4J4LA

Modular evolution and design of the protein binding interface
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
258
Chain Sequence
b'PIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLTLEPNQLQSLPNGVFDKLTNLKELQLWANQLQSLPDGVFDKLTNLTYLNLAFNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIICP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin B,REPEAT MODULES,Variable lymphocyte receptor B
publication title Modular evolution and design of the protein binding interface
rcsb
source organism Listeria monocytogenes
molecule tags Protein binding/cytokine
total genus 82
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4j4lA00
2XOTA 4LSCA 1H6UA 3JB9j 3RIZA 1H6TA 4ARNA 1DFJI 2P1OB 4R6GA 4GT6A 4J0MA 1LTXA 3RW7A 3O53A 3OGLB 3C6NB 4R5CA 4AW4A 2JE0A 4RWTC 2JQDA 2BNHA 3WPGA 5B4PA 2RA8A 1O6VA 3W3LA 2Q4GW 2Z81A 3W3GA 3UL8A 2Z66A 4V2EA 1M9LA 2P1MB 5AWAA 3RGXA 1OOKG 5GS2B 4ECNA 2WQXA 1GWBA 3WPHA 2Y5QA 4ARRA 3A79B 1XECA 4MQWX 2OMWA 5B0NA 3ULAA 4U06A 5GMGA 4U7LA 5FTTB 4R08A 3BZ5A 3E3ZA 4V2DA 5HZLB 4NKHA 3RFJA 3E6JA 3W3MA 3WPCA 4LSXC 3VQ1A 4U09A 4I6JB 2OMYA 2O6SA 4XGOA 1P8VA 2OMVA 4Z94G 3CIYA 3M19A 5IJDA 4UFRA 4FCGA 1D0BA 3G39A 2Z82A 4Z64C 4BV4R 2ID5A 4C2BB 4RCWA 2UZYA 3ULUA 2XWTC 2Z63A 1FQVA 3ZYNA 4CP6A 4L3FA 5GS0A 5IYXC 4LSAA 2P1QB 3RFEA 1K5DC 4QXEA 3G04C 2Z64A 5IJCA 4FMZA 4WYKA 1W8AA 4R5DA 4J4LA 3UL7A 2CA6A 5AWBA 1XWDC 4Q3IA 4PEQB 4C2AB 3WPFA 4PERA 4LSXA 1DS9A 2R9UA 3OGMB 4PKIG 3CIGA 3G06A 4LI1A 3RGZA 2V70A 3FXIA 4M7EC 1DCEA 4FD0A 3OGKB 3UL9A 4R58A 3ZYJA 1FS2A 1P8TA 1YRGA 3KJ4A 2OMTA 4BSUA 1JL5A 3O6NA 4LXRA 5GQRK 4Z61C 1A4YA 2BEXA 3C6PB 1OTMA 4R09A 3ULVA 4FDWA 1IO0A 2ASTB 1OTNA 2OMXA 2O6QA 4Q3GA 4Y61B 2V9SA 2WFHA 4YEBB 3PMHG 4Z8GA 4P91A 4CC4A 4H09A 2P1PB 4M7EA 3WPIA 1QYYA 3CVRA 2WQWA 1OGQA 4CILA 1SQ0B 2Z7XA 4R6AA 4ECOA 3GOZA 3DZEA 4LI2A 4R0AA 1FT8A 5HDHA 4V2CA 5B0TA 5CMPA 3WPBA 2OMUA 3E4GA 3OJAA 2Z65A 1M9SA 1G9UA 4BSRA 