4J4LA

Modular evolution and design of the protein binding interface
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
258
Chain Sequence
PIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLTLEPNQLQSLPNGVFDKLTNLKELQLWANQLQSLPDGVFDKLTNLTYLNLAFNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular evolution and design of the protein binding interface
rcsb
source organism Listeria monocytogenes
molecule tags Protein binding/cytokine
molecule keywords Internalin B,REPEAT MODULES,Variable lymphocyte receptor B
total genus 82
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4j4lA00
3ZYIA 4P91A 4R6FA 4ECNA 3RGZA 1GWBA 4R08A 4NKGA 1W8AA 4FS7A 4TZHA 4UFRA 1DFJI 3WN4A 4C2BB 4Z79A 5IJDA 1ZIWA 4PSJA 1O6VA 3OGKB 1QYYA 2BEXA 2V9TB 1KOHA 1OTNA 2WQUA 4NKHA 4CC4A 3W3NA 3W3LA 3DZEA 3TSRE 1PGVA 4ARRA 4FMZA 1FQVA 4KXFB 4FDWA 4WYKA 4PERA 4EZGA 4M7EC 1DS9A 2OMUA 4WP6A 2OMTA 2P1MB 2RA8A 5CMNA 4Z61C 2Z63A 4Q62A 3G04C 3M19A 4H09A 3O6NA 4R6AA 3P72A 2OMYA 3CIYA 3OGLB 5GQRK 3W3JA 3W3MA 5CMPA 4Z64C 2WQXA 4AW4A 4PQ8A 4LI1A 1WWLA 4U09A 3WPFA 3C6OB 2BNHA 1FS2A 1K5GC 4FHOA 4HQ1A 4CC4C 4J4LA 4CNMA 3ULVA 4LSXA 5HDHA 2Z7XB 3WPDA 1P8VA 1H6UA 4YEBB 3WPCA 1XCDA 3A79B 3PMHG 3W3GA 4V2DA 3REZA 5B0NA 4LSXC 1K5DC 2P1PB 5A5CA 4ARNA 2O6QA 1A9NA 2ID5A 2O6RA 4R5DA 4ECOA 3KJ4A 2FT3A 2JE1A 4FD0A 5IYXC 4GLPA 4BSUA 2OMVA 2XWTC 3RFJA 3E2JA 4LXRA 4CNCA 4V2CA 4L3FA 2WFHA 4BSRA 5AWAA 4BV4R 2Q4GW 1G9UA 2O6SA 2UZXA 4XOSA 4R5CA 4Y61B 2A0ZA 2OMXA 2Y5QA 4R09A 2RR6A 2Z7XA 1M9SA 2R9UA 5IJBA 2WQVA 4G8AA 5B4PA 3RW7A 3E3ZA 3ZYOA 3RFEA 3BZ5A 3JB9j 4FCGA 4R58A 1U0ND 4Q3IA 3C6PB 3RGXA 4U7LA 4MQWX 5HZLB 1M0ZA 4KNGA 2XOTA 1DCEA 4PEQB 4R07A 3WPIA 2Z64A 5GS2B 3WPGA 4MN8B 1JL5A 4RCWA 1OGQA 1XKUA 1OTOA 2Z82A 4OQTA 3UN9A 4QBZA 5AZ5A 1A4YA 2Z62A 4U08A 2P1QB 4V2EA 5GS0A 4K17A 2OMWA 5IJCA 1LTXA 1P8TA 1XEUA 1YRGA 2OMZA 3G3BA 4P8SA 2CA6A 4RCAB 1P9AG 3VQ2A 4B8CD 5D3IA 5B0TA 5GMFA 3RJ0A 