4J4NA

Crystal structure of fk506 binding domain of plasmodium falciparum fkbp35 in complex with d44
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
publication title Small molecule Plasmodium FKBP35 inhibitor as a potential antimalaria agent.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase/isomerase inhibitor
total genus 28
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4j4nA01
2RSEA 1FKIA 3O5KA 4DIPA 3IKGA 1F40A 4TX0A 1TCOC 2MNTA 1J4IA 2XP3A 3UF8A 1FJDA 1FD9A 2KE0A 2MLXA 2XP9A 3FAPA 2D9FA 3H9RB 3RGCA 3UI5A 3O5QA 4DRJA 3IK8A 2UZ5A 3KAIA 5HWCA 3NTPA 2KO7A 3UI4A 5HW7A 4DRKA 3KCEA 2ZQVA 3UQAA 3GPKA 2M1IA 4R0XA 3CGNA 3KACA 4TW6A 1NMWA 4QT2A 2XPAA 2XP4A 3O5EA 1FKDA 4DRQA 4DT4A 2AWGA 4DRHA 2L2SA 1FKHA 1YATA 3O5DA 1KT0A 1Q6HA 2JZVA 2OFNA 2PV3A 2ITKA 1L1PA 2ZQSA 1JNSA 5J6EA 4DZ2A 4TYOA 4TW7A 1D7IA 2MF9A 1BL4A 2Q5AA 2ZQTA 2PBCA 4W9QA 2Y78A 3RFWA 2XP7A 5DIVA 1Q6UA 4DZ3A 5GPGA 1FKKA 4U84A 5I98A 4TW8A 2PPNA 4IQ2A 1T11A 4JFJA 2ZQUA 2ZR5A 4NNRA 3O5GA 3O5FA 4ODOA 5HKGA 5HW6A 3O5PA 3KADA 2PPPA 2FKEA 1Q1CA 1FKGA 4DRNA 4J4NA 4ODKA 4W9PA 2VCDA 3PRDA 2LGOA 4ODNA 1FKJA 2XP5A 2K8IA 1Y0OA 1FKRA 1FKTA 3TC5A 4W9OA 1ZCNA 4G2PA 4J4OA 3IHZA 4LAWA 5HT1A 3UQIA 4DH0A 3OOBA 5BXJA 2DG9A 4GGQA 2N87A 1QZ2A 3O5IA 4MSPA 4O2TA 4U86A 1J6YA 1R9HA 1EYMA 2ZR6A 4TNSA 3B7XA 5HTGA 4N19A 1EQ3A 2FAPA 3MDYB 4G50A 2DG4A 1ROUA 4LAXA 2KGJA 1PBKA 4LAYA 4ODRA 2KR7A 4GIVA 3PA7A 1B6CA 5DITA 2RQSA 3TCZA 3TDBA 2VN1A 2PPOA 3IKDA 2M2AA 3ODKA 2F21A 4ODQA 5HWBA 1JNTA 2RURA 2KFWA 4ODPA 1J4HA 3UI6A 2RUCA 4QT3A 4DROA 3I6CA 3O5OA 1FKFA 4JFMA 4U85A 2XP6A 5DIUA 3KABA 1HXVA 4JFKA 2LPVA 2ZR4A 3EY6A 4DRMA 3JXVA 1C9HA 2XP8A 2MLZA 1YW5A 4FAPA 1F8AB 5D75A 3O5LA 3JYJA 4ODLA 5HUAA 4JFLA 3O5MA 1FKLA 2DG3A 3WH0A 1NSGA 1U79A 1FAPA 2LJ4A 2F4EA 3LUOA 1BKFA 1Q6IA 5B8IC 1D6OA 2M08A 1N1AA 1PINA 4ITZA 1KT1A 4DRIA 2F2DA 2RUDA 4ODMA 3UQBA 3KAGA 4BF8A 2XPBA 3PRBA 3JYMA 3NI6A 1D7JA 2PV2A 4DRPA 2RUQA 5HW8A 3KAHA 3KZ7A 1P5QA 1ROTA 2PV1A 4MGVA 4LAVA 2KI3A 4QIBA 2LKNA 3CGMA 3KAFA 3O5JA 4IPXA 2IF4A 3NRKA 4IQCA 2MLYA 1FKBA 2MPHA 1ZK6A 4C02B 1JVWA 4JYSA 4JFIA 1A7XA 1J4RA 3O5RA 1QPLA 1D7HA 1FKSA 3VAWA 1NMVA 4FN2A 1QPFA 1M5YA 1W26A
chains in the Genus database with same CATH superfamily
2RSEA 1TCOC 3WD0A 4DWSC 2O9OA 1O6IA 3RMEA 2MLXA 2XP9A 3UI5A 3O5QA 1JNDA 3KAIA 1GPFA 1E15A 3CGNA 3O5EA 1CTNA 2WLYA 4DRQA 4DT4A 2AWGA 3WD3A 1LQ0A 2L2SA 1YATA 1Q6HA 2OFNA 1L1PA 4ZPWR 1BL4A 1ZBWA 2Y78A 3RFWA 5DO2A 5DIVA 1SYTA 5GPGA 2ZQUA 2DT1A 1E6RA 3PRAA 1W1PA 4MAVA 3QOKA 4ZS6A 1HKKA 2LGOA 2K8IA 1Y0OA 1FKTA 4J4OA 3UQIA 5HT1A 3ARQA 3OOBA 3AROA 1OWQA 4MSPA 1J6YA 1ZBCA 1R9HA 4TNSA 2F23A 