4J4NA

Crystal structure of fk506 binding domain of plasmodium falciparum fkbp35 in complex with d44
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecule Plasmodium FKBP35 inhibitor as a potential antimalaria agent.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase/isomerase inhibitor
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
total genus 28
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4j4nA01
2PV2A 4W9PA 3KADA 4IQ2A 1F8AB 3O5RA 2IF4A 3PRBA 3O5MA 4NNRA 3O5GA 4DH0A 2ZQVA 4U86A 1Q1CA 1M5YA 2M1IA 2Y78A 2ZQUA 2RURA 4TX0A 3LUOA 3UI6A 4DROA 5B8IC 2FKEA 2PPOA 2ZQSA 2PPNA 1EYMA 4DRNA 4ODPA 1ROUA 1JVWA 1FKFA 3TCZA 1J6YA 2Q5AA 2XP5A 1L1PA 4JFMA 3CGMA 2RSEA 1Q6IA 1PINA 2F21A 2XPBA 2ITKA 1EQ3A 1U79A 4DRJA 4O2TA 4FN2A 2N87A 5D75A 1KT0A 4DRQA 4QT3A 2ZQTA 3KAIA 3UF8A 2OFNA 3O5QA 4LAXA 1YW5A 2XP6A 3CGNA 1C9HA 1A7XA 2LPVA 3O5OA 4ITZA 4J4NA 4ODKA 2L2SA 1FAPA 4C02B 4TW6A 2KI3A 2PPPA 2LGOA 1FKRA 2XP7A 3JYJA 4JFJA 2KFWA 3KABA 4DIPA 3OOBA 1NSGA 1Q6UA 3EY6A 3IK8A 5BXJA 3GPKA 2PBCA 2UZ5A 3ODKA 4FAPA 4QIBA 3PRDA 5GPGA 1D7HA 1QPFA 4MGVA 3NTPA 5DIVA 4GIVA 4J4OA 4LAWA 1FKBA 3KCEA 2F2DA 4U84A 2DG4A 4R0XA 1D7IA 2K8IA 3B7XA 3JXVA 1D7JA 5HT1A 1QZ2A 1D6OA 4ODQA 4QT2A 4GGQA 4DRKA 3UQAA 3I6CA 3WH0A 5HKGA 4ODMA 1JNTA 3UI5A 1T11A 2FAPA 4ODNA 1FD9A 2KO7A 2VN1A 1ZCNA 2M2AA 3O5LA 1NMVA 1J4RA 2RUCA 3O5FA 4LAYA 3RFWA 1HXVA 5I98A 1FJDA 3O5KA 4LAVA 1FKSA 3NI6A 2ZR4A 2RUDA 2VCDA 4ODLA 2PV3A 2MLYA 3O5DA 3H9RB 1P5QA 5HTGA 4MSPA 2MF9A 3IKDA 4G50A 4IQCA 5DITA 1ZK6A 1TCOC 4JFLA 3RGCA 4DZ3A 3KAHA 2AWGA 4U85A 3MDYB 1F40A 2MLZA 2D9FA 2ZR6A 3TDBA 4DZ2A 4JFIA 2XP4A 5HW7A 4BF8A 2RQSA 3KAGA 2DG9A 2F4EA 3UI4A 4IPXA 1Y0OA 1PBKA 4DRPA 1N1AA 2DG3A 2PV1A 1B6CA 4TYOA 4JYSA 5HUAA 3NRKA 3O5EA 3TC5A 1J4IA 4DRHA 4ODRA 5HWCA 2XPAA 2KGJA 2XP9A 2MPHA 5HW6A 5DIUA 5J6EA 2M08A 1FKLA 2JZVA 3KAFA 1JNSA 1KT1A 1W26A 1FKHA 3IHZA 4TW8A 4DRMA 1BKFA 2KE0A 3O5PA 3O5IA 4TNSA 3FAPA 1YATA 3PA7A 2MNTA 1NMWA 1Q6HA 1QPLA 3O5JA 4TW7A 4DRIA 2RUQA 3UQBA 2XP8A 4ODOA 1J4HA 5HW8A 2MLXA 2LJ4A 5HWBA 4W9QA 1FKGA 1FKDA 4N19A 2LKNA 1FKTA 3UQIA 2XP3A 3KACA 4JFKA 3KZ7A 1FKKA 4W9OA 4DT4A 1BL4A 1FKJA 2KR7A 3JYMA 4G2PA 3VAWA 3IKGA 1R9HA 1FKIA 1ROTA 2ZR5A
chains in the Genus database with same CATH superfamily
