4J4NA

Crystal structure of fk506 binding domain of plasmodium falciparum fkbp35 in complex with d44
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecule Plasmodium FKBP35 inhibitor as a potential antimalaria agent.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase/isomerase inhibitor
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
total genus 28
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4j4nA01
2FKEA 2MNTA 2UZ5A 4G50A 1P5QA 2PPPA 3O5RA 1D7HA 2RQSA 3KACA 2KI3A 4ODRA 1R9HA 2PBCA 2LJ4A 3KAIA 1FKKA 1JVWA 2KE0A 2DG9A 3KABA 3O5LA 3O5OA 2KFWA 4MGVA 4U86A 2MPHA 4DRNA 5J6EA 4GGQA 1W26A 2Q5AA 2DG4A 1JNTA 1YATA 4ODPA 2DG3A 2XP7A 3NTPA 2M08A 2L2SA 4QIBA 4MSPA 1QPFA 1F40A 2RURA 2XP8A 3UQBA 1FD9A 2RUCA 1NSGA 3TC5A 4DRQA 1FAPA 2RUQA 1C9HA 2XPBA 2VCDA 4DT4A 2XP9A 4IQ2A 4DRKA 4N19A 1FKHA 3PA7A 2ZR6A 4ODMA 4QT2A 5HTGA 2RUDA 2PPNA 3LUOA 4U85A 1QPLA 3UF8A 4IQCA 5HW8A 5HWBA 3O5IA 1M5YA 3IHZA 4ODQA 4FAPA 1FKRA 4FN2A 2ITKA 3O5QA 1F8AB 4LAWA 1Q6UA 2MLXA 1FJDA 1EQ3A 2M1IA 3O5PA 4ODNA 3O5JA 2F21A 3RGCA 4O2TA 3CGNA 4DROA 3I6CA 1FKGA 2ZR4A 2M2AA 2PV3A 1FKIA 2PV2A 1Q6IA 2XP6A 4GIVA 4ODOA 4DIPA 5HW7A 1BL4A 4DRIA 2ZQSA 2N87A 2XP3A 5B8IC 1JNSA 3VAWA 1B6CA 1L1PA 4JFKA 3JYJA 1Q6HA 1FKBA 1BKFA 1FKFA 1D7IA 2ZQVA 1EYMA 4J4NA 4TW6A 4J4OA 2XPAA 2PPOA 1ZCNA 4C02B 2XP5A 1J4RA 4DH0A 3UI6A 3CGMA 4DZ2A 2JZVA 2ZQTA 3OOBA 2D9FA 5HWCA 2ZQUA 1J6YA 4JFJA 4R0XA 4G2PA 2MLZA 4ITZA 5I98A 4TW8A 2FAPA 4LAVA 1YW5A 4BF8A 1J4IA 1PINA 2RSEA 3KZ7A 2PV1A 2MLYA 3PRBA 4W9PA 5GPGA 4LAYA 4ODLA 1FKDA 1NMVA 4TX0A 3NI6A 4NNRA 3PRDA 4DZ3A 2KGJA 2F2DA 3KADA 1FKJA 4DRJA 2KO7A 3O5GA 2MF9A 1D7JA 2LGOA 2LPVA 1TCOC 5HKGA 1U79A 4JFIA 2KR7A 1N1AA 3JYMA 1D6OA 3TCZA 3UI4A 3RFWA 3FAPA 3UQAA 3TDBA 3B7XA 3IK8A 3NRKA 3O5KA 4U84A 1FKLA 4QT3A 1NMWA 1ROUA 4TW7A 1A7XA 3MDYB 3O5DA 5DITA 4JFMA 5BXJA 4JYSA 4ODKA 3O5EA 3KAFA 3IKDA 1QZ2A 3UI5A 4W9QA 4JFLA 1KT0A 2XP4A 2OFNA 5HW6A 1J4HA 4DRMA 5HT1A 4DRHA 1HXVA 4TYOA 4W9OA 2VN1A 1FKTA 1PBKA 1FKSA 3EY6A 2IF4A 3IKGA 5DIVA 5DIUA 3KCEA 5HUAA 5D75A 3KAHA 3WH0A 1Y0OA 1ROTA 1T11A 2LKNA 3JXVA 1Q1CA 2AWGA 2ZR5A 3H9RB 3KAGA 3O5MA 2K8IA 4IPXA 1KT1A 4TNSA 1ZK6A 3UQIA 3O5FA 3ODKA 4DRPA 2Y78A 4LAXA 2F4EA 3GPKA
chains in the Genus database with same CATH superfamily