3RFSA 3G3AA 4CNMA 4BSSA 2Z62A 4KT1A 3C6OB 4NKGA 4EZGA 4R6FA 4R6JA 3TSRE 4FHOA 3G3BA 4XOSA 1P9AG 2JE1A 2WQUA 3ZYOA 3WN4A 3WPDA 2UZXA 1XCDA 4B8CD 4KNGA 4CC4C 4L3AA 4QBZA 4MN8B 4U08A 4IM6A 1M10B 2A0ZA 5AZ5A 2RR6A 3W3JA 4HQ1A 5D3IA 3REZA 3E2JA 4R07A 2WQVA 3M18A 1U0ND 1OTOA 4G8AA 4FS7A 4PQ8A 3SB4A 2V9TB 4Q62A 1KOOA 3P72A 3RJ0A 3W3KA 2Z7XB 3RW6A 4OQTA 4KXFB 4GLPA 1M0ZA 2ELLA 4XSQA 5CMNA 1O6TA 4AY9X 1XEUA 3WPEA 1WWLA 4TZHA 1FO1A 4QC0A 1XKUA 5AWCA 3OJAB 5A5CA 1KOHA 3UN9A 4K17A 4WP6A 1OZNA 2O6RA 5LFNA 1O6SA 4CNCA 2IFGA 1A9NA 2ASSB 4LXSA 4P8SA 2P1NB 1K5GC 4RCAB 1Z7XW 1ZIWA 2FT3A 5GMHA 3VQ2A 3ZYIA 4Z79A 5IJBA 3W3NA 5AWDA 5GMFA 4PSJA 2OMZA 1PGVA
chains in the Genus database with same CATH superfamily
2XOTA 4LSCA 1H6UA 3JB9j 3RIZA 4NZRM 1H6TA 4ARNA 1DFJI 2P1OB 4R6GA 4GT6A 4J0MA 1LTXA 3RW7A 3O53A 3OGLB 3C6NB 4R5CA 4AW4A 2JE0A 4RWTC 2JQDA 2BNHA 3WPGA 5B4PA 2RA8A 1O6VA 3W3LA 2Q4GW 2Z81A 3W3GA 3UL8A 2Z66A 4V2EA 1M9LA 2P1MB 5AWAA 3RGXA 1OOKG 5GS2B 4ECNA 2WQXA 1GWBA 3WPHA 2Y5QA 4ARRA 3A79B 1XECA 4MQWX 2OMWA 5B0NA 3ULAA 4U06A 5GMGA 4U7LA 5FTTB 4R08A 3BZ5A 3E3ZA 4V2DA 5HZLB 4NKHA 3RFJA 3E6JA 3W3MA 3WPCA 4LSXC 3VQ1A 4U09A 4I6JB 2OMYA 2O6SA 4XGOA 1P8VA 2OMVA 4Z94G 3CIYA 3M19A 5IJDA 4UFRA 4FCGA 1D0BA 3G39A 2Z82A 4Z64C 4BV4R 2ID5A 4C2BB 4RCWA 2UZYA 3ULUA 2XWTC 2Z63A 1FQVA 3ZYNA 4CP6A 4L3FA 5GS0A 5IYXC 4LSAA 2P1QB 3RFEA 1K5DC 4QXEA 3G04C 2Z64A 5IJCA 4FMZA 4WYKA 1W8AA 4R5DA 4J4LA 3UL7A 2CA6A 5AWBA 1XWDC 4Q3IA 4PEQB 4C2AB 3WPFA 4PERA 4LSXA 1DS9A 2R9UA 3OGMB 4PKIG 3CIGA 3G06A 4LI1A 3RGZA 2V70A 3FXIA 4M7EC 1DCEA 4FD0A 3OGKB 3UL9A 4R58A 3ZYJA 1FS2A 1P8TA 1YRGA 3KJ4A 2OMTA 4BSUA 1JL5A 3O6NA 4LXRA 5GQRK 4Z61C 1A4YA 2BEXA 3C6PB 1OTMA 4R09A 3ULVA 4FDWA 1IO0A 2ASTB 1OTNA 2OMXA 2O6QA 4Q3GA 4Y61B 2V9SA 2WFHA 4YEBB 3PMHG 4Z8GA 4P91A 4CC4A 4H09A 2P1PB 4M7EA 3WPIA 1QYYA 3CVRA 2WQWA 1OGQA 4CILA 1SQ0B 2Z7XA 4R6AA 4ECOA 3GOZA 3DZEA 4LI2A 4R0AA 1FT8A 5HDHA 4V2CA 5B0TA 