2PV2A 3PRBA 3O5GA 1Q1CA 2PPOA 4IT4A 4NZCA 1RD6A 3FXYA 3ARQA 1ROUA 1JVWA 4W5UA 1J6YA 1LL7A 3WD3A 2ESCA 1EQ3A 2ITKA 4FN2A 2N87A 5D75A 1E6NA 1YW5A 2XP6A 1WAWA 4P8XA 1C9HA 4ODKA 4MAVA 2KI3A 3BXWA 3RM9A 1FFQA 1LG1A 1GOIA 4DIPA 3AS1A 3OOBA 4KQZA 2WK2A 3CHFA 4QIBA 3PRDA 3WD4A 1QPFA 4J4OA 4LAWA 3KCEA 1D7IA 3QOKA 1H0IA 3ARWA 5GPRA 1JNTA 2A3CA 1T11A 3ARZA 3O5FA 4DWSC 2ETNA 1FJDA 2DT0A 4ODLA 3H9RB 1P5QA 1HJXA 2MF9A 3CHDA 5DITA 1ZK6A 3RGCA 1W9VA 4QZVB 1CTNA 2AWGA 3MDYB 4UDMA 2MLZA 2A3BA 4JFIA 2XP4A 5HW7A 1LL6A 2DG9A 4IPXA 5GQBA 1Y0OA 2WM0A 1B6CA 1W9PA 5HUAA 3O5EA 4DRHA 1ROTA 1UR9A 3AS2A 5J6EA 2M08A 4Z2JA 1FKHA 3IHZA 4DRMA 1HJWA 2KE0A 3B9AA 3FAPA 1YATA 3PA7A 4DRIA 4Z2KA 4Z2LA 3O5JA 3UQBA 2XP8A 3PR9A 5HW8A 2LJ4A 1EHNA 1FKDA 2LKNA 2PI6A 4LGXA 1FKJA 3WIJA 3NTPA 2ZR5A 1X6LA 2DSUA 3KADA 3O5RA 4DH0A 1NH6A 2EULA 2Y78A 2ZQUA 1K9TA 3LUOA 3UI6A 1LJYA 4IT6A 4DWSA 3BMBA 2FKEA 4P8WA 2A3EA 3TCZA 3CGMA 1PINA 2XPBA 1U79A 3WD0A 4DRJA 1W9UA 4QT3A 2ZQTA 3UF8A 3G6MA 2OFNA 1X6NA 1E6RA 1IX5A 4WJXA 2PPPA 2LGOA 1FKRA 3JYJA 1NSGA 3EY6A 3IK8A 3GPKA 3ODKA 4NSBA 5DEZA 3RMEA 1HKKA 1SR0A 1D2KA 2IUZA 1FKBA 1W1YA 1OWQA 2K8IA 3JXVA 1D7JA 1QZ2A 4QT2A 4DRKA 3I6CA 3UI5A 4DWSD 3RM8A 1FD9A 2KO7A 2M2AA 3GU0A 3O5LA 1KFWA 1NMVA 2RUCA 1HXVA 3RFWA 2DSWA 3O5KA 3B9DA 1FKSA 2DSZA 4L72B 2RUDA 3ARUA 2PV3A 2MLYA 4WKAA 4MSPA 3G6LA 3IKDA 1TCOC 4U85A 1F40A 3TDBA 2ZR6A 3ARVA 4BF8A 2RQSA 1HKIA 3KAGA 1OGGA 1PBKA 2O92A 1N1AA 4DRPA 2PV1A 1JCHB 1ZU8A 4JYSA 4Z2IA 5HWCA 4ODRA 2XPAA 3AS3A 3KAFA 1ZBVA 4ZS6A 1Q6HA 1GUVA 1UR8A 2G8ZA 4URIA 2MLXA 4ZPTR 5HWBA 1XRVA 4W9QA 1HKMA 2DSVA 1FKGA 1FKTA 2XP3A 3KACA 2FDMA 4W9OA 2F23A 4G2PA 3CH9A 3WL1A 4LAVA 4W9PA 4Z2GA 4IQ2A 2IF4A 3WQWA 4U86A 4PTMA 4TX0A 2RURA 2ZQSA 2PPNA 1EYMA 1GRJA 4DRNA 3OA5A 1FKFA 3GTYX 2RSEA 4ZPWR 1EIBA 1LL4A 2F21A 5JH8A 4MPKA 5DO2A 4LAXA 3O5QA 3CGNA 1HKJA 1ITXA 1A7XA 2LPVA 4ITZA 2L2SA 4C02B 4HBEA 1ZBKA 1EDQA 3FY1A 4WKHA 2XP7A 3WL0A 2KFWA 3KABA 3WKZA 1E15A 5GPGA 1D7HA 5DIVA 4GIVA 3CHCA 1NWTA 3AQUA 2YBUA 3ARPA 1O6IA 2DG4A 4R0XA 3B7XA 5HT1A 1D6OA 4GGQA 4ODMA 4ODNA 2VN1A 1ZCNA 1J4RA 4MNMA 3NI6A 1FFRA 2ZR4A 2VCDA 3O5DA 5HTGA 1E6ZA 1W1VA 3ARTA 4IQCA 4JFLA 4S3JA 2YBTA 3ALFA 2D9FA 4DZ2A 1E44A 1JNEA 2F4EA 1NWUA 1W1TA 2B5UB 2DG3A 4MTVA 4TYOA 4HBOA 2XP9A 4P8VA 2B31A 5HW6A 5DIUA 1W26A 4TW8A 1BKFA 2P4VA 3W4RA 1ZL1A 4ML4A 2MNTA 1NMWA 4HARA 4ODOA 4MNLA 1TFVA 2O9OA 3ARSA 2QF8A 4N19A 4ZPVR 1XHGA 4Z2HA 4JFKA 4MNKA 3CHEA 1GPFA 3IKGA 1R9HA 4DROA 5BXJA 1OGBA 1F8AB 4WKFA 3O5MA 4XAKA 4NNRA 1HJVA 2ZQVA 2PN0A 1M5YA 2M1IA 3WD1A 5B8IC 4L3NA 4ODPA 1L1PA 2Q5AA 2XP5A 3WD2A 4JFMA 3RM4A 1SYTA 4P8UA 4WIWA 1Q6IA 4Q7NA 4O2TA 1KT0A 1NWSA 3KAIA 4Q22A 2WLYA 3AROA 3PRAA 3O5OA 4J4NA 1FAPA 4DWSB 4TW6A 4JFJA 3B9EA 1LG2A 1Q6UA 1ZBCA 2PBCA 2UZ5A 4FAPA 2A3AA 4MGVA 1VF8A 4R5EA 4U84A 2F2DA 4KR0B 3ARRA 1E9LA 4ODQA 3UQAA 3WH0A 5HKGA 1JNDA 1ZB5A 2FAPA 1WNOA 1LQ0A 2DT3A 1WB0A 4LAYA 5I98A 5DF0A 3B8SA 1ZBWA 4G50A 4DZ3A 3KAHA 3ARYA 4S3KA 2AOSA 2OLHA 3ARXA 3UI4A 1H0GA 5HBFA 3EIPA 3NRKA 3TC5A 1J4IA 2KGJA 4WK9A 2MPHA 3WQVA 1FKLA 2JZVA 1JNSA 1KT1A 4AY1A 3O5PA 2DT2A 3O5IA 4TNSA 1QPLA 4TW7A 2RUQA 3ALGA 1E6PA 1J4HA 1NWRA 2WLZA 3AS0A 4MNJA 1W1PA 3UQIA 3CZ8A 3KZ7A 1FKKA 2G41A 4DT4A 1BL4A 3JYMA 2KR7A 3VAWA 4DRQA 1FKIA 2DT1A 2DPEA
