4J4LA

Modular evolution and design of the protein binding interface
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
258
Chain Sequence
PIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLTLEPNQLQSLPNGVFDKLTNLKELQLWANQLQSLPDGVFDKLTNLTYLNLAFNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin B,REPEAT MODULES,Variable lymphocyte receptor B
publication title Modular evolution and design of the protein binding interface
rcsb
source organism Listeria monocytogenes
molecule tags Protein binding/cytokine
total genus 82
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4j4lA00
3G3AA 3REZA 2Z81A 3RJ0A 3ZYOA 1P9AG 3W3LA 1SQ0B 3W3GA 2JE0A 2BEXA 4YEBB 4XOSA 4AW4A 1OTOA 2V9TB 4Z79A 1ZIWA 2ELLA 5CMNA 3KJ4A 4R09A 1P8TA 2Z82A 3FXIA 5B0TA 3E3ZA 1OGQA 2Z62A 2R9UA 5GMFA 3G04C 1IO0A 4RWTC 1OZNA 2Q4GW 3BZ5A 4AY9X 5IJBA 1FO1A 1KOOA 4LSXA 5AZ5A 1DS9A 3C6NB 3W3MA 2IFGA 1KOHA 2BNHA 5GS2B 2A0ZA 1XCDA 1QYYA 3JB9j 1LTXA 1XEUA 1H6UA 2JQDA 3RFEA 2V9SA 4P8SA 4V2CA 3WPGA 2Z63A 4Z64C 2OMUA 4C2AB 4LI2A 1O6SA 3A79B 4FMZA 3VQ2A 4G8AA 4CC4A 1JL5A 1O6TA 3WPEA 4FCGA 2ID5A 4GLPA 5AWAA 4CILA 1OTNA 2JE1A 3OGKB 4NKGA 4K17A 5IJCA 4IM6A 3G3BA 4KNGA 3E2JA 2OMXA 4U09A 3WPDA 4RCWA 3WPBA 4GT6A 3ULAA 4KXFB 4Q62A 3M19A 4R0AA 1M9SA 4OQTA 3O53A 1W8AA 5IJDA 4XGOA 3C6OB 4R08A 2P1PB 3W3KA 3RW7A 3ULVA 5HDHA 2P1QB 1FT8A 1PGVA 4V2EA 4RCAB 4XSQA 1XECA 4CNCA 4LSAA 3DZEA 3CIGA 1OOKG 2OMTA 4R5DA 4EZGA 1Z7XW 4PEQB 3UL8A 5GMHA 4M7EA 1U0ND 2XWTC 1H6TA 5B0NA 3RFJA 4FDWA 3G39A 2XOTA 4UFRA 2Z7XB 2V70A 1XWDC 2O6RA 3ZYIA 4QXEA 4V2DA 4LXSA 3WN4A 4Y61B 2ASTB 4L3AA 2OMWA 4QBZA 2ASSB 4C2BB 5FTTB 3WPHA 4R6JA 3OJAB 5D3IA 2WQVA 3P72A 5IYXC 1GWBA 4ECOA 1D0BA 4Z61C 4J0MA 3OGLB 4MQWX 4R6FA 2P1NB 3RFSA 3WPIA 1OTMA 4J4LA 4U06A 4NKHA 2OMYA 4WYKA 3ULUA 4PSJA 2WQUA 3TSRE 4WP6A 4U08A 1A4YA 1M10B 3GOZA 4BSSA 3RGZA 2O6SA 3UL9A 2Z66A 2UZYA 2WQWA 1YRGA 4B8CD 5GS0A 1A9NA 1FS2A 4BSUA 3W3NA 