4J56E

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
b'GSVKIVTSQAEFDSIISQNELVIVDFFAEWCGPSKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
molecule keywords Thioredoxin reductase 2
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 31
structure length 105
sequence length 105
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4j56E00
5EVOA 4FYCA 2QGVA 2FD3A 1R4WA 1GSQA 3HA9A 4IGJA 5DVBA 2GQKA 2DSAA 1V9WA 3A2XA 1MDJA 4KB3A 2VLUA 1U3IA 3BD2A 5ECHB 2DC5A 2PBJA 3APOA 3HJPA 4G10A 1WPIA 2IN3A 1GSEA 2CVKA 3IR4A 2CA8A 1YEPA 2FWEA 2O89A 3LYKA 5HFGA 3APSA 2VCWA 4DEJA 1TOFA 3C71A 3H1NA 2WRTA 3HD5A 3KGKA 3GURA 1ERUA 4Z7XA 5ABRA 2LJRA 1KBNA 3EMPA 1BX9A 2H1BA 2H73A 3WT1A 2L6DA 4RUVA 2KP1A 2WFCA 2GQLA 1THXA 4KDXA 1J9BA 4DSSB 2OACA 3BOAA 4OFNA 2DJ2A 1YEXA 3I69A 2VOCA 1EGOA 2LEGA 1TK5B 4OO4A 2DMMA 2A4VA 4LL1B 1Z7RA 1FHEA 1EWXA 1ZL9A 1VF2A 1JZWA 3QMXA 1M2DA 1Y25A 2KLXA 2VIMA 3D0ZA 4ML6A 3HVVA 5GAND 1RK4A 1T3BA 2HRFA 3TRPA 3KJYA 1QMVA 1XPVA 4MDCA 4AGSA 5D9XA 2C0FA 3FHKA 3HXSA 5HR0A 4OCFA 2F9SA 5HR3A 4OO5A 5KN1A 5J41A 2BJXA 5INYA 1PL2A 1TK8B 1FB6A 1HD2A 5CRHA 3UMAA 4JZQA 2PN8A 2V41A 2YP6A 5KEJA 1PGTA 2F8AA 3EWLA 1OE7A 1Z9HA 3ZZXA 2F51A 2IPAA 3K8NA 3J7Yk 2C3NA 1PX6A 1BAYA 4GSNA 1DSBA 6GSSA 5CP1A 4PUFC 4MLYA 2DLXA 2ON7A 4TKYA 2ALBA 3HKRA 3O76A 4POBA 1EV9A 4RQRA 4K7NA 2VCTA 5CAXA 4K2DA 3ZL5A 5ECNB 1UN2A 1GTAA 1GSDA 1XWBA 3D6IA 4IKHA 3TJJA 3ZREA 2P0GA 4HEA2 3HJMA 6GSWA 2VM1A 3ZTLA 3CRUA 3ME8A 1MDIA 3VFIA 3G7JA 1K0BA 1DE2A 1GSUA 2H1DA 3ERWA 5ECOB 2CAQA 4TR1B 2A2SA 3G7YA 1MD3A 3GRXA 5KN0A 1GLQA 1WIKA 2CV4A 4BVXA 2XHFA 3V1WA 2YNXA 2L59A 1XWKA 4GQCA 3ZYWA 3CRTA 2B5XA 3TJBA 7GSSA 1V98A 2H1AA 1V58A 2YJHA 3G9BA 3TOUA 4EE0A 4EVMA 1GNWA 2PU9C 3C8EA 4AJ7A 2K6VA 5DCGA 1FOVA 2A2RA 2HFDA 4O7HA 3GHAA 1XOBA 6GSYA 3WGDA 3IPZA 1EEMA 3BCKA 2HE3A 2XBIA 1U87A 2GSRA 