2MNTA 1E6PA 2KI3A 1R9HA 4MAVA 2LJ4A 2EULA 2DT1A 1HJVA 3O5OA 4U86A 2MPHA 4DRNA 3ARUA 4P8XA 4MNLA 2XP7A 1NWSA 2L2SA 1E6ZA 1QPFA 1ZL1A 2IUZA 2RURA 2XPBA 2VCDA 2G8ZA 1ZU8A 1ZB5A 1HJWA 3PA7A 2B5UB 4QT2A 2RUDA 4IQCA 3PRAA 1EDQA 3ARRA 1NWTA 1HKKA 3CH9A 1FKRA 4W5UA 3O5QA 3EIPA 1Q6UA 2MLXA 3RM9A 3WIJA 4LGXA 3WD1A 1IX5A 3CGNA 3UQAA 1FKIA 4ODOA 5GPRA 3B8SA 1L1PA 4JFKA 3WL1A 1Q6HA 4ZPVR 1FKBA 1D7IA 1EYMA 1D2KA 4J4OA 2XPAA 2ETNA 1EHNA 4C02B 2FDMA 3FY1A 1H0GA 4XAKA 4DZ2A 1J6YA 3WD0A 4JFJA 4ITZA 1FJDA 1UR9A 4BF8A 2FAPA 1PINA 2RSEA 3KZ7A 2PV1A 3PRBA 4TX0A 4NNRA 5JH8A 3KADA 3WQVA 1NH6A 3O5GA 4ZPWR 2MF9A 1D7JA 1TCOC 4Z2KA 4JFIA 2G41A 3RM8A 2KR7A 3JYMA 4Z2HA 3RFWA 3TDBA 1X6NA 3NRKA 5GQBA 2ESCA 4WKFA 3MDYB 4JFMA 3ARYA 3O5EA 3IKDA 4Z2GA 4W9QA 1GRJA 2A3BA 4WK9A 4L72B 5HW6A 3AS0A 2VN1A 1FKTA 1HKIA 2IF4A 4DWSC 4QZVB 1LJYA 2LKNA 1SYTA 1Q1CA 3KAGA 1H0IA 3G6LA 2P4VA 2PPPA 3O5RA 2RQSA 4WKHA 4Q7NA 4DWSB 4Z2IA 4IT6A 4ODRA 2PI6A 3ALGA 3KAIA 2DG9A 4MGVA 3WQWA 1W26A 3GU0A 2DG4A 1YATA 3NTPA 2M08A 3UQBA 1FAPA 5DO2A 2QF8A 4P8UA 4N19A 1XHGA 4IT4A 5HTGA 3BXWA 1E15A 3LUOA 4Q22A 3UF8A 1W1PA 3WD3A 2WK2A 3OA5A 3IHZA 1NWUA 4FAPA 4Z2JA 2ITKA 1HJXA 2O9OA 1GPFA 4ODNA 4UDMA 3RGCA 4O2TA 1LL7A 1OWQA 3ARXA 1FKGA 2ZR4A 1HKJA 2PV3A 5I98A 2DT2A 1Q6IA 4DIPA 5B8IC 1ITXA 2XP3A 4MNKA 1B6CA 5DF0A 4WIWA 1ZBVA 3AS2A 4NSBA 1FKFA 2PPOA 1ZCNA 1W9PA 2XP5A 1J4RA 4DH0A 3CGMA 3OOBA 2D9FA 4P8WA 3WD4A 4TW8A 1EIBA 1J4IA 2A3CA 1W1YA 1HKMA 3WD2A 5HBFA 2KGJA 2F2DA 1UR8A 1JCHB 3GTYX 4URIA 5HKGA 3QOKA 3B7XA 3O5KA 1KFWA 4U84A 1NMWA 1ROUA 3BMBA 3O5DA 2PN0A 5BXJA 4JYSA 3FXYA 4Z2LA 2XP4A 2DSZA 4DRMA 4W9OA 4NZCA 1FKSA 3EY6A 3KCEA 5D75A 1ROTA 1W1TA 2ZR5A 3JXVA 3H9RB 4TNSA 2K8IA 1ZK6A 2Y78A 1OGBA 2FKEA 2UZ5A 4G50A 1LQ0A 4ZPTR 4WJXA 3ARWA 1JVWA 2KE0A 3O5LA 2KFWA 1JNTA 1W9VA 4MNJA 4QIBA 1F40A 2DT3A 2XP8A 1FD9A 4HBEA 2RUCA 4DRQA 1X6LA 1FKHA 2ZR6A 4ODMA 3ARPA 3B9AA 2O92A 2PPNA 4U85A 2DPEA 1QPLA 5HW8A 2B31A 3O5IA 4MTVA 3B9EA 3AS3A 4ODQA 4LAWA 2F23A 2F21A 4L3NA 1ZBWA 4DROA 3I6CA 5J6EA 2M2AA 4GIVA 1E44A 4MPKA 1JNSA 4DRIA 2ZQSA 1E6RA 2DSVA 1JNDA 3VAWA 1E9LA 3AROA 1K9TA 3JYJA 2ZQVA 4TW6A 3CZ8A 3W4RA 3UI6A 2JZVA 2YBUA 2A3AA 2DT0A 2ZQUA 2OLHA 3CHFA 5HWCA 4G2PA 1WNOA 3ARVA 1YW5A 3CHDA 4KQZA 4W9PA 2MLYA 4LAYA 4ODLA 1NMVA 4WKAA 4DZ3A 3PRDA 1FKJA 1ZBCA 1U79A 4ZS6A 1N1AA 1D6OA 1ZBKA 3IK8A 1FKLA 3WL0A 4QT3A 4TW7A 3RM4A 5DITA 4JFLA 1KT0A 1J4HA 5HT1A 4DRHA 1HXVA 4TYOA 3CHCA 3IKGA 4AY1A 2WM0A 4S3KA 4DWSD 5HUAA 3KAHA 3WH0A 1Y0OA 5DEZA 1OGGA 4IPXA 2AWGA 1KT1A 3AQUA 3O5FA 4ML4A 4DRPA 4LAXA 2F4EA 3GPKA 3CHEA 1P5QA 1NWRA 4KR0B 2WLZA 1D7HA 3KACA 2WLYA 2A3EA 2PBCA 1FKKA 3KABA 4GGQA 2DSUA 2Q5AA 4ODPA 2DG3A 4MSPA 1NSGA 3TC5A 2RUQA 1C9HA 1O6IA 1GUVA 4DT4A 2XP9A 4IQ2A 4DRKA 3RMEA 4P8VA 1RD6A 5HWBA 4HBOA 3B9DA 2YBTA 4PTMA 1W9UA 1M5YA 4FN2A 1F8AB 1EQ3A 2M1IA 3O5PA 3O5JA 3WKZA 5HW7A 1WAWA 2PV2A 2XP6A 3PR9A 1BL4A 2N87A 3ALFA 4S3JA 1SR0A 2AOSA 1BKFA 1FFRA 4J4NA 1JNEA 4R5EA 1VF8A 2ZQTA 1E6NA 4R0XA 2MLZA 4LAVA 1LG2A 5GPGA 1FKDA 4HARA 3G6MA 3NI6A 3ARTA 4DRJA 1CTNA 2KO7A 3ARSA 3AS1A 2LGOA 2LPVA 1LL6A 1LL4A 3UI4A 3TCZA 1GOIA 3FAPA 3ARQA 1A7XA 4ODKA 3KAFA 1FFQA 1QZ2A 4MNMA 3UI5A 2OFNA 1TFVA 1PBKA 4DWSA 5DIVA 5DIUA 1WB0A 2DSWA 1T11A 3O5MA 1W1VA 3UQIA 1XRVA 3ODKA 1LG1A 3ARZA