2FAPA 4G50A 3AQUA 2KGJA 3IKDA 1EHNA 2RURA 2KFWA 1J4HA 1W9PA 4DROA 4JFMA 5DIUA 3RM8A 4U85A 2XP6A 4JFKA 3EY6A 1WAWA 1W9UA 3JXVA 4MNJA 2XP8A 2MLZA 1F8AB 3O5LA 3JYJA 4JFLA 3O5MA 1WNOA 3RM4A 4Z2IA 3WD1A 1U79A 4WK9A 2LJ4A 3EIPA 3LUOA 1BKFA 2RUDA 3ARRA 3OA5A 1NWTA 3GTYX 3PRBA 4P8UA 2PV2A 3KAHA 1P5QA 4IT6A 4HBOA 4LAVA 4MGVA 4DWSB 1ZU8A 4Z2HA 4QIBA 3O5JA 3KAFA 4W5UA 2IUZA 4IQCA 4UDMA 1QPFA 1ZK6A 3WQVA 3O5RA 1UR8A 1M5YA 4DWSD 2P4VA 3IKGA 2MNTA 1J4IA 2XP3A 3UF8A 3WL1A 1FJDA 2KE0A 3AS0A 4MNKA 4Z2KA 1UR9A 2D9FA 3RGCA 3WKZA 2UZ5A 3FY1A 3NTPA 2KO7A 3CHCA 1W1VA 1LJYA 3GPKA 2A3CA 1TFVA 1E44A 2WK2A 3KACA 1E9LA 1NMWA 4QT2A 3WL0A 2XP4A 3BMBA 3ARZA 3WD2A 3O5DA 1LL7A 2PV3A 2ITKA 1K9TA 5J6EA 4DZ2A 4TYOA 1D7IA 2MF9A 2ZQTA 2A3AA 4DZ3A 1W9VA 1LG1A 1OGGA 4U84A 2PPNA 4IQ2A 1T11A 2ZR5A 2DPEA 2DSZA 4ML4A 1E6PA 3O5GA 3O5FA 4ODOA 3ARUA 5HKGA 5HW6A 3KADA 2EULA 1JCHB 1LL6A 3AS1A 1FKGA 1HJVA 4W9PA 2VCDA 1FKJA 1ZCNA 4DH0A 3IHZA 5DEZA 2ESCA 1HKMA 4GGQA 3FXYA 1ZBVA 1GOIA 1FFRA 3CZ8A 4N19A 2AOSA 2DG4A 3CHDA 1ZBKA 4WKAA 3CHFA 3PA7A 1B6CA 2PPOA 1GRJA 1OGBA 1VF8A 2A3BA 1W1TA 3O5OA 4DRMA 4FAPA 4XAKA 2DG3A 4NSBA 1FAPA 1NH6A 1HJWA 1Q6IA 2YBTA 1D6OA 4ITZA 1PINA 1KT1A 4ODMA 3UQBA 1NWRA 3KAGA 4BF8A 4QZVB 1RD6A 4DRPA 2RUQA 3G6LA 5DF0A 3PR9A 2KI3A 3CGMA 4IPXA 1JNEA 2MPHA 4IT4A 1QPLA 4Q7NA 1W26A 3O5KA 4DIPA 4URIA 1F40A 3H9RB 4DRJA 3FAPA 5HWCA 3ALFA 2ETNA 5HW7A 4DRKA 4TW6A 1HJXA 4MTVA 1FKDA 1FFQA 4S3JA 1FKHA 3G6MA 2DT0A 2WLZA 2ZQSA 3ARYA 3ARVA 4TW7A 4Z2JA 2Q5AA 2PBCA 1EIBA 2XP7A 4TW8A 4NNRA 4ZPVR 3O5PA 1ZB5A 5HBFA 4J4NA 3WD4A 4ODNA 2XP5A 1FKRA 2DT2A 4W9OA 4LAWA 1E6ZA 2DG9A 1QZ2A 4O2TA 4U86A 1H0GA 3B7XA 4DWSA 3MDYB 4S3KA 4LAXA 4ODRA 4LGXA 3TDBA 2M2AA 4ODQA 2F21A 2WM0A 4Z2GA 1KFWA 3UI6A 2RUCA 3WQWA 2LPVA 2PI6A 1YW5A 1IX5A 4ODLA 5HUAA 2QF8A 2DSUA 2PN0A 3AS3A 4Z2LA 2XPBA 3NI6A 1D7JA 1W1YA 3ARTA 4MPKA 5HW8A 3KZ7A 4P8VA 2PV1A 4KQZA 1E6NA 1GUVA 1ZL1A 2LKNA 2IF4A 2MLYA 1FKBA 1H0IA 4C02B 4JFIA 3VAWA 1D7HA 3CHEA 4WIWA 1NMVA 4FN2A 1FKSA 3W4RA 1FKIA 3RM9A 4WKHA 4TX0A 1HKJA 1FD9A 1LL4A 4MNMA 3ARXA 3IK8A 1LG2A 3UI4A 3B9EA 3KCEA 2ZQVA 4L72B 3UQAA 2M1IA 4R0XA 1D2KA 2O92A 1XRVA 2XPAA 4DRHA 3ALGA 2G8ZA 4WJXA 1KT0A 2JZVA 1EDQA 1JNSA 2DT3A 4W9QA 4HBEA 1Q6UA 5I98A 1FKKA 4L3NA 4JFJA 1X6LA 5GPRA 2OLHA 3B9AA 3B8SA 4PTMA 2PPPA 2FKEA 1Q1CA 2A3EA 4DRNA 4ODKA 3PRDA 3CH9A 3TC5A 4G2PA 5BXJA 2N87A 3O5IA 2YBUA 2B5UB 1NWUA 3WIJA 2ZR6A 1EYMA 5HTGA 1EQ3A 4NZCA 1ROUA 1PBKA 4LAYA 4GIVA 5DITA 1HKIA 2RQSA 3B9DA 4P8WA 4R5EA 2VN1A 3ODKA 1XHGA 3TCZA 5HWBA 1JNTA 4ODPA 1WB0A 1ITXA 4QT3A 3I6CA 1NWSA 1FKFA 1HXVA 1SR0A 2G41A 3KABA 2ZR4A 1C9HA 5D75A 4HARA 1FKLA 3WH0A 1NSGA 4P8XA 2F4EA 5B8IC 2M08A 1N1AA 4DRIA 2F2DA 4Q22A 2DSWA 1X6NA 3JYMA 3ARPA 5GQBA 1ROTA 3BXWA 4KR0B 3ARSA 2FDMA 3NRKA 2B31A 3ARWA 1JVWA 4JYSA 1A7XA 1J4RA 4AY1A 4ZPTR 4WKFA 4MNLA 2DSVA 3AS2A 3GU0A 5JH8A 2KR7A