1K5GC 4TZHA 4CNMA 4LSXC 4FD0A 5AWBA 3ZYJA 4M7EC 5GQRK 1K5DC 1O6VA 4L3FA 4FHOA 4BSRA 4R6GA 4LI1A 3G06A 4ARRA 3RGXA 3E4GA 3E6JA 4KT1A 2UZXA 4LXRA 4P91A 3O6NA 5AWCA 2Z7XA 4H09A 3RIZA 5HZLB 2Z65A 3ZYNA 2OMZA 4CC4C 3RW6A 4HQ1A 2WQXA 3OGMB 5AWDA 3VQ1A 3OJAA 3C6PB 3W3JA 1M9LA 4R6AA 2RA8A 4ARNA 3M18A 3UL7A 4I6JB 4LSCA 5GMGA 5CMPA 4PKIG 2CA6A 4QC0A 2OMVA 4FS7A 1FQVA 3SB4A 4CP6A 3PMHG 4U7LA 4ECNA 4PERA 2RR6A 2P1MB 2P1OB 4Z8GA 1XKUA 4BV4R 3UN9A 2FT3A 2Z64A 3WPFA 4PQ8A 1WWLA 4Q3GA 4R58A 1G9UA 4R5CA 2Y5QA 4Z94G 1DFJI 2WFHA 1M0ZA 2O6QA 5A5CA 4Q3IA 1DCEA 3CVRA 4MN8B 3CIYA 4R07A 5LFNA 3WPCA 1P8VA 5B4PA
chains in the Genus database with same CATH superfamily
3G3AA 3REZA 2Z81A 3RJ0A 3ZYOA 1P9AG 3W3LA 1SQ0B 3W3GA 2JE0A 2BEXA 4YEBB 4XOSA 4AW4A 1OTOA 2V9TB 4Z79A 1ZIWA 2ELLA 5CMNA 3KJ4A 4R09A 1P8TA 2Z82A 3FXIA 5B0TA 3E3ZA 1OGQA 2Z62A 2R9UA 5GMFA 3G04C 1IO0A 4RWTC 1OZNA 2Q4GW 3BZ5A 4AY9X 5IJBA 1FO1A 1KOOA 4LSXA 5AZ5A 1DS9A 3C6NB 3W3MA 2IFGA 1KOHA 2BNHA 5GS2B 2A0ZA 1XCDA 1QYYA 3JB9j 1LTXA 1XEUA 1H6UA 2JQDA 3RFEA 2V9SA 4P8SA 4V2CA 3WPGA 2Z63A 4Z64C 2OMUA 4C2AB 4LI2A 1O6SA 3A79B 4FMZA 3VQ2A 4G8AA 4CC4A 1JL5A 1O6TA 3WPEA 4FCGA 2ID5A 4GLPA 5AWAA 4CILA 1OTNA 2JE1A 3OGKB 4NKGA 4K17A 5IJCA 4IM6A 3G3BA 4KNGA 3E2JA 2OMXA 4U09A 3WPDA 4RCWA 3WPBA 4GT6A 3ULAA 4KXFB 4Q62A 3M19A 4R0AA 1M9SA 4OQTA 3O53A 1W8AA 5IJDA 4XGOA 3C6OB 4R08A 2P1PB 3W3KA 3RW7A 3ULVA 5HDHA 2P1QB 1FT8A 1PGVA 4V2EA 4RCAB 4XSQA 1XECA 4CNCA 4LSAA 3DZEA 3CIGA 1OOKG 2OMTA 4R5DA 4EZGA 1Z7XW 4PEQB 3UL8A 5GMHA 4M7EA 1U0ND 2XWTC 1H6TA 5B0NA 3RFJA 4FDWA 3G39A 2XOTA 4UFRA 2Z7XB 2V70A 1XWDC 2O6RA 3ZYIA 4QXEA 4V2DA 4LXSA 3WN4A 4Y61B 2ASTB 4L3AA 2OMWA 4QBZA 2ASSB 4C2BB 5FTTB 3WPHA 4R6JA 3OJAB 5D3IA 2WQVA 3P72A 5IYXC 1GWBA 4NZRM 4ECOA 1D0BA 4Z61C 4J0MA 3OGLB 4MQWX 4R6FA 2P1NB 3RFSA 3WPIA 1OTMA 4J4LA 4U06A 4NKHA 2OMYA 4WYKA 3ULUA 4PSJA 2WQUA 3TSRE 4WP6A 4U08A 1A4YA 1M10B 3GOZA 4BSSA 3RGZA 2O6SA 3UL9A 