chains in the Genus database with same CATH topology
2PV2A 3PRBA 3O5GA 1Q1CA 2PPOA 4IT4A 4NZCA 1RD6A 3FXYA 3ARQA 1ROUA 1JVWA 4W5UA 1J6YA 1LL7A 3WD3A 2ESCA 1EQ3A 2ITKA 4FN2A 2N87A 5D75A 1E6NA 1YW5A 2XP6A 1WAWA 4P8XA 1C9HA 4ODKA 4MAVA 2KI3A 3BXWA 3RM9A 1FFQA 1LG1A 1GOIA 4DIPA 3AS1A 3OOBA 4KQZA 2WK2A 3CHFA 4QIBA 3PRDA 3WD4A 1QPFA 4J4OA 4LAWA 3KCEA 1D7IA 3QOKA 1H0IA 3ARWA 5GPRA 1JNTA 2A3CA 1T11A 3ARZA 3O5FA 4DWSC 1FJDA 2DT0A 4ODLA 3H9RB 1P5QA 1HJXA 2MF9A 3CHDA 5DITA 1ZK6A 3RGCA 1W9VA 4QZVB 1CTNA 2AWGA 3MDYB 2MLZA 2A3BA 4JFIA 2XP4A 5HW7A 1LL6A 2DG9A 4IPXA 5GQBA 1Y0OA 2WM0A 1B6CA 1W9PA 5HUAA 3O5EA 4DRHA 1ROTA 1UR9A 3AS2A 5J6EA 2M08A 4Z2JA 1FKHA 3IHZA 4DRMA 1HJWA 2KE0A 3B9AA 3FAPA 1YATA 3PA7A 4DRIA 4Z2KA 4Z2LA 3O5JA 3UQBA 2XP8A 3PR9A 5HW8A 2LJ4A 1EHNA 1FKDA 2LKNA 2PI6A 4LGXA 1FKJA 3WIJA 3NTPA 2ZR5A 1X6LA 2DSUA 3KADA 3O5RA 4DH0A 1NH6A 2Y78A 2ZQUA 1K9TA 3LUOA 3UI6A 1LJYA 4IT6A 4DWSA 2FKEA 4P8WA 2A3EA 3TCZA 3CGMA 1PINA 2XPBA 1U79A 3WD0A 4DRJA 1W9UA 4QT3A 2ZQTA 3UF8A 3G6MA 2OFNA 1X6NA 1E6RA 1IX5A 4WJXA 2PPPA 2LGOA 1FKRA 3JYJA 1NSGA 3EY6A 3IK8A 3GPKA 3ODKA 4NSBA 5DEZA 3RMEA 1HKKA 1SR0A 1D2KA 2IUZA 1FKBA 1W1YA 1OWQA 2K8IA 3JXVA 1D7JA 1QZ2A 4QT2A 4DRKA 3I6CA 3UI5A 4DWSD 3RM8A 1FD9A 2KO7A 2M2AA 3O5LA 1KFWA 1NMVA 2RUCA 1HXVA 3RFWA 2DSWA 3O5KA 3B9DA 1FKSA 2DSZA 4L72B 2RUDA 3ARUA 2PV3A 2MLYA 4WKAA 4MSPA 3G6LA 3IKDA 1TCOC 4U85A 1F40A 3TDBA 2ZR6A 3ARVA 4BF8A 2RQSA 1HKIA 3KAGA 1OGGA 1PBKA 2O92A 1N1AA 4DRPA 2PV1A 1ZU8A 4JYSA 4Z2IA 5HWCA 4ODRA 2XPAA 3AS3A 3KAFA 1ZBVA 4ZS6A 1Q6HA 1GUVA 1UR8A 2G8ZA 4URIA 2MLXA 4ZPTR 5HWBA 1XRVA 4W9QA 1HKMA 2DSVA 1FKGA 1FKTA 2XP3A 3KACA 2FDMA 4W9OA 4G2PA 3WL1A 3CH9A 4LAVA 4W9PA 4Z2GA 4IQ2A 2IF4A 3WQWA 4U86A 4PTMA 4TX0A 2RURA 2ZQSA 2PPNA 1EYMA 4DRNA 3OA5A 1FKFA 2RSEA 4ZPWR 1EIBA 1LL4A 2F21A 5JH8A 4MPKA 5DO2A 4LAXA 3O5QA 3CGNA 1HKJA 1ITXA 1A7XA 2LPVA 4ITZA 2L2SA 4C02B 4HBEA 1ZBKA 1EDQA 3FY1A 4WKHA 2XP7A 3WL0A 2KFWA 3KABA 3WKZA 1E15A 5GPGA 1D7HA 5DIVA 4GIVA 3CHCA 1NWTA 3AQUA 2YBUA 3ARPA 1O6IA 2DG4A 4R0XA 3B7XA 5HT1A 1D6OA 4GGQA 4ODMA 4ODNA 2VN1A 1ZCNA 1J4RA 4MNMA 3NI6A 1FFRA 2ZR4A 2VCDA 3O5DA 5HTGA 1E6ZA 1W1VA 3ARTA 4IQCA 4JFLA 4S3JA 2YBTA 3ALFA 2D9FA 4DZ2A 1JNEA 2F4EA 1NWUA 1W1TA 2DG3A 4MTVA 4TYOA 4HBOA 2XP9A 4P8VA 2B31A 5HW6A 5DIUA 1W26A 4TW8A 1BKFA 3W4RA 1ZL1A 4ML4A 2MNTA 1NMWA 4HARA 4ODOA 4MNLA 1TFVA 2O9OA 3ARSA 2QF8A 4N19A 4ZPVR 1XHGA 4Z2HA 4JFKA 4MNKA 3CHEA 1GPFA 3IKGA 1R9HA 