2ASTB 3G3AA 3ZYJA 4CILA 5GMGA 4R6JA 4KT1A 3VQ1A 3RIZA 4Z8GA 3FXIA 1FO1A 4XGOA 1H6TA 2V70A 1SQ0B 3M18A 3ULUA 5AWCA 1OOKG 3O53A 5GMHA 3GOZA 4PKIG 3UL8A 4BSSA 1KOOA 5AWDA 3WPEA 4GT6A 1O6TA 2P1OB 1O6SA 3CIGA 2Z81A 3RFSA 3OJAA 3UL7A 4RWTC 4R6GA 3C6NB 3G06A 3G39A 1OZNA 5AWBA 4R0AA 4Q3GA 4I6JB 2Z65A 1D0BA 3OGMB 3UL9A 4LSAA 1FT8A 4LI2A 4XSQA 5FTTB 3W3KA 1Z7XW 3WPHA 3OJAB 2IFGA 4LXSA 3ZYNA 1OTMA 4J0MA 4Z94G 2JE0A 3CVRA 4L3AA 3ULAA 3WPBA 2V9SA 1XECA 4LSCA 4C2AB 3RW6A 1M9LA 1XWDC 2JQDA 4IM6A 3SB4A 4AY9X 3E6JA 1IO0A 3E4GA 1M10B 2WQWA 2ELLA 2UZYA 2Z66A 4QC0A 4U06A 4M7EA 2P1NB 4CP6A 4QXEA 2ASSB 5LFNA
chains in the Genus database with same CATH superfamily
3ZYIA 4P91A 4R6FA 4ECNA 3RGZA 1GWBA 4R08A 4NKGA 1W8AA 4FS7A 4TZHA 4UFRA 1DFJI 3WN4A 4C2BB 4Z79A 5IJDA 1ZIWA 4PSJA 1O6VA 3OGKB 1QYYA 2BEXA 2V9TB 1KOHA 1OTNA 2WQUA 4NKHA 4CC4A 3W3NA 3W3LA 3DZEA 3TSRE 1PGVA 4ARRA 4FMZA 1FQVA 4KXFB 4FDWA 4WYKA 4PERA 4EZGA 4M7EC 1DS9A 2OMUA 4WP6A 2OMTA 2P1MB 2RA8A 5CMNA 4Z61C 2Z63A 4Q62A 3G04C 3M19A 4H09A 3O6NA 4R6AA 3P72A 2OMYA 3CIYA 3OGLB 5GQRK 3W3JA 3W3MA 5CMPA 4Z64C 2WQXA 4AW4A 4PQ8A 4LI1A 1WWLA 4U09A 3WPFA 3C6OB 2BNHA 1FS2A 1K5GC 4FHOA 4HQ1A 4CC4C 4J4LA 4CNMA 3ULVA 4LSXA 5HDHA 2Z7XB 3WPDA 1P8VA 1H6UA 4YEBB 3WPCA 1XCDA 3A79B 3PMHG 3W3GA 4V2DA 3REZA 5B0NA 4LSXC 1K5DC 2P1PB 5A5CA 4ARNA 2O6QA 1A9NA 2ID5A 2O6RA 4R5DA 4ECOA 3KJ4A 2FT3A 2JE1A 4FD0A 5IYXC 4GLPA 4BSUA 2OMVA 2XWTC 3RFJA 3E2JA 4LXRA 4CNCA 4V2CA 4L3FA 2WFHA 4BSRA 5AWAA 4BV4R 2Q4GW 1G9UA 2O6SA 2UZXA 4XOSA 4R5CA 4Y61B 2A0ZA 2OMXA 2Y5QA 4R09A 2RR6A 2Z7XA 1M9SA 2R9UA 5IJBA 2WQVA 4G8AA 5B4PA 3RW7A 3E3ZA 3ZYOA 3RFEA 3BZ5A 3JB9j 4FCGA 4R58A 1U0ND 4Q3IA 3C6PB 3RGXA 4U7LA 4MQWX 5HZLB 1M0ZA 4KNGA 2XOTA 1DCEA 4PEQB 4R07A 3WPIA 2Z64A 5GS2B 3WPGA 4MN8B 1JL5A 4RCWA 1OGQA 1XKUA 1OTOA 2Z82A 4OQTA 3UN9A 4QBZA 5AZ5A 1A4YA 2Z62A 4U08A 2P1QB 4V2EA 5GS0A 4K17A 2OMWA 5IJCA 1LTXA 1P8TA 1XEUA 1YRGA 2OMZA 3G3BA 4P8SA 2CA6A 4RCAB 1P9AG 3VQ2A 4B8CD 5D3IA 5B0TA 5GMFA 3RJ0A 2ASTB 3G3AA 3ZYJA 4CILA 5GMGA 4R6JA 4KT1A 3VQ1A 3RIZA 4Z8GA 3FXIA 4NZTM 1FO1A 4XGOA 1H6TA 2V70A 1SQ0B 3M18A 3ULUA 5AWCA 1OOKG 3O53A 5GMHA 3GOZA 4PKIG 3UL8A 4BSSA 1KOOA 5AWDA 3WPEA 4GT6A 1O6TA 2P1OB 1O6SA 3CIGA 2Z81A 3RFSA 3OJAA 3UL7A 4RWTC 4R6GA 3C6NB 3G06A 3G39A 1OZNA 5AWBA 4R0AA 4Q3GA 4I6JB 2Z65A 1D0BA 3OGMB 3UL9A 4LSAA 1FT8A 4LI2A 4XSQA 5FTTB 3W3KA 1Z7XW 3WPHA 3OJAB 2IFGA 4NZRM 4LXSA 3ZYNA 1OTMA 4J0MA 4Z94G 2JE0A 3CVRA 4L3AA 3ULAA 3WPBA 2V9SA 1XECA 4LSCA 4C2AB 3RW6A 1M9LA 1XWDC 2JQDA 4IM6A 3SB4A 4AY9X 3E6JA 1IO0A 3E4GA 1M10B 2WQWA 2ELLA 2UZYA 2Z66A 4QC0A 4U06A 4M7EA 2P1NB 4CP6A 4QXEA 2ASSB 5LFNA
chains in the Genus database with same CATH topology
3ZYIA 4P91A 4R6FA 4ECNA 3RGZA 1GWBA 4R08A 4NKGA 1W8AA 4FS7A 4TZHA 4UFRA 1DFJI 3WN4A 4C2BB 4Z79A 5IJDA 1ZIWA 4PSJA 1O6VA 3OGKB 1QYYA 2BEXA 2V9TB 1KOHA 1OTNA 2WQUA 4NKHA 4CC4A 3W3NA 3W3LA 3DZEA 3TSRE 1PGVA 4ARRA 4FMZA 1FQVA 4KXFB 4FDWA 4WYKA 4PERA 4EZGA 4M7EC 1DS9A 2OMUA 4WP6A 2OMTA 2P1MB 2RA8A 5CMNA 4Z61C 2Z63A 4Q62A 3G04C 3M19A 4H09A 3O6NA 4R6AA 3P72A 2OMYA 3CIYA 3OGLB 5GQRK 3W3JA 3W3MA 5CMPA 4Z64C 2WQXA 4AW4A 4PQ8A 4LI1A 1WWLA 4U09A 3WPFA 3C6OB 2BNHA 1FS2A 1K5GC 4FHOA 4HQ1A 4CC4C 4J4LA 4CNMA 3ULVA 4LSXA 5HDHA 2Z7XB 3WPDA 1P8VA 1H6UA 4YEBB 3WPCA 1XCDA 3A79B 3PMHG 3W3GA 4V2DA 3REZA 5B0NA 4LSXC 1K5DC 2P1PB 5A5CA 4ARNA 2O6QA 1A9NA 2ID5A 2O6RA 4R5DA 4ECOA 3KJ4A 2FT3A 2JE1A 4FD0A 5IYXC 4GLPA 4BSUA 2OMVA 2XWTC 3RFJA 3E2JA 4LXRA 4CNCA 4V2CA 4L3FA 2WFHA 4BSRA 5AWAA 4BV4R 2Q4GW 1G9UA 2O6SA 2UZXA 4XOSA 4R5CA 4Y61B 2A0ZA 2OMXA 2Y5QA 4R09A 2RR6A 2Z7XA 1M9SA 2R9UA 5IJBA 2WQVA 4G8AA 5B4PA 3RW7A 3E3ZA 3ZYOA 3RFEA 3BZ5A 3JB9j 4FCGA 4R58A 1U0ND 4Q3IA 3C6PB 3RGXA 4U7LA 4MQWX 5HZLB 1M0ZA 4KNGA 2XOTA 1DCEA 4PEQB 4R07A 3WPIA 2Z64A 5GS2B 3WPGA 4MN8B 1JL5A 4RCWA 1OGQA 1XKUA 1OTOA 2Z82A 4OQTA 3UN9A 4QBZA 5AZ5A 1A4YA 2Z62A 4U08A 2P1QB 4V2EA 