5CMPA 3WPBA 2OMUA 3E4GA 3OJAA 2Z65A 1M9SA 1G9UA 4BSRA 3RFSA 3G3AA 4CNMA 4BSSA 2Z62A 4KT1A 3C6OB 4NKGA 4EZGA 4R6FA 4R6JA 3TSRE 4FHOA 3G3BA 4XOSA 1P9AG 2JE1A 2WQUA 3ZYOA 3WN4A 3WPDA 2UZXA 1XCDA 4B8CD 4KNGA 4CC4C 4L3AA 4QBZA 4MN8B 4U08A 4IM6A 1M10B 2A0ZA 5AZ5A 2RR6A 3W3JA 4HQ1A 5D3IA 3REZA 3E2JA 4R07A 2WQVA 3M18A 1U0ND 1OTOA 4G8AA 4FS7A 4PQ8A 3SB4A 2V9TB 4Q62A 1KOOA 3P72A 3RJ0A 3W3KA 2Z7XB 3RW6A 4OQTA 4KXFB 4GLPA 1M0ZA 2ELLA 4XSQA 5CMNA 1O6TA 4AY9X 1XEUA 3WPEA 1WWLA 4TZHA 1FO1A 4QC0A 1XKUA 5AWCA 3OJAB 5A5CA 4NZTM 1KOHA 3UN9A 4K17A 4WP6A 1OZNA 2O6RA 5LFNA 1O6SA 4CNCA 2IFGA 1A9NA 2ASSB 4LXSA 4P8SA 2P1NB 1K5GC 4RCAB 1Z7XW 1ZIWA 2FT3A 5GMHA 3VQ2A 3ZYIA 4Z79A 5IJBA 3W3NA 5AWDA 5GMFA 4PSJA 2OMZA 1PGVA
chains in the Genus database with same CATH topology
2XOTA 4LSCA 1H6UA 3JB9j 3RIZA 1H6TA 4ARNA 1DFJI 2P1OB 4R6GA 4GT6A 4J0MA 1LTXA 3RW7A 3O53A 3OGLB 3C6NB 4R5CA 4AW4A 2JE0A 4RWTC 2JQDA 2BNHA 3WPGA 5B4PA 2RA8A 1O6VA 3W3LA 2Q4GW 2Z81A 3W3GA 3UL8A 2Z66A 4V2EA 1M9LA 2P1MB 5AWAA 3RGXA 1OOKG 5GS2B 4ECNA 2WQXA 1GWBA 3WPHA 2Y5QA 4ARRA 3A79B 1XECA 4MQWX 2OMWA 5B0NA 3ULAA 4U06A 5GMGA 4U7LA 5FTTB 4R08A 3BZ5A 3E3ZA 4V2DA 5HZLB 4NKHA 3RFJA 3E6JA 3W3MA 3WPCA 4LSXC 3VQ1A 4U09A 4I6JB 2OMYA 2O6SA 4XGOA 1P8VA 2OMVA 4Z94G 3CIYA 3M19A 5IJDA 4UFRA 4FCGA 1D0BA 3G39A 2Z82A 4Z64C 4BV4R 2ID5A 4C2BB 4RCWA 2UZYA 3ULUA 2XWTC 2Z63A 1FQVA 3ZYNA 4CP6A 4L3FA 5GS0A 5IYXC 4LSAA 2P1QB 3RFEA 1K5DC 4QXEA 3G04C 2Z64A 5IJCA 4FMZA 4WYKA 1W8AA 4R5DA 4J4LA 3UL7A 2CA6A 5AWBA 1XWDC 4Q3IA 4PEQB 4C2AB 3WPFA 4PERA 4LSXA 1DS9A 2R9UA 3OGMB 4PKIG 3CIGA 3G06A 4LI1A 3RGZA 2V70A 3FXIA 4M7EC 1DCEA 4FD0A 3OGKB 3UL9A 4R58A 3ZYJA 1FS2A 1P8TA 1YRGA 3KJ4A 2OMTA 4BSUA 1JL5A 3O6NA 4LXRA 5GQRK 4Z61C 1A4YA 2BEXA 3C6PB 1OTMA 4R09A 3ULVA 4FDWA 1IO0A 2ASTB 1OTNA 2OMXA 2O6QA 4Q3GA 4Y61B 2V9SA 2WFHA 4YEBB 3PMHG 4Z8GA 4P91A 4CC4A 4H09A 2P1PB 4M7EA 3WPIA 1QYYA 3CVRA 2WQWA 1OGQA 4CILA 1SQ0B 2Z7XA 4R6AA 4ECOA 