;  3ICX A;  4B3S B;  1N34 O;  4U7O A;  3D36 A;  3K5L A;  3CCL V;  4YHH B;  2IM9 A;  5JQG B;  1VQ9 V;  3PJS K;  2XOK G;  1K9M W;  4JI0 B;  4LF5 O;  1FFX B;  2IH1 C;  2MW2 B;  4EFE A;  4EEQ A;  4JI2 B;  1I08 A;  3L74 H;  3I5D A;  4LF8 O;  4X1Y B;  4MT8 A;  2Y69 C;  2ZXW B;  4JV5 O;  5LMU O;  2YIC A;  3B8M A;  4QJF B;  1IZ3 A;  3UKM A;  4PA3 A;  2BSK A;  2Q7G A;  1YXB A;  1NTZ H;  2F66 C;  3VBB A;  4RWU A;  3OT7 A;  1X59 A;  2E5L O;  2YID A;  1XL6 A;  4JI6 B;  3HKC A;  5IYD O;  5LBQ A;  1BQZ A;  2WLN A;  1BL8 A;  1GN2 A;  4IHJ B;  1VF7 A;  3JSL A;  2LGQ A;  3M8A A;  3RVZ A;  4LCU C;  4HYO A;  4DV5 O;  2P22 C;  3OMA B;  4QNH B;  1M56 B;  3LDD A;  5H6Q A;  4RO2 A;  2JDI G;  1Q43 A;  2RJZ A;  3RYC A;  1OCC B;  2KKW A;  3K9S A;  4DV0 B;  4EB6 A;  3K5O A;  4FK5 C;  4CH6 A;  3CPW U;  1ZL8 B;  4JAS A;  4ZOL B;  4I7Z B;  2DWE C;  4ICG A;  4I4T A;  4UCV A;  1OJH A;  1FD9 A;  2CK3 G;  3JAK A;  1B3Q A;  1AVM A;  3ABU A;  2FL4 A;  4EFB A;  2HVK C;  2IU0 A;  1I5Y A;  3E8B A;  2OTJ V;  2ZIN A;  2VQE B;  1XMQ O;  1G6U A;  2EIL B;  3CCV V;  2IJJ A;  5BXZ A;  5ITZ A;  4J11 A;  1S76 D;  1H2N A;  2UU9 O;  5DED A;  4DV2 B;  1NQT A;  1HNW B;  4JI3 O;  4B3S O;  2PGG A;  2N05 A;  1AI7 A;  4YHH O;  2EX3 A;  3DC5 A;  2Z0A A;  4JI0 O;  1RM1 B;  3ZHV A;  3CYO A;  3ZJZ A;  4PDL A;  4JI2 O;  2UXC B;  4JF3 A;  3UM7 A;  5J2T A;  4LF7 B;  1M1K W;  4J9Z B;  2A79 B;  1XBL A;  1AJQ A;  4PI0 A;  2RMK B;  1TVK A;  4UV8 A;  1OCO B;  3AEI A;  2EJ7 A;  2D3O W;  4KHP B;  3VQX A;  2FML A;  3EXA A;  4J7Z A;  3ZMV A;  4RQF A;  1Y74 A;  2EZO A;  4JYC A;  3SDL A;  3E22 A;  3SJA C;  4JI6 O;  1PV0 A;  2HG5 C;  2LW1 A;  4CC6 A;  3ZS8 C;  2KG7 B;  3IJ4 A;  5LA6 B;  3F7Y C;  2ZE6 A;  3ZBH A;  2XAH A;  2UXN A;  4GT1 A;  2EIK B;  1GAX A;  1B04 A;  2GTS A;  4DR6 B;  4DV0 O;  1JVM A;  4PA6 A;  1EFR G;  1SA0 B;  4XDJ A;  4X65 B;  3SPI A;  1M93 A;  4K35 A;  3P32 A;  1YJN V;  4A5U B;  4DO2 A;  4JI4 B;  2BE3 A;  2BTQ B;  3OTF A;  2F23 A;  2OIG A;  4RAI A;  4MVZ A;  1Y4M A;  2DW4 A;  2VQE O;  3CC4 V;  3CCM V;  5FPO A;  4D7T A;  3B09 A;  1XNQ B;  3ZHQ A;  4DV2 O;  5B1N A;  1HNW O;  