2Z66A 2UZYA 2WQWA 1YRGA 4B8CD 5GS0A 1A9NA 1FS2A 4BSUA 3W3NA 1K5GC 4TZHA 4CNMA 4LSXC 4FD0A 5AWBA 3ZYJA 4M7EC 5GQRK 1K5DC 1O6VA 4L3FA 4FHOA 4BSRA 4R6GA 4LI1A 3G06A 4ARRA 3RGXA 3E4GA 3E6JA 4KT1A 2UZXA 4LXRA 4P91A 3O6NA 5AWCA 2Z7XA 4H09A 3RIZA 5HZLB 2Z65A 3ZYNA 2OMZA 4CC4C 3RW6A 4HQ1A 2WQXA 3OGMB 5AWDA 3VQ1A 3OJAA 3C6PB 3W3JA 1M9LA 4R6AA 2RA8A 4ARNA 3M18A 3UL7A 4I6JB 4LSCA 5GMGA 5CMPA 4PKIG 2CA6A 4QC0A 2OMVA 4FS7A 1FQVA 3SB4A 4CP6A 3PMHG 4U7LA 4NZTM 4ECNA 4PERA 2RR6A 2P1MB 2P1OB 4Z8GA 1XKUA 4BV4R 3UN9A 2FT3A 2Z64A 3WPFA 4PQ8A 1WWLA 4Q3GA 4R58A 1G9UA 4R5CA 2Y5QA 4Z94G 1DFJI 2WFHA 1M0ZA 2O6QA 5A5CA 4Q3IA 1DCEA 3CVRA 4MN8B 3CIYA 4R07A 5LFNA 3WPCA 1P8VA 5B4PA
chains in the Genus database with same CATH topology
3G3AA 3REZA 2Z81A 3RJ0A 3ZYOA 1P9AG 3W3LA 1SQ0B 3W3GA 2JE0A 2BEXA 4YEBB 4XOSA 4AW4A 1OTOA 2V9TB 4Z79A 1ZIWA 2ELLA 5CMNA 3KJ4A 4R09A 1P8TA 2Z82A 3FXIA 5B0TA 3E3ZA 1OGQA 2Z62A 2R9UA 5GMFA 3G04C 1IO0A 4RWTC 1OZNA 2Q4GW 3BZ5A 4AY9X 5IJBA 1FO1A 1KOOA 4LSXA 5AZ5A 1DS9A 3C6NB 3W3MA 2IFGA 1KOHA 2BNHA 5GS2B 2A0ZA 1XCDA 1QYYA 3JB9j 1LTXA 1XEUA 1H6UA 2JQDA 3RFEA 2V9SA 4P8SA 4V2CA 3WPGA 2Z63A 4Z64C 2OMUA 4C2AB 4LI2A 1O6SA 3A79B 4FMZA 3VQ2A 4G8AA 4CC4A 1JL5A 1O6TA 3WPEA 4FCGA 2ID5A 4GLPA 5AWAA 4CILA 1OTNA 2JE1A 3OGKB 4NKGA 4K17A 5IJCA 4IM6A 3G3BA 4KNGA 3E2JA 2OMXA 4U09A 3WPDA 4RCWA 3WPBA 4GT6A 3ULAA 4KXFB 4Q62A 3M19A 4R0AA 1M9SA 4OQTA 3O53A 1W8AA 5IJDA 4XGOA 3C6OB 4R08A 2P1PB 3W3KA 3RW7A 3ULVA 5HDHA 2P1QB 1FT8A 1PGVA 4V2EA 4RCAB 4XSQA 1XECA 4CNCA 4LSAA 3DZEA 3CIGA 1OOKG 2OMTA 4R5DA 4EZGA 1Z7XW 4PEQB 3UL8A 5GMHA 4M7EA 1U0ND 2XWTC 1H6TA 5B0NA 3RFJA 4FDWA 3G39A 2XOTA 4UFRA 2Z7XB 2V70A 1XWDC 2O6RA 3ZYIA 4QXEA 4V2DA 4LXSA 3WN4A 4Y61B 2ASTB 4L3AA 2OMWA 4QBZA 2ASSB 4C2BB 5FTTB 3WPHA 4R6JA 3OJAB 5D3IA 2WQVA 3P72A 5IYXC 1GWBA 4ECOA 1D0BA 4Z61C 4J0MA 3OGLB 4MQWX 4R6FA 2P1NB 3RFSA 3WPIA 1OTMA 4J4LA 4U06A 4NKHA 2OMYA 4WYKA 3ULUA 4PSJA 2WQUA 3TSRE 