chains in the Genus database with same CATH topology
2RSEA 1TCOC 3WD0A 4DWSC 2O9OA 1O6IA 3RMEA 2MLXA 2XP9A 3UI5A 3O5QA 1JNDA 3KAIA 1GPFA 1E15A 3CGNA 3O5EA 1CTNA 2WLYA 4DRQA 4DT4A 2AWGA 3WD3A 1LQ0A 2L2SA 1YATA 1Q6HA 2OFNA 1L1PA 4ZPWR 1BL4A 1ZBWA 2Y78A 3RFWA 5DO2A 5DIVA 1SYTA 5GPGA 2ZQUA 2DT1A 1E6RA 3PRAA 1W1PA 4MAVA 3QOKA 4ZS6A 1HKKA 2LGOA 2K8IA 1Y0OA 1FKTA 4J4OA 3UQIA 5HT1A 3ARQA 3OOBA 3AROA 1OWQA 4MSPA 1J6YA 1ZBCA 1R9HA 4TNSA 2FAPA 4G50A 3AQUA 2KGJA 3IKDA 1EHNA 2RURA 2KFWA 1J4HA 1W9PA 4DROA 4JFMA 5DIUA 3RM8A 4U85A 2XP6A 4JFKA 3EY6A 1WAWA 1W9UA 3JXVA 4MNJA 2XP8A 2MLZA 1F8AB 3O5LA 3JYJA 4JFLA 3O5MA 1WNOA 3RM4A 4Z2IA 3WD1A 1U79A 4WK9A 2LJ4A 3LUOA 1BKFA 2RUDA 3ARRA 3OA5A 1NWTA 3PRBA 4P8UA 2PV2A 3KAHA 1P5QA 4IT6A 4HBOA 4LAVA 4MGVA 4DWSB 1ZU8A 4Z2HA 4QIBA 3O5JA 3KAFA 4W5UA 2IUZA 4IQCA 1QPFA 1ZK6A 3WQVA 3O5RA 1UR8A 1M5YA 4DWSD 3IKGA 2MNTA 1J4IA 2XP3A 3UF8A 3WL1A 1FJDA 2KE0A 3AS0A 4MNKA 4Z2KA 1UR9A 2D9FA 3RGCA 3WKZA 2UZ5A 3FY1A 3NTPA 2KO7A 3CHCA 1W1VA 1LJYA 3GPKA 2A3CA 1TFVA 2WK2A 3KACA 1E9LA 1NMWA 4QT2A 3WL0A 2XP4A 3ARZA 3WD2A 3O5DA 1LL7A 2PV3A 2ITKA 1K9TA 5J6EA 4DZ2A 4TYOA 1D7IA 2MF9A 2ZQTA 2A3AA 4DZ3A 1W9VA 1LG1A 1OGGA 4U84A 2PPNA 4IQ2A 1T11A 2ZR5A 2DPEA 2DSZA 4ML4A 1E6PA 3O5GA 3O5FA 4ODOA 3ARUA 5HKGA 5HW6A 3KADA 1LL6A 3AS1A 1FKGA 1HJVA 4W9PA 2VCDA 1FKJA 1ZCNA 4DH0A 3IHZA 5DEZA 2ESCA 1HKMA 4GGQA 3FXYA 1ZBVA 1GOIA 1FFRA 3CZ8A 4N19A 2AOSA 2DG4A 3CHDA 1ZBKA 4WKAA 3CHFA 3PA7A 1B6CA 2PPOA 1OGBA 1VF8A 2A3BA 1W1TA 3O5OA 4DRMA 4FAPA 4XAKA 2DG3A 4NSBA 1FAPA 1NH6A 1HJWA 1Q6IA 2YBTA 1D6OA 4ITZA 1PINA 1KT1A 4ODMA 3UQBA 1NWRA 3KAGA 4BF8A 4QZVB 1RD6A 4DRPA 2RUQA 3G6LA 5DF0A 3PR9A 2KI3A 3CGMA 4IPXA 1JNEA 2MPHA 4IT4A 1QPLA 4Q7NA 1W26A 3O5KA 4DIPA 4URIA 1F40A 3H9RB 4DRJA 3FAPA 5HWCA 3ALFA 5HW7A 4DRKA 4TW6A 1HJXA 4MTVA 1FKDA 1FFQA 4S3JA 1FKHA 3G6MA 2DT0A 2WLZA 2ZQSA 3ARYA 3ARVA 4TW7A 4Z2JA 2Q5AA 2PBCA 1EIBA 2XP7A 4TW8A 4NNRA 4ZPVR 3O5PA 1ZB5A 5HBFA 4J4NA 3WD4A 4ODNA 2XP5A 1FKRA 2DT2A 4W9OA 4LAWA 1E6ZA 2DG9A 1QZ2A 4O2TA 4U86A 1H0GA 3B7XA 4DWSA 3MDYB 4S3KA 4LAXA 4ODRA 4LGXA 3TDBA 2M2AA 4ODQA 2F21A 2WM0A 4Z2GA 1KFWA 3UI6A 2RUCA 3WQWA 2LPVA 2PI6A 1YW5A 1IX5A 4ODLA 5HUAA 2QF8A 2DSUA 3AS3A 4Z2LA 2XPBA 3NI6A 1D7JA 1W1YA 3ARTA 4MPKA 5HW8A 3KZ7A 4P8VA 2PV1A 4KQZA 1E6NA 1GUVA 1ZL1A 2LKNA 2IF4A 2MLYA 1FKBA 1H0IA 4C02B 4JFIA 3VAWA 1D7HA 3CHEA 4WIWA 1NMVA 4FN2A 1FKSA 3W4RA 1FKIA 3RM9A 4WKHA 4TX0A 1HKJA 1FD9A 1LL4A 4MNMA 3ARXA 3IK8A 1LG2A 