4J42A

The crystal structure of a secreted protein esxb (mutant y65f) from bacillus anthracis str. sterne
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
80
structure length
80
Chain Sequence
KITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQFIPILEGISTDLKRIADKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a secreted protein EsxB (Mutant Y65F) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
molecule keywords secreted protein EsxB
total genus 32
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j42A00
4IYIA 4J41A 4J42A 4J7KA 4J10A 2GTSA 4W4KA 4J7JA 4KXRA 4IYHA 4J11A 4W4LA 3FX7A 2G38A
chains in the Genus database with same CATH superfamily
4MVSA 3F5WC 4QPKA 1DGSA 2CH7B 5LOVA 3K5MA 1CEZA 4K35A 2ETNA 1R1BA 1M5IA 1KYOF 2PGGA 5IJ0A 1W59A 2YXLA 2H3OA 2IJHA 2ZD9A 2CK3G 2N74A 2EX3A 3G4SV 4PA9A 3LSSA 3CXCU 5KAIZ 1L1FA 1IBLB 2ZIOA 1CXZB 1BS3A 3H1IH 3DXRB 1K33A 3L75H 1BSMA 1PNLA 3F5TA 1LNQA 2VS0A 5H6RA 2DYSB 2Y4UA 3QVNA 2UXBO 1OZ0A 2YSUB 2UXDB 3VBBA 4JZ2A 4NR1A 4DRXA 3B4SA 4N21A 4X1YA 4UB6Z 2QDOA 2VWKA 3N27A 4MW3A 2EJRA 3MDSA 5B1BB 3AG7A 1VARA 2B5UA 1VEWA 3W7XA 3T1YB 4TV9A 3OGCC 1LUWA 1Y74A 4AI8A 3HKCA 4MVRA 2DYRC 5KMGB 2LFSA 1IXBA 3C3TA 3X2QB 4GKKB 2YXYA 4B3SB 3HKDA 2ZDIC 1YJWV 4I55B 1JR9A 4JI4O 1F4NA 4X1IB 5DN6G 4ZI7B 4GYCB 4D7SA 1JVMA 1WJZA 4PJ0Z 3RVYA 4F6RB 1JA8A 4X88A 2KB1A 3CE2A 3TGUH 4DR5O 3FB7C 4W4KA 1TVKB 3OEHG 2WLNA 1KB9F 2JS5A 4IYHA 3CX5F 3P30A 1OCZB 3RYIB 1JOYA 2WLIB 4PA3A 3ZHRA 5KHIA 4UCVA 3NXSA 3HKEB 4FFBA 1JCHA 2EBOA 4NTWA 1TUBB 3UCSC 3DGEA 4BIOA 1O9GA 5EIBC 2CTWA 2BTQB 2QSAA 3CRQA 3D36A 4E4EA 1JJOA 5KAFZ 4X1IA 1KECA 3L71H 1N36O 2GSMB 3KG2A 4FPPA 5FNVB 5JH7A 2W6JG 1HW7A 5EIBD 3JAKB 3ZX6A 4O2AA 4DR3B 3CC2V 4OX9B 5J9PC 5IWAO 4HYOA 4I50B 3JATB 1RFYA 1UPGA 3AK3A 4DR7B 4B3RO 1VQLV 1E1QG 3THOA 3CCVV 4JGSA 5BMVB 2CGOA 2B1IA 3IC7A 3QO7A 1CPYA 4DR5B 2IH3C 2B1GA 2FTKA 5B1NA 1RP3B 2RDCA 2QA4V 4U3JA 3OMIB 4JPRA 3T4DA 4DUZO 1RPRA 2Y0IA 3Q4HA 4JF3A 1M57B 4F4LA 5JQGA 4DV1O 1VP7A 3A0RA 3ETEA 1B6QA 4LR3A 3BA9A 3IGAC 4JI7B 1K97A 4I9WA 3DSQA 2GUZB 2Q73A 5J2UB 4HZ3A 4DV6B 5IDJA 1EN5A 2OIEA 4UVAA 4UCSA 3FAVA 3RYCB 4YXWG 4MVMA 2W0FC 2QTOA 1U97A 1MZFA 4P30A 4CS3A 3EFFK 2NNUA 3VQVA 4X1KB 4FZ0A 3W7WA 1VQNV 1OHHG 2CH7A 1IBLO 3T1HB 3IAYA 2IU0A 1K92A 3ABMB 2FL4A 4LF8O 3M8AA 4UCUA 2RN9A 4X89A 2XTAA 3E2EA 5IWAB 3ETQA 5EBMC 4DK0A 1PM9A 2XAHA 3CC4V 1NTMH 3K59A 5JJJB 1OV9A 4NXMO 3JCZA 1MZEA 4KHPB 2KKWA 1F7YA 1SQGA 5KHJA 2A06H 1DTOA 5LBQA 2JGUA 1PP9H 1S5JA 1HNWO 4FLVA 2WSSG 1QR8A 1B06A 4BW9A 5JCOC 3TETA 4JI8B 4DV4O 4LNUA 2H94A 5FLXN 2QGNA 3JD2A 1X59A 1IDSA 1AROP 2ATKC 4G28B 3B8MA 1AR5A 4FK5C 1RM1C 4UXNA 2HVJC 4JI0O 4UCOA 2E5LB 4FLWA 1YF2A 4DV3B 4FFKA 3JASB 4JZGA 3CCLV 4DUZB 3FD9A 5IY5C 5D5QA 2UXCB 1M56B 3ZN0A 3P3NA 1LR1A 5B5EZ 4JYYA 4NB5A 2ZXWB 1GN3A 5LL6Y 3SPIA 1IBMO 2YEVA 1F4MA 4DRXB 1OCCC 2F4VO 3SJBC 2IJJA 1WA8B 4X8AA 1VQPV 2JJ1G 4FLYA 1XNQO 5H6QA 4PV1B 4JI2B 2F66C 1MOFA 1X4TA 2YXHA 4KHPO 4JTAB 1M56C 3JALB 1R6KA 3BHPA 4JI5B 2UXXA 4X65O 4ZOLB 4JTCB 1K4DC 5CBGA 1Y74B 4CC6A 2QKAA 1UFIA 5B1OA 1XHXA 1QVGU 3B09A 4L8JA 4E2LA 2Y69C 4I50A 2EJ7A 3BFRA 3QO8A 5HFMA 2UU9O 4G2KA 2CAZC 5JCOA 2FKXA 3AEIA 3ZMZA 3GWOA 4PD4F 1ZSPA 3ABTA 3BY6A 4PA4A 5A9GA 4O4LB 4P2ZA 4LP8A 4AILC 4AQYB 2KG7A 4WFFA 1VQ5V 4Z1MG 3W7SA 2ITCC 4YJ2A 2X7RB 1GRJA 1FYJA 2DMXA 3JAMN 2F43G 4C7UA 1Z5WA 3JD0A 2DN9A 2ILMA 4BAYA 3QO5A 3WG7B 5IJ0B 4JI5O 2WPDG 4WBNB 2Q5ZA 2VQEO 3UO3A 5CA1A 5B1AC 4IIJB 5LMNB 2BOBC 4GX5A 2YC0A 1OCOB 4I55A 2HHHB 2PZSA 4EFBA 2Q68A 2AHZA 1AP6A 4KXRA 3B77A 1HNZB 2EIMC 4RUFA 4F6RA 2E75B 1XNQB 4QGPA 3K06A 5LHIA 5KUMA 2GBOA 1QVFU 1BL8A 4NTXA 3ZRVA 4UV8A 5E79Z 2LW1A 1V55C 4LF4O 2IBZH 4F6EA 2AZ2A 2NN4A 4ZHQB 1YI2V 2W0XA 2C2AA 5CA1B 3FYEB 4AHCA 1VQOV 4LFBB 3ZMSA 2PYLA 2EIKC 