4WP6A 4U08A 1A4YA 1M10B 3GOZA 4BSSA 3RGZA 2O6SA 3UL9A 2Z66A 2UZYA 2WQWA 1YRGA 4B8CD 5GS0A 1A9NA 1FS2A 4BSUA 3W3NA 1K5GC 4TZHA 4CNMA 4LSXC 4FD0A 5AWBA 3ZYJA 4M7EC 5GQRK 1K5DC 1O6VA 4L3FA 4FHOA 4BSRA 4R6GA 4LI1A 3G06A 4ARRA 3RGXA 3E4GA 3E6JA 4KT1A 2UZXA 4LXRA 4P91A 3O6NA 5AWCA 2Z7XA 4H09A 3RIZA 5HZLB 2Z65A 3ZYNA 2OMZA 4CC4C 3RW6A 4HQ1A 2WQXA 3OGMB 5AWDA 3VQ1A 3OJAA 3C6PB 3W3JA 1M9LA 4R6AA 2RA8A 4ARNA 3M18A 3UL7A 4I6JB 4LSCA 5GMGA 5CMPA 4PKIG 2CA6A 4QC0A 2OMVA 4FS7A 1FQVA 3SB4A 4CP6A 3PMHG 4U7LA 4ECNA 4PERA 2RR6A 2P1MB 2P1OB 4Z8GA 1XKUA 4BV4R 3UN9A 2FT3A 2Z64A 3WPFA 4PQ8A 1WWLA 4Q3GA 4R58A 1G9UA 4R5CA 2Y5QA 4Z94G 1DFJI 2WFHA 1M0ZA 2O6QA 5A5CA 4Q3IA 1DCEA 3CVRA 4MN8B 3CIYA 4R07A 5LFNA 3WPCA 1P8VA 5B4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3A A;  3REZ A;  2Z81 A;  3RJ0 A;  3ZYO A;  1P9A G;  3W3L A;  1SQ0 B;  3W3G A;  2JE0 A;  2BEX A;  4YEB B;  4XOS A;  4AW4 A;  1OTO A;  2V9T B;  4Z79 A;  1ZIW A;  2ELL A;  5CMN A;  3KJ4 A;  4R09 A;  1P8T A;  2Z82 A;  3FXI A;  5B0T A;  3E3Z A;  1OGQ A;  2Z62 A;  2R9U A;  5GMF A;  3G04 C;  1IO0 A;  4RWT C;  1OZN A;  2Q4G W;  3BZ5 A;  4AY9 X;  5IJB A;  1FO1 A;  1KOO A;  4LSX A;  5AZ5 A;  1DS9 A;  3C6N B;  3W3M A;  2IFG A;  1KOH A;  2BNH A;  5GS2 B;  2A0Z A;  1XCD A;  1QYY A;  3JB9 j;  1LTX A;  1XEU A;  1H6U A;  2JQD A;  3RFE A;  2V9S A;  4P8S A;  4V2C A;  3WPG A;  2Z63 A;  4Z64 C;  2OMU A;  4C2A B;  4LI2 A;  1O6S A;  3A79 B;  4FMZ A;  3VQ2 A;  4G8A A;  4CC4 A;  1JL5 A;  1O6T A;  3WPE A;  4FCG A;  2ID5 A;  4GLP A;  5AWA A;  4CIL A;  1OTN A;  2JE1 A;  3OGK B;  4NKG A;  4K17 A;  5IJC A;  4IM6 A;  3G3B A;  4KNG A;  3E2J A;  2OMX A;  4U09 A;  3WPD A;  4RCW A;  3WPB A;  4GT6 A;  3ULA A;  4KXF B;  4Q62 A;  3M19 A;  4R0A A;  1M9S A;  4OQT A;  3O53 A;  1W8A A;  5IJD A;  4XGO A;  3C6O B;  4R08 A;  2P1P B;  3W3K A;  3RW7 A;  3ULV A;  5HDH A;  2P1Q B;  1FT8 A;  1PGV A;  4V2E A;  4RCA B;  4XSQ A;  1XEC A;  4CNC A;  4LSA A;  3DZE A;  3CIG A;  1OOK G;  2OMT A;  4R5D A;  4EZG A;  1Z7X W;  4PEQ B;  3UL8 A;  5GMH A;  4M7E A;  1U0N D;  2XWT C;  1H6T A;  5B0N A;  3RFJ A;  4FDW A;  3G39 A;  2XOT A;  4UFR A;  2Z7X B;  2V70 A;  1XWD C;  2O6R A;  3ZYI A;  4QXE A;  4V2D A;  4LXS A;  3WN4 A;  4Y61 B;  2AST B;  4L3A A;  2OMW A;  4QBZ A;  2ASS B;  4C2B B;  5FTT B;  3WPH A;  4R6J A;  3OJA B;  5D3I A;  2WQV A;  3P72 A;  5IYX C;  1GWB A;  4ECO A;  1D0B A;  4Z61 C;  4J0M A;  3OGL B;  4MQW X;  4R6F A;  2P1N B;  3RFS A;  3WPI A;  1OTM A;  4J4L A;  4U06 A;  4NKH A;  2OMY A;  4WYK A;  3ULU A;  4PSJ A;  2WQU A;  3TSR E;  4WP6 A;  4U08 A;  1A4Y A;  1M10 B;  3GOZ A;  4BSS A;  3RGZ A;  2O6S A;  3UL9 A;  2Z66 A;  2UZY A;  2WQW A;  1YRG A;  4B8C D;  5GS0 A;  1A9N A;  1FS2 A;  4BSU A;  3W3N A;  1K5G C;  4TZH A;  4CNM A;  4LSX C;  4FD0 A;  5AWB A;  3ZYJ A;  4M7E C;  5GQR K;  1K5D C;  1O6V A;  4L3F A;  4FHO A;  4BSR A;  4R6G A;  4LI1 A;  3G06 A;  4ARR A;  3RGX A;  3E4G A;  3E6J A;  4KT1 A;  2UZX A;  4LXR A;  4P91 A;  3O6N A;  5AWC A;  2Z7X A;  4H09 A;  3RIZ A;  5HZL B;  2Z65 A;  3ZYN A;  2OMZ A;  4CC4 C;  3RW6 A;  4HQ1 A;  2WQX A;  3OGM B;  5AWD A;  3VQ1 A;  3OJA A;  3C6P B;  3W3J A;  1M9L A;  4R6A A;  2RA8 A;  4ARN A;  3M18 A;  3UL7 A;  4I6J B;  4LSC A;  5GMG A;  5CMP A;  4PKI G;  2CA6 A;  4QC0 A;  2OMV A;  4FS7 A;  1FQV A;  3SB4 A;  4CP6 A;  3PMH G;  4U7L A;  4ECN A;  4PER A;  2RR6 A;  2P1M B;  2P1O B;  4Z8G A;  1XKU A;  4BV4 R;  3UN9 A;  2FT3 A;  2Z64 A;  3WPF A;  4PQ8 A;  1WWL A;  4Q3G A;  4R58 A;  1G9U A;  4R5C A;  2Y5Q A;  4Z94 G;  1DFJ I;  2WFH A;  1M0Z A;  2O6Q A;  5A5C A;  4Q3I A;  1DCE A;  3CVR A;  4MN8 B;  3CIY A;  4R07 A;  5LFN A;  3WPC A;  1P8V A;  5B4P A; 
#chains in the Genus database with same CATH topology