5GS0A 4K17A 2OMWA 5IJCA 1LTXA 1P8TA 1XEUA 1YRGA 2OMZA 3G3BA 4P8SA 2CA6A 4RCAB 1P9AG 3VQ2A 4B8CD 5D3IA 5B0TA 5GMFA 3RJ0A 2ASTB 3G3AA 3ZYJA 4CILA 5GMGA 4R6JA 4KT1A 3VQ1A 3RIZA 4Z8GA 3FXIA 1FO1A 4XGOA 1H6TA 2V70A 1SQ0B 3M18A 3ULUA 5AWCA 1OOKG 3O53A 5GMHA 3GOZA 4PKIG 3UL8A 4BSSA 1KOOA 5AWDA 3WPEA 4GT6A 1O6TA 2P1OB 1O6SA 3CIGA 2Z81A 3RFSA 3OJAA 3UL7A 4RWTC 4R6GA 3C6NB 3G06A 3G39A 1OZNA 5AWBA 4R0AA 4Q3GA 4I6JB 2Z65A 1D0BA 3OGMB 3UL9A 4LSAA 1FT8A 4LI2A 4XSQA 5FTTB 3W3KA 1Z7XW 3WPHA 3OJAB 2IFGA 4LXSA 3ZYNA 1OTMA 4J0MA 4Z94G 2JE0A 3CVRA 4L3AA 3ULAA 3WPBA 2V9SA 1XECA 4LSCA 4C2AB 3RW6A 1M9LA 1XWDC 2JQDA 4IM6A 3SB4A 4AY9X 3E6JA 1IO0A 3E4GA 1M10B 2WQWA 2ELLA 2UZYA 2Z66A 4QC0A 4U06A 4M7EA 2P1NB 4CP6A 4QXEA 2ASSB 5LFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYI A;  4P91 A;  4R6F A;  4ECN A;  3RGZ A;  1GWB A;  4R08 A;  4NKG A;  1W8A A;  4FS7 A;  4TZH A;  4UFR A;  1DFJ I;  3WN4 A;  4C2B B;  4Z79 A;  5IJD A;  1ZIW A;  4PSJ A;  1O6V A;  3OGK B;  1QYY A;  2BEX A;  2V9T B;  1KOH A;  1OTN A;  2WQU A;  4NKH A;  4CC4 A;  3W3N A;  3W3L A;  3DZE A;  3TSR E;  1PGV A;  4ARR A;  4FMZ A;  1FQV A;  4KXF B;  4FDW A;  4WYK A;  4PER A;  4EZG A;  4M7E C;  1DS9 A;  2OMU A;  4WP6 A;  2OMT A;  2P1M B;  2RA8 A;  5CMN A;  4Z61 C;  2Z63 A;  4Q62 A;  3G04 C;  3M19 A;  4H09 A;  3O6N A;  4R6A A;  3P72 A;  2OMY A;  3CIY A;  3OGL B;  5GQR K;  3W3J A;  3W3M A;  5CMP A;  4Z64 C;  2WQX A;  4AW4 A;  4PQ8 A;  4LI1 A;  1WWL A;  4U09 A;  3WPF A;  3C6O B;  2BNH A;  1FS2 A;  1K5G C;  4FHO A;  4HQ1 A;  4CC4 C;  4J4L A;  4CNM A;  3ULV A;  4LSX A;  5HDH A;  2Z7X B;  3WPD A;  1P8V A;  1H6U A;  4YEB B;  3WPC A;  1XCD A;  3A79 B;  3PMH G;  3W3G A;  4V2D A;  3REZ A;  5B0N A;  4LSX C;  1K5D C;  2P1P B;  5A5C A;  4ARN A;  2O6Q A;  1A9N A;  2ID5 A;  2O6R A;  4R5D A;  4ECO A;  3KJ4 A;  2FT3 A;  2JE1 A;  4FD0 A;  5IYX C;  4GLP A;  4BSU A;  2OMV A;  2XWT C;  3RFJ A;  3E2J A;  