4I9QA 3UKMA 4O4IB 5KHHA 2ZE6A 4K8XA 3L73H 5CMUA 3I55V 4TQFA 4DV2B 3ZRWA 1KQSU 4FM0A 4TT3G 2HKOA 2DJVA 2EZOA 2UU9B 3CB2A 3ZMTA 1HWYA 5IT9N 4CC5A 2PUSA 1ZX3A 5GTHZ 2CGNA 3WG7C 1CP9A 2QWNB 5L3GA 3VQYA 1VF5B 5LGTA 5JJEB 5LHGA 2YIAA 2ZE7A 3EXAA 4MVZA 3L74H 1NJIW 4D7TA 2M6YA 2IW5A 3M99B 3JARB 3ASNC 3JD4A 2WLIA 5EBWC 4MW8A 1FPOA 1P7GA 3JYCA 2YI8A 3C90A 4NYKA 4U7OA 4H33A 4FM2A 1S72V 4I5SA 3TXQA 1NTZH 1K73W 3HR0A 4K8ZA 1XI1A 3LSQA 1I08A 5JJNB 3SYPA 5B66Z 5IYDO 2ZNIA 3E86A 1XL4A 1QQCA 4DV4B 1XDCA 3ABMC 2EILB 3SPHA 4YJ2B 3OTFA 4JYBA 4LFBO 1R3LC 1Q8IA 4FVMA 1I5YA 5EYPB 1YJNV 1R6NA 3VQWA 1TA8A 3RT3C 4IHJA 2Q69A 1DK1A 2W6IG 1YDXA 3PJSK 2GTSA 1KC8W 4CBCA 3E22A 3ZBHA 1Y67A 1YHQV 1FFTB 3FKSG 3A2FA 3E8HA 1V55B 2ZR3A 1MMMA 2LW7A 5H5NA 4FFBB 2YEVB 3FB6C 4ZOLA 3K57A 3ABUA 4LF6B 3KCYA 1FXKB 4ABMA 2EZPA 2UUCB 3ZMVA 2V4DA 2EINB 2BSKB 2WA3A 1W0KG 1DF5A 4JI7O 1TUEB 2YS8A 2Q8VA 2JRIA 2QTSA 5LMUO 1YCIA 2BTQA 1Z2GA 3LDCA 4I4TB 1BE3H 3OM3B 1GO3F 1E79G 3CRAA 2DWDC 4WF9V 4X65B 1H8HG 2BCCH 4IT5A 1ROPA 3SPGA 2HJDA 2QM8A 3RWRD 1KP3A 2ADPA 3ABKC 3VQXA 2WLHA 5KHKA 4TWKA 1EM1A 2CDYA 3ASOC 1N34B 4PHZA 1HP8A 3FB5C 1AB3A 3I5DA 1OCCB 1JFFA 3JD1A 4DR2O 1K5SA 2JIZG 4BIZA 4W4LA 1GTOA 2G38A 5LGUA 3H9VA 3P32A 2DQ0A 3SYOA 3CHXA 1GK9A 4U3JB 4JAVA 4NKGB 4MS2A 2KG7B 4XDJA 4LWSA 2D2CB 4P9OA 4BR6A 1OCRC 1Q90D 2ODMA 5JQGB 1M4UA 3ABLB 3AG2B 4JYCA 1XMQO 1M90W 4UVBA 3SPJA 2ZKOA 1PL4A 4PDVA 3OD4A 2JEXA 4B3MB 4TUYA 5LMUB 4CS2A 3L72H 3O65A 1H2KA 4RWUA 1Y76B 3RYCA 5LA6A 1HR0O 3ZS8C 1I7FA 3PN1A 3T1YO 3TXSA 2RJZA 3TK1A 2Y48A 2P7TC 3SYCA 1K7DA 3JATA 1SA0B 4DV3O 1I0HA 1N34O 4LWSB 4YIPA 4DR2B 1N0JA 2HP8A 3AG1B 1FFXA 5D5PA 1WP7A 5B1AB 4HNAA 3UQ8A 2NLJC 3JSNA 2WLMA 1EN4A 4JI0B 3RW0A 1Y6XA 4WFEA 1WB8A 3K03A 3ZHVA 3JAWB 1OCOC 4JI6O 5F2VO 1GM8A 4XBFA 5L3EA 2OTLV 3JARA 1MA1A 3CYOA 1XEQA 4O4JA 3ZN1A 3CXHF 5J2TB 1SQVH 1XNRB 3G71V 3ABKB 3CJHA 3HKDB 1NI8A 4X64B 3HPLC 1AVMA 4XDLA 3HKBB 4GKJB 4TV8B 1OCRB 4MTXA 1ZL8A 2D3OW 2VQFB 4X62O 4DV7B 3E8FA 1SQFA 4R7CA 4LFAO 1EZJA 2VWJA 5LXTA 5L3CA 1SESA 4R50A 2P4VA 1DF4A 4B7KA 1SS3A 4O4HA 4IIJA 2EULA 2QM7A 3MD0A 4N23A 5CA3A 2QM4A 1AP5A 1TVKA 3C3SA 4EKWA 4RQFA 1Q3EA 1KKCA 1PL0A 3ABLC 4Z1VA 1GN4A 3SDLA 5DEDA 1IBKB 1J95A 4J7ZA 2QEXV 4J11A 4DV6O 4DR4O 4JV5O 5E1AC 3UT5A 4JYAO 3D36C 4OXSA 4EB6B 1K3EA 2JS3A 3FB8C 5K1PA 3BVOA 2BE3A 4DV1B 2Z5UA 4FJCC 1S76D 5KMGA 1E1RG 4OGQB 1HNXB 4K3AA 3ZCCA 3KKYA 2NR5A 3A8TA 2DW4A 4JI4B 3N2GB 4GUNA 4O4IA 2JEUA 3RYFB 2HEPA 1XILA 3AG3B 2P67A 5BR8O 3ICXA 3LNNA 4CS4A 1N0NA 2XAGA 2UUBB 1VQ9V 1FD9A 4X1YB 3O9OA 3RN4A 2QWOB 1Q6HA 5FL7G 4NXNB 5EYPA 4QNHB 1NBMG 4I4TA 2HG5C 4FZ1A 4HAMA 1S5HC 3LUTB 1DLBA 5ITZA 1N33B 1JJ2U 4B3TB 1QR9A 2QKCA 1M93A 2WWWA 4ASUG 1Q7YW 4GX0A 4RUEA 3M7MX 2ZM6B 3OEEG 1B3QA 4LBEC 4LF4B 5HFLA 1VIBA 1V54B 4UCRA 4DV5O 1WPBA 3A0BZ 4KUMA 4FLTA 3AG4B 1WP8A 3CD6V 2XAQA 4DV7O 1Q43A 3OW2U 2ZE8A 2OYQA 1HNXO 2DOSA 1H2NA 2XHBA 1QLEB 2YIDA 4EFEA 1N36B 5CN0A 3E89A 1JPXA 5KHGA 3K58A 1O9HA 4QE7A 5ITZB 1N32O 1ZUQA 4YY3O 2AXTZ 3LDDA 1FJGB 2N04A 2OIGA 3HKBA 4A5UB 3R66A 1YEWA 2RCVA 2LO1A 1EZVH 1XOUA 1AR4A 3VOUA 1KUQA 1F51A 2AZ0A 2FMLA 4ZKIA 4TV9B 4GLXA 4DR6B 3HKCB 1NTKH 4B7EA 5IYZB 1SZTA 1AJQA 1NT2B 4HBNA 2X6CA 2Q7GA 1BZKA 1I5XA 5CA0A 3CCUV 1VQ6V 2CUGA 3BPZA 4LCUC 2PTMA 2GHYA 5KUKA 5J2UA 4CH5A 3F7YC 3G6BA 2E74B 1K4CC 4DV0B 2WLJA 1Y4MA 2PY5A 3RVZA 1XMOB 3H01A 1H8EG 1FKAO 3ZHUA 3D3IA 1BGYH 1L0NH 4X66O 2UUBO 5C8YB 2R9RB 5IYBO 4PA6A 5GTIZ 4JASA 2ZXWC 5EZYB 1NVPB 3BA8A 1GMGA 2QWRB 4MT8A 4D6TH 4WCEV 1UJWB 4OPHA 4X20B 5EK0A 1XNRO 2OCCC 5KA6A 2H8PC 5LA6B 2EIKB 3T4ZA 5J2TA 3E35A 1AILA 5B3SC 4AQYO 2WLLB 2DYRB 2HHHO 2UXDO 1K8AW 1H2MA 1H2GA 2P90A 5L3FA 2L35A 2XAFA 2R9AA 1AI4A 1G4YB 2P6JA 2ZQMA 1RM1B 4JAUA 2F95B 3GB7C 1BHAA 4KP4A 4FLUA 2EILC 3RGBA 1AI6A 1ZWIC 5LXTB 1VQMV 