3GOZA 3DZEA 4LI2A 4R0AA 1FT8A 5HDHA 4V2CA 5B0TA 5CMPA 3WPBA 2OMUA 3E4GA 3OJAA 2Z65A 1M9SA 1G9UA 4BSRA 3RFSA 3G3AA 4CNMA 4BSSA 2Z62A 4KT1A 3C6OB 4NKGA 4EZGA 4R6FA 4R6JA 3TSRE 4FHOA 3G3BA 4XOSA 1P9AG 2JE1A 2WQUA 3ZYOA 3WN4A 3WPDA 2UZXA 1XCDA 4B8CD 4KNGA 4CC4C 4L3AA 4QBZA 4MN8B 4U08A 4IM6A 1M10B 2A0ZA 5AZ5A 2RR6A 3W3JA 4HQ1A 5D3IA 3REZA 3E2JA 4R07A 2WQVA 3M18A 1U0ND 1OTOA 4G8AA 4FS7A 4PQ8A 3SB4A 2V9TB 4Q62A 1KOOA 3P72A 3RJ0A 3W3KA 2Z7XB 3RW6A 4OQTA 4KXFB 4GLPA 1M0ZA 2ELLA 4XSQA 5CMNA 1O6TA 4AY9X 1XEUA 3WPEA 1WWLA 4TZHA 1FO1A 4QC0A 1XKUA 5AWCA 3OJAB 5A5CA 1KOHA 3UN9A 4K17A 4WP6A 1OZNA 2O6RA 5LFNA 1O6SA 4CNCA 2IFGA 1A9NA 2ASSB 4LXSA 4P8SA 2P1NB 1K5GC 4RCAB 1Z7XW 1ZIWA 2FT3A 5GMHA 3VQ2A 3ZYIA 4Z79A 5IJBA 3W3NA 5AWDA 5GMFA 4PSJA 2OMZA 1PGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOT A;  4LSC A;  1H6U A;  3JB9 j;  3RIZ A;  1H6T A;  4ARN A;  1DFJ I;  2P1O B;  4R6G A;  4GT6 A;  4J0M A;  1LTX A;  3RW7 A;  3O53 A;  3OGL B;  3C6N B;  4R5C A;  4AW4 A;  2JE0 A;  4RWT C;  2JQD A;  2BNH A;  3WPG A;  5B4P A;  2RA8 A;  1O6V A;  3W3L A;  2Q4G W;  2Z81 A;  3W3G A;  3UL8 A;  2Z66 A;  4V2E A;  1M9L A;  2P1M B;  5AWA A;  3RGX A;  1OOK G;  5GS2 B;  4ECN A;  2WQX A;  1GWB A;  3WPH A;  2Y5Q A;  4ARR A;  3A79 B;  1XEC A;  4MQW X;  2OMW A;  5B0N A;  3ULA A;  4U06 A;  5GMG A;  4U7L A;  5FTT B;  4R08 A;  3BZ5 A;  3E3Z A;  4V2D A;  5HZL B;  4NKH A;  3RFJ A;  3E6J A;  3W3M A;  3WPC A;  4LSX C;  3VQ1 A;  4U09 A;  4I6J B;  2OMY A;  2O6S A;  4XGO A;  1P8V A;  2OMV A;  4Z94 G;  3CIY A;  3M19 A;  5IJD A;  4UFR A;  4FCG A;  1D0B A;  3G39 A;  2Z82 A;  4Z64 C;  4BV4 R;  2ID5 A;  4C2B B;  4RCW A;  2UZY A;  3ULU A;  2XWT C;  2Z63 A;  1FQV A;  3ZYN A;  4CP6 A;  4L3F A;  5GS0 A;  5IYX C;  4LSA A;  2P1Q B;  3RFE A;  1K5D C;  4QXE A;  3G04 C;  2Z64 A;  5IJC A;  4FMZ A;  4WYK A;  1W8A A;  4R5D A;  4J4L A;  3UL7 A;  2CA6 A;  5AWB A;  1XWD C;  4Q3I A;  4PEQ B;  