4LXR A;  4CNC A;  4V2C A;  4L3F A;  2WFH A;  4BSR A;  5AWA A;  4BV4 R;  2Q4G W;  1G9U A;  2O6S A;  2UZX A;  4XOS A;  4R5C A;  4Y61 B;  2A0Z A;  2OMX A;  2Y5Q A;  4R09 A;  2RR6 A;  2Z7X A;  1M9S A;  2R9U A;  5IJB A;  2WQV A;  4G8A A;  5B4P A;  3RW7 A;  3E3Z A;  3ZYO A;  3RFE A;  3BZ5 A;  3JB9 j;  4FCG A;  4R58 A;  1U0N D;  4Q3I A;  3C6P B;  3RGX A;  4U7L A;  4MQW X;  5HZL B;  1M0Z A;  4KNG A;  2XOT A;  1DCE A;  4PEQ B;  4R07 A;  3WPI A;  2Z64 A;  5GS2 B;  3WPG A;  4MN8 B;  1JL5 A;  4RCW A;  1OGQ A;  1XKU A;  1OTO A;  2Z82 A;  4OQT A;  3UN9 A;  4QBZ A;  5AZ5 A;  1A4Y A;  2Z62 A;  4U08 A;  2P1Q B;  4V2E A;  5GS0 A;  4K17 A;  2OMW A;  5IJC A;  1LTX A;  1P8T A;  1XEU A;  1YRG A;  2OMZ A;  3G3B A;  4P8S A;  2CA6 A;  4RCA B;  1P9A G;  3VQ2 A;  4B8C D;  5D3I A;  5B0T A;  5GMF A;  3RJ0 A;  2AST B;  3G3A A;  3ZYJ A;  4CIL A;  5GMG A;  4R6J A;  4KT1 A;  3VQ1 A;  3RIZ A;  4Z8G A;  3FXI A;  1FO1 A;  4XGO A;  1H6T A;  2V70 A;  1SQ0 B;  3M18 A;  3ULU A;  5AWC A;  1OOK G;  3O53 A;  5GMH A;  3GOZ A;  4PKI G;  3UL8 A;  4BSS A;  1KOO A;  5AWD A;  3WPE A;  4GT6 A;  1O6T A;  2P1O B;  1O6S A;  3CIG A;  2Z81 A;  3RFS A;  3OJA A;  3UL7 A;  4RWT C;  4R6G A;  3C6N B;  3G06 A;  3G39 A;  1OZN A;  5AWB A;  4R0A A;  4Q3G A;  4I6J B;  2Z65 A;  1D0B A;  3OGM B;  3UL9 A;  4LSA A;  1FT8 A;  4LI2 A;  4XSQ A;  5FTT B;  3W3K A;  1Z7X W;  3WPH A;  3OJA B;  2IFG A;  4LXS A;  3ZYN A;  1OTM A;  4J0M A;  4Z94 G;  2JE0 A;  3CVR A;  4L3A A;  3ULA A;  3WPB A;  2V9S A;  1XEC A;  4LSC A;  4C2A B;  3RW6 A;  1M9L A;  1XWD C;  2JQD A;  4IM6 A;  3SB4 A;  4AY9 X;  3E6J A;  1IO0 A;  3E4G A;  1M10 B;  2WQW A;  2ELL A;  2UZY A;  2Z66 A;  4QC0 A;  4U06 A;  4M7E A;  2P1N B;  4CP6 A;  4QXE A;  2ASS B;  5LFN A; 
#chains in the Genus database with same CATH topology