1R73A 2ZNJA 3STZC 4LF5O 2IM9A 3ASOB 2LFRA 2XAJA 5AG2A 3UT5B 2OCHA 3DTUB 4CH3A 2JGDB 1XHZA 3S3XA 1NH2B 3OUSA 2X6BA 1W2BU 3H1KH 1NS1A 1WLEA 1AR1B 2A79B 1YTFB 1VQ7V 3QG5A 4JI1O 1KD1W 2A3QA 5FPOA 1N8RW 4H0LB 4MSWC 2RNBA 1D2DA 1EN6A 3ETDA 1RPOA 1US6A 5DECA 2QKSA 1H38A 3H1LH 3CS5A 3K9SA 3IJ4A 3GWKC 4DR3O 3EHBB 1COWG 2EIJC 3S3WA 1SETA 4RAIA 4J42A 1NU1H 3OTOB 3FX7A 3WB2A 1W0JG 1SA0A 1S77D 5BY1A 4O2BA 2PF4E 3APQA 3SYAA 4IGGA 3ZMUA 4H37A 5TISZ 3L70H 1MABG 4CH4A 3IC9A 1FFXB 1HNZO 3K79A 4HNAB 5JVDB 4LF7B 1LUVA 1YIJV 4OPAA 1BCCH 2L6LA 4WFBV 2RQ6A 3K0DA 3OFNG 3CCMV 5B3SB 1PPJH 2P4KA 1QBZA 1NZ6A 2BSKA 4WBNA 4IYIA 4LFCO 1Y66A 1IXMA 1FXHA 1VF6C 4I0XA 4JI3B 5KX5A 1TUBA 4DR1O 3J7AU 1YTFD 4ICGA 2ZR2A 3GVMA 3UM7A 1QCEA 2ZINA 4YHHO 2Y0PA 3ZRSA 2E3CA 3ZIAG 1YJ9V 3AK2A 1EFRG 2ZE5A 1RSOA 4GT1A 3F7VC 3NR7A 1YZBA 2PI5A 4I7ZB 1MNGA 1VMGA 4UFZA 3DC6A 4IHJB 2HFEC 1JFFB 1R3IC 1HR0B 3I56V 4BW5A 3D8CA 4GX1A 4FMTA 5KX5B 4UB8Z 1QLEC 4B3SO 1Q6IA 4JI6B 4MTOA 2N05A 1GM9A 2UXBB 4Q20A 5BMVA 1P49A 1KU9A 4J80A 2V1DA 3SGIA 2P5OA 4LFCB 1R6TA 4PELA 1AI7A 1YXBA 3T1CA 3MAQA 2Q67A 4TUYB 1PKXA 2ZDIA 5LYJA 2EIJB 3KCXA 1HNWB 1SQXH 2QWQB 1IZ3A 3SJCC 1S0VA 5EC2C 4PI2A 5IYZA 1ORQC 4X62B 2LJ2A 1I94B 1WN7A 4UCTA 2XT9A 1GKFA 5LP6A 2LGQA 1WA8A 2EINC 2Q9LA 4B3RB 5H2FZ 5FPRA 3ZHSA 1SRYA 3CWBH 4YIOA 4WFGA 3E8BA 2F23A 1Q86W 5A2QN 1XL6A 1EBOA 1XQ8A 4PDLA 1GN2A 4LFAB 2HJFC 2E5LO 2P06A 1NQTA 1A32A 2XNDG 1G8MA 3W7UA 1L0LH 2IJIA 3H1JH 5GONA 3TCUA 5CB4B 4JI8O 4JYAB 4MVQA 4R6ZA 3K5LA 4DO2A 4DXWA 2A7WA 3DXRA 4BIUA 1GN6A 4QE9A 2K9PA 4ZBMA 5C8YA 2R70A 3CJHB 1ZAUA 3CSXA 3OE7G 3RYHA 2YDEA 3ZRWB 2VRZA 4UV9A 4FIPC 3AK1A 4NXNO 4JV5B 4O4HB 4JAAA 1L8DA 2O57A 2Q4PA 3BRCA 1S5LZ 2GTAA 2LP7A 3AG1C 3OMAB 1M9NA 1N33O 2JK5C 2JDIG 1SQBH 4TQDA 3OGIB 3AG4C 1VF6A 3E22B 5BR8B 3AG2C 3T2MA 3ZJZA 1I94O 2OWOA 1IBMB 4ZIBA 1KP2A 1H2SB 2Q6AA 2F4VB 4EB6A 4QJFB 3JASA 3LNMB 3B2EE 5IJ9B 2ZM6O 5H9CA 5L3DA 4B3TO 2ZCEA 2BOCC 3OTOO 5BZBA 3OT7A 2OT5A 3JAWA 4H13B 3G6EV 5JVDA 2PI4A 3CRCA 4PDRA 3HKEA 1WNSA 1K34A 4MTGA 4Q6GA 3KZIZ 5EC1C 4MVUA 1FJGO 2FYUH 4B3MO 1P84F 3RBZA 2Q7HA 3N2GA 3CRMA 2JJ2G 4P9PA 1ZL8B 4GKKO 3JALA 1Q82W 4RQEA 3LDEA 2WAMA 4WFAV 2ARHA 1SQPH 3ZRXA 4QIWF 4O2AB 1IX9A 5LYJB 2ITDC 3CCSV 4JI3O 4DR1B 3L9DA 2CTRA 1FXVA 3JSLA 1GAXA 4J7JA 1KKDA 3RFRA 4DW1A 2AGAA 4IL6Z 3K5OA 1AJPA 2KSDA 2MK3A 2LGWA 1P7BA 3UO2A 2IJKA 4J9ZB 3SPCA 1URFA 2BTOA 1GH6A 2XASA 3ETGA 1XMOO 5KLVH 3D3QA 1U96A 1JX9A 1K5QA 1YVWA 1S3JA 3BCCH 1IBKO 4X66B 5CBHA 2OCCB 3SJAC 3J81N 1MG1A 2DWEC 3K0GA 3CMAV 3IFXA 1N4CA 4J10A 4DUYB 4PA7A 1IVSA 2AHYA 2P22C 4DK1A 1VQKV 4H44B 2R72A 4LH6A 2YIBD 3FFQA 3OR7C 1G1XB 1PNKA 4R8CA 2X0LA 2KQXA 5LOVB 4FLZA 3R65A 2WA4A 4CZZA 1V9PA 2JGDA 3MHHC 5IY5B 3N2KA 4YJ3B 5LMNO 1G6UA 2A9HA 3DC5A 3CMEV 1J5EB 4QPJA 5DM6V 1VF7A 3K5NA 3QNEA 5K1XA 1VQ4V 4B08A 3SYQA 1ZTEA 5FNVA 3CPWU 3FYIB 3WB0A 4Z2WA 1PV0A 3ZHQA 4LF9B 3CCRV 4UVCA 1K9MW 1ENVA 1BMFG 1XBLA 2Y4TA 2F93B 1QHTA 4LH7A 1D5NA 5GW7A 3W7TA 1M1KW 4J41A 1AI5A 3ZEDA 1NH2D 1NVPD 3TJTA 1T5EA 4RO2A 1Q81W 3B8NA 1SC5B 3K04A 2DE0X 5B1BC 2YI9A 1PNMA 4X9QA 1FAFA 2CE4A 2YIBA 2YICA 2Z0AA 1SQQH 1Q5OA 2CTQA 4DV5B 1YSCA 1YITV 3E8GA 5EZYA 2GDSA 5LP6C 3SR2C 4GX2A 2Q0OC 3BABA 2UXNA 3X2QC 3H1HH 1OJHA 5GONB 3Q4HB 3WB1A 2UUAB 2Z3YA 4JI1B 3STLC 4GCZA 3T1HO 4TV8A 1WAZA 3CRRA 3QF7A 4U3FH 4DUYO 2ZIMA 3K9AA 1BQZA 4LNUB 1FXKA 1BT8A 4LF5B 4ZHQA 2YUAA 3OUFA 2B9ZA 2WLKA 4LF7O 4NVPA 2CTPA 2AW9A 3U10A 1SKVA 1PD3A 2R9IA 2WLLA 5LP6B 3RYHB 3OMNB 3B40A 1OCZC 4FM1A 4K0KB 1R3JC 4LF8B 3EVKA 5IYCO 2VQEB 1HDJA 2FB5A 5BXZA 3BEHA 1Y76A 3G80A 5CB4A 4PDMA 2K1EA 4O4LA 5CA0B 1SF9A 1NR1A 4GKJO 5IJ9A 3P3PA 2X6AA 2HR3A 1J5EO 2ZT9B 2OTJV 1SERA 3WFVA 1VQ8V 4DV0O 2DQ3A 2IH1C 2XOKG 2V7QG 3JAKA 1TAEA 3FAVB 4G27B 3BAAA 2EIMB 2JVDA 1BHBA 2RMKB 2Y69B 3RYFA 