4C2A B;  3WPF A;  4PER A;  4LSX A;  1DS9 A;  2R9U A;  3OGM B;  4PKI G;  3CIG A;  3G06 A;  4LI1 A;  3RGZ A;  2V70 A;  3FXI A;  4M7E C;  1DCE A;  4FD0 A;  3OGK B;  3UL9 A;  4R58 A;  3ZYJ A;  1FS2 A;  1P8T A;  1YRG A;  3KJ4 A;  2OMT A;  4BSU A;  1JL5 A;  3O6N A;  4LXR A;  5GQR K;  4Z61 C;  1A4Y A;  2BEX A;  3C6P B;  1OTM A;  4R09 A;  3ULV A;  4FDW A;  1IO0 A;  2AST B;  1OTN A;  2OMX A;  2O6Q A;  4Q3G A;  4Y61 B;  2V9S A;  2WFH A;  4YEB B;  3PMH G;  4Z8G A;  4P91 A;  4CC4 A;  4H09 A;  2P1P B;  4M7E A;  3WPI A;  1QYY A;  3CVR A;  2WQW A;  1OGQ A;  4CIL A;  1SQ0 B;  2Z7X A;  4R6A A;  4ECO A;  3GOZ A;  3DZE A;  4LI2 A;  4R0A A;  1FT8 A;  5HDH A;  4V2C A;  5B0T A;  5CMP A;  3WPB A;  2OMU A;  3E4G A;  3OJA A;  2Z65 A;  1M9S A;  1G9U A;  4BSR A;  3RFS A;  3G3A A;  4CNM A;  4BSS A;  2Z62 A;  4KT1 A;  3C6O B;  4NKG A;  4EZG A;  4R6F A;  4R6J A;  3TSR E;  4FHO A;  3G3B A;  4XOS A;  1P9A G;  2JE1 A;  2WQU A;  3ZYO A;  3WN4 A;  3WPD A;  2UZX A;  1XCD A;  4B8C D;  4KNG A;  4CC4 C;  4L3A A;  4QBZ A;  4MN8 B;  4U08 A;  4IM6 A;  1M10 B;  2A0Z A;  5AZ5 A;  2RR6 A;  3W3J A;  4HQ1 A;  5D3I A;  3REZ A;  3E2J A;  4R07 A;  2WQV A;  3M18 A;  1U0N D;  1OTO A;  4G8A A;  4FS7 A;  4PQ8 A;  3SB4 A;  2V9T B;  4Q62 A;  1KOO A;  3P72 A;  3RJ0 A;  3W3K A;  2Z7X B;  3RW6 A;  4OQT A;  4KXF B;  4GLP A;  1M0Z A;  2ELL A;  4XSQ A;  5CMN A;  1O6T A;  4AY9 X;  1XEU A;  3WPE A;  1WWL A;  4TZH A;  1FO1 A;  4QC0 A;  1XKU A;  5AWC A;  3OJA B;  5A5C A;  1KOH A;  3UN9 A;  4K17 A;  4WP6 A;  1OZN A;  2O6R A;  5LFN A;  1O6S A;  4CNC A;  2IFG A;  1A9N A;  2ASS B;  4LXS A;  4P8S A;  2P1N B;  1K5G C;  4RCA B;  1Z7X W;  1ZIW A;  2FT3 A;  5GMH A;  3VQ2 A;  3ZYI A;  4Z79 A;  5IJB A;  3W3N A;  5AWD A;  5GMF A;  4PSJ A;  2OMZ A;  1PGV A; 
#chains in the Genus database with same CATH topology