 3ZYI A;  4P91 A;  4R6F A;  4ECN A;  3RGZ A;  1GWB A;  4R08 A;  4NKG A;  1W8A A;  4FS7 A;  4TZH A;  4UFR A;  1DFJ I;  3WN4 A;  4C2B B;  4Z79 A;  5IJD A;  1ZIW A;  4PSJ A;  1O6V A;  3OGK B;  1QYY A;  2BEX A;  2V9T B;  1KOH A;  1OTN A;  2WQU A;  4NKH A;  4CC4 A;  3W3N A;  3W3L A;  3DZE A;  3TSR E;  1PGV A;  4ARR A;  4FMZ A;  1FQV A;  4KXF B;  4FDW A;  4WYK A;  4PER A;  4EZG A;  4M7E C;  1DS9 A;  2OMU A;  4WP6 A;  2OMT A;  2P1M B;  2RA8 A;  5CMN A;  4Z61 C;  2Z63 A;  4Q62 A;  3G04 C;  3M19 A;  4H09 A;  3O6N A;  4R6A A;  3P72 A;  2OMY A;  3CIY A;  3OGL B;  5GQR K;  3W3J A;  3W3M A;  5CMP A;  4Z64 C;  2WQX A;  4AW4 A;  4PQ8 A;  4LI1 A;  1WWL A;  4U09 A;  3WPF A;  3C6O B;  2BNH A;  1FS2 A;  1K5G C;  4FHO A;  4HQ1 A;  4CC4 C;  4J4L A;  4CNM A;  3ULV A;  4LSX A;  5HDH A;  2Z7X B;  3WPD A;  1P8V A;  1H6U A;  4YEB B;  3WPC A;  1XCD A;  3A79 B;  3PMH G;  3W3G A;  4V2D A;  3REZ A;  5B0N A;  4LSX C;  1K5D C;  2P1P B;  5A5C A;  4ARN A;  2O6Q A;  1A9N A;  2ID5 A;  2O6R A;  4R5D A;  4ECO A;  3KJ4 A;  2FT3 A;  2JE1 A;  4FD0 A;  5IYX C;  4GLP A;  4BSU A;  2OMV A;  2XWT C;  3RFJ A;  3E2J A;  4LXR A;  4CNC A;  4V2C A;  4L3F A;  2WFH A;  4BSR A;  5AWA A;  4BV4 R;  2Q4G W;  1G9U A;  2O6S A;  2UZX A;  4XOS A;  4R5C A;  4Y61 B;  2A0Z A;  2OMX A;  2Y5Q A;  4R09 A;  2RR6 A;  2Z7X A;  1M9S A;  2R9U A;  5IJB A;  2WQV A;  4G8A A;  5B4P A;  3RW7 A;  3E3Z A;  3ZYO A;  3RFE A;  3BZ5 A;  3JB9 j;  4FCG A;  4R58 A;  1U0N D;  4Q3I A;  3C6P B;  3RGX A;  4U7L A;  4MQW X;  5HZL B;  1M0Z A;  4KNG A;  2XOT A;  1DCE A;  4PEQ B;  4R07 A;  3WPI A;  2Z64 A;  5GS2 B;  3WPG A;  4MN8 B;  1JL5 A;  4RCW A;  1OGQ A;  1XKU A;  1OTO A;  2Z82 A;  4OQT A;  3UN9 A;  4QBZ A;  5AZ5 A;  1A4Y A;  2Z62 A;  4U08 A;  2P1Q B;  4V2E A;  5GS0 A;  4K17 A;  2OMW A;  5IJC A;  1LTX A;  1P8T A;  1XEU A;  1YRG A;  2OMZ A;  3G3B A;  4P8S A;  2CA6 A;  4RCA B;  1P9A G;  3VQ2 A;  4B8C D;  5D3I A;  5B0T A;  5GMF A;  3RJ0 A;  2AST B;  3G3A A;  3ZYJ A;  4CIL A;  5GMG A;  4R6J A;  4KT1 A;  3VQ1 A;  3RIZ A;  4Z8G