chains in the Genus database with same CATH topology
2MNTA 1E6PA 2KI3A 1R9HA 4MAVA 2LJ4A 2DT1A 1HJVA 3O5OA 4U86A 2MPHA 4DRNA 3ARUA 4P8XA 4MNLA 2XP7A 1NWSA 2L2SA 1E6ZA 1QPFA 1ZL1A 2IUZA 2RURA 2XPBA 2VCDA 2G8ZA 1ZU8A 1ZB5A 1HJWA 3PA7A 4QT2A 2RUDA 4IQCA 3PRAA 1EDQA 3ARRA 1NWTA 1HKKA 3CH9A 1FKRA 4W5UA 3O5QA 1Q6UA 2MLXA 3RM9A 3WIJA 4LGXA 3WD1A 1IX5A 3CGNA 3UQAA 1FKIA 4ODOA 5GPRA 3B8SA 1L1PA 4JFKA 3WL1A 1Q6HA 4ZPVR 1FKBA 1D7IA 1EYMA 1D2KA 4J4OA 2XPAA 1EHNA 4C02B 2FDMA 3FY1A 1H0GA 4XAKA 4DZ2A 1J6YA 3WD0A 4JFJA 4ITZA 1FJDA 1UR9A 4BF8A 2FAPA 1PINA 2RSEA 3KZ7A 2PV1A 3PRBA 4TX0A 4NNRA 5JH8A 3KADA 3WQVA 1NH6A 3O5GA 4ZPWR 2MF9A 1D7JA 1TCOC 4Z2KA 4JFIA 2G41A 3RM8A 2KR7A 3JYMA 4Z2HA 3RFWA 3TDBA 1X6NA 3NRKA 5GQBA 2ESCA 4WKFA 3MDYB 4JFMA 3ARYA 3O5EA 3IKDA 4Z2GA 4W9QA 2A3BA 4WK9A 4L72B 5HW6A 3AS0A 2VN1A 1FKTA 1HKIA 2IF4A 4DWSC 4QZVB 1LJYA 2LKNA 1SYTA 1Q1CA 3KAGA 1H0IA 3G6LA 2PPPA 3O5RA 2RQSA 4WKHA 4Q7NA 4DWSB 4Z2IA 4IT6A 4ODRA 2PI6A 3ALGA 3KAIA 2DG9A 4MGVA 3WQWA 1W26A 2DG4A 1YATA 3NTPA 2M08A 3UQBA 1FAPA 5DO2A 2QF8A 4P8UA 4N19A 1XHGA 4IT4A 5HTGA 3BXWA 1E15A 3LUOA 4Q22A 3UF8A 1W1PA 3WD3A 2WK2A 3OA5A 3IHZA 1NWUA 4FAPA 4Z2JA 2ITKA 1HJXA 2O9OA 1GPFA 4ODNA 3RGCA 4O2TA 1LL7A 1OWQA 3ARXA 1FKGA 2ZR4A 1HKJA 2PV3A 5I98A 2DT2A 1Q6IA 4DIPA 5B8IC 1ITXA 2XP3A 4MNKA 1B6CA 5DF0A 4WIWA 1ZBVA 3AS2A 4NSBA 1FKFA 2PPOA 1ZCNA 1W9PA 2XP5A 1J4RA 4DH0A 3CGMA 3OOBA 2D9FA 4P8WA 3WD4A 4TW8A 1EIBA 1J4IA 2A3CA 1W1YA 1HKMA 3WD2A 5HBFA 2KGJA 2F2DA 1UR8A 4URIA 5HKGA 3QOKA 3B7XA 3O5KA 1KFWA 4U84A 1NMWA 1ROUA 3O5DA 5BXJA 4JYSA 3FXYA 4Z2LA 2XP4A 2DSZA 4DRMA 4W9OA 4NZCA 1FKSA 3EY6A 3KCEA 5D75A 1ROTA 1W1TA 2ZR5A 3JXVA 3H9RB 4TNSA 2K8IA 1ZK6A 2Y78A 1OGBA 2FKEA 2UZ5A 4G50A 1LQ0A 4ZPTR 4WJXA 3ARWA 1JVWA 2KE0A 3O5LA 2KFWA 1JNTA 1W9VA 4MNJA 4QIBA 1F40A 2DT3A 2XP8A 1FD9A 4HBEA 2RUCA 4DRQA 1X6LA 1FKHA 2ZR6A 4ODMA 3ARPA 3B9AA 2O92A 2PPNA 4U85A 2DPEA 1QPLA 5HW8A 2B31A 3O5IA 4MTVA 3B9EA 3AS3A 4ODQA 4LAWA 2F21A 4L3NA 1ZBWA 4DROA 3I6CA 5J6EA 2M2AA 4GIVA 4MPKA 1JNSA 4DRIA 2ZQSA 1E6RA 2DSVA 1JNDA 3VAWA 1E9LA 3AROA 1K9TA 3JYJA 2ZQVA 4TW6A 3CZ8A 3W4RA 3UI6A 2JZVA 2YBUA 2A3AA 2DT0A 2ZQUA 2OLHA 3CHFA 5HWCA 4G2PA 1WNOA 3ARVA 1YW5A 3CHDA 4KQZA 4W9PA 2MLYA 4LAYA 4ODLA 1NMVA 4WKAA 4DZ3A 3PRDA 1FKJA 1ZBCA 1U79A 4ZS6A 1N1AA 1D6OA 1ZBKA 3IK8A 1FKLA 3WL0A 4QT3A 4TW7A 3RM4A 5DITA 4JFLA 1KT0A 1J4HA 5HT1A 4DRHA 1HXVA 4TYOA 3CHCA 3IKGA 4AY1A 2WM0A 4S3KA 4DWSD 5HUAA 3KAHA 3WH0A 