3APQ A;  1YHQ V;  2IBZ H;  3WG7 B;  2GV9 A;  3E2E A;  2UXD B;  2B9Z A;  4H13 B;  1L1F A;  1GN4 A;  1NBM G;  3EVK A;  2ILM A;  4TOI A;  2PZS A;  3W7S A;  4P2Z A;  3K59 A;  2ARH A;  4U3F H;  4JAA A;  2WLH A;  4O2A A;  2PYL A;  1QBZ A;  1M4U A;  4L87 A;  2UXC O;  3DSQ A;  3RW0 A;  4LF7 O;  5K1P A;  1F7Y A;  4UXN A;  2WLL A;  2YIA A;  4X88 A;  1AP5 A;  1Q6H A;  1ZLZ A;  1O9H A;  1R3K C;  1WPX A;  5H5N A;  4GYC B;  3JAT B;  1G8M A;  4KHP O;  1JA8 A;  1YJW V;  2HLD G;  2AZ2 A;  3UT5 A;  1G4Y B;  3P3P A;  2Q67 A;  1FXK C;  3AK2 A;  1PP9 H;  3I56 V;  1K34 A;  3AG4 B;  1KP2 A;  4GX2 A;  2E75 B;  1HDJ A;  3STL C;  2ETN A;  4FJC C;  3CE2 A;  1OCZ B;  3CCJ V;  4JI7 B;  1YI2 V;  1XHX A;  3LUT B;  4MSW C;  3RWR D;  4O2B A;  5LGU A;  4EKW A;  3DGE A;  3F7V C;  2BCC H;  3KCY A;  3LSU A;  4UV9 A;  4DR6 O;  4G28 B;  2CTQ A;  1ZUQ A;  1X4T A;  4X65 O;  1A32 A;  3BA9 A;  1BE3 H;  2DYS B;  3N2G B;  2YI9 A;  1FS0 G;  4CC5 A;  3A8T A;  1QU7 A;  4PA4 A;  4FFB B;  4X62 B;  5IYB O;  1CEZ A;  5BMV A;  5CB4 A;  5GON A;  4WFF A;  1N4C A;  1XNQ O;  2LJ2 A;  3RFR A;  4R50 A;  1EM1 A;  3QO7 A;  1KKC A;  1Z5V A;  2F93 B;  1PM9 A;  3BAB A;  2ITD C;  2UXD O;  5H6R A;  3JAL A;  4NXN B;  5CBH A;  3FB5 C;  1CPY A;  3CMA V;  4NKG B;  4Z1M G;  1JFF A;  3SPC A;  5JJE B;  1KP3 A;  4N21 A;  4FM0 A;  3OGI B;  4UCR A;  5HFM A;  3BRC A;  2QM4 A;  3E86 A;  4LWS A;  3IC9 A;  1GKF A;  3UO2 A;  2DOS A;  3OD4 A;  3SYC A;  3D3Q A;  2QWN B;  3CCE V;  1M9N A;  4NXM B;  4FIP C;  3ZRW A;  2JGU A;  1ZX3 A;  4IL6 Z;  4C7U A;  4PA9 A;  3OMI B;  3TXQ A;  3MHH C;  5B1A C;  4PA7 A;  4JI7 O;  5LYJ B;  1L8D A;  3B2E E;  1ZAU A;  3HKE A;  4DR3 B;  4XDL A;  3N2K A;  1E1Q G;  1LUW A;  2PUS A;  2R70 A;  4HAM A;  4LR3 A;  4WCE V;  1IXB A;  5LOV A;  3RYF B;  1V54 C;  4H33 A;  3OR6 C;  4R7C A;  1MSD A;  3X2Q C;  1ZWI C;  3OUF A;  1XMO B;  1AI4 A;  1BZK A;  2KB1 A;  4DR4 B;  4WBN B;  2ZNI A;  5FL7 G;  1QVF U;  4TV8 B;  1N8R W;  4E4E A;  1DF5 A;  3G4S V;  5TIS Z;  3BCC H;  2Q0A A;  4MS2 A;  2CTR A;  4X62 O;  4X66 B;  5JJN B;  2X7R B;  4O4L A;  3JAS A;  5LHH A;  1K5S A;  5B1O A;  3ZHU A;  