3PINA 2QC7A 3SWLA 1U3AA 4F82A 3L9SA 5GZZB 4QL9A 3ZVJA 2B1LA 6GSXA 2H0HA 1PMTA 1X5DA 1X0RA 4ZB8A 3FKFA 1AXDA 1JFUA 1OVNA 3H79A 1SJZA 1T4YA 1G7OA 4BPYA 1XZOA 3WD6A 3UJ1A 1W89A 1M9AA 4PUAA 4MJEA 1F3BA 1G6WA 3F6FA 3F3RA 1GULA 3RHCA 2FY6A 1QGVA 3F8UA 4YQMA 1TXXA 2GZYA 3HVXA 1S3DA 2HNLA 2O87A 3CSHA 2XPDA 1J0FA 4K6XA 4MJCA 2K8VA 5G1KA 2WJUA 2MMOA 2GS3A 2NPBA 3ZFBA 5IIZA 2NVLA 3KMOA 1B4QA 1XWCA 5IO0A 3E0UA 4ID0A 1Z5YE 3W6GA 3MNGA 2B5EA 1EP8A 1SU9A 8GSSA 2H30A 3KZQA 1WRYA 4TOPA 3VI7A 2I1UA 1O85A 4OD7A 4JBBA 4IBPA 4IP1A 4ECCA 4IVFA 2OJLA 2GZZA 2WB9A 2K9FA 1O8XA 2CX4A 3ED3A 5CO3A 4NV5A 2C1YA 2R4VA 5HR2A 1O6JA 3IBHA 1KEBA 4KSOA 4GWRA 3U6VA 4POMA 2MMNA 4KGIA 4D73A 3HCZA 2C3TA 2YPMA 2OKAA 1MTCA 1TI1A 5CRDA 4EUYA 1F37A 1AAZA 1R7HA 2C80A 3NOFA 4HZ2A 5ECRB 4PQIA 5G2ZA 1Z3EA 1ABAA 4ZL8A 4ECJA 4MA9A 5G31A 5IMVA 3LFLA 2H1GA 1OE8A 5E4WA 5ELGA 4QQ7A 3APQA 5FT3A 17GSA 4NV2A 5KN3A 2L57A 2XPEA 2VCVA 4TRXA 1Z7PA 4WETA 2MMZA 4K9ZA 4GSSA 4GLTA 1WE0A 3TCOA 1BG5A 1A2LA 2TRCP 4NPBA 3KMNA 1EGRA 4HOJA 4F2IA 2IL3A 3KXOA 4X1UA 2FLSA 2YJ7A 3HZ4A 2DJKA 1PKZA 1MEKA 5C04A 1XBSA 1M9BA 5JWQB 1QQ2A 1ERWA 1A2JA 2YCDA 1F6MC 2FWFA 4JE1A 4ECIA 5CYYA 4TR4A 4KCEA 2DJ3A 2IWTA 5JWRB 1ZYQB 1YY7A 4LL4B 2VCZA 4IQ1A 1SL1B 1M99A 4EF0A 3SBCA 4OCEA 1SD9A 3GH9A 4ACSA 5GSSA 3A2VA 3KH9A 1K3YA 1O8WA 2HLSA 2ES7A 4IHUA 4IQAA 1DE1A 1A0FA 2GSSA 4FYUA 1SL2B 1PX7A 2WGRA 3U5RE 4JR4A 1G6YA 4V2NA 3CSIA 2YV7A 5DALB 2C4JA 3WGXA 3GFKA 2G2QA 5ECMB 2AV4A 4NWYA 1A24A 3A2WA 3IA1A 3TRXA 2FA4A 2LUSA 1WJKA 2HZFA 3CTFA 5F07A 3DMLA 3RHBA 2WZ9A 2GLRA 3D4TA 3C73A 2IMEA 2CVDA 3RBTA 3TKSA 3L0HA 2YWOA 4H86A 1WP0A 3LJRA 5IMDA 2FA8A 5JWOB 4WR4A 3CMIA 3P90A 5F0GA 1ZCPA 2JZSA 2L4QA 5COHA 2IJYA 3ZVJD 1OC8A 4AJ8A 2B6MA 2YANA 2VAFA 2REMA 5G5FA 1SYXA 1EZKA 4O32A 1RQMA 1YF1A 3GKXA 1K0MA 2ON5A 1SKSB 4I8BA 1LJRA 4DSRA 2GZPA 3VPTA 2BTOT 