1Y0OA 5DEZA 1OGGA 4IPXA 2AWGA 1KT1A 3AQUA 3O5FA 4ML4A 4DRPA 4LAXA 2F4EA 3GPKA 3CHEA 1P5QA 1NWRA 4KR0B 2WLZA 1D7HA 3KACA 2WLYA 2A3EA 2PBCA 1FKKA 3KABA 4GGQA 2DSUA 2Q5AA 4ODPA 2DG3A 4MSPA 1NSGA 3TC5A 2RUQA 1C9HA 1O6IA 1GUVA 4DT4A 2XP9A 4IQ2A 4DRKA 3RMEA 4P8VA 1RD6A 5HWBA 4HBOA 3B9DA 2YBTA 4PTMA 1W9UA 1M5YA 4FN2A 1F8AB 1EQ3A 2M1IA 3O5PA 3O5JA 3WKZA 5HW7A 1WAWA 2PV2A 2XP6A 3PR9A 1BL4A 2N87A 3ALFA 4S3JA 1SR0A 2AOSA 1BKFA 1FFRA 4J4NA 1JNEA 4R5EA 1VF8A 2ZQTA 1E6NA 4R0XA 2MLZA 4LAVA 1LG2A 5GPGA 1FKDA 4HARA 3G6MA 3NI6A 3ARTA 4DRJA 1CTNA 2KO7A 3ARSA 3AS1A 2LGOA 2LPVA 1LL6A 1LL4A 3UI4A 3TCZA 1GOIA 3FAPA 3ARQA 1A7XA 4ODKA 3KAFA 1FFQA 1QZ2A 4MNMA 3UI5A 2OFNA 1TFVA 1PBKA 4DWSA 5DIVA 5DIUA 1WB0A 2DSWA 1T11A 3O5MA 1W1VA 3UQIA 1XRVA 3ODKA 1LG1A 3ARZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKE A;  2MNT A;  2UZ5 A;  4G50 A;  1P5Q A;  2PPP A;  3O5R A;  1D7H A;  2RQS A;  3KAC A;  2KI3 A;  4ODR A;  1R9H A;  2PBC A;  2LJ4 A;  3KAI A;  1FKK A;  1JVW A;  2KE0 A;  2DG9 A;  3KAB A;  3O5L A;  3O5O A;  2KFW A;  4MGV A;  4U86 A;  2MPH A;  4DRN A;  5J6E A;  4GGQ A;  1W26 A;  2Q5A A;  2DG4 A;  1JNT A;  1YAT A;  4ODP A;  2DG3 A;  2XP7 A;  3NTP A;  2M08 A;  2L2S A;  4QIB A;  4MSP A;  1QPF A;  1F40 A;  2RUR A;  2XP8 A;  3UQB A;  1FD9 A;  2RUC A;  1NSG A;  3TC5 A;  4DRQ A;  1FAP A;  2RUQ A;  1C9H A;  2XPB A;  2VCD A;  4DT4 A;  2XP9 A;  4IQ2 A;  4DRK A;  4N19 A;  1FKH A;  3PA7 A;  2ZR6 A;  4ODM A;  4QT2 A;  5HTG A;  2RUD A;  2PPN A;  3LUO A;  4U85 A;  1QPL A;  3UF8 A;  4IQC A;  5HW8 A;  5HWB A;  3O5I A;  1M5Y A;  3IHZ A;  4ODQ A;  4FAP A;  1FKR A;  4FN2 A;  2ITK A;  3O5Q A;  1F8A B;  4LAW A;  1Q6U A;  2MLX A;  1FJD A;  1EQ3 A;  2M1I A;  3O5P A;  4ODN A;  3O5J A;  2F21 A;  3RGC A;  4O2T A;  3CGN A;  4DRO A;  3I6C A;  1FKG A;  2ZR4 A;  2M2A A;  2PV3 A;  1FKI A;  2PV2 A;  1Q6I A;  2XP6 A;  4GIV A;  4ODO A;  4DIP A;  5HW7 A;  1BL4 A;  4DRI A;  2ZQS A;  2N87 A;  2XP3 A;  5B8I C;  1JNS A;  3VAW A;  1B6C A;  1L1P A;  4JFK A;  3JYJ A;  1Q6H A;  1FKB A;  1BKF A;  1FKF A;  1D7I A;  2ZQV A;  1EYM A;  4J4N A;  4TW6 A;  4J4O A;  2XPA A;  2PPO A;  1ZCN A;  4C02 B;  2XP5 A;  1J4R A;  4DH0 A;  3UI6 A;  3CGM A;  4DZ2 A;  2JZV A;  2ZQT A;  3OOB A;  2D9F A;  5HWC A;  2ZQU A;  1J6Y A;  4JFJ A;  4R0X A;  4G2P A;  2MLZ A;  4ITZ A;  5I98 A;  4TW8 A;  2FAP A;  4LAV A;  1YW5 A;  4BF8 A;  1J4I A;  1PIN A;  2RSE A;  3KZ7 A;  2PV1 A;  2MLY A;  3PRB A;  4W9P A;  5GPG A;  4LAY A;  4ODL A;  1FKD A;  1NMV A;  4TX0 A;  3NI6 A;  4NNR A;  3PRD A;  4DZ3 A;  2KGJ A;  2F2D A;  3KAD A;  1FKJ A;  4DRJ A;  2KO7 A;  3O5G A;  2MF9 A;  1D7J A;  2LGO A;  2LPV