 2XOT A;  4LSC A;  1H6U A;  3JB9 j;  3RIZ A;  4NZR M;  1H6T A;  4ARN A;  1DFJ I;  2P1O B;  4R6G A;  4GT6 A;  4J0M A;  1LTX A;  3RW7 A;  3O53 A;  3OGL B;  3C6N B;  4R5C A;  4AW4 A;  2JE0 A;  4RWT C;  2JQD A;  2BNH A;  3WPG A;  5B4P A;  2RA8 A;  1O6V A;  3W3L A;  2Q4G W;  2Z81 A;  3W3G A;  3UL8 A;  2Z66 A;  4V2E A;  1M9L A;  2P1M B;  5AWA A;  3RGX A;  1OOK G;  5GS2 B;  4ECN A;  2WQX A;  1GWB A;  3WPH A;  2Y5Q A;  4ARR A;  3A79 B;  1XEC A;  4MQW X;  2OMW A;  5B0N A;  3ULA A;  4U06 A;  5GMG A;  4U7L A;  5FTT B;  4R08 A;  3BZ5 A;  3E3Z A;  4V2D A;  5HZL B;  4NKH A;  3RFJ A;  3E6J A;  3W3M A;  3WPC A;  4LSX C;  3VQ1 A;  4U09 A;  4I6J B;  2OMY A;  2O6S A;  4XGO A;  1P8V A;  2OMV A;  4Z94 G;  3CIY A;  3M19 A;  5IJD A;  4UFR A;  4FCG A;  1D0B A;  3G39 A;  2Z82 A;  4Z64 C;  4BV4 R;  2ID5 A;  4C2B B;  4RCW A;  2UZY A;  3ULU A;  2XWT C;  2Z63 A;  1FQV A;  3ZYN A;  4CP6 A;  4L3F A;  5GS0 A;  5IYX C;  4LSA A;  2P1Q B;  3RFE A;  1K5D C;  4QXE A;  3G04 C;  2Z64 A;  5IJC A;  4FMZ A;  4WYK A;  1W8A A;  4R5D A;  4J4L A;  3UL7 A;  2CA6 A;  5AWB A;  1XWD C;  4Q3I A;  4PEQ B;  4C2A B;  3WPF A;  4PER A;  4LSX A;  1DS9 A;  2R9U A;  3OGM B;  4PKI G;  3CIG A;  3G06 A;  4LI1 A;  3RGZ A;  2V70 A;  3FXI A;  4M7E C;  1DCE A;  4FD0 A;  3OGK B;  3UL9 A;  4R58 A;  3ZYJ A;  1FS2 A;  1P8T A;  1YRG A;  3KJ4 A;  2OMT A;  4BSU A;  1JL5 A;  3O6N A;  4LXR A;  5GQR K;  4Z61 C;  1A4Y A;  2BEX A;  3C6P B;  1OTM A;  4R09 A;  3ULV A;  4FDW A;  1IO0 A;  2AST B;  1OTN A;  2OMX A;  2O6Q A;  4Q3G A;  4Y61 B;  2V9S A;  2WFH A;  4YEB B;  3PMH G;  4Z8G A;  4P91 A;  4CC4 A;  4H09 A;  2P1P B;  4M7E A;  3WPI A;  1QYY A;  3CVR A;  2WQW A;  1OGQ A;  4CIL A;  1SQ0 B;  2Z7X A;  4R6A A;  4ECO A;  3GOZ A;  3DZE A;  4LI2 A;  4R0A A;  1FT8 A;  5HDH A;  4V2C A;  5B0T A;  5CMP A;  3WPB A;  2OMU A;  3E4G A;  3OJA A;  2Z65 A;  1M9S A;  1G9U A;  4BSR A;  3RFS A;  3G3A A;  4CNM A;  4BSS A;  2Z62 A;  4KT1 A;  3C6O B;  4NKG A;  4EZG A;  4R6F A;  4R6J A;  3TSR E;  4FHO A;  3G3B A;  4XOS A;  