 3G3A A;  3REZ A;  2Z81 A;  3RJ0 A;  3ZYO A;  1P9A G;  3W3L A;  1SQ0 B;  3W3G A;  2JE0 A;  2BEX A;  4YEB B;  4XOS A;  4AW4 A;  1OTO A;  2V9T B;  4Z79 A;  1ZIW A;  2ELL A;  5CMN A;  3KJ4 A;  4R09 A;  1P8T A;  2Z82 A;  3FXI A;  5B0T A;  3E3Z A;  1OGQ A;  2Z62 A;  2R9U A;  5GMF A;  3G04 C;  1IO0 A;  4RWT C;  1OZN A;  2Q4G W;  3BZ5 A;  4AY9 X;  5IJB A;  1FO1 A;  1KOO A;  4LSX A;  5AZ5 A;  1DS9 A;  3C6N B;  3W3M A;  2IFG A;  1KOH A;  2BNH A;  5GS2 B;  2A0Z A;  1XCD A;  1QYY A;  3JB9 j;  1LTX A;  1XEU A;  1H6U A;  2JQD A;  3RFE A;  2V9S A;  4P8S A;  4V2C A;  3WPG A;  2Z63 A;  4Z64 C;  2OMU A;  4C2A B;  4LI2 A;  1O6S A;  3A79 B;  4FMZ A;  3VQ2 A;  4G8A A;  4CC4 A;  1JL5 A;  1O6T A;  3WPE A;  4FCG A;  2ID5 A;  4GLP A;  5AWA A;  4CIL A;  1OTN A;  2JE1 A;  3OGK B;  4NKG A;  4K17 A;  5IJC A;  4IM6 A;  3G3B A;  4KNG A;  3E2J A;  2OMX A;  4U09 A;  3WPD A;  4RCW A;  3WPB A;  4GT6 A;  3ULA A;  4KXF B;  4Q62 A;  3M19 A;  4R0A A;  1M9S A;  4OQT A;  3O53 A;  1W8A A;  5IJD A;  4XGO A;  3C6O B;  4R08 A;  2P1P B;  3W3K A;  3RW7 A;  3ULV A;  5HDH A;  2P1Q B;  1FT8 A;  1PGV A;  4V2E A;  4RCA B;  4XSQ A;  1XEC A;  4CNC A;  4LSA A;  3DZE A;  3CIG A;  1OOK G;  2OMT A;  4R5D A;  4EZG A;  1Z7X W;  4PEQ B;  3UL8 A;  5GMH A;  4M7E A;  1U0N D;  2XWT C;  1H6T A;  5B0N A;  3RFJ A;  4FDW A;  3G39 A;  2XOT A;  4UFR A;  2Z7X B;  2V70 A;  1XWD C;  2O6R A;  3ZYI A;  4QXE A;  4V2D A;  4LXS A;  3WN4 A;  4Y61 B;  2AST B;  4L3A A;  2OMW A;  4QBZ A;  2ASS B;  4C2B B;  5FTT B;  3WPH A;  4R6J A;  3OJA B;  5D3I A;  2WQV A;  3P72 A;  5IYX C;  1GWB A;  4NZR M;  4ECO A;  1D0B A;  4Z61 C;  4J0M A;  3OGL B;  4MQW X;  4R6F A;  2P1N B;  3RFS A;  3WPI A;  1OTM A;  4J4L A;  4U06 A;  4NKH A;  2OMY A;  4WYK A;  3ULU A;  4PSJ A;  2WQU A;  3TSR E;  4WP6 A;  4U08 A;  1A4Y A;  1M10 B;  3GOZ A;  4BSS A;  3RGZ A;  2O6S A;  3UL9 A;  2Z66 A;  2UZY A;  2WQW A;  1YRG A;  4B8C D;  5GS0 A;  1A9N A;  1FS2 A;  4BSU A;  3W3N A;  1K5G C;  4TZH A;  4CNM A;  4LSX C;  4FD0 A;  5AWB A;  3ZYJ A;  4M7E C;  5GQR