A;  1TCO C;  5HKG A;  1U79 A;  4JFI A;  2KR7 A;  1N1A A;  3JYM A;  1D6O A;  3TCZ A;  3UI4 A;  3RFW A;  3FAP A;  3UQA A;  3TDB A;  3B7X A;  3IK8 A;  3NRK A;  3O5K A;  4U84 A;  1FKL A;  4QT3 A;  1NMW A;  1ROU A;  4TW7 A;  1A7X A;  3MDY B;  3O5D A;  5DIT A;  4JFM A;  5BXJ A;  4JYS A;  4ODK A;  3O5E A;  3KAF A;  3IKD A;  1QZ2 A;  3UI5 A;  4W9Q A;  4JFL A;  1KT0 A;  2XP4 A;  2OFN A;  5HW6 A;  1J4H A;  4DRM A;  5HT1 A;  4DRH A;  1HXV A;  4TYO A;  4W9O A;  2VN1 A;  1FKT A;  1PBK A;  1FKS A;  3EY6 A;  2IF4 A;  3IKG A;  5DIV A;  5DIU A;  3KCE A;  5HUA A;  5D75 A;  3KAH A;  3WH0 A;  1Y0O A;  1ROT A;  1T11 A;  2LKN A;  3JXV A;  1Q1C A;  2AWG A;  2ZR5 A;  3H9R B;  3KAG A;  3O5M A;  2K8I A;  4IPX A;  1KT1 A;  4TNS A;  1ZK6 A;  3UQI A;  3O5F A;  3ODK A;  4DRP A;  2Y78 A;  4LAX A;  2F4E A;  3GPK A; 
#chains in the Genus database with same CATH topology
 2MNT A;  1E6P A;  2KI3 A;  1R9H A;  4MAV A;  2LJ4 A;  2EUL A;  2DT1 A;  1HJV A;  3O5O A;  4U86 A;  2MPH A;  4DRN A;  3ARU A;  4P8X A;  4MNL A;  2XP7 A;  1NWS A;  2L2S A;  1E6Z A;  1QPF A;  1ZL1 A;  2IUZ A;  2RUR A;  2XPB A;  2VCD A;  2G8Z A;  1ZU8 A;  1ZB5 A;  1HJW A;  3PA7 A;  2B5U B;  4QT2 A;  2RUD A;  4IQC A;  3PRA A;  1EDQ A;  3ARR A;  1NWT A;  1HKK A;  3CH9 A;  1FKR A;  4W5U A;  3O5Q A;  3EIP A;  1Q6U A;  2MLX A;  3RM9 A;  3WIJ A;  4LGX A;  3WD1 A;  1IX5 A;  3CGN A;  3UQA A;  1FKI A;  4ODO A;  5GPR A;  3B8S A;  1L1P A;  4JFK A;  3WL1 A;  1Q6H A;  4ZPV R;  1FKB A;  1D7I A;  1EYM A;  1D2K A;  4J4O A;  2XPA A;  2ETN A;  1EHN A;  4C02 B;  2FDM A;  3FY1 A;  1H0G A;  4XAK A;  4DZ2 A;  1J6Y A;  3WD0 A;  4JFJ A;  4ITZ A;  1FJD A;  1UR9 A;  4BF8 A;  2FAP A;  1PIN A;  2RSE A;  3KZ7 A;  2PV1 A;  3PRB A;  4TX0 A;  4NNR A;  5JH8 A;  3KAD A;  3WQV A;  1NH6 A;  3O5G A;  4ZPW R;  2MF9 A;  1D7J A;  1TCO C;  4Z2K A;  4JFI A;  2G41 A;  3RM8 A;  2KR7 A;  3JYM A;  4Z2H A;  3RFW A;  3TDB A;  1X6N A;  3NRK A;  5GQB A;  2ESC A;  4WKF A;  3MDY B;  4JFM A;  3ARY A;  3O5E A;  3IKD A;  4Z2G A;  4W9Q A;  1GRJ A;  2A3B A;  4WK9 A;  4L72 B;  5HW6 A;  3AS0 A;  2VN1 A;  1FKT A;  1HKI A;  2IF4 A;  4DWS C;  4QZV B;  1LJY A;  2LKN A;  1SYT A;  1Q1C A;  3KAG A;  1H0I A;  3G6L A;  2P4V A;  2PPP A;  3O5R A;  2RQS A;  4WKH A;  4Q7N A;  4DWS B;  4Z2I A;  4IT6 A;  4ODR A;  2PI6 A;  3ALG A;  3KAI A;  2DG9 A;  4MGV A;  3WQW A;  1W26 A;  3GU0 A;  2DG4 A;  1YAT A;  3NTP A;  2M08 A;  3UQB A;  1FAP A;  5DO2 A;  2QF8 A;  4P8U A;  4N19 A;  1XHG A;  4IT4 A;  5HTG A;  3BXW A;  1E15 A;  3LUO A;  4Q22 A;  3UF8 A;  1W1P A;  3WD3 A;  2WK2 A;  3OA5 A;  3IHZ A;  1NWU A;  4FAP A;  4Z2J A;  2ITK A;  1HJX A;  2O9O