4DROA 5BXJA 1OGBA 1F8AB 4WKFA 3O5MA 4XAKA 4NNRA 1HJVA 2ZQVA 1M5YA 2M1IA 3WD1A 5B8IC 4L3NA 4ODPA 1L1PA 2Q5AA 2XP5A 3WD2A 4JFMA 3RM4A 1SYTA 4P8UA 4WIWA 1Q6IA 4Q7NA 4O2TA 1KT0A 1NWSA 3KAIA 4Q22A 2WLYA 3AROA 3PRAA 3O5OA 4J4NA 1FAPA 4DWSB 4TW6A 4JFJA 3B9EA 1LG2A 1Q6UA 1ZBCA 2PBCA 2UZ5A 4FAPA 2A3AA 4MGVA 1VF8A 4R5EA 4U84A 2F2DA 4KR0B 3ARRA 1E9LA 4ODQA 3UQAA 3WH0A 5HKGA 1JNDA 1ZB5A 2FAPA 1WNOA 1LQ0A 2DT3A 1WB0A 4LAYA 5I98A 5DF0A 3B8SA 1ZBWA 4G50A 4DZ3A 3KAHA 3ARYA 4S3KA 2AOSA 2OLHA 3ARXA 3UI4A 1H0GA 5HBFA 3NRKA 3TC5A 1J4IA 2KGJA 4WK9A 2MPHA 3WQVA 1FKLA 2JZVA 1JNSA 1KT1A 4AY1A 3O5PA 2DT2A 3O5IA 4TNSA 1QPLA 4TW7A 2RUQA 3ALGA 1E6PA 1J4HA 1NWRA 2WLZA 3AS0A 4MNJA 1W1PA 3UQIA 3CZ8A 3KZ7A 1FKKA 2G41A 4DT4A 1BL4A 3JYMA 2KR7A 3VAWA 4DRQA 1FKIA 2DT1A 2DPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  4W9P A;  3KAD A;  4IQ2 A;  1F8A B;  3O5R A;  2IF4 A;  3PRB A;  3O5M A;  4NNR A;  3O5G A;  4DH0 A;  2ZQV A;  4U86 A;  1Q1C A;  1M5Y A;  2M1I A;  2Y78 A;  2ZQU A;  2RUR A;  4TX0 A;  3LUO A;  3UI6 A;  4DRO A;  5B8I C;  2FKE A;  2PPO A;  2ZQS A;  2PPN A;  1EYM A;  4DRN A;  4ODP A;  1ROU A;  1JVW A;  1FKF A;  3TCZ A;  1J6Y A;  2Q5A A;  2XP5 A;  1L1P A;  4JFM A;  3CGM A;  2RSE A;  1Q6I A;  1PIN A;  2F21 A;  2XPB A;  2ITK A;  1EQ3 A;  1U79 A;  4DRJ A;  4O2T A;  4FN2 A;  2N87 A;  5D75 A;  1KT0 A;  4DRQ A;  4QT3 A;  2ZQT A;  3KAI A;  3UF8 A;  2OFN A;  3O5Q A;  4LAX A;  1YW5 A;  2XP6 A;  3CGN A;  1C9H A;  1A7X A;  2LPV A;  3O5O A;  4ITZ A;  4J4N A;  4ODK A;  2L2S A;  1FAP A;  4C02 B;  4TW6 A;  2KI3 A;  2PPP A;  2LGO A;  1FKR A;  2XP7 A;  3JYJ A;  4JFJ A;  2KFW A;  3KAB A;  4DIP A;  3OOB A;  1NSG A;  1Q6U A;  3EY6 A;  3IK8 A;  5BXJ A;  3GPK A;  2PBC A;  2UZ5 A;  3ODK A;  4FAP A;  4QIB A;  3PRD A;  5GPG A;  1D7H A;  1QPF A;  4MGV A;  3NTP A;  5DIV A;  4GIV A;  4J4O A;  4LAW A;  1FKB A;  3KCE A;  2F2D A;  4U84 A;  2DG4 A;  4R0X A;  1D7I A;  2K8I A;  3B7X A;  3JXV A;  1D7J A;  5HT1 A;  1QZ2 A;  1D6O A;  4ODQ A;  4QT2 A;  4GGQ A;  4DRK A;  3UQA A;  3I6C A;  3WH0 A;  5HKG A;  4ODM A;  1JNT A;  3UI5 A;  1T11 A;  2FAP A;  4ODN A;  1FD9 A;  2KO7 A;  2VN1 A;  1ZCN A;  2M2A A;  3O5L A;  1NMV A;  1J4R A;  2RUC A;  3O5F A;  4LAY A;  3RFW A;  1HXV A;  5I98 A;  1FJD A;  3O5K A;  4LAV A;  1FKS A;  3NI6 A;  2ZR4 A;  2RUD A;  2VCD A;  4ODL A;  2PV3 A;  2MLY A;  3O5D A;  3H9R B;  1P5Q A;  5HTG A;  4MSP A;  2MF9 A;  3IKD A;  4G50 A;  4IQC A;  5DIT A;  1ZK6 A;  1TCO C;  4JFL A;  3RGC A;  4DZ3 A;  3KAH A;  2AWG A;  4U85 A;  3MDY B;  1F40 A;  2MLZ A;  2D9F A;  2ZR6 A;  3TDB A;  4DZ2 A;  4JFI A;  2XP4 A;  5HW7 A;  4BF8 A;  2RQS A;  3KAG A;  