5E1A C;  1QCE A;  5LGN A;  2Y0I A;  4QIW F;  1TUE B;  5LHI A;  1H38 A;  1AI6 A;  2HJD A;  5IT9 N;  3O65 A;  4NXN O;  2BSK B;  5EBW C;  1QLE C;  1TGO A;  2CDY A;  5CA1 A;  1EN4 A;  2RQ6 A;  3ABL B;  1H8E G;  4WFA V;  1VQP V;  3TXS A;  3O9O A;  1XI1 A;  2ZE8 A;  4TUY A;  4UB6 Z;  4FFK A;  1Q81 W;  2RNB A;  1B06 A;  2XAF A;  3LNM B;  4O4H A;  1QR9 A;  5IYZ A;  4DV6 B;  5IWA B;  2YDE A;  3K08 A;  2IW5 A;  5LXT A;  5L3G A;  4NXM O;  2E3C A;  4UVA A;  2JGD A;  1ENV A;  2HJF C;  1RPO A;  2Q7H A;  1Q5O A;  1R3L C;  1M56 C;  3ZMT A;  1NVP B;  4K3A A;  3IC7 A;  1NU1 H;  5LL6 Y;  3FAV B;  1U96 A;  4DR3 O;  4HZ3 A;  4I4T B;  5FPR A;  2PI5 A;  2WAM A;  4NVP A;  4B3R B;  5B66 Z;  1BSM A;  5JCO C;  4I50 A;  1MG1 A;  3G6E V;  2DMX A;  4DYL A;  3B8N A;  2B5U A;  3ASN B;  4PDM A;  1XMO O;  3K5M A;  3CRM A;  4DR4 O;  2DN9 A;  5ITZ B;  3JAW A;  1SER A;  1GRJ A;  3K0G A;  3L71 H;  1VQK V;  1UPG A;  4I9W A;  3ZHT A;  4GX1 A;  2QTO A;  1WJZ A;  1W59 A;  1AJN A;  2N04 A;  4IYH A;  2W6J G;  4Z1V A;  2BOC C;  4X66 O;  4CH5 A;  1K4C C;  2AXT Z;  1FXV A;  1K73 W;  4OPA A;  3U0Z A;  2BOB C;  3EFF K;  1RM1 C;  4FZ1 A;  2WLI A;  2ZQM A;  1FXK A;  2XAS A;  4ZHQ A;  2XAJ A;  3F5T A;  4L8J A;  1EN6 A;  4J42 A;  3E8G A;  1TA8 A;  1MAB G;  3JD0 A;  2QJ1 A;  1UFI A;  2NLJ C;  1Y74 B;  3ZRS A;  2N74 A;  1KYO F;  4ZI7 A;  1OCO C;  5J2U A;  3E22 B;  4N23 A;  4JYY A;  3Q4H A;  4DXW A;  4OGQ B;  3TCU A;  1XEQ A;  3B40 A;  4TV9 A;  3CRR A;  2ZE5 A;  1SQF A;  1SZT A;  4DV6 O;  5IWA O;  5JH7 A;  4CBC A;  2XAG A;  1QNM A;  1FFT B;  1AR5 A;  2VRZ A;  3L72 H;  2DYR C;  2QKC A;  1NT2 B;  3SYQ A;  1AR1 B;  4JI5 B;  3BEH A;  3ZN0 A;  2X6A A;  2YIB D;  3FX7 A;  1R6N A;  3KKY A;  2ADQ B;  2DQ0 A;  5J9P C;  3HKD A;  1COW G;  3FB7 C;  4LF4 B;  5DM6 V;  1DTO A;  1OV9 A;  2OCC B;  1GMG A;  5B3S C;  4B3R O;  4CS4 A;  3IFX A;  4MVQ A;  3OMN B;  3CCQ V;  2PTM A;  5GTI Z;  3R66 A;  1Q6I A;  5EC2 C;  1KC8 W;  2ATK C;  4JYB A;  1SF9 A;  2CGN A;  1N0N A;  4G27 B;  4YXW G;  4DR5 B;  2HHH B;  3WU2 Z;  3B4S A;  4NYK A;  1H2L A;  1ROP A;  1V55 C;  3DXR A;  3I55 V;  4F6R A;  4CS2 A;  