A;  1GPF A;  4ODN A;  4UDM A;  3RGC A;  4O2T A;  1LL7 A;  1OWQ A;  3ARX A;  1FKG A;  2ZR4 A;  1HKJ A;  2PV3 A;  5I98 A;  2DT2 A;  1Q6I A;  4DIP A;  5B8I C;  1ITX A;  2XP3 A;  4MNK A;  1B6C A;  5DF0 A;  4WIW A;  1ZBV A;  3AS2 A;  4NSB A;  1FKF A;  2PPO A;  1ZCN A;  1W9P A;  2XP5 A;  1J4R A;  4DH0 A;  3CGM A;  3OOB A;  2D9F A;  4P8W A;  3WD4 A;  4TW8 A;  1EIB A;  1J4I A;  2A3C A;  1W1Y A;  1HKM A;  3WD2 A;  5HBF A;  2KGJ A;  2F2D A;  1UR8 A;  1JCH B;  3GTY X;  4URI A;  5HKG A;  3QOK A;  3B7X A;  3O5K A;  1KFW A;  4U84 A;  1NMW A;  1ROU A;  3BMB A;  3O5D A;  2PN0 A;  5BXJ A;  4JYS A;  3FXY A;  4Z2L A;  2XP4 A;  2DSZ A;  4DRM A;  4W9O A;  4NZC A;  1FKS A;  3EY6 A;  3KCE A;  5D75 A;  1ROT A;  1W1T A;  2ZR5 A;  3JXV A;  3H9R B;  4TNS A;  2K8I A;  1ZK6 A;  2Y78 A;  1OGB A;  2FKE A;  2UZ5 A;  4G50 A;  1LQ0 A;  4ZPT R;  4WJX A;  3ARW A;  1JVW A;  2KE0 A;  3O5L A;  2KFW A;  1JNT A;  1W9V A;  4MNJ A;  4QIB A;  1F40 A;  2DT3 A;  2XP8 A;  1FD9 A;  4HBE A;  2RUC A;  4DRQ A;  1X6L A;  1FKH A;  2ZR6 A;  4ODM A;  3ARP A;  3B9A A;  2O92 A;  2PPN A;  4U85 A;  2DPE A;  1QPL A;  5HW8 A;  2B31 A;  3O5I A;  4MTV A;  3B9E A;  3AS3 A;  4ODQ A;  4LAW A;  2F23 A;  2F21 A;  4L3N A;  1ZBW A;  4DRO A;  3I6C A;  5J6E A;  2M2A A;  4GIV A;  1E44 A;  4MPK A;  1JNS A;  4DRI A;  2ZQS A;  1E6R A;  2DSV A;  1JND A;  3VAW A;  1E9L A;  3ARO A;  1K9T A;  3JYJ A;  2ZQV A;  4TW6 A;  3CZ8 A;  3W4R A;  3UI6 A;  2JZV A;  2YBU A;  2A3A A;  2DT0 A;  2ZQU A;  2OLH A;  3CHF A;  5HWC A;  4G2P A;  1WNO A;  3ARV A;  1YW5 A;  3CHD A;  4KQZ A;  4W9P A;  2MLY A;  4LAY A;  4ODL A;  1NMV A;  4WKA A;  4DZ3 A;  3PRD A;  1FKJ A;  1ZBC A;  1U79 A;  4ZS6 A;  1N1A A;  1D6O A;  1ZBK A;  3IK8 A;  1FKL A;  3WL0 A;  4QT3 A;  4TW7 A;  3RM4 A;  5DIT A;  4JFL A;  1KT0 A;  1J4H A;  5HT1 A;  4DRH A;  1HXV A;  4TYO A;  3CHC A;  3IKG A;  4AY1 A;  2WM0 A;  4S3K A;  4DWS D;  5HUA A;  3KAH A;  3WH0 A;  1Y0O A;  5DEZ A;  1OGG A;  4IPX A;  2AWG A;  1KT1 A;  3AQU A;  3O5F A;  4ML4 A;  4DRP A;  4LAX A;  2F4E A;  3GPK A;  3CHE A;  1P5Q A;  1NWR A;  4KR0 B;  2WLZ A;  1D7H A;  3KAC A;  2WLY A;  2A3E A;  2PBC A;  1FKK A;  3KAB A;  4GGQ A;  2DSU A;  2Q5A A;  4ODP A;  2DG3 A;  4MSP A;  1NSG A;  3TC5 A;  2RUQ A;  1C9H A;  1O6I A;  1GUV A;  4DT4 A;  2XP9 A;  4IQ2 A;  4DRK A;  3RME A;  4P8V A;  1RD6 A;  5HWB A;  4HBO A;  3B9D A;  2YBT A;  4PTM A;  1W9U A;  1M5Y A;  4FN2 A;  1F8A B;  1EQ3 A;  2M1I A;  3O5P A;  3O5J A;  3WKZ A;  5HW7 A;  1WAW A;  2PV2 A;  2XP6 A;  3PR9 A;  1BL4 A;  2N87 A;  3ALF A;  4S3J A;  1SR0 A;  2AOS A;  1BKF A;  1FFR A;  4J4N A;  1JNE A;  4R5E A;  1VF8 A;  2ZQT