2DG9 A;  2F4E A;  3UI4 A;  4IPX A;  1Y0O A;  1PBK A;  4DRP A;  1N1A A;  2DG3 A;  2PV1 A;  1B6C A;  4TYO A;  4JYS A;  5HUA A;  3NRK A;  3O5E A;  3TC5 A;  1J4I A;  4DRH A;  4ODR A;  5HWC A;  2XPA A;  2KGJ A;  2XP9 A;  2MPH A;  5HW6 A;  5DIU A;  5J6E A;  2M08 A;  1FKL A;  2JZV A;  3KAF A;  1JNS A;  1KT1 A;  1W26 A;  1FKH A;  3IHZ A;  4TW8 A;  4DRM A;  1BKF A;  2KE0 A;  3O5P A;  3O5I A;  4TNS A;  3FAP A;  1YAT A;  3PA7 A;  2MNT A;  1NMW A;  1Q6H A;  1QPL A;  3O5J A;  4TW7 A;  4DRI A;  2RUQ A;  3UQB A;  2XP8 A;  4ODO A;  1J4H A;  5HW8 A;  2MLX A;  2LJ4 A;  5HWB A;  4W9Q A;  1FKG A;  1FKD A;  4N19 A;  2LKN A;  1FKT A;  3UQI A;  2XP3 A;  3KAC A;  4JFK A;  3KZ7 A;  1FKK A;  4W9O A;  4DT4 A;  1BL4 A;  1FKJ A;  2KR7 A;  3JYM A;  4G2P A;  3VAW A;  3IKG A;  1R9H A;  1FKI A;  1ROT A;  2ZR5 A; 
#chains in the Genus database with same CATH topology
 2PV2 A;  3PRB A;  3O5G A;  1Q1C A;  2PPO A;  4IT4 A;  4NZC A;  1RD6 A;  3FXY A;  3ARQ A;  1ROU A;  1JVW A;  4W5U A;  1J6Y A;  1LL7 A;  3WD3 A;  2ESC A;  1EQ3 A;  2ITK A;  4FN2 A;  2N87 A;  5D75 A;  1E6N A;  1YW5 A;  2XP6 A;  1WAW A;  4P8X A;  1C9H A;  4ODK A;  4MAV A;  2KI3 A;  3BXW A;  3RM9 A;  1FFQ A;  1LG1 A;  1GOI A;  4DIP A;  3AS1 A;  3OOB A;  4KQZ A;  2WK2 A;  3CHF A;  4QIB A;  3PRD A;  3WD4 A;  1QPF A;  4J4O A;  4LAW A;  3KCE A;  1D7I A;  3QOK A;  1H0I A;  3ARW A;  5GPR A;  1JNT A;  2A3C A;  1T11 A;  3ARZ A;  3O5F A;  4DWS C;  2ETN A;  1FJD A;  2DT0 A;  4ODL A;  3H9R B;  1P5Q A;  1HJX A;  2MF9 A;  3CHD A;  5DIT A;  1ZK6 A;  3RGC A;  1W9V A;  4QZV B;  1CTN A;  2AWG A;  3MDY B;  4UDM A;  2MLZ A;  2A3B A;  4JFI A;  2XP4 A;  5HW7 A;  1LL6 A;  2DG9 A;  4IPX A;  5GQB A;  1Y0O A;  2WM0 A;  1B6C A;  1W9P A;  5HUA A;  3O5E A;  4DRH A;  1ROT A;  1UR9 A;  3AS2 A;  5J6E A;  2M08 A;  4Z2J A;  1FKH A;  3IHZ A;  4DRM A;  1HJW A;  2KE0 A;  3B9A A;  3FAP A;  1YAT A;  3PA7 A;  4DRI A;  4Z2K A;  4Z2L A;  3O5J A;  3UQB A;  2XP8 A;  3PR9 A;  5HW8 A;  2LJ4 A;  1EHN A;  1FKD A;  2LKN A;  2PI6 A;  4LGX A;  1FKJ A;  3WIJ A;  3NTP A;  2ZR5 A;  1X6L A;  2DSU A;  3KAD A;  3O5R A;  4DH0 A;  1NH6 A;  2EUL A;  2Y78 A;  2ZQU A;  1K9T A;  3LUO A;  3UI6 A;  1LJY A;  4IT6 A;  4DWS A;  3BMB A;  2FKE A;  4P8W A;  2A3E A;  3TCZ A;  3CGM A;  1PIN A;  2XPB A;  1U79 A;  3WD0 A;  4DRJ A;  1W9U A;  4QT3 A;  2ZQT A;  3UF8 A;  3G6M A;  2OFN A;  1X6N A;  1E6R A;  1IX5 A;  4WJX A;  2PPP A;  2LGO A;  1FKR A;  3JYJ A;  1NSG A;  3EY6 A;  3IK8 A;  3GPK A;  3ODK A;  4NSB A;  5DEZ A;  3RME A;  1HKK A;  1SR0 A;  1D2K A;  2IUZ A;  1FKB A;  1W1Y A;  1OWQ A;  2K8I A;  3JXV A;  1D7J A;  1QZ2 A;  4QT2 A;  4DRK A;  