4YHHB 2VQFO 1THZA 3MHSC 4WFHA 3WU2Z 1MSDA 5IE9A 4DR6O 3QTCA 4LC1A 3CP1A 3K08A 5KA5A 2GV9A 1V54C 2E76B 4JTDB 3CCQV 4YJ3A 1AJNA 2HVKC 1FXKC 2F1MA 1TGOA 1B04A 3CEIA 4FLXA 3U0ZA 2QWPB 2UUCO 3G67A 5JWPA 3ZHTA 4DV2O 3U11A 4PI0A 3ML0A 4XDKA 4I0XB 3APOA 4KL1A 1QLNA 2Q0AA 1MSWD 3JD3A 2UUAO 4DR4B 1IURA 4TOIA 1Q6UA 4MVOA 4K0KO 2A0LA 2Q7EA 1BQ0A 4MTFA 1RSOB 1JMKC 1XREA 2HLDG 2UXCO 4OX9O 2QE7G 1R3KC 4DYLA 3A0HZ 1KBHA 2MW2B 2DYSC 4U7NA 1KMIZ 4JI2O 3LSUA 1NR7A 4CH6A 1F23A 4GZRB 4TSFG 1D5AA 4ZI7A 5LHHA 1JQ0A 5L3BA 1ZLZA 3SJQC 1GM7A 3OR6C 3J80N 2M7WA 2QR4A 1M57C 4LF9O 4J9YB 5EBLC 5C93A 1Z5VA 4X1KA 1XUQA 2QJ1A 4EEQA 4DR7O 2PYJA 4BWAA 4O2BB 3RYIA 4DW0A 1N32B 2LQTA 4L87A 4YY3B 2GUZA 2ADQB 4NTYA 4LF6O 1XMQB 2XUMA 4UUJC 3JCUZ 1H2LA 3AG3C 3CCJV 1P4RA 4NXMB 4KFMA 3CC7V 4J7KA 1FS0G 1WB7A 5JH7B 3HB3B 3ASNB 4X20A 1QU7A 5LGNA 3N2KB 2IU3A 1WPXA 3E83A 1QNMA 4X64O 1NKDA 1SZXA 4O4JB 3OAAG 3CCEV 3K3WA 5CBFA
chains in the Genus database with same CATH topology
4IYIA 4J41A 4J42A 4J7KA 4J10A 2GTSA 4W4KA 4J7JA 4KXRA 4IYHA 4J11A 4W4LA 3FX7A 2G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYI A;  4J41 A;  4J42 A;  4J7K A;  4J10 A;  2GTS A;  4W4K A;  4J7J A;  4KXR A;  4IYH A;  4J11 A;  4W4L A;  3FX7 A;  2G38 A; 
#chains in the Genus database with same CATH topology
 4MVS A;  3F5W C;  4QPK A;  1DGS A;  2CH7 B;  5LOV A;  3K5M A;  1CEZ A;  4K35 A;  2ETN A;  1R1B A;  1M5I A;  1KYO F;  2PGG A;  5IJ0 A;  1W59 A;  2YXL A;  2H3O A;  2IJH A;  2ZD9 A;  2CK3 G;  2N74 A;  2EX3 A;  3G4S V;  4PA9 A;  3LSS A;  3CXC U;  5KAI Z;  1L1F A;  1IBL B;  2ZIO A;  1CXZ B;  1BS3 A;  3H1I H;  3DXR B;  1K33 A;  3L75 H;  1BSM A;  1PNL A;  3F5T A;  1LNQ A;  2VS0 A;  5H6R A;  2DYS B;  2Y4U A;  3QVN A;  2UXB O;  1OZ0 A;  2YSU B;  2UXD B;  3VBB A;  4JZ2 A;  4NR1 A;  4DRX A;  3B4S A;  4N21 A;  4X1Y A;  4UB6 Z;  2QDO A;  2VWK A;  3N27 A;  4MW3 A;  2EJR A;  3MDS A;  5B1B B;  3AG7 A;  1VAR A;  2B5U A;  1VEW A;  3W7X A;  3T1Y B;  4TV9 A;  3OGC C;  1LUW A;  1Y74 A;  4AI8 A;  3HKC A;  4MVR A;  2DYR C;  5KMG B;  2LFS A;  1IXB A;  3C3T A;  3X2Q B;  4GKK B;  2YXY A;  4B3S B;  3HKD A;  2ZDI C;  1YJW V;  4I55 B;  1JR9 A;  4JI4 O;  1F4N A;  4X1I B;  5DN6 G;  4ZI7 B;  4GYC B;  4D7S A;  1JVM A;  1WJZ A;  4PJ0 Z;  3RVY A;  4F6R B;  1JA8 A;  4X88 A;  2KB1 A;  3CE2 A;  3TGU H;  4DR5 O;  3FB7 C;  4W4K A;  1TVK B;  3OEH G;  2WLN A;  1KB9 F;  2JS5 A;  4IYH A;  3CX5 F;  3P30 A;  1OCZ B;  3RYI B;  1JOY A;  2WLI B;  4PA3 A;  3ZHR A;  5KHI A;  4UCV A;  3NXS A;  3HKE B;  4FFB A;  1JCH A;  2EBO A;  4NTW A;  1TUB B;  3UCS C;  3DGE A;  4BIO A;  1O9G A;  5EIB C;  2CTW A;  2BTQ B;  2QSA A;  3CRQ A;  3D36 A;  4E4E A;  1JJO A;  5KAF Z;  4X1I A;  1KEC A;  3L71 H;  1N36 O;  2GSM B;  3KG2 A;  4FPP A;  5FNV B;  5JH7 A;  2W6J G;  1HW7 A;  5EIB D;  3JAK B;  3ZX6 A;  4O2A A;  4DR3 B;  3CC2 V;  4OX9 B;  5J9P C;  5IWA O;  4HYO A;  4I50 B;  3JAT B;  1RFY A;  1UPG A;  3AK3 A;  4DR7 B;  4B3R O;  1VQL V;  1E1Q G;  3THO A;  3CCV V;  4JGS A;  5BMV B;  2CGO A;  2B1I A;  3IC7 A;  3QO7 A;  1CPY A;  4DR5 B;  2IH3 C;  2B1G A;  2FTK A;  5B1N A;  1RP3 B;  2RDC A;  2QA4 V;  4U3J A;  3OMI B;  4JPR A;  3T4D A;  4DUZ O;  1RPR A;  2Y0I A;  3Q4H A;  4JF3 A;  1M57 B;  4F4L A;  5JQG A;  4DV1 O;  1VP7 A;  3A0R A;  3ETE A;  1B6Q A;  4LR3 A;  3BA9 A;  3IGA C;  4JI7 B;  1K97 A;  4I9W A;  3DSQ A;  2GUZ B;  2Q73 A;  5J2U B;  4HZ3 A;  4DV6 B;  5IDJ A;  1EN5 A;  2OIE A;  4UVA A;  4UCS A;  3FAV A;  3RYC B;  4YXW G;  4MVM A;  2W0F C;  2QTO A;  1U97 A;  1MZF A;  4P30 A;  4CS3 A;  3EFF K;  2NNU A;  3VQV A;  4X1K B;  4FZ0 A;  3W7W A;  1VQN V;  1OHH G;  2CH7 A;  1IBL O;  3T1H B;  3IAY A;  2IU0 A;  1K92 A;  3ABM B;  2FL4 A;  4LF8 O;  3M8A A;  4UCU A;  2RN9 A;  4X89 A;  2XTA A;  3E2E