3KD0A 4GXZA 3ZLPA 2FHEA 1RW1A 4IJ3A 2DIZA 2YZUA 1V2AA 2I3YA 4DSQA 4JEDA 1TRUA 5GSTA 4P3YB 3JCML 2P5RA 2KUCA 3GX0A 2XBQA 5B8BA 3GV1A 2I9HA 5CREA 2GTUA 1XW6A 2X8GA 2IMIA 2FWGA 1QFNA 1LU4A 3IK7A 1EP7A 3GKNA 4G9HA 1JZDA 5HFIA 3LORA 3BJ5A 2EC4A 2AAWA 3L4NA 5G5EA 3LSZA 3ISOA 4MF7A 3F63A 3IV4A 3LWAA 2RM6A 2PWJA 2H6YA 4EC0A 2FGXA 3M9JA 5D9VA 4OFMA 1TJDA 1AC1A 1VF4A 2VCXA 2HXKA 3GNJA 4XIHA 1GSYA 1B9XC 1PQNA 3BBYA 2VD1A 3ZMLA 1K0DA 4J56E 1X9WB 4L0WA 4YQUA 4XHMA 2X8CA 3P7XA 4KNDA 1ST9A 2H6XA 1PSQA 2TIRA 4IJIA 5EY6A 4WEYA 3TB2A 2FUG2 2AJQB 3WGEA 5DALA 1WWJA 4GQFA 2H0GA 4KDUA 5ENUA 2VM2A 3GX8A 5CRGA 1HNCA 1XW5A 1GH2A 3Q19A 1R5PA 3QPMA 2VCQA 2PPTA 1MDKA 5DAKA 4I2UA 1ZOFA 3DVWA 5AIXA 3GTUA 4GTUA 1SK2A 2LJKA 4ZL7A 1W4VA 4XS6A 4D73B 2LRTA 3EE2A 2JZRA 1ML6A 4MZBA 2HZEB 2OE0A 2AYTA 1FO5A 4XRDA 1TRWA 3D5JA 4KAEA 1S3CA 1VF1A 1JLWA 1PD21 4MF6A 1U6TA 2CVBA 4NXIA 1UA5A 2V1MA 2V32A 3G7IA 3R2QA 1OKTA 3KTLA 4X43A 3CYNA 3GN3A 4WXTA 2CT6A 1O73A 1A8LA 1GTBA 3TGZA 3UOMA 3KTBA 2LV3A 5FHIA 3WYWA 1TTZA 2CQ9A 3F6DA 4EL1A 2MZCA 4V1Ap 2VL2A 13GSA 3ZMKA 2M72A 1YF0A 3M1GA 2OE3A 1TKDB 2OE1A 3A3TA 4OMVA 3RPPA 4ILFA 2LKUA 4FH8A 1JZOA 4MP4A 3NZNA 3IXRA 2YN1A 3IOSA 4KDYA 2GSTA 1J08A 5G30A 3TDGA 4TVEA 3M9KA 1XVWA 2X8HA 2IFQA 1IYIA 3LQ7A 2AUVA 3LEFA 3WT2A 3VK9A 1X9SB 4EDYA 3QAVA 3IAM2 1XCCA 4GRFA 3IDVA 4MK3A 5A5KA 4HI7A 4E8EA 4KCAA 2IIYA 2AHEA 2B5YA 3LGCA 4WR5A 5IOWA 1SKRB 5ECLB 2CAIA 1T8EB 1S3AA 3GKMA 3IE3A 3GL5A 1SK0A 2OA7A 3EYTA 5AISA 1DUGA 5IOXA 4BWQA 3O6TA 3D22A 6GSUA 4HDEA 1TP9A 1SL0B 1NW2A 4PURA 4ULXA 1EOHA 5D8IA 3TKSC 5ID2B 5B6NA 4HQZA 3DWVA 3VPQA 1AQWA 1HQOA 2H01A 3A5WA 1O81A 1TU7A 4WBRD 3FZ4A 1I5GA 1PN9A 4IELA 2J9HA 2NTOA 4PQHA 1SK1A 2RUEA 5JCUA 4G19A 1XIYA 1Y6EA 2R3XA 5LNKe 4CHSA 2ZCTA 1TK0B 2MMAA 1THOA 4HQSA 4MMMA 1ZMAA 4TW5A 4F9ZA 1JZRA 3AY8A 2HI7A 3GSSA 4V2MA 2FCHA 1URMA 3CXGA 