A;  1E6N A;  4R0X A;  2MLZ A;  4LAV A;  1LG2 A;  5GPG A;  1FKD A;  4HAR A;  3G6M A;  3NI6 A;  3ART A;  4DRJ A;  1CTN A;  2KO7 A;  3ARS A;  3AS1 A;  2LGO A;  2LPV A;  1LL6 A;  1LL4 A;  3UI4 A;  3TCZ A;  1GOI A;  3FAP A;  3ARQ A;  1A7X A;  4ODK A;  3KAF A;  1FFQ A;  1QZ2 A;  4MNM A;  3UI5 A;  2OFN A;  1TFV A;  1PBK A;  4DWS A;  5DIV A;  5DIU A;  1WB0 A;  2DSW A;  1T11 A;  3O5M A;  1W1V A;  3UQI A;  1XRV A;  3ODK A;  1LG1 A;  3ARZ A; 
#chains in the Genus database with same CATH homology
 2MNT A;  1E6P A;  2KI3 A;  1R9H A;  4MAV A;  2LJ4 A;  2DT1 A;  1HJV A;  3O5O A;  4U86 A;  2MPH A;  4DRN A;  3ARU A;  4P8X A;  4MNL A;  2XP7 A;  1NWS A;  2L2S A;  1E6Z A;  1QPF A;  1ZL1 A;  2IUZ A;  2RUR A;  2XPB A;  2VCD A;  2G8Z A;  1ZU8 A;  1ZB5 A;  1HJW A;  3PA7 A;  4QT2 A;  2RUD A;  4IQC A;  3PRA A;  1EDQ A;  3ARR A;  1NWT A;  1HKK A;  3CH9 A;  1FKR A;  4W5U A;  3O5Q A;  1Q6U A;  2MLX A;  3RM9 A;  3WIJ A;  4LGX A;  3WD1 A;  1IX5 A;  3CGN A;  3UQA A;  1FKI A;  4ODO A;  5GPR A;  3B8S A;  1L1P A;  4JFK A;  3WL1 A;  1Q6H A;  4ZPV R;  1FKB A;  1D7I A;  1EYM A;  1D2K A;  4J4O A;  2XPA A;  1EHN A;  4C02 B;  2FDM A;  3FY1 A;  1H0G A;  4XAK A;  4DZ2 A;  1J6Y A;  3WD0 A;  4JFJ A;  4ITZ A;  1FJD A;  1UR9 A;  4BF8 A;  2FAP A;  1PIN A;  2RSE A;  3KZ7 A;  2PV1 A;  3PRB A;  4TX0 A;  4NNR A;  5JH8 A;  3KAD A;  3WQV A;  1NH6 A;  3O5G A;  4ZPW R;  2MF9 A;  1D7J A;  1TCO C;  4Z2K A;  4JFI A;  2G41 A;  3RM8 A;  2KR7 A;  3JYM A;  4Z2H A;  3RFW A;  3TDB A;  1X6N A;  3NRK A;  5GQB A;  2ESC A;  4WKF A;  3MDY B;  4JFM A;  3ARY A;  3O5E A;  3IKD A;  4Z2G A;  4W9Q A;  2A3B A;  4WK9 A;  4L72 B;  5HW6 A;  3AS0 A;  2VN1 A;  1FKT A;  1HKI A;  2IF4 A;  4DWS C;  4QZV B;  1LJY A;  2LKN A;  1SYT A;  1Q1C A;  3KAG A;  1H0I A;  3G6L A;  2PPP A;  3O5R A;  2RQS A;  4WKH A;  4Q7N A;  4DWS B;  4Z2I A;  4IT6 A;  4ODR A;  2PI6 A;  3ALG A;  3KAI A;  2DG9 A;  4MGV A;  3WQW A;  1W26 A;  2DG4 A;  1YAT A;  3NTP A;  2M08 A;  3UQB A;  1FAP A;  5DO2 A;  2QF8 A;  4P8U A;  4N19 A;  1XHG A;  4IT4 A;  5HTG A;  3BXW A;  1E15 A;  3LUO A;  4Q22 A;  3UF8 A;  1W1P A;  3WD3 A;  2WK2 A;  3OA5 A;  3IHZ A;  1NWU A;  4FAP A;  4Z2J A;  2ITK A;  1HJX A;  2O9O A;  1GPF A;  4ODN A;  3RGC A;  4O2T A;  1LL7 A;  1OWQ A;  3ARX A;  1FKG A;  2ZR4 A;  1HKJ A;  2PV3 A;  5I98 A;  2DT2 A;  1Q6I A;  4DIP A;  5B8I C;  1ITX A;  2XP3 A;  4MNK A;  1B6C A;  5DF0 A;  4WIW A;  1ZBV A;  3AS2 A;  4NSB A;  1FKF A;  2PPO A;  1ZCN A;  1W9P A;  2XP5 A;  1J4R A;  4DH0 A;  3CGM A;  3OOB A;  2D9F A;  4P8W A;  3WD4 A;  4TW8 A;  1EIB A;  1J4I A;  2A3C A;  1W1Y A;  1HKM A;  3WD2 A;  5HBF A;  2KGJ A;  2F2D