A;  5IWA B;  3ETQ A;  5EBM C;  4DK0 A;  1PM9 A;  2XAH A;  3CC4 V;  1NTM H;  3K59 A;  5JJJ B;  1OV9 A;  4NXM O;  3JCZ A;  1MZE A;  4KHP B;  2KKW A;  1F7Y A;  1SQG A;  5KHJ A;  2A06 H;  1DTO A;  5LBQ A;  2JGU A;  1PP9 H;  1S5J A;  1HNW O;  4FLV A;  2WSS G;  1QR8 A;  1B06 A;  4BW9 A;  5JCO C;  3TET A;  4JI8 B;  4DV4 O;  4LNU A;  2H94 A;  5FLX N;  2QGN A;  3JD2 A;  1X59 A;  1IDS A;  1ARO P;  2ATK C;  4G28 B;  3B8M A;  1AR5 A;  4FK5 C;  1RM1 C;  4UXN A;  2HVJ C;  4JI0 O;  4UCO A;  2E5L B;  4FLW A;  1YF2 A;  4DV3 B;  4FFK A;  3JAS B;  4JZG A;  3CCL V;  4DUZ B;  3FD9 A;  5IY5 C;  5D5Q A;  2UXC B;  1M56 B;  3ZN0 A;  3P3N A;  1LR1 A;  5B5E Z;  4JYY A;  4NB5 A;  2ZXW B;  1GN3 A;  5LL6 Y;  3SPI A;  1IBM O;  2YEV A;  1F4M A;  4DRX B;  1OCC C;  2F4V O;  3SJB C;  2IJJ A;  1WA8 B;  4X8A A;  1VQP V;  2JJ1 G;  4FLY A;  1XNQ O;  5H6Q A;  4PV1 B;  4JI2 B;  2F66 C;  1MOF A;  1X4T A;  2YXH A;  4KHP O;  4JTA B;  1M56 C;  3JAL B;  1R6K A;  3BHP A;  4JI5 B;  2UXX A;  4X65 O;  4ZOL B;  4JTC B;  1K4D C;  5CBG A;  1Y74 B;  4CC6 A;  2QKA A;  1UFI A;  5B1O A;  1XHX A;  1QVG U;  3B09 A;  4L8J A;  4E2L A;  2Y69 C;  4I50 A;  2EJ7 A;  3BFR A;  3QO8 A;  5HFM A;  2UU9 O;  4G2K A;  2CAZ C;  5JCO A;  2FKX A;  3AEI A;  3ZMZ A;  3GWO A;  4PD4 F;  1ZSP A;  3ABT A;  3BY6 A;  4PA4 A;  5A9G A;  4O4L B;  4P2Z A;  4LP8 A;  4AIL C;  4AQY B;  2KG7 A;  4WFF A;  1VQ5 V;  4Z1M G;  3W7S A;  2ITC C;  4YJ2 A;  2X7R B;  1GRJ A;  1FYJ A;  2DMX A;  3JAM N;  2F43 G;  4C7U A;  1Z5W A;  3JD0 A;  2DN9 A;  2ILM A;  4BAY A;  3QO5 A;  3WG7 B;  5IJ0 B;  4JI5 O;  2WPD G;  4WBN B;  2Q5Z A;  2VQE O;  3UO3 A;  5CA1 A;  5B1A C;  4IIJ B;  5LMN B;  2BOB C;  4GX5 A;  2YC0 A;  1OCO B;  4I55 A;  2HHH B;  2PZS A;  4EFB A;  2Q68 A;  2AHZ A;  1AP6 A;  4KXR A;  3B77 A;  1HNZ B;  2EIM C;  4RUF A;  4F6R A;  2E75 B;  1XNQ B;  4QGP A;  3K06 A;  5LHI A;  5KUM A;  2GBO A;  1QVF U;  1BL8 A;  4NTX A;  3ZRV A;  4UV8 A;  5E79 Z;  2LW1 A;  1V55 C;  4LF4 O;  2IBZ H;  4F6E A;  2AZ2 A;  2NN4 A;  4ZHQ B;  1YI2 V;  2W0X A;  2C2A A;  5CA1 B;  3FYE B;  4AHC A;  1VQO V;  4LFB B;  3ZMS A;  2PYL A;  2EIK C;  4I9Q A;  3UKM A;  4O4I B;  5KHH A;  2ZE6 A;  4K8X A;  3L73 H;  5CMU A;  3I55 V;  4TQF A;  4DV2 B;  3ZRW A;  1KQS U;  4FM0 A;  4TT3 G;  2HKO A;  2DJV A;  2EZO A;  2UU9 B;  3CB2 A;  3ZMT A;  1HWY A;  5IT9 N;  4CC5 A;  2PUS A;  1ZX3 A;  5GTH Z;  2CGN A;  3WG7 C;  1CP9 A;  2QWN B;  5L3G A;  3VQY A;  1VF5 B;  5LGT A;  5JJE B;  5LHG A;  2YIA A;  2ZE7 A;  3EXA A;  4MVZ A;  3L74 H;  1NJI W;  4D7T A;  2M6Y A;  2IW5 A;  3M99 B;  3JAR B;  3ASN C;  3JD4 A;  2WLI A;  5EBW C;  4MW8 A;  1FPO A;  1P7G A;  3JYC A;  2YI8 A;  3C90 A;  4NYK A;  4U7O A;  4H33 A;  4FM2 A;  1S72 V;  4I5S A;  3TXQ A;  1NTZ H;  1K73 W;  3HR0 A;  4K8Z A;  1XI1 A;  3LSQ A;  1I08 A;  5JJN B;  3SYP A;  5B66 Z;  5IYD O;  2ZNI A;  3E86 A;  1XL4 A;  1QQC A;  4DV4 B;  1XDC A;  3ABM C;  2EIL B;  3SPH A;  4YJ2 B;  3OTF A;  4JYB A;  4LFB O;  1R3L C;  1Q8I A;  4FVM A;  1I5Y A;  5EYP B;  1YJN V;  1R6N A;  3VQW A;  1TA8 A;  3RT3 C;  4IHJ A;  2Q69 A;  1DK1 A;  2W6I G;  1YDX A;  3PJS K;  2GTS A;  1KC8 W;  4CBC A;  3E22 A;  3ZBH A;  1Y67 A;  1YHQ V;  1FFT B;  3FKS G;  3A2F A;  3E8H A;  1V55 B;  2ZR3 A;  1MMM A;  2LW7 A;  5H5N A;  4FFB B;  2YEV B;  3FB6 C;  4ZOL A;  3K57 A;  3ABU A;  4LF6 B;  3KCY A;  1FXK B;  4ABM A;  2EZP A;  2UUC B;  3ZMV A;  2V4D A;  2EIN B;  2BSK B;  2WA3 A;  1W0K G;  1DF5 A;  4JI7 O;  1TUE B;  2YS8 A;  2Q8V A;  2JRI A;  2QTS A;  5LMU O;  1YCI A;  2BTQ A;  1Z2G A;  3LDC A;  4I4T B;  1BE3 H;  3OM3 B;  1GO3 F;  1E79 G;  3CRA A;  2DWD C;  4WF9 V;  4X65 B;  1H8H G;  2BCC H;  4IT5 A;  1ROP A;  3SPG A;  2HJD A;  2QM8 A;  3RWR D;  1KP3 A;  2ADP A;  3ABK C;  3VQX A;  2WLH A;  