3UI4A 3B9EA 3KCEA 2ZQVA 4L72B 3UQAA 2M1IA 4R0XA 1D2KA 2O92A 1XRVA 2XPAA 4DRHA 3ALGA 2G8ZA 4WJXA 1KT0A 2JZVA 1EDQA 1JNSA 2DT3A 4W9QA 4HBEA 1Q6UA 5I98A 1FKKA 4L3NA 4JFJA 1X6LA 5GPRA 2OLHA 3B9AA 3B8SA 4PTMA 2PPPA 2FKEA 1Q1CA 2A3EA 4DRNA 4ODKA 3PRDA 3CH9A 3TC5A 4G2PA 5BXJA 2N87A 3O5IA 2YBUA 1NWUA 3WIJA 2ZR6A 1EYMA 5HTGA 1EQ3A 4NZCA 1ROUA 1PBKA 4LAYA 4GIVA 5DITA 1HKIA 2RQSA 3B9DA 4P8WA 4R5EA 2VN1A 3ODKA 1XHGA 3TCZA 5HWBA 1JNTA 4ODPA 1WB0A 1ITXA 4QT3A 3I6CA 1NWSA 1FKFA 1HXVA 1SR0A 2G41A 3KABA 2ZR4A 1C9HA 5D75A 4HARA 1FKLA 3WH0A 1NSGA 4P8XA 2F4EA 5B8IC 2M08A 1N1AA 4DRIA 2F2DA 4Q22A 2DSWA 1X6NA 3JYMA 3ARPA 5GQBA 1ROTA 3BXWA 4KR0B 3ARSA 2FDMA 3NRKA 2B31A 3ARWA 1JVWA 4JYSA 1A7XA 1J4RA 4AY1A 4ZPTR 4WKFA 4MNLA 2DSVA 3AS2A 5JH8A 2KR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSE A;  1FKI A;  3O5K A;  4DIP A;  3IKG A;  1F40 A;  4TX0 A;  1TCO C;  2MNT A;  1J4I A;  2XP3 A;  3UF8 A;  1FJD A;  1FD9 A;  2KE0 A;  2MLX A;  2XP9 A;  3FAP A;  2D9F A;  3H9R B;  3RGC A;  3UI5 A;  3O5Q A;  4DRJ A;  3IK8 A;  2UZ5 A;  3KAI A;  5HWC A;  3NTP A;  2KO7 A;  3UI4 A;  5HW7 A;  4DRK A;  3KCE A;  2ZQV A;  3UQA A;  3GPK A;  2M1I A;  4R0X A;  3CGN A;  3KAC A;  4TW6 A;  1NMW A;  4QT2 A;  2XPA A;  2XP4 A;  3O5E A;  1FKD A;  4DRQ A;  4DT4 A;  2AWG A;  4DRH A;  2L2S A;  1FKH A;  1YAT A;  3O5D A;  1KT0 A;  1Q6H A;  2JZV A;  2OFN A;  2PV3 A;  2ITK A;  1L1P A;  2ZQS A;  1JNS A;  5J6E A;  4DZ2 A;  4TYO A;  4TW7 A;  1D7I A;  2MF9 A;  1BL4 A;  2Q5A A;  2ZQT A;  2PBC A;  4W9Q A;  2Y78 A;  3RFW A;  2XP7 A;  5DIV A;  1Q6U A;  4DZ3 A;  5GPG A;  1FKK A;  4U84 A;  5I98 A;  4TW8 A;  2PPN A;  4IQ2 A;  1T11 A;  4JFJ A;  2ZQU A;  2ZR5 A;  4NNR A;  3O5G A;  3O5F A;  4ODO A;  5HKG A;  5HW6 A;  3O5P A;  3KAD A;  2PPP A;  2FKE A;  1Q1C A;  1FKG A;  4DRN A;  4J4N A;  4ODK A;  4W9P A;  2VCD A;  3PRD A;  2LGO A;  4ODN A;  1FKJ A;  2XP5 A;  2K8I A;  1Y0O A;  1FKR A;  1FKT A;  3TC5 A;  4W9O A;  1ZCN A;  4G2P A;  4J4O A;  3IHZ A;  4LAW A;  5HT1 A;  3UQI A;  4DH0 A;  3OOB A;  5BXJ A;  2DG9 A;  4GGQ A;  2N87 A;  1QZ2 A;  3O5I A;  4MSP A;  4O2T A;  4U86 A;  1J6Y A;  1R9H A;  1EYM A;  2ZR6 A;  4TNS A;  3B7X A;  5HTG A;  4N19 A;  1EQ3 A;  2FAP A;  3MDY B;  4G50 A;  2DG4 A;  1ROU A;  4LAX A;  2KGJ A;  1PBK A;  4LAY A;  4ODR A;  2KR7 A;  4GIV A;  3PA7 A;  1B6C A;  5DIT A;  2RQS A;  3TCZ A;  3TDB A;  2VN1 A;  2PPO A;  3IKD A;  2M2A A;  3ODK A;  2F21 A;  4ODQ A;  5HWB A;  1JNT A;  2RUR A;  2KFW A;  4ODP A;  1J4H A;  3UI6 A;  2RUC A;  4QT3 A;  4DRO A;  3I6C A;  3O5O A;  1FKF A;  4JFM A;  4U85 A;  2XP6 A;  5DIU A;  3KAB A;  1HXV A;  4JFK A;  2LPV A;  2ZR4 A;  