A;  3FXI A;  4NZT M;  1FO1 A;  4XGO A;  1H6T A;  2V70 A;  1SQ0 B;  3M18 A;  3ULU A;  5AWC A;  1OOK G;  3O53 A;  5GMH A;  3GOZ A;  4PKI G;  3UL8 A;  4BSS A;  1KOO A;  5AWD A;  3WPE A;  4GT6 A;  1O6T A;  2P1O B;  1O6S A;  3CIG A;  2Z81 A;  3RFS A;  3OJA A;  3UL7 A;  4RWT C;  4R6G A;  3C6N B;  3G06 A;  3G39 A;  1OZN A;  5AWB A;  4R0A A;  4Q3G A;  4I6J B;  2Z65 A;  1D0B A;  3OGM B;  3UL9 A;  4LSA A;  1FT8 A;  4LI2 A;  4XSQ A;  5FTT B;  3W3K A;  1Z7X W;  3WPH A;  3OJA B;  2IFG A;  4NZR M;  4LXS A;  3ZYN A;  1OTM A;  4J0M A;  4Z94 G;  2JE0 A;  3CVR A;  4L3A A;  3ULA A;  3WPB A;  2V9S A;  1XEC A;  4LSC A;  4C2A B;  3RW6 A;  1M9L A;  1XWD C;  2JQD A;  4IM6 A;  3SB4 A;  4AY9 X;  3E6J A;  1IO0 A;  3E4G A;  1M10 B;  2WQW A;  2ELL A;  2UZY A;  2Z66 A;  4QC0 A;  4U06 A;  4M7E A;  2P1N B;  4CP6 A;  4QXE A;  2ASS B;  5LFN A; 
#chains in the Genus database with same CATH homology
 3ZYI A;  4P91 A;  4R6F A;  4ECN A;  3RGZ A;  1GWB A;  4R08 A;  4NKG A;  1W8A A;  4FS7 A;  4TZH A;  4UFR A;  1DFJ I;  3WN4 A;  4C2B B;  4Z79 A;  5IJD A;  1ZIW A;  4PSJ A;  1O6V A;  3OGK B;  1QYY A;  2BEX A;  2V9T B;  1KOH A;  1OTN A;  2WQU A;  4NKH A;  4CC4 A;  3W3N A;  3W3L A;  3DZE A;  3TSR E;  1PGV A;  4ARR A;  4FMZ A;  1FQV A;  4KXF B;  4FDW A;  4WYK A;  4PER A;  4EZG A;  4M7E C;  1DS9 A;  2OMU A;  4WP6 A;  2OMT A;  2P1M B;  2RA8 A;  5CMN A;  4Z61 C;  2Z63 A;  4Q62 A;  3G04 C;  3M19 A;  4H09 A;  3O6N A;  4R6A A;  3P72 A;  2OMY A;  3CIY A;  3OGL B;  5GQR K;  3W3J A;  3W3M A;  5CMP A;  4Z64 C;  2WQX A;  4AW4 A;  4PQ8 A;  4LI1 A;  1WWL A;  4U09 A;  3WPF A;  3C6O B;  2BNH A;  1FS2 A;  1K5G C;  4FHO A;  4HQ1 A;  4CC4 C;  4J4L A;  4CNM A;  3ULV A;  4LSX A;  5HDH A;  2Z7X B;  3WPD A;  1P8V A;  1H6U A;  4YEB B;  3WPC A;  1XCD A;  3A79 B;  3PMH G;  3W3G A;  4V2D A;  3REZ A;  5B0N A;  4LSX C;  1K5D C;  2P1P B;  5A5C A;  4ARN A;  2O6Q A;  1A9N A;  2ID5 A;  2O6R A;  