K;  1K5D C;  1O6V A;  4L3F A;  4FHO A;  4BSR A;  4R6G A;  4LI1 A;  3G06 A;  4ARR A;  3RGX A;  3E4G A;  3E6J A;  4KT1 A;  2UZX A;  4LXR A;  4P91 A;  3O6N A;  5AWC A;  2Z7X A;  4H09 A;  3RIZ A;  5HZL B;  2Z65 A;  3ZYN A;  2OMZ A;  4CC4 C;  3RW6 A;  4HQ1 A;  2WQX A;  3OGM B;  5AWD A;  3VQ1 A;  3OJA A;  3C6P B;  3W3J A;  1M9L A;  4R6A A;  2RA8 A;  4ARN A;  3M18 A;  3UL7 A;  4I6J B;  4LSC A;  5GMG A;  5CMP A;  4PKI G;  2CA6 A;  4QC0 A;  2OMV A;  4FS7 A;  1FQV A;  3SB4 A;  4CP6 A;  3PMH G;  4U7L A;  4NZT M;  4ECN A;  4PER A;  2RR6 A;  2P1M B;  2P1O B;  4Z8G A;  1XKU A;  4BV4 R;  3UN9 A;  2FT3 A;  2Z64 A;  3WPF A;  4PQ8 A;  1WWL A;  4Q3G A;  4R58 A;  1G9U A;  4R5C A;  2Y5Q A;  4Z94 G;  1DFJ I;  2WFH A;  1M0Z A;  2O6Q A;  5A5C A;  4Q3I A;  1DCE A;  3CVR A;  4MN8 B;  3CIY A;  4R07 A;  5LFN A;  3WPC A;  1P8V A;  5B4P A; 
#chains in the Genus database with same CATH homology
 3G3A A;  3REZ A;  2Z81 A;  3RJ0 A;  3ZYO A;  1P9A G;  3W3L A;  1SQ0 B;  3W3G A;  2JE0 A;  2BEX A;  4YEB B;  4XOS A;  4AW4 A;  1OTO A;  2V9T B;  4Z79 A;  1ZIW A;  2ELL A;  5CMN A;  3KJ4 A;  4R09 A;  1P8T A;  2Z82 A;  3FXI A;  5B0T A;  3E3Z A;  1OGQ A;  2Z62 A;  2R9U A;  5GMF A;  3G04 C;  1IO0 A;  4RWT C;  1OZN A;  2Q4G W;  3BZ5 A;  4AY9 X;  5IJB A;  1FO1 A;  1KOO A;  4LSX A;  5AZ5 A;  1DS9 A;  3C6N B;  3W3M A;  2IFG A;  1KOH A;  2BNH A;  5GS2 B;  2A0Z A;  1XCD A;  1QYY A;  3JB9 j;  1LTX A;  1XEU A;  1H6U A;  2JQD A;  3RFE A;  2V9S A;  4P8S A;  4V2C A;  3WPG A;  2Z63 A;  4Z64 C;  2OMU A;  4C2A B;  4LI2 A;  1O6S A;  3A79 B;  4FMZ A;  3VQ2 A;  4G8A A;  4CC4 A;  1JL5 A;  1O6T A;  3WPE A;  4FCG A;  2ID5 A;  4GLP A;  5AWA A;  4CIL A;  1OTN A;  2JE1 A;  3OGK B;  4NKG A;  4K17 A;  5IJC A;  4IM6 A;  3G3B A;  4KNG A;  3E2J A;  2OMX A;  4U09 A;  3WPD A;  4RCW A;  3WPB A;  4GT6 A;  3ULA A;  4KXF B;  4Q62 A;  3M19 A;  4R0A A;  1M9S A;  4OQT A;  3O53 A;  1W8A A;  5IJD A;  