2UUB B;  1VQ7 V;  3E83 A;  1XNR B;  3HR0 A;  1MMM A;  4DW0 A;  2ZD9 A;  3CRA A;  4MW8 A;  4FLV A;  3E35 A;  1WP7 A;  3ABK C;  5LMN B;  2P6J A;  2M7W A;  2YEV A;  5B1B B;  5IDJ A;  2R9I A;  1YJ9 V;  2YSU B;  2R9R B;  5CA3 A;  4IGG A;  4NR1 A;  3AG3 B;  1MOF A;  3UT5 B;  3CXC U;  2EIM C;  1S0V A;  5KUM A;  2V1D A;  4I0X B;  2EZP A;  4ZBM A;  4UFZ A;  4WFG A;  4U3J A;  2BTO A;  1Y66 A;  1PNK A;  4PDR A;  5HFL A;  1DLB A;  3CCR V;  1OCZ C;  1NVP D;  4O2B B;  4F4L A;  2KQX A;  3QNE A;  4I55 B;  2VWJ A;  3VQW A;  3ASO B;  1WAZ A;  1GM8 A;  5C8Y A;  3B77 A;  1EZJ A;  4IYI A;  4JI5 O;  3LDE A;  3W7T A;  2K9P A;  4UCS A;  2Q4P A;  4H44 B;  5E79 Z;  1DF4 A;  4LF4 O;  3NXS A;  1URF A;  5EIB C;  1L0N H;  3BY6 A;  2FTK A;  1VF5 B;  2JEU A;  2WLM A;  4O4J A;  1Q6U A;  2G38 A;  4FLT A;  3AG7 A;  4X1Y A;  4JTD B;  5CB4 B;  5GON B;  1K97 A;  2JVD A;  1JCH A;  4LNU A;  3ZN1 A;  2C2A A;  3AG2 C;  3HB3 B;  1SZX A;  3TET A;  4DR5 O;  2HHH O;  3BAA A;  3IAY A;  2UUB O;  3JAL B;  1BQ0 A;  4D6T H;  4JAU A;  3AG1 C;  5CMU A;  5CBG A;  4GLX A;  2JRI A;  3RT3 C;  1XNR O;  1IDS A;  3ZRX A;  2EIJ C;  1S72 V;  4UVC A;  2QSA A;  1JFF B;  4CH4 A;  5LP6 B;  4WF9 V;  1Z2G A;  3QTC A;  4U7N A;  5LMN O;  3PN1 A;  1RP3 B;  4JYA B;  3RN4 A;  2O57 A;  2P5O A;  2UXB B;  3W7X A;  1F4N A;  4LWS B;  4MVM A;  2LO1 A;  5CBF A;  2EBO A;  1R6K A;  3QO8 A;  4DW1 A;  2GTA A;  1S5H C;  3ZRW B;  4GX0 A;  3CHX A;  2PY5 A;  4ZOL A;  2CUG A;  5JCO A;  3JD4 A;  3LNN A;  1NH2 B;  4MVO A;  3SYO A;  4TSF G;  1T5E A;  2VS0 A;  3K03 A;  1WN7 A;  3N2K B;  4GUN A;  3CB2 A;  2DWD C;  3CCS V;  4MVU A;  4FM1 A;  1H2M A;  1AP6 A;  3OE7 G;  5LOV B;  1N36 B;  5C93 A;  4UUJ C;  2XAQ A;  2EIN C;  5IJ9 A;  3L70 H;  1VMG A;  2ZDI C;  5BZB A;  1KEC A;  1HWY A;  1YEW A;  1JPX A;  1MA1 A;  1Z5W A;  5A2Q N;  2QE7 G;  4X20 A;  4AIL C;  4MTO A;  4O4L B;  1D5A A;  1TUB A;  3JAS B;  1SQQ H;  4DR7 B;  3D36 C;  3D8C A;  1SQB H;  3RYI B;  1H2G A;  3J7A U;  4DUY B;  3G80 A;  2ODM A;  2YI8 A;  3TJT A;  4AHC A;  1WB7 A;  2CTP A;  1ORQ C;  4R8C A;  3ZMZ A;  4TWK A;  5EYP B;  1S77 D;  1N33 B;  4X1K A;  2P4V