4R5D A;  4ECO A;  3KJ4 A;  2FT3 A;  2JE1 A;  4FD0 A;  5IYX C;  4GLP A;  4BSU A;  2OMV A;  2XWT C;  3RFJ A;  3E2J A;  4LXR A;  4CNC A;  4V2C A;  4L3F A;  2WFH A;  4BSR A;  5AWA A;  4BV4 R;  2Q4G W;  1G9U A;  2O6S A;  2UZX A;  4XOS A;  4R5C A;  4Y61 B;  2A0Z A;  2OMX A;  2Y5Q A;  4R09 A;  2RR6 A;  2Z7X A;  1M9S A;  2R9U A;  5IJB A;  2WQV A;  4G8A A;  5B4P A;  3RW7 A;  3E3Z A;  3ZYO A;  3RFE A;  3BZ5 A;  3JB9 j;  4FCG A;  4R58 A;  1U0N D;  4Q3I A;  3C6P B;  3RGX A;  4U7L A;  4MQW X;  5HZL B;  1M0Z A;  4KNG A;  2XOT A;  1DCE A;  4PEQ B;  4R07 A;  3WPI A;  2Z64 A;  5GS2 B;  3WPG A;  4MN8 B;  1JL5 A;  4RCW A;  1OGQ A;  1XKU A;  1OTO A;  2Z82 A;  4OQT A;  3UN9 A;  4QBZ A;  5AZ5 A;  1A4Y A;  2Z62 A;  4U08 A;  2P1Q B;  4V2E A;  5GS0 A;  4K17 A;  2OMW A;  5IJC A;  1LTX A;  1P8T A;  1XEU A;  1YRG A;  2OMZ A;  3G3B A;  4P8S A;  2CA6 A;  4RCA B;  1P9A G;  3VQ2 A;  4B8C D;  5D3I A;  5B0T A;  5GMF A;  3RJ0 A;  2AST B;  3G3A A;  3ZYJ A;  4CIL A;  5GMG A;  4R6J A;  4KT1 A;  3VQ1 A;  3RIZ A;  4Z8G A;  3FXI A;  1FO1 A;  4XGO A;  1H6T A;  2V70 A;  1SQ0 B;  3M18 A;  3ULU A;  5AWC A;  1OOK G;  3O53 A;  5GMH A;  3GOZ A;  4PKI G;  3UL8 A;  4BSS A;  1KOO A;  5AWD A;  3WPE A;  4GT6 A;  1O6T A;  2P1O B;  1O6S A;  3CIG A;  2Z81 A;  3RFS A;  3OJA A;  3UL7 A;  4RWT C;  4R6G A;  3C6N B;  3G06 A;  3G39 A;  1OZN A;  5AWB A;  4R0A A;  4Q3G A;  4I6J B;  2Z65 A;  1D0B A;  3OGM B;  3UL9 A;  4LSA A;  1FT8 A;  4LI2 A;  4XSQ A;  5FTT B;  3W3K A;  1Z7X W;  3WPH A;  3OJA B;  2IFG A;  4LXS A;  3ZYN A;  1OTM A;  4J0M A;  4Z94 G;  2JE0 A;  3CVR A;  4L3A A;  3ULA A;  3WPB A;  2V9S A;  1XEC A;  4LSC A;  4C2A B;  3RW6 A;  1M9L A;  1XWD C;  2JQD A;  4IM6 A;  3SB4 A;  4AY9 X;  3E6J A;  1IO0 A;  3E4G A;  1M10 B;  2WQW A;  2ELL A;  2UZY A;  2Z66 A;  4QC0 A;  4U06 A;  4M7E A;  2P1N B;  4CP6 A;  4QXE A;  2ASS B;  5LFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...