1P9A G;  2JE1 A;  2WQU A;  3ZYO A;  3WN4 A;  3WPD A;  2UZX A;  1XCD A;  4B8C D;  4KNG A;  4CC4 C;  4L3A A;  4QBZ A;  4MN8 B;  4U08 A;  4IM6 A;  1M10 B;  2A0Z A;  5AZ5 A;  2RR6 A;  3W3J A;  4HQ1 A;  5D3I A;  3REZ A;  3E2J A;  4R07 A;  2WQV A;  3M18 A;  1U0N D;  1OTO A;  4G8A A;  4FS7 A;  4PQ8 A;  3SB4 A;  2V9T B;  4Q62 A;  1KOO A;  3P72 A;  3RJ0 A;  3W3K A;  2Z7X B;  3RW6 A;  4OQT A;  4KXF B;  4GLP A;  1M0Z A;  2ELL A;  4XSQ A;  5CMN A;  1O6T A;  4AY9 X;  1XEU A;  3WPE A;  1WWL A;  4TZH A;  1FO1 A;  4QC0 A;  1XKU A;  5AWC A;  3OJA B;  5A5C A;  4NZT M;  1KOH A;  3UN9 A;  4K17 A;  4WP6 A;  1OZN A;  2O6R A;  5LFN A;  1O6S A;  4CNC A;  2IFG A;  1A9N A;  2ASS B;  4LXS A;  4P8S A;  2P1N B;  1K5G C;  4RCA B;  1Z7X W;  1ZIW A;  2FT3 A;  5GMH A;  3VQ2 A;  3ZYI A;  4Z79 A;  5IJB A;  3W3N A;  5AWD A;  5GMF A;  4PSJ A;  2OMZ A;  1PGV A; 
#chains in the Genus database with same CATH homology
 2XOT A;  4LSC A;  1H6U A;  3JB9 j;  3RIZ A;  1H6T A;  4ARN A;  1DFJ I;  2P1O B;  4R6G A;  4GT6 A;  4J0M A;  1LTX A;  3RW7 A;  3O53 A;  3OGL B;  3C6N B;  4R5C A;  4AW4 A;  2JE0 A;  4RWT C;  2JQD A;  2BNH A;  3WPG A;  5B4P A;  2RA8 A;  1O6V A;  3W3L A;  2Q4G W;  2Z81 A;  3W3G A;  3UL8 A;  2Z66 A;  4V2E A;  1M9L A;  2P1M B;  5AWA A;  3RGX A;  1OOK G;  5GS2 B;  4ECN A;  2WQX A;  1GWB A;  3WPH A;  2Y5Q A;  4ARR A;  3A79 B;  1XEC A;  4MQW X;  2OMW A;  5B0N A;  3ULA A;  4U06 A;  5GMG A;  4U7L A;  5FTT B;  4R08 A;  3BZ5 A;  3E3Z A;  4V2D A;  5HZL B;  4NKH A;  3RFJ A;  3E6J A;  3W3M A;  3WPC A;  4LSX C;  3VQ1 A;  4U09 A;  4I6J B;  2OMY A;  2O6S A;  4XGO A;  1P8V A;  2OMV A;  4Z94 G;  3CIY A;  3M19 A;  5IJD A;  4UFR A;  4FCG A;  1D0B A;  3G39 A;  2Z82 A;  4Z64 C;  4BV4 R;  2ID5 A;  4C2B B;  4RCW A;  2UZY A;  3ULU A;  2XWT C;  2Z63 A;  1FQV A;  3ZYN A;  4CP6 A;  4L3F A;  5GS0 A;  5IYX C;  4LSA A;  2P1Q B;  3RFE A;  1K5D C;  4QXE A;  3G04 C;  2Z64 A;  5IJC A;  