3I6C A;  3UI5 A;  4DWS D;  3RM8 A;  1FD9 A;  2KO7 A;  2M2A A;  3GU0 A;  3O5L A;  1KFW A;  1NMV A;  2RUC A;  1HXV A;  3RFW A;  2DSW A;  3O5K A;  3B9D A;  1FKS A;  2DSZ A;  4L72 B;  2RUD A;  3ARU A;  2PV3 A;  2MLY A;  4WKA A;  4MSP A;  3G6L A;  3IKD A;  1TCO C;  4U85 A;  1F40 A;  3TDB A;  2ZR6 A;  3ARV A;  4BF8 A;  2RQS A;  1HKI A;  3KAG A;  1OGG A;  1PBK A;  2O92 A;  1N1A A;  4DRP A;  2PV1 A;  1JCH B;  1ZU8 A;  4JYS A;  4Z2I A;  5HWC A;  4ODR A;  2XPA A;  3AS3 A;  3KAF A;  1ZBV A;  4ZS6 A;  1Q6H A;  1GUV A;  1UR8 A;  2G8Z A;  4URI A;  2MLX A;  4ZPT R;  5HWB A;  1XRV A;  4W9Q A;  1HKM A;  2DSV A;  1FKG A;  1FKT A;  2XP3 A;  3KAC A;  2FDM A;  4W9O A;  2F23 A;  4G2P A;  3CH9 A;  3WL1 A;  4LAV A;  4W9P A;  4Z2G A;  4IQ2 A;  2IF4 A;  3WQW A;  4U86 A;  4PTM A;  4TX0 A;  2RUR A;  2ZQS A;  2PPN A;  1EYM A;  1GRJ A;  4DRN A;  3OA5 A;  1FKF A;  3GTY X;  2RSE A;  4ZPW R;  1EIB A;  1LL4 A;  2F21 A;  5JH8 A;  4MPK A;  5DO2 A;  4LAX A;  3O5Q A;  3CGN A;  1HKJ A;  1ITX A;  1A7X A;  2LPV A;  4ITZ A;  2L2S A;  4C02 B;  4HBE A;  1ZBK A;  1EDQ A;  3FY1 A;  4WKH A;  2XP7 A;  3WL0 A;  2KFW A;  3KAB A;  3WKZ A;  1E15 A;  5GPG A;  1D7H A;  5DIV A;  4GIV A;  3CHC A;  1NWT A;  3AQU A;  2YBU A;  3ARP A;  1O6I A;  2DG4 A;  4R0X A;  3B7X A;  5HT1 A;  1D6O A;  4GGQ A;  4ODM A;  4ODN A;  2VN1 A;  1ZCN A;  1J4R A;  4MNM A;  3NI6 A;  1FFR A;  2ZR4 A;  2VCD A;  3O5D A;  5HTG A;  1E6Z A;  1W1V A;  3ART A;  4IQC A;  4JFL A;  4S3J A;  2YBT A;  3ALF A;  2D9F A;  4DZ2 A;  1E44 A;  1JNE A;  2F4E A;  1NWU A;  1W1T A;  2B5U B;  2DG3 A;  4MTV A;  4TYO A;  4HBO A;  2XP9 A;  4P8V A;  2B31 A;  5HW6 A;  5DIU A;  1W26 A;  4TW8 A;  1BKF A;  2P4V A;  3W4R A;  1ZL1 A;  4ML4 A;  2MNT A;  1NMW A;  4HAR A;  4ODO A;  4MNL A;  1TFV A;  2O9O A;  3ARS A;  2QF8 A;  4N19 A;  4ZPV R;  1XHG A;  4Z2H A;  4JFK A;  4MNK A;  3CHE A;  1GPF A;  3IKG A;  1R9H A;  4DRO A;  5BXJ A;  1OGB A;  1F8A B;  4WKF A;  3O5M A;  4XAK A;  4NNR A;  1HJV A;  2ZQV A;  2PN0 A;  1M5Y A;  2M1I A;  3WD1 A;  5B8I C;  4L3N A;  4ODP A;  1L1P A;  2Q5A A;  2XP5 A;  3WD2 A;  4JFM A;  3RM4 A;  1SYT A;  4P8U A;  4WIW A;  1Q6I A;  4Q7N A;  4O2T A;  1KT0 A;  1NWS A;  3KAI A;  4Q22 A;  2WLY A;  3ARO A;  3PRA A;  3O5O A;  4J4N A;  1FAP A;  4DWS B;  4TW6 A;  4JFJ A;  3B9E A;  1LG2 A;  1Q6U A;  1ZBC A;  2PBC A;  2UZ5 A;  4FAP A;  2A3A A;  4MGV A;  1VF8 A;  4R5E A;  4U84 A;  2F2D A;  4KR0 B;  3ARR A;  1E9L A;  4ODQ A;  3UQA A;  3WH0 A;  5HKG A;  1JND A;  1ZB5 A;  2FAP A;  1WNO A;  1LQ0 A;  2DT3 A;  1WB0 A;  4LAY A;  5I98 A;  5DF0 A;  3B8S A;  1ZBW A;  4G50 A;  4DZ3 A;  3KAH A;  3ARY A;  4S3K