3EY6 A;  4DRM A;  3JXV A;  1C9H A;  2XP8 A;  2MLZ A;  1YW5 A;  4FAP A;  1F8A B;  5D75 A;  3O5L A;  3JYJ A;  4ODL A;  5HUA A;  4JFL A;  3O5M A;  1FKL A;  2DG3 A;  3WH0 A;  1NSG A;  1U79 A;  1FAP A;  2LJ4 A;  2F4E A;  3LUO A;  1BKF A;  1Q6I A;  5B8I C;  1D6O A;  2M08 A;  1N1A A;  1PIN A;  4ITZ A;  1KT1 A;  4DRI A;  2F2D A;  2RUD A;  4ODM A;  3UQB A;  3KAG A;  4BF8 A;  2XPB A;  3PRB A;  3JYM A;  3NI6 A;  1D7J A;  2PV2 A;  4DRP A;  2RUQ A;  5HW8 A;  3KAH A;  3KZ7 A;  1P5Q A;  1ROT A;  2PV1 A;  4MGV A;  4LAV A;  2KI3 A;  4QIB A;  2LKN A;  3CGM A;  3KAF A;  3O5J A;  4IPX A;  2IF4 A;  3NRK A;  4IQC A;  2MLY A;  1FKB A;  2MPH A;  1ZK6 A;  4C02 B;  1JVW A;  4JYS A;  4JFI A;  1A7X A;  1J4R A;  3O5R A;  1QPL A;  1D7H A;  1FKS A;  3VAW A;  1NMV A;  4FN2 A;  1QPF A;  1M5Y A;  1W26 A; 
#chains in the Genus database with same CATH topology
 2RSE A;  1TCO C;  3WD0 A;  4DWS C;  2O9O A;  1O6I A;  3RME A;  2MLX A;  2XP9 A;  3UI5 A;  3O5Q A;  1JND A;  3KAI A;  1GPF A;  1E15 A;  3CGN A;  3O5E A;  1CTN A;  2WLY A;  4DRQ A;  4DT4 A;  2AWG A;  3WD3 A;  1LQ0 A;  2L2S A;  1YAT A;  1Q6H A;  2OFN A;  1L1P A;  4ZPW R;  1BL4 A;  1ZBW A;  2Y78 A;  3RFW A;  5DO2 A;  5DIV A;  1SYT A;  5GPG A;  2ZQU A;  2DT1 A;  1E6R A;  3PRA A;  1W1P A;  4MAV A;  3QOK A;  4ZS6 A;  1HKK A;  2LGO A;  2K8I A;  1Y0O A;  1FKT A;  4J4O A;  3UQI A;  5HT1 A;  3ARQ A;  3OOB A;  3ARO A;  1OWQ A;  4MSP A;  1J6Y A;  1ZBC A;  1R9H A;  4TNS A;  2F23 A;  2FAP A;  4G50 A;  3AQU A;  2KGJ A;  3IKD A;  1EHN A;  2RUR A;  2KFW A;  1J4H A;  1W9P A;  4DRO A;  4JFM A;  5DIU A;  3RM8 A;  4U85 A;  2XP6 A;  4JFK A;  3EY6 A;  1WAW A;  1W9U A;  3JXV A;  4MNJ A;  2XP8 A;  2MLZ A;  1F8A B;  3O5L A;  3JYJ A;  4JFL A;  3O5M A;  1WNO A;  3RM4 A;  4Z2I A;  3WD1 A;  1U79 A;  4WK9 A;  2LJ4 A;  3EIP A;  3LUO A;  1BKF A;  2RUD A;  3ARR A;  3OA5 A;  1NWT A;  3GTY X;  3PRB A;  4P8U A;  2PV2 A;  3KAH A;  1P5Q A;  4IT6 A;  4HBO A;  4LAV A;  4MGV A;  4DWS B;  1ZU8 A;  4Z2H A;  4QIB A;  3O5J A;  3KAF A;  4W5U A;  2IUZ A;  4IQC A;  4UDM A;  1QPF A;  1ZK6 A;  3WQV A;  3O5R A;  1UR8 A;  1M5Y A;  4DWS D;  2P4V A;  3IKG A;  2MNT A;  1J4I A;  2XP3 A;  3UF8 A;  3WL1 A;  1FJD A;  2KE0 A;  3AS0 A;  4MNK A;  4Z2K A;  1UR9 A;  2D9F A;  3RGC A;  3WKZ A;  2UZ5 A;  3FY1 A;  3NTP A;  2KO7 A;  3CHC A;  1W1V A;  1LJY A;  3GPK A;  2A3C A;  1TFV A;  1E44 A;  2WK2 A;  3KAC A;  1E9L A;  1NMW A;  4QT2 A;  3WL0 A;  2XP4 A;  3BMB A;  3ARZ A;  3WD2 A;  3O5D A;  1LL7 A;  2PV3 A;  2ITK A;  1K9T A;  5J6E A;  4DZ2 A;  4TYO A;  1D7I A;  2MF9 A;  2ZQT A;  2A3A A;  4DZ3 A;  1W9V A;  1LG1 A;  1OGG A;  4U84 A;  2PPN