A;  2AW9 A;  1XUQ A;  2Y48 A;  3MD0 A;  1MSW D;  2QKS A;  5CA1 B;  2OWO A;  1WA8 A;  4W4L A;  4YJ3 A;  3CRC A;  3SPJ A;  4TQD A;  5KA6 A;  2KG7 A;  2Y4T A;  3SJQ C;  2QEX V;  3WFV A;  4FLZ A;  1Q8I A;  4JYA O;  1YDX A;  2UXB O;  3JCZ A;  4O4H B;  1NTM H;  5IYZ B;  3C3S A;  3UO3 A;  5BR8 B;  1JJ2 U;  3FB6 C;  4E2L A;  5LXT B;  2QTS A;  1BCC H;  1KMI Z;  2H3O A;  3WB2 A;  1BMF G;  2OTL V;  1D5N A;  4J7J A;  1DGS A;  1F51 A;  5KAI Z;  1VQ5 V;  2XND G;  1ZTE A;  1RSO A;  1OCR B;  3EHB B;  4X8A A;  3HKB B;  2IU3 A;  4WFH A;  4DV4 B;  1Q90 D;  2FB5 A;  1VP7 A;  1I7F A;  4I50 B;  1M57 C;  3RGB A;  2M6Y A;  1VAR A;  1U97 A;  1N36 O;  1H2K A;  5IJ0 A;  3KZI Z;  5JWP A;  1N0J A;  4OPH A;  1AB3 A;  1R3I C;  3ETD A;  3JAW B;  1SES A;  2GUZ A;  3ZHS A;  4K0K B;  3FYE B;  2LGW A;  4PV1 B;  3K58 A;  1XIL A;  1WB8 A;  1KU9 A;  4QPJ A;  2V4D A;  3SJB C;  1H8H G;  2YXY A;  1NTK H;  4J10 A;  3CCU V;  4R6Z A;  1SKV A;  1VQO V;  1G1X B;  3A2F A;  4Z2W A;  5CN0 A;  4WFB V;  1CP9 A;  4DR7 O;  5FNV B;  4DUY O;  1IXM A;  3OEH G;  3H1K H;  4ZKI A;  2E76 B;  3JAT A;  1YVW A;  1FXK B;  4O4I A;  1N33 O;  1VQL V;  3M99 B;  3S3W A;  1S5L Z;  2P4K A;  4LFA B;  3GWO A;  5IY5 C;  4JI8 B;  3FFQ A;  2A06 H;  1AI5 A;  4Q6G A;  4BW9 A;  1J95 A;  4BWA A;  2YS8 A;  4P9P A;  2AGA A;  3K3W A;  3KCX A;  3Q4H B;  1GO3 F;  4BAY A;  3ZED A;  2F4V B;  5BY1 A;  4LF9 B;  4GZR B;  1SC5 B;  3U11 A;  4NTY A;  4FMT A;  5BR8 O;  2ZXW C;  2UUC B;  3GVM A;  2CTW A;  4KL1 A;  4I5S A;  1YSC A;  2F95 B;  1NH2 D;  3MAQ A;  4DR2 B;  1YIJ V;  2WWW A;  2F43 G;  1MNG A;  3HKC B;  1BHA A;  4H0L B;  3HKD B;  3ZCC A;  3QF7 A;  2YXH A;  2QR4 A;  3BVO A;  1VQM V;  4KXR A;  2WLJ A;  4HBN A;  2XTA A;  1BHB A;  4DV4 O;  2K1E A;  5DN6 G;  2LW7 A;  2MK3 A;  1NJI W;  1E1R G;  2GSM B;  3RBZ A;  2OCC C;  5D5P A;  5KHG A;  2Q9L A;  4J9Y B;  5JJJ B;  3ABT A;  2QWP B; 
#chains in the Genus database with same CATH homology
 4W4K A;  4J10 A;  2G38 A;  4J11 A;  4J41 A;  4J7J A;  4W4L A;  4IYH A;  3FX7 A;  4IYI A;  4J7K A;  4J42 A;  2GTS A;  4KXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...