4XGO A;  3C6O B;  4R08 A;  2P1P B;  3W3K A;  3RW7 A;  3ULV A;  5HDH A;  2P1Q B;  1FT8 A;  1PGV A;  4V2E A;  4RCA B;  4XSQ A;  1XEC A;  4CNC A;  4LSA A;  3DZE A;  3CIG A;  1OOK G;  2OMT A;  4R5D A;  4EZG A;  1Z7X W;  4PEQ B;  3UL8 A;  5GMH A;  4M7E A;  1U0N D;  2XWT C;  1H6T A;  5B0N A;  3RFJ A;  4FDW A;  3G39 A;  2XOT A;  4UFR A;  2Z7X B;  2V70 A;  1XWD C;  2O6R A;  3ZYI A;  4QXE A;  4V2D A;  4LXS A;  3WN4 A;  4Y61 B;  2AST B;  4L3A A;  2OMW A;  4QBZ A;  2ASS B;  4C2B B;  5FTT B;  3WPH A;  4R6J A;  3OJA B;  5D3I A;  2WQV A;  3P72 A;  5IYX C;  1GWB A;  4ECO A;  1D0B A;  4Z61 C;  4J0M A;  3OGL B;  4MQW X;  4R6F A;  2P1N B;  3RFS A;  3WPI A;  1OTM A;  4J4L A;  4U06 A;  4NKH A;  2OMY A;  4WYK A;  3ULU A;  4PSJ A;  2WQU A;  3TSR E;  4WP6 A;  4U08 A;  1A4Y A;  1M10 B;  3GOZ A;  4BSS A;  3RGZ A;  2O6S A;  3UL9 A;  2Z66 A;  2UZY A;  2WQW A;  1YRG A;  4B8C D;  5GS0 A;  1A9N A;  1FS2 A;  4BSU A;  3W3N A;  1K5G C;  4TZH A;  4CNM A;  4LSX C;  4FD0 A;  5AWB A;  3ZYJ A;  4M7E C;  5GQR K;  1K5D C;  1O6V A;  4L3F A;  4FHO A;  4BSR A;  4R6G A;  4LI1 A;  3G06 A;  4ARR A;  3RGX A;  3E4G A;  3E6J A;  4KT1 A;  2UZX A;  4LXR A;  4P91 A;  3O6N A;  5AWC A;  2Z7X A;  4H09 A;  3RIZ A;  5HZL B;  2Z65 A;  3ZYN A;  2OMZ A;  4CC4 C;  3RW6 A;  4HQ1 A;  2WQX A;  3OGM B;  5AWD A;  3VQ1 A;  3OJA A;  3C6P B;  3W3J A;  1M9L A;  4R6A A;  2RA8 A;  4ARN A;  3M18 A;  3UL7 A;  4I6J B;  4LSC A;  5GMG A;  5CMP A;  4PKI G;  2CA6 A;  4QC0 A;  2OMV A;  4FS7 A;  1FQV A;  3SB4 A;  4CP6 A;  3PMH G;  4U7L A;  4ECN A;  4PER A;  2RR6 A;  2P1M B;  2P1O B;  4Z8G A;  1XKU A;  4BV4 R;  3UN9 A;  2FT3 A;  2Z64 A;  3WPF A;  4PQ8 A;  1WWL A;  4Q3G A;  4R58 A;  1G9U A;  4R5C A;  2Y5Q A;  4Z94 G;  1DFJ I;  2WFH A;  1M0Z A;  2O6Q A;  5A5C A;  4Q3I A;  1DCE A;  3CVR A;  4MN8 B;  3CIY A;  4R07 A;  5LFN A;  3WPC A;  1P8V A;  5B4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...