A;  4IQ2 A;  1T11 A;  2ZR5 A;  2DPE A;  2DSZ A;  4ML4 A;  1E6P A;  3O5G A;  3O5F A;  4ODO A;  3ARU A;  5HKG A;  5HW6 A;  3KAD A;  2EUL A;  1JCH B;  1LL6 A;  3AS1 A;  1FKG A;  1HJV A;  4W9P A;  2VCD A;  1FKJ A;  1ZCN A;  4DH0 A;  3IHZ A;  5DEZ A;  2ESC A;  1HKM A;  4GGQ A;  3FXY A;  1ZBV A;  1GOI A;  1FFR A;  3CZ8 A;  4N19 A;  2AOS A;  2DG4 A;  3CHD A;  1ZBK A;  4WKA A;  3CHF A;  3PA7 A;  1B6C A;  2PPO A;  1GRJ A;  1OGB A;  1VF8 A;  2A3B A;  1W1T A;  3O5O A;  4DRM A;  4FAP A;  4XAK A;  2DG3 A;  4NSB A;  1FAP A;  1NH6 A;  1HJW A;  1Q6I A;  2YBT A;  1D6O A;  4ITZ A;  1PIN A;  1KT1 A;  4ODM A;  3UQB A;  1NWR A;  3KAG A;  4BF8 A;  4QZV B;  1RD6 A;  4DRP A;  2RUQ A;  3G6L A;  5DF0 A;  3PR9 A;  2KI3 A;  3CGM A;  4IPX A;  1JNE A;  2MPH A;  4IT4 A;  1QPL A;  4Q7N A;  1W26 A;  3O5K A;  4DIP A;  4URI A;  1F40 A;  3H9R B;  4DRJ A;  3FAP A;  5HWC A;  3ALF A;  2ETN A;  5HW7 A;  4DRK A;  4TW6 A;  1HJX A;  4MTV A;  1FKD A;  1FFQ A;  4S3J A;  1FKH A;  3G6M A;  2DT0 A;  2WLZ A;  2ZQS A;  3ARY A;  3ARV A;  4TW7 A;  4Z2J A;  2Q5A A;  2PBC A;  1EIB A;  2XP7 A;  4TW8 A;  4NNR A;  4ZPV R;  3O5P A;  1ZB5 A;  5HBF A;  4J4N A;  3WD4 A;  4ODN A;  2XP5 A;  1FKR A;  2DT2 A;  4W9O A;  4LAW A;  1E6Z A;  2DG9 A;  1QZ2 A;  4O2T A;  4U86 A;  1H0G A;  3B7X A;  4DWS A;  3MDY B;  4S3K A;  4LAX A;  4ODR A;  4LGX A;  3TDB A;  2M2A A;  4ODQ A;  2F21 A;  2WM0 A;  4Z2G A;  1KFW A;  3UI6 A;  2RUC A;  3WQW A;  2LPV A;  2PI6 A;  1YW5 A;  1IX5 A;  4ODL A;  5HUA A;  2QF8 A;  2DSU A;  2PN0 A;  3AS3 A;  4Z2L A;  2XPB A;  3NI6 A;  1D7J A;  1W1Y A;  3ART A;  4MPK A;  5HW8 A;  3KZ7 A;  4P8V A;  2PV1 A;  4KQZ A;  1E6N A;  1GUV A;  1ZL1 A;  2LKN A;  2IF4 A;  2MLY A;  1FKB A;  1H0I A;  4C02 B;  4JFI A;  3VAW A;  1D7H A;  3CHE A;  4WIW A;  1NMV A;  4FN2 A;  1FKS A;  3W4R A;  1FKI A;  3RM9 A;  4WKH A;  4TX0 A;  1HKJ A;  1FD9 A;  1LL4 A;  4MNM A;  3ARX A;  3IK8 A;  1LG2 A;  3UI4 A;  3B9E A;  3KCE A;  2ZQV A;  4L72 B;  3UQA A;  2M1I A;  4R0X A;  1D2K A;  2O92 A;  1XRV A;  2XPA A;  4DRH A;  3ALG A;  2G8Z A;  4WJX A;  1KT0 A;  2JZV A;  1EDQ A;  1JNS A;  2DT3 A;  4W9Q A;  4HBE A;  1Q6U A;  5I98 A;  1FKK A;  4L3N A;  4JFJ A;  1X6L A;  5GPR A;  2OLH A;  3B9A A;  3B8S A;  4PTM A;  2PPP A;  2FKE A;  1Q1C A;  2A3E A;  4DRN A;  4ODK A;  3PRD A;  3CH9 A;  3TC5 A;  4G2P A;  5BXJ A;  2N87 A;  3O5I A;  2YBU A;  2B5U B;  1NWU A;  3WIJ A;  2ZR6 A;  1EYM A;  5HTG A;  1EQ3 A;  4NZC A;  1ROU A;  1PBK A;  4LAY A;  4GIV A;  5DIT A;  1HKI A;  2RQS A;  3B9D A;  4P8W A;  4R5E A;  2VN1 A;  3ODK A;  1XHG A;  3TCZ A;  5HWB A;  1JNT A;  4ODP A;  1WB0 A;  1ITX A;  4QT3 A;  3I6C