5KHK A;  4TWK A;  1EM1 A;  2CDY A;  3ASO C;  1N34 B;  4PHZ A;  1HP8 A;  3FB5 C;  1AB3 A;  3I5D A;  1OCC B;  1JFF A;  3JD1 A;  4DR2 O;  1K5S A;  2JIZ G;  4BIZ A;  4W4L A;  1GTO A;  2G38 A;  5LGU A;  3H9V A;  3P32 A;  2DQ0 A;  3SYO A;  3CHX A;  1GK9 A;  4U3J B;  4JAV A;  4NKG B;  4MS2 A;  2KG7 B;  4XDJ A;  4LWS A;  2D2C B;  4P9O A;  4BR6 A;  1OCR C;  1Q90 D;  2ODM A;  5JQG B;  1M4U A;  3ABL B;  3AG2 B;  4JYC A;  1XMQ O;  1M90 W;  4UVB A;  3SPJ A;  2ZKO A;  1PL4 A;  4PDV A;  3OD4 A;  2JEX A;  4B3M B;  4TUY A;  5LMU B;  4CS2 A;  3L72 H;  3O65 A;  1H2K A;  4RWU A;  1Y76 B;  3RYC A;  5LA6 A;  1HR0 O;  3ZS8 C;  1I7F A;  3PN1 A;  3T1Y O;  3TXS A;  2RJZ A;  3TK1 A;  2Y48 A;  2P7T C;  3SYC A;  1K7D A;  3JAT A;  1SA0 B;  4DV3 O;  1I0H A;  1N34 O;  4LWS B;  4YIP A;  4DR2 B;  1N0J A;  2HP8 A;  3AG1 B;  1FFX A;  5D5P A;  1WP7 A;  5B1A B;  4HNA A;  3UQ8 A;  2NLJ C;  3JSN A;  2WLM A;  1EN4 A;  4JI0 B;  3RW0 A;  1Y6X A;  4WFE A;  1WB8 A;  3K03 A;  3ZHV A;  3JAW B;  1OCO C;  4JI6 O;  5F2V O;  1GM8 A;  4XBF A;  5L3E A;  2OTL V;  3JAR A;  1MA1 A;  3CYO A;  1XEQ A;  4O4J A;  3ZN1 A;  3CXH F;  5J2T B;  1SQV H;  1XNR B;  3G71 V;  3ABK B;  3CJH A;  3HKD B;  1NI8 A;  4X64 B;  3HPL C;  1AVM A;  4XDL A;  3HKB B;  4GKJ B;  4TV8 B;  1OCR B;  4MTX A;  1ZL8 A;  2D3O W;  2VQF B;  4X62 O;  4DV7 B;  3E8F A;  1SQF A;  4R7C A;  4LFA O;  1EZJ A;  2VWJ A;  5LXT A;  5L3C A;  1SES A;  4R50 A;  2P4V A;  1DF4 A;  4B7K A;  1SS3 A;  4O4H A;  4IIJ A;  2EUL A;  2QM7 A;  3MD0 A;  4N23 A;  5CA3 A;  2QM4 A;  1AP5 A;  1TVK A;  3C3S A;  4EKW A;  4RQF A;  1Q3E A;  1KKC A;  1PL0 A;  3ABL C;  4Z1V A;  1GN4 A;  3SDL A;  5DED A;  1IBK B;  1J95 A;  4J7Z A;  2QEX V;  4J11 A;  4DV6 O;  4DR4 O;  4JV5 O;  5E1A C;  3UT5 A;  4JYA O;  3D36 C;  4OXS A;  4EB6 B;  1K3E A;  2JS3 A;  3FB8 C;  5K1P A;  3BVO A;  2BE3 A;  4DV1 B;  2Z5U A;  4FJC C;  1S76 D;  5KMG A;  1E1R G;  4OGQ B;  1HNX B;  4K3A A;  3ZCC A;  3KKY A;  2NR5 A;  3A8T A;  2DW4 A;  4JI4 B;  3N2G B;  4GUN A;  4O4I A;  2JEU A;  3RYF B;  2HEP A;  1XIL A;  3AG3 B;  2P67 A;  5BR8 O;  3ICX A;  3LNN A;  4CS4 A;  1N0N A;  2XAG A;  2UUB B;  1VQ9 V;  1FD9 A;  4X1Y B;  3O9O A;  3RN4 A;  2QWO B;  1Q6H A;  5FL7 G;  4NXN B;  5EYP A;  4QNH B;  1NBM G;  4I4T A;  2HG5 C;  4FZ1 A;  4HAM A;  1S5H C;  3LUT B;  1DLB A;  5ITZ A;  1N33 B;  1JJ2 U;  4B3T B;  1QR9 A;  2QKC A;  1M93 A;  2WWW A;  4ASU G;  1Q7Y W;  4GX0 A;  4RUE A;  3M7M X;  2ZM6 B;  3OEE G;  1B3Q A;  4LBE C;  4LF4 B;  5HFL A;  1VIB A;  1V54 B;  4UCR A;  4DV5 O;  1WPB A;  3A0B Z;  4KUM A;  4FLT A;  3AG4 B;  1WP8 A;  3CD6 V;  2XAQ A;  4DV7 O;  1Q43 A;  3OW2 U;  2ZE8 A;  2OYQ A;  1HNX O;  2DOS A;  1H2N A;  2XHB A;  1QLE B;  2YID A;  4EFE A;  1N36 B;  5CN0 A;  3E89 A;  1JPX A;  5KHG A;  3K58 A;  1O9H A;  4QE7 A;  5ITZ B;  1N32 O;  1ZUQ A;  4YY3 O;  2AXT Z;  3LDD A;  1FJG B;  2N04 A;  2OIG A;  3HKB A;  4A5U B;  3R66 A;  1YEW A;  2RCV A;  2LO1 A;  1EZV H;  1XOU A;  1AR4 A;  3VOU A;  1KUQ A;  1F51 A;  2AZ0 A;  2FML A;  4ZKI A;  4TV9 B;  4GLX A;  4DR6 B;  3HKC B;  1NTK H;  4B7E A;  5IYZ B;  1SZT A;  1AJQ A;  1NT2 B;  4HBN A;  2X6C A;  2Q7G A;  1BZK A;  1I5X A;  5CA0 A;  3CCU V;  1VQ6 V;  2CUG A;  3BPZ A;  4LCU C;  2PTM A;  2GHY A;  5KUK A;  5J2U A;  4CH5 A;  3F7Y C;  3G6B A;  2E74 B;  1K4C C;  4DV0 B;  2WLJ A;  1Y4M A;  2PY5 A;  3RVZ A;  1XMO B;  3H01 A;  1H8E G;  1FKA O;  3ZHU A;  3D3I A;  1BGY H;  1L0N H;  4X66 O;  2UUB O;  5C8Y B;  2R9R B;  5IYB O;  4PA6 A;  5GTI Z;  4JAS A;  2ZXW C;  5EZY B;  1NVP B;  3BA8 A;  1GMG A;  2QWR B;  4MT8 A;  4D6T H;  4WCE V;  1UJW B;  4OPH A;  4X20 B;  5EK0 A;  1XNR O;  2OCC C;  5KA6 A;  2H8P C;  5LA6 B;  2EIK B;  3T4Z A;  5J2T A;  3E35 A;  1AIL A;  5B3S C;  4AQY O;  2WLL B;  2DYR