A;  1UR8 A;  4URI A;  5HKG A;  3QOK A;  3B7X A;  3O5K A;  1KFW A;  4U84 A;  1NMW A;  1ROU A;  3O5D A;  5BXJ A;  4JYS A;  3FXY A;  4Z2L A;  2XP4 A;  2DSZ A;  4DRM A;  4W9O A;  4NZC A;  1FKS A;  3EY6 A;  3KCE A;  5D75 A;  1ROT A;  1W1T A;  2ZR5 A;  3JXV A;  3H9R B;  4TNS A;  2K8I A;  1ZK6 A;  2Y78 A;  1OGB A;  2FKE A;  2UZ5 A;  4G50 A;  1LQ0 A;  4ZPT R;  4WJX A;  3ARW A;  1JVW A;  2KE0 A;  3O5L A;  2KFW A;  1JNT A;  1W9V A;  4MNJ A;  4QIB A;  1F40 A;  2DT3 A;  2XP8 A;  1FD9 A;  4HBE A;  2RUC A;  4DRQ A;  1X6L A;  1FKH A;  2ZR6 A;  4ODM A;  3ARP A;  3B9A A;  2O92 A;  2PPN A;  4U85 A;  2DPE A;  1QPL A;  5HW8 A;  2B31 A;  3O5I A;  4MTV A;  3B9E A;  3AS3 A;  4ODQ A;  4LAW A;  2F21 A;  4L3N A;  1ZBW A;  4DRO A;  3I6C A;  5J6E A;  2M2A A;  4GIV A;  4MPK A;  1JNS A;  4DRI A;  2ZQS A;  1E6R A;  2DSV A;  1JND A;  3VAW A;  1E9L A;  3ARO A;  1K9T A;  3JYJ A;  2ZQV A;  4TW6 A;  3CZ8 A;  3W4R A;  3UI6 A;  2JZV A;  2YBU A;  2A3A A;  2DT0 A;  2ZQU A;  2OLH A;  3CHF A;  5HWC A;  4G2P A;  1WNO A;  3ARV A;  1YW5 A;  3CHD A;  4KQZ A;  4W9P A;  2MLY A;  4LAY A;  4ODL A;  1NMV A;  4WKA A;  4DZ3 A;  3PRD A;  1FKJ A;  1ZBC A;  1U79 A;  4ZS6 A;  1N1A A;  1D6O A;  1ZBK A;  3IK8 A;  1FKL A;  3WL0 A;  4QT3 A;  4TW7 A;  3RM4 A;  5DIT A;  4JFL A;  1KT0 A;  1J4H A;  5HT1 A;  4DRH A;  1HXV A;  4TYO A;  3CHC A;  3IKG A;  4AY1 A;  2WM0 A;  4S3K A;  4DWS D;  5HUA A;  3KAH A;  3WH0 A;  1Y0O A;  5DEZ A;  1OGG A;  4IPX A;  2AWG A;  1KT1 A;  3AQU A;  3O5F A;  4ML4 A;  4DRP A;  4LAX A;  2F4E A;  3GPK A;  3CHE A;  1P5Q A;  1NWR A;  4KR0 B;  2WLZ A;  1D7H A;  3KAC A;  2WLY A;  2A3E A;  2PBC A;  1FKK A;  3KAB A;  4GGQ A;  2DSU A;  2Q5A A;  4ODP A;  2DG3 A;  4MSP A;  1NSG A;  3TC5 A;  2RUQ A;  1C9H A;  1O6I A;  1GUV A;  4DT4 A;  2XP9 A;  4IQ2 A;  4DRK A;  3RME A;  4P8V A;  1RD6 A;  5HWB A;  4HBO A;  3B9D A;  2YBT A;  4PTM A;  1W9U A;  1M5Y A;  4FN2 A;  1F8A B;  1EQ3 A;  2M1I A;  3O5P A;  3O5J A;  3WKZ A;  5HW7 A;  1WAW A;  2PV2 A;  2XP6 A;  3PR9 A;  1BL4 A;  2N87 A;  3ALF A;  4S3J A;  1SR0 A;  2AOS A;  1BKF A;  1FFR A;  4J4N A;  1JNE A;  4R5E A;  1VF8 A;  2ZQT A;  1E6N A;  4R0X A;  2MLZ A;  4LAV A;  1LG2 A;  5GPG A;  1FKD A;  4HAR A;  3G6M A;  3NI6 A;  3ART A;  4DRJ A;  1CTN A;  2KO7 A;  3ARS A;  3AS1 A;  2LGO A;  2LPV A;  1LL6 A;  1LL4 A;  3UI4 A;  3TCZ A;  1GOI A;  3FAP A;  3ARQ A;  1A7X A;  4ODK A;  3KAF A;  1FFQ A;  1QZ2 A;  4MNM A;  3UI5 A;  2OFN A;  1TFV A;  1PBK A;  4DWS A;  5DIV A;  5DIU A;  1WB0 A;  2DSW A;  1T11 A;  3O5M A;  1W1V A;  3UQI A;  1XRV A;  3ODK A;  1LG1 A;  3ARZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...