A;  1NWS A;  1FKF A;  1HXV A;  1SR0 A;  2G41 A;  3KAB A;  2ZR4 A;  1C9H A;  5D75 A;  4HAR A;  1FKL A;  3WH0 A;  1NSG A;  4P8X A;  2F4E A;  5B8I C;  2M08 A;  1N1A A;  4DRI A;  2F2D A;  4Q22 A;  2DSW A;  1X6N A;  3JYM A;  3ARP A;  5GQB A;  1ROT A;  3BXW A;  4KR0 B;  3ARS A;  2FDM A;  3NRK A;  2B31 A;  3ARW A;  1JVW A;  4JYS A;  1A7X A;  1J4R A;  4AY1 A;  4ZPT R;  4WKF A;  4MNL A;  2DSV A;  3AS2 A;  3GU0 A;  5JH8 A;  2KR7 A; 
#chains in the Genus database with same CATH homology
 2RSE A;  1TCO C;  3WD0 A;  4DWS C;  2O9O A;  1O6I A;  3RME A;  2MLX A;  2XP9 A;  3UI5 A;  3O5Q A;  1JND A;  3KAI A;  1GPF A;  1E15 A;  3CGN A;  3O5E A;  1CTN A;  2WLY A;  4DRQ A;  4DT4 A;  2AWG A;  3WD3 A;  1LQ0 A;  2L2S A;  1YAT A;  1Q6H A;  2OFN A;  1L1P A;  4ZPW R;  1BL4 A;  1ZBW A;  2Y78 A;  3RFW A;  5DO2 A;  5DIV A;  1SYT A;  5GPG A;  2ZQU A;  2DT1 A;  1E6R A;  3PRA A;  1W1P A;  4MAV A;  3QOK A;  4ZS6 A;  1HKK A;  2LGO A;  2K8I A;  1Y0O A;  1FKT A;  4J4O A;  3UQI A;  5HT1 A;  3ARQ A;  3OOB A;  3ARO A;  1OWQ A;  4MSP A;  1J6Y A;  1ZBC A;  1R9H A;  4TNS A;  2FAP A;  4G50 A;  3AQU A;  2KGJ A;  3IKD A;  1EHN A;  2RUR A;  2KFW A;  1J4H A;  1W9P A;  4DRO A;  4JFM A;  5DIU A;  3RM8 A;  4U85 A;  2XP6 A;  4JFK A;  3EY6 A;  1WAW A;  1W9U A;  3JXV A;  4MNJ A;  2XP8 A;  2MLZ A;  1F8A B;  3O5L A;  3JYJ A;  4JFL A;  3O5M A;  1WNO A;  3RM4 A;  4Z2I A;  3WD1 A;  1U79 A;  4WK9 A;  2LJ4 A;  3LUO A;  1BKF A;  2RUD A;  3ARR A;  3OA5 A;  1NWT A;  3PRB A;  4P8U A;  2PV2 A;  3KAH A;  1P5Q A;  4IT6 A;  4HBO A;  4LAV A;  4MGV A;  4DWS B;  1ZU8 A;  4Z2H A;  4QIB A;  3O5J A;  3KAF A;  4W5U A;  2IUZ A;  4IQC A;  1QPF A;  1ZK6 A;  3WQV A;  3O5R A;  1UR8 A;  1M5Y A;  4DWS D;  3IKG A;  2MNT A;  1J4I A;  2XP3 A;  3UF8 A;  3WL1 A;  1FJD A;  2KE0 A;  3AS0 A;  4MNK A;  4Z2K A;  1UR9 A;  2D9F A;  3RGC A;  3WKZ A;  2UZ5 A;  3FY1 A;  3NTP A;  2KO7 A;  3CHC A;  1W1V A;  1LJY A;  3GPK A;  2A3C A;  1TFV A;  2WK2 A;  3KAC A;  1E9L A;  1NMW A;  4QT2 A;  3WL0 A;  2XP4 A;  3ARZ A;  3WD2 A;  3O5D A;  1LL7 A;  2PV3 A;  2ITK A;  1K9T A;  5J6E A;  4DZ2 A;  4TYO A;  1D7I A;  2MF9 A;  2ZQT A;  2A3A A;  4DZ3 A;  1W9V A;  1LG1 A;  1OGG A;  4U84 A;  2PPN A;  4IQ2 A;  1T11 A;  2ZR5 A;  2DPE A;  2DSZ A;  4ML4 A;  1E6P A;  3O5G A;  3O5F A;  4ODO A;  3ARU A;  5HKG A;  5HW6 A;  3KAD A;  1LL6 A;  3AS1 A;  1FKG A;  1HJV A;  4W9P A;  2VCD A;  1FKJ A;  1ZCN A;  4DH0 A;  3IHZ A;  5DEZ A;  2ESC A;  1HKM A;  4GGQ A;  3FXY A;  1ZBV A;  1GOI A;  1FFR A;  3CZ8 A;  4N19 A;  2AOS A;  2DG4 A;  3CHD A;  1ZBK A;  4WKA A;  3CHF A;  3PA7 A;  1B6C A;  2PPO A;  1OGB A;  1VF8 A;  2A3B A;  