A;  2AOS A;  2OLH A;  3ARX A;  3UI4 A;  1H0G A;  5HBF A;  3EIP A;  3NRK A;  3TC5 A;  1J4I A;  2KGJ A;  4WK9 A;  2MPH A;  3WQV A;  1FKL A;  2JZV A;  1JNS A;  1KT1 A;  4AY1 A;  3O5P A;  2DT2 A;  3O5I A;  4TNS A;  1QPL A;  4TW7 A;  2RUQ A;  3ALG A;  1E6P A;  1J4H A;  1NWR A;  2WLZ A;  3AS0 A;  4MNJ A;  1W1P A;  3UQI A;  3CZ8 A;  3KZ7 A;  1FKK A;  2G41 A;  4DT4 A;  1BL4 A;  3JYM A;  2KR7 A;  3VAW A;  4DRQ A;  1FKI A;  2DT1 A;  2DPE A; 
#chains in the Genus database with same CATH homology
 2PV2 A;  3PRB A;  3O5G A;  1Q1C A;  2PPO A;  4IT4 A;  4NZC A;  1RD6 A;  3FXY A;  3ARQ A;  1ROU A;  1JVW A;  4W5U A;  1J6Y A;  1LL7 A;  3WD3 A;  2ESC A;  1EQ3 A;  2ITK A;  4FN2 A;  2N87 A;  5D75 A;  1E6N A;  1YW5 A;  2XP6 A;  1WAW A;  4P8X A;  1C9H A;  4ODK A;  4MAV A;  2KI3 A;  3BXW A;  3RM9 A;  1FFQ A;  1LG1 A;  1GOI A;  4DIP A;  3AS1 A;  3OOB A;  4KQZ A;  2WK2 A;  3CHF A;  4QIB A;  3PRD A;  3WD4 A;  1QPF A;  4J4O A;  4LAW A;  3KCE A;  1D7I A;  3QOK A;  1H0I A;  3ARW A;  5GPR A;  1JNT A;  2A3C A;  1T11 A;  3ARZ A;  3O5F A;  4DWS C;  1FJD A;  2DT0 A;  4ODL A;  3H9R B;  1P5Q A;  1HJX A;  2MF9 A;  3CHD A;  5DIT A;  1ZK6 A;  3RGC A;  1W9V A;  4QZV B;  1CTN A;  2AWG A;  3MDY B;  2MLZ A;  2A3B A;  4JFI A;  2XP4 A;  5HW7 A;  1LL6 A;  2DG9 A;  4IPX A;  5GQB A;  1Y0O A;  2WM0 A;  1B6C A;  1W9P A;  5HUA A;  3O5E A;  4DRH A;  1ROT A;  1UR9 A;  3AS2 A;  5J6E A;  2M08 A;  4Z2J A;  1FKH A;  3IHZ A;  4DRM A;  1HJW A;  2KE0 A;  3B9A A;  3FAP A;  1YAT A;  3PA7 A;  4DRI A;  4Z2K A;  4Z2L A;  3O5J A;  3UQB A;  2XP8 A;  3PR9 A;  5HW8 A;  2LJ4 A;  1EHN A;  1FKD A;  2LKN A;  2PI6 A;  4LGX A;  1FKJ A;  3WIJ A;  3NTP A;  2ZR5 A;  1X6L A;  2DSU A;  3KAD A;  3O5R A;  4DH0 A;  1NH6 A;  2Y78 A;  2ZQU A;  1K9T A;  3LUO A;  3UI6 A;  1LJY A;  4IT6 A;  4DWS A;  2FKE A;  4P8W A;  2A3E A;  3TCZ A;  3CGM A;  1PIN A;  2XPB A;  1U79 A;  3WD0 A;  4DRJ A;  1W9U A;  4QT3 A;  2ZQT A;  3UF8 A;  3G6M A;  2OFN A;  1X6N A;  1E6R A;  1IX5 A;  4WJX A;  2PPP A;  2LGO A;  1FKR A;  3JYJ A;  1NSG A;  3EY6 A;  3IK8 A;  3GPK A;  3ODK A;  4NSB A;  5DEZ A;  3RME A;  1HKK A;  1SR0 A;  1D2K A;  2IUZ A;  1FKB A;  1W1Y A;  1OWQ A;  2K8I A;  3JXV A;  1D7J A;  1QZ2 A;  4QT2 A;  4DRK A;  3I6C A;  3UI5 A;  4DWS D;  3RM8 A;  1FD9 A;  2KO7 A;  2M2A A;  3O5L A;  1KFW A;  1NMV A;  2RUC A;  1HXV A;  3RFW A;  2DSW A;  3O5K A;  3B9D A;  1FKS A;  2DSZ A;  4L72 B;  2RUD A;  3ARU A;  2PV3 A;  2MLY A;  4WKA A;  4MSP A;  3G6L A;  3IKD A;  1TCO C;  4U85 A;  1F40 A;  3TDB A;  2ZR6 A;  3ARV A;  4BF8 A;  2RQS A;  1HKI A;  3KAG A;  1OGG A;  1PBK A;  2O92 A;  1N1A A;  4DRP A;  2PV1 A;  1ZU8 