B;  2HHH O;  2UXD O;  1K8A W;  1H2M A;  1H2G A;  2P90 A;  5L3F A;  2L35 A;  2XAF A;  2R9A A;  1AI4 A;  1G4Y B;  2P6J A;  2ZQM A;  1RM1 B;  4JAU A;  2F95 B;  3GB7 C;  1BHA A;  4KP4 A;  4FLU A;  2EIL C;  3RGB A;  1AI6 A;  1ZWI C;  5LXT B;  1VQM V;  1R73 A;  2ZNJ A;  3STZ C;  4LF5 O;  2IM9 A;  3ASO B;  2LFR A;  2XAJ A;  5AG2 A;  3UT5 B;  2OCH A;  3DTU B;  4CH3 A;  2JGD B;  1XHZ A;  3S3X A;  1NH2 B;  3OUS A;  2X6B A;  1W2B U;  3H1K H;  1NS1 A;  1WLE A;  1AR1 B;  2A79 B;  1YTF B;  1VQ7 V;  3QG5 A;  4JI1 O;  1KD1 W;  2A3Q A;  5FPO A;  1N8R W;  4H0L B;  4MSW C;  2RNB A;  1D2D A;  1EN6 A;  3ETD A;  1RPO A;  1US6 A;  5DEC A;  2QKS A;  1H38 A;  3H1L H;  3CS5 A;  3K9S A;  3IJ4 A;  3GWK C;  4DR3 O;  3EHB B;  1COW G;  2EIJ C;  3S3W A;  1SET A;  4RAI A;  4J42 A;  1NU1 H;  3OTO B;  3FX7 A;  3WB2 A;  1W0J G;  1SA0 A;  1S77 D;  5BY1 A;  4O2B A;  2PF4 E;  3APQ A;  3SYA A;  4IGG A;  3ZMU A;  4H37 A;  5TIS Z;  3L70 H;  1MAB G;  4CH4 A;  3IC9 A;  1FFX B;  1HNZ O;  3K79 A;  4HNA B;  5JVD B;  4LF7 B;  1LUV A;  1YIJ V;  4OPA A;  1BCC H;  2L6L A;  4WFB V;  2RQ6 A;  3K0D A;  3OFN G;  3CCM V;  5B3S B;  1PPJ H;  2P4K A;  1QBZ A;  1NZ6 A;  2BSK A;  4WBN A;  4IYI A;  4LFC O;  1Y66 A;  1IXM A;  1FXH A;  1VF6 C;  4I0X A;  4JI3 B;  5KX5 A;  1TUB A;  4DR1 O;  3J7A U;  1YTF D;  4ICG A;  2ZR2 A;  3GVM A;  3UM7 A;  1QCE A;  2ZIN A;  4YHH O;  2Y0P A;  3ZRS A;  2E3C A;  3ZIA G;  1YJ9 V;  3AK2 A;  1EFR G;  2ZE5 A;  1RSO A;  4GT1 A;  3F7V C;  3NR7 A;  1YZB A;  2PI5 A;  4I7Z B;  1MNG A;  1VMG A;  4UFZ A;  3DC6 A;  4IHJ B;  2HFE C;  1JFF B;  1R3I C;  1HR0 B;  3I56 V;  4BW5 A;  3D8C A;  4GX1 A;  4FMT A;  5KX5 B;  4UB8 Z;  1QLE C;  4B3S O;  1Q6I A;  4JI6 B;  4MTO A;  2N05 A;  1GM9 A;  2UXB B;  4Q20 A;  5BMV A;  1P49 A;  1KU9 A;  4J80 A;  2V1D A;  3SGI A;  2P5O A;  4LFC B;  1R6T A;  4PEL A;  1AI7 A;  1YXB A;  3T1C A;  3MAQ A;  2Q67 A;  4TUY B;  1PKX A;  2ZDI A;  5LYJ A;  2EIJ B;  3KCX A;  1HNW B;  1SQX H;  2QWQ B;  1IZ3 A;  3SJC C;  1S0V A;  5EC2 C;  4PI2 A;  5IYZ A;  1ORQ C;  4X62 B;  2LJ2 A;  1I94 B;  1WN7 A;  4UCT A;  2XT9 A;  1GKF A;  5LP6 A;  2LGQ A;  1WA8 A;  2EIN C;  2Q9L A;  4B3R B;  5H2F Z;  5FPR A;  3ZHS A;  1SRY A;  3CWB H;  4YIO A;  4WFG A;  3E8B A;  2F23 A;  1Q86 W;  5A2Q N;  1XL6 A;  1EBO A;  1XQ8 A;  4PDL A;  1GN2 A;  4LFA B;  2HJF C;  2E5L O;  2P06 A;  1NQT A;  1A32 A;  2XND G;  1G8M A;  3W7U A;  1L0L H;  2IJI A;  3H1J H;  5GON A;  3TCU A;  5CB4 B;  4JI8 O;  4JYA B;  4MVQ A;  4R6Z A;  3K5L A;  4DO2 A;  4DXW A;  2A7W A;  3DXR A;  4BIU A;  1GN6 A;  4QE9 A;  2K9P A;  4ZBM A;  5C8Y A;  2R70 A;  3CJH B;  1ZAU A;  3CSX A;  3OE7 G;  3RYH A;  2YDE A;  3ZRW B;  2VRZ A;  4UV9 A;  4FIP C;  3AK1 A;  4NXN O;  4JV5 B;  4O4H B;  4JAA A;  1L8D A;  2O57 A;  2Q4P A;  3BRC A;  1S5L Z;  2GTA A;  2LP7 A;  3AG1 C;  3OMA B;  1M9N A;  1N33 O;  2JK5 C;  2JDI G;  1SQB H;  4TQD A;  3OGI B;  3AG4 C;  1VF6 A;  3E22 B;  5BR8 B;  3AG2 C;  3T2M A;  3ZJZ A;  1I94 O;  2OWO A;  1IBM B;  4ZIB A;  1KP2 A;  1H2S B;  2Q6A A;  2F4V B;  4EB6 A;  4QJF B;  3JAS A;  3LNM B;  3B2E E;  5IJ9 B;  2ZM6 O;  5H9C A;  5L3D A;  4B3T O;  2ZCE A;  2BOC C;  3OTO O;  5BZB A;  3OT7 A;  2OT5 A;  3JAW A;  4H13 B;  3G6E V;  5JVD A;  2PI4 A;  3CRC A;  4PDR A;  3HKE A;  1WNS A;  1K34 A;  4MTG A;  4Q6G A;  3KZI Z;  5EC1 C;  4MVU A;  1FJG O;  2FYU H;  4B3M O;  1P84 F;  3RBZ A;  2Q7H A;  3N2G A;  3CRM A;  2JJ2 G;  4P9P A;  1ZL8 B;  4GKK O;  3JAL A;  1Q82 W;  4RQE A;  3LDE A;  2WAM A;  4WFA V;  2ARH A;  1SQP H;  3ZRX A;  4QIW F;  4O2A B;  1IX9 A;  5LYJ B;  2ITD C;  3CCS V;  4JI3 O;  4DR1 B;  3L9D A;  2CTR A;  1FXV A;  3JSL A;  1GAX A;  4J7J A;  1KKD A;  3RFR A;  4DW1 A;  2AGA A;  4IL6 Z;  3K5O A;  1AJP A;  2KSD A;  2MK3 A;  2LGW A;  