1W1T A;  3O5O A;  4DRM A;  4FAP A;  4XAK A;  2DG3 A;  4NSB A;  1FAP A;  1NH6 A;  1HJW A;  1Q6I A;  2YBT A;  1D6O A;  4ITZ A;  1PIN A;  1KT1 A;  4ODM A;  3UQB A;  1NWR A;  3KAG A;  4BF8 A;  4QZV B;  1RD6 A;  4DRP A;  2RUQ A;  3G6L A;  5DF0 A;  3PR9 A;  2KI3 A;  3CGM A;  4IPX A;  1JNE A;  2MPH A;  4IT4 A;  1QPL A;  4Q7N A;  1W26 A;  3O5K A;  4DIP A;  4URI A;  1F40 A;  3H9R B;  4DRJ A;  3FAP A;  5HWC A;  3ALF A;  5HW7 A;  4DRK A;  4TW6 A;  1HJX A;  4MTV A;  1FKD A;  1FFQ A;  4S3J A;  1FKH A;  3G6M A;  2DT0 A;  2WLZ A;  2ZQS A;  3ARY A;  3ARV A;  4TW7 A;  4Z2J A;  2Q5A A;  2PBC A;  1EIB A;  2XP7 A;  4TW8 A;  4NNR A;  4ZPV R;  3O5P A;  1ZB5 A;  5HBF A;  4J4N A;  3WD4 A;  4ODN A;  2XP5 A;  1FKR A;  2DT2 A;  4W9O A;  4LAW A;  1E6Z A;  2DG9 A;  1QZ2 A;  4O2T A;  4U86 A;  1H0G A;  3B7X A;  4DWS A;  3MDY B;  4S3K A;  4LAX A;  4ODR A;  4LGX A;  3TDB A;  2M2A A;  4ODQ A;  2F21 A;  2WM0 A;  4Z2G A;  1KFW A;  3UI6 A;  2RUC A;  3WQW A;  2LPV A;  2PI6 A;  1YW5 A;  1IX5 A;  4ODL A;  5HUA A;  2QF8 A;  2DSU A;  3AS3 A;  4Z2L A;  2XPB A;  3NI6 A;  1D7J A;  1W1Y A;  3ART A;  4MPK A;  5HW8 A;  3KZ7 A;  4P8V A;  2PV1 A;  4KQZ A;  1E6N A;  1GUV A;  1ZL1 A;  2LKN A;  2IF4 A;  2MLY A;  1FKB A;  1H0I A;  4C02 B;  4JFI A;  3VAW A;  1D7H A;  3CHE A;  4WIW A;  1NMV A;  4FN2 A;  1FKS A;  3W4R A;  1FKI A;  3RM9 A;  4WKH A;  4TX0 A;  1HKJ A;  1FD9 A;  1LL4 A;  4MNM A;  3ARX A;  3IK8 A;  1LG2 A;  3UI4 A;  3B9E A;  3KCE A;  2ZQV A;  4L72 B;  3UQA A;  2M1I A;  4R0X A;  1D2K A;  2O92 A;  1XRV A;  2XPA A;  4DRH A;  3ALG A;  2G8Z A;  4WJX A;  1KT0 A;  2JZV A;  1EDQ A;  1JNS A;  2DT3 A;  4W9Q A;  4HBE A;  1Q6U A;  5I98 A;  1FKK A;  4L3N A;  4JFJ A;  1X6L A;  5GPR A;  2OLH A;  3B9A A;  3B8S A;  4PTM A;  2PPP A;  2FKE A;  1Q1C A;  2A3E A;  4DRN A;  4ODK A;  3PRD A;  3CH9 A;  3TC5 A;  4G2P A;  5BXJ A;  2N87 A;  3O5I A;  2YBU A;  1NWU A;  3WIJ A;  2ZR6 A;  1EYM A;  5HTG A;  1EQ3 A;  4NZC A;  1ROU A;  1PBK A;  4LAY A;  4GIV A;  5DIT A;  1HKI A;  2RQS A;  3B9D A;  4P8W A;  4R5E A;  2VN1 A;  3ODK A;  1XHG A;  3TCZ A;  5HWB A;  1JNT A;  4ODP A;  1WB0 A;  1ITX A;  4QT3 A;  3I6C A;  1NWS A;  1FKF A;  1HXV A;  1SR0 A;  2G41 A;  3KAB A;  2ZR4 A;  1C9H A;  5D75 A;  4HAR A;  1FKL A;  3WH0 A;  1NSG A;  4P8X A;  2F4E A;  5B8I C;  2M08 A;  1N1A A;  4DRI A;  2F2D A;  4Q22 A;  2DSW A;  1X6N A;  3JYM A;  3ARP A;  5GQB A;  1ROT A;  3BXW A;  4KR0 B;  3ARS A;  2FDM A;  3NRK A;  2B31 A;  3ARW A;  1JVW A;  4JYS A;  1A7X A;  1J4R A;  4AY1 A;  4ZPT R;  4WKF A;  4MNL A;  2DSV A;  3AS2 A;  5JH8 A;  2KR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...