A;  4JYS A;  4Z2I A;  5HWC A;  4ODR A;  2XPA A;  3AS3 A;  3KAF A;  1ZBV A;  4ZS6 A;  1Q6H A;  1GUV A;  1UR8 A;  2G8Z A;  4URI A;  2MLX A;  4ZPT R;  5HWB A;  1XRV A;  4W9Q A;  1HKM A;  2DSV A;  1FKG A;  1FKT A;  2XP3 A;  3KAC A;  2FDM A;  4W9O A;  4G2P A;  3WL1 A;  3CH9 A;  4LAV A;  4W9P A;  4Z2G A;  4IQ2 A;  2IF4 A;  3WQW A;  4U86 A;  4PTM A;  4TX0 A;  2RUR A;  2ZQS A;  2PPN A;  1EYM A;  4DRN A;  3OA5 A;  1FKF A;  2RSE A;  4ZPW R;  1EIB A;  1LL4 A;  2F21 A;  5JH8 A;  4MPK A;  5DO2 A;  4LAX A;  3O5Q A;  3CGN A;  1HKJ A;  1ITX A;  1A7X A;  2LPV A;  4ITZ A;  2L2S A;  4C02 B;  4HBE A;  1ZBK A;  1EDQ A;  3FY1 A;  4WKH A;  2XP7 A;  3WL0 A;  2KFW A;  3KAB A;  3WKZ A;  1E15 A;  5GPG A;  1D7H A;  5DIV A;  4GIV A;  3CHC A;  1NWT A;  3AQU A;  2YBU A;  3ARP A;  1O6I A;  2DG4 A;  4R0X A;  3B7X A;  5HT1 A;  1D6O A;  4GGQ A;  4ODM A;  4ODN A;  2VN1 A;  1ZCN A;  1J4R A;  4MNM A;  3NI6 A;  1FFR A;  2ZR4 A;  2VCD A;  3O5D A;  5HTG A;  1E6Z A;  1W1V A;  3ART A;  4IQC A;  4JFL A;  4S3J A;  2YBT A;  3ALF A;  2D9F A;  4DZ2 A;  1JNE A;  2F4E A;  1NWU A;  1W1T A;  2DG3 A;  4MTV A;  4TYO A;  4HBO A;  2XP9 A;  4P8V A;  2B31 A;  5HW6 A;  5DIU A;  1W26 A;  4TW8 A;  1BKF A;  3W4R A;  1ZL1 A;  4ML4 A;  2MNT A;  1NMW A;  4HAR A;  4ODO A;  4MNL A;  1TFV A;  2O9O A;  3ARS A;  2QF8 A;  4N19 A;  4ZPV R;  1XHG A;  4Z2H A;  4JFK A;  4MNK A;  3CHE A;  1GPF A;  3IKG A;  1R9H A;  4DRO A;  5BXJ A;  1OGB A;  1F8A B;  4WKF A;  3O5M A;  4XAK A;  4NNR A;  1HJV A;  2ZQV A;  1M5Y A;  2M1I A;  3WD1 A;  5B8I C;  4L3N A;  4ODP A;  1L1P A;  2Q5A A;  2XP5 A;  3WD2 A;  4JFM A;  3RM4 A;  1SYT A;  4P8U A;  4WIW A;  1Q6I A;  4Q7N A;  4O2T A;  1KT0 A;  1NWS A;  3KAI A;  4Q22 A;  2WLY A;  3ARO A;  3PRA A;  3O5O A;  4J4N A;  1FAP A;  4DWS B;  4TW6 A;  4JFJ A;  3B9E A;  1LG2 A;  1Q6U A;  1ZBC A;  2PBC A;  2UZ5 A;  4FAP A;  2A3A A;  4MGV A;  1VF8 A;  4R5E A;  4U84 A;  2F2D A;  4KR0 B;  3ARR A;  1E9L A;  4ODQ A;  3UQA A;  3WH0 A;  5HKG A;  1JND A;  1ZB5 A;  2FAP A;  1WNO A;  1LQ0 A;  2DT3 A;  1WB0 A;  4LAY A;  5I98 A;  5DF0 A;  3B8S A;  1ZBW A;  4G50 A;  4DZ3 A;  3KAH A;  3ARY A;  4S3K A;  2AOS A;  2OLH A;  3ARX A;  3UI4 A;  1H0G A;  5HBF A;  3NRK A;  3TC5 A;  1J4I A;  2KGJ A;  4WK9 A;  2MPH A;  3WQV A;  1FKL A;  2JZV A;  1JNS A;  1KT1 A;  4AY1 A;  3O5P A;  2DT2 A;  3O5I A;  4TNS A;  1QPL A;  4TW7 A;  2RUQ A;  3ALG A;  1E6P A;  1J4H A;  1NWR A;  2WLZ A;  3AS0 A;  4MNJ A;  1W1P A;  3UQI A;  3CZ8 A;  3KZ7 A;  1FKK A;  2G41 A;  4DT4 A;  1BL4 A;  3JYM A;  2KR7 A;  3VAW A;  4DRQ A;  1FKI A;  2DT1 A;  2DPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...