1P7B A;  3UO2 A;  2IJK A;  4J9Z B;  3SPC A;  1URF A;  2BTO A;  1GH6 A;  2XAS A;  3ETG A;  1XMO O;  5KLV H;  3D3Q A;  1U96 A;  1JX9 A;  1K5Q A;  1YVW A;  1S3J A;  3BCC H;  1IBK O;  4X66 B;  5CBH A;  2OCC B;  3SJA C;  3J81 N;  1MG1 A;  2DWE C;  3K0G A;  3CMA V;  3IFX A;  1N4C A;  4J10 A;  4DUY B;  4PA7 A;  1IVS A;  2AHY A;  2P22 C;  4DK1 A;  1VQK V;  4H44 B;  2R72 A;  4LH6 A;  2YIB D;  3FFQ A;  3OR7 C;  1G1X B;  1PNK A;  4R8C A;  2X0L A;  2KQX A;  5LOV B;  4FLZ A;  3R65 A;  2WA4 A;  4CZZ A;  1V9P A;  2JGD A;  3MHH C;  5IY5 B;  3N2K A;  4YJ3 B;  5LMN O;  1G6U A;  2A9H A;  3DC5 A;  3CME V;  1J5E B;  4QPJ A;  5DM6 V;  1VF7 A;  3K5N A;  3QNE A;  5K1X A;  1VQ4 V;  4B08 A;  3SYQ A;  1ZTE A;  5FNV A;  3CPW U;  3FYI B;  3WB0 A;  4Z2W A;  1PV0 A;  3ZHQ A;  4LF9 B;  3CCR V;  4UVC A;  1K9M W;  1ENV A;  1BMF G;  1XBL A;  2Y4T A;  2F93 B;  1QHT A;  4LH7 A;  1D5N A;  5GW7 A;  3W7T A;  1M1K W;  4J41 A;  1AI5 A;  3ZED A;  1NH2 D;  1NVP D;  3TJT A;  1T5E A;  4RO2 A;  1Q81 W;  3B8N A;  1SC5 B;  3K04 A;  2DE0 X;  5B1B C;  2YI9 A;  1PNM A;  4X9Q A;  1FAF A;  2CE4 A;  2YIB A;  2YIC A;  2Z0A A;  1SQQ H;  1Q5O A;  2CTQ A;  4DV5 B;  1YSC A;  1YIT V;  3E8G A;  5EZY A;  2GDS A;  5LP6 C;  3SR2 C;  4GX2 A;  2Q0O C;  3BAB A;  2UXN A;  3X2Q C;  3H1H H;  1OJH A;  5GON B;  3Q4H B;  3WB1 A;  2UUA B;  2Z3Y A;  4JI1 B;  3STL C;  4GCZ A;  3T1H O;  4TV8 A;  1WAZ A;  3CRR A;  3QF7 A;  4U3F H;  4DUY O;  2ZIM A;  3K9A A;  1BQZ A;  4LNU B;  1FXK A;  1BT8 A;  4LF5 B;  4ZHQ A;  2YUA A;  3OUF A;  2B9Z A;  2WLK A;  4LF7 O;  4NVP A;  2CTP A;  2AW9 A;  3U10 A;  1SKV A;  1PD3 A;  2R9I A;  2WLL A;  5LP6 B;  3RYH B;  3OMN B;  3B40 A;  1OCZ C;  4FM1 A;  4K0K B;  1R3J C;  4LF8 B;  3EVK A;  5IYC O;  2VQE B;  1HDJ A;  2FB5 A;  5BXZ A;  3BEH A;  1Y76 A;  3G80 A;  5CB4 A;  4PDM A;  2K1E A;  4O4L A;  5CA0 B;  1SF9 A;  1NR1 A;  4GKJ O;  5IJ9 A;  3P3P A;  2X6A A;  2HR3 A;  1J5E O;  2ZT9 B;  2OTJ V;  1SER A;  3WFV A;  1VQ8 V;  4DV0 O;  2DQ3 A;  2IH1 C;  2XOK G;  2V7Q G;  3JAK A;  1TAE A;  3FAV B;  4G27 B;  3BAA A;  2EIM B;  2JVD A;  1BHB A;  2RMK B;  2Y69 B;  3RYF A;  4YHH B;  2VQF O;  1THZ A;  3MHS C;  4WFH A;  3WU2 Z;  1MSD A;  5IE9 A;  4DR6 O;  3QTC A;  4LC1 A;  3CP1 A;  3K08 A;  5KA5 A;  2GV9 A;  1V54 C;  2E76 B;  4JTD B;  3CCQ V;  4YJ3 A;  1AJN A;  2HVK C;  1FXK C;  2F1M A;  1TGO A;  1B04 A;  3CEI A;  4FLX A;  3U0Z A;  2QWP B;  2UUC O;  3G67 A;  5JWP A;  3ZHT A;  4DV2 O;  3U11 A;  4PI0 A;  3ML0 A;  4XDK A;  4I0X B;  3APO A;  4KL1 A;  1QLN A;  2Q0A A;  1MSW D;  3JD3 A;  2UUA O;  4DR4 B;  1IUR A;  4TOI A;  1Q6U A;  4MVO A;  4K0K O;  2A0L A;  2Q7E A;  1BQ0 A;  4MTF A;  1RSO B;  1JMK C;  1XRE A;  2HLD G;  2UXC O;  4OX9 O;  2QE7 G;  1R3K C;  4DYL A;  3A0H Z;  1KBH A;  2MW2 B;  2DYS C;  4U7N A;  1KMI Z;  4JI2 O;  3LSU A;  1NR7 A;  4CH6 A;  1F23 A;  4GZR B;  4TSF G;  1D5A A;  4ZI7 A;  5LHH A;  1JQ0 A;  5L3B A;  1ZLZ A;  3SJQ C;  1GM7 A;  3OR6 C;  3J80 N;  2M7W A;  2QR4 A;  1M57 C;  4LF9 O;  4J9Y B;  5EBL C;  5C93 A;  1Z5V A;  4X1K A;  1XUQ A;  2QJ1 A;  4EEQ A;  4DR7 O;  2PYJ A;  4BWA A;  4O2B B;  3RYI A;  4DW0 A;  1N32 B;  2LQT A;  4L87 A;  4YY3 B;  2GUZ A;  2ADQ B;  4NTY A;  4LF6 O;  1XMQ B;  2XUM A;  4UUJ C;  3JCU Z;  1H2L A;  3AG3 C;  3CCJ V;  1P4R A;  4NXM B;  4KFM A;  3CC7 V;  4J7K A;  1FS0 G;  1WB7 A;  5JH7 B;  3HB3 B;  3ASN B;  4X20 A;  1QU7 A;  5LGN A;  3N2K B;  2IU3 A;  1WPX A;  3E83 A;  1QNM A;  4X64 O;  1NKD A;  1SZX A;  4O4J B;  3OAA G;  3CCE V;  3K3W A;  5CBF A; 
#chains in the Genus database with same CATH homology
 4IYI A;  4J41 A;  4J42 A;  4J7K A;  4J10 A;  2GTS A;  4W4K A;  4J7J A;  4KXR A;  4IYH A;  4J11 A;  4W4L A;  3FX7 A;  2G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...