4FMZ A;  4WYK A;  1W8A A;  4R5D A;  4J4L A;  3UL7 A;  2CA6 A;  5AWB A;  1XWD C;  4Q3I A;  4PEQ B;  4C2A B;  3WPF A;  4PER A;  4LSX A;  1DS9 A;  2R9U A;  3OGM B;  4PKI G;  3CIG A;  3G06 A;  4LI1 A;  3RGZ A;  2V70 A;  3FXI A;  4M7E C;  1DCE A;  4FD0 A;  3OGK B;  3UL9 A;  4R58 A;  3ZYJ A;  1FS2 A;  1P8T A;  1YRG A;  3KJ4 A;  2OMT A;  4BSU A;  1JL5 A;  3O6N A;  4LXR A;  5GQR K;  4Z61 C;  1A4Y A;  2BEX A;  3C6P B;  1OTM A;  4R09 A;  3ULV A;  4FDW A;  1IO0 A;  2AST B;  1OTN A;  2OMX A;  2O6Q A;  4Q3G A;  4Y61 B;  2V9S A;  2WFH A;  4YEB B;  3PMH G;  4Z8G A;  4P91 A;  4CC4 A;  4H09 A;  2P1P B;  4M7E A;  3WPI A;  1QYY A;  3CVR A;  2WQW A;  1OGQ A;  4CIL A;  1SQ0 B;  2Z7X A;  4R6A A;  4ECO A;  3GOZ A;  3DZE A;  4LI2 A;  4R0A A;  1FT8 A;  5HDH A;  4V2C A;  5B0T A;  5CMP A;  3WPB A;  2OMU A;  3E4G A;  3OJA A;  2Z65 A;  1M9S A;  1G9U A;  4BSR A;  3RFS A;  3G3A A;  4CNM A;  4BSS A;  2Z62 A;  4KT1 A;  3C6O B;  4NKG A;  4EZG A;  4R6F A;  4R6J A;  3TSR E;  4FHO A;  3G3B A;  4XOS A;  1P9A G;  2JE1 A;  2WQU A;  3ZYO A;  3WN4 A;  3WPD A;  2UZX A;  1XCD A;  4B8C D;  4KNG A;  4CC4 C;  4L3A A;  4QBZ A;  4MN8 B;  4U08 A;  4IM6 A;  1M10 B;  2A0Z A;  5AZ5 A;  2RR6 A;  3W3J A;  4HQ1 A;  5D3I A;  3REZ A;  3E2J A;  4R07 A;  2WQV A;  3M18 A;  1U0N D;  1OTO A;  4G8A A;  4FS7 A;  4PQ8 A;  3SB4 A;  2V9T B;  4Q62 A;  1KOO A;  3P72 A;  3RJ0 A;  3W3K A;  2Z7X B;  3RW6 A;  4OQT A;  4KXF B;  4GLP A;  1M0Z A;  2ELL A;  4XSQ A;  5CMN A;  1O6T A;  4AY9 X;  1XEU A;  3WPE A;  1WWL A;  4TZH A;  1FO1 A;  4QC0 A;  1XKU A;  5AWC A;  3OJA B;  5A5C A;  1KOH A;  3UN9 A;  4K17 A;  4WP6 A;  1OZN A;  2O6R A;  5LFN A;  1O6S A;  4CNC A;  2IFG A;  1A9N A;  2ASS B;  4LXS A;  4P8S A;  2P1N B;  1K5G C;  4RCA B;  1Z7X W;  1ZIW A;  2FT3 A;  5GMH A;  3VQ2 A;  3ZYI A;  4Z79 A;  5IJB A;  3W3N A;  5AWD A;  5GMF A;  4PSJ A;  2OMZ A;  1PGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...