1E2YA 4HJMA 5LD0A 2L5OA 1IYHA 4KUNA 2LSTA 3J7Yb 2H70A 5F06A 1WMJA 1YZXA 4YH2A 3CTGA 2YWMA 4MJAA 3F3QA 3KIJA 1TI3A 4MH3A 3M8NA 1B9YC 4K1FA 4GF0A 2HZEA 3M3MA 1TDIA 3DGQA 5GAPD 3TKPA 4LMVA 2X64A 2E7PA 1GUHA 4I2TA 2N5FA 16GSA 3QCPA 5A4VA 2H6ZA 5EPFA 5ECKB 4N11A 5ELAA 2LJAA 3I6AA 3QR6A 3UBLA 2C0EA 1R5AA 2O7KA 2E2MA 5J3RA 4QL7A 4NHWA 3DD3A 5L71A 3GA4A 2H19A 4I6XA 2PVQA 3HZ8A 3UIWA 2VL3A 3TJFA 3EU3A 3VWWA 4MJBA 2LRCA 3PH9A 4J2FA 1B4PA 1ZGNA 3CSJA 3QFBC 2CZ2A 4NHZA 5HR1A 3LXTA 3TJGA 2J23A 3TKSE 5DBQA 2MYGA 4K8MA 2E0QA 2GT5A 1PA3A 4MPFA 4FIWA 2JL4A 18GSA 1B8XA 3FEUA 4KA0A 3H93A 3GMFA 4YAVA 2WS2A 4BL7A 2DJ1A 2M46A 4K7IA 4ECBA 4NAXA 3EMXA 1V40A 5D9WA 5G1LA 3VWXA 1HNAA 5DCHA 2WDUA 2LRNA 3PR8A 2F8FA 4HZ4A 4L5LA 3ERFA 4POLA 1V57A 2YV9A 3QDNA 3C7MA 1N2AA 5D73A 4TXOA 2H74A 2D2ZA 2LS5A 3N9JA 1E6BA 2JADA 4L5OA 1MD4A 1NHOA 1KNGA 1FB0A 4MZCA 2H76A 2CZ3A 4EDZA 3EINA 4HS1A 3ME7A 5EL8A 1VGLA 3FYGA 5DAKB 1X5CA 2PERA 5ID2A 5D93A 3GTUB 1A2MA 4IW9A 1OKDA 4V2LA 1PKWA 3HY2A 4J57E 2FWHA 3F9UA 4K0NA 3UL3A 4AJ6A 9GSSA 4PGTA 2EIRA 2NDOA 4MCUA 1XOAA 1FVJA 2DBCA 1F3AA 1T4ZA 2I4AA 4EKZA 2B1KA 3QAWA 1M7TA 2DJJA 2JZTA 1UVZA 4TR3A 5B6MA 2VL2C 2HRNA 2IMFA 1CQHA 3QD9A 3IRAA 2JU5A 4EXJA 1T1VA 1M2AA 2P5QA 2B3SA 22GSA 4JR6A 1SENA 1N8JA 4RI6A 1XWGA 5A4UA 5AN1A 4L0UA 3E3EA 3FW2A 5J9BA 3TJKA 2IMDA 2GT6A 3I9V2 3GSTA 5DDLA 4BWSA 2P31A 4BA7A 2VLVA 3GL3A 2GGTA 2OBKA 5IM9A 4WBJA 4YQVA 4KSMA 4PNGA 5ECQB 1QUWA 4Q5NA 1GNEA 1PRXA 3FK8A 2IFQB 2YWIA 4FO5A 4GSTA 4N30A 3HHVA 3N5OA 3DIEA 2M80A 1T00A 5FWGA 3KM6A 5ECSA 4PXOA 1GL8A 2VO4A 1ERTA 2AB6A 4N0ZA 5IQYA 4XTSA 2EIOA 3FRCA 2RIIA 1C72A 2G0FA 5J5NA 4ZB6A 5J4UA 4I5QA 1G7EA 3MAKA 3I43A 2H8LA 1GUKA 5IMZA 4JRRA 1TRVA 1TU8A 4POKA 1USBA 20GSA 4YAPA 2JACA 2R37A 5B8AA 4XCSA 4ML1A 1JLVA 4PNFA 5DQYA 1FG4A 5C00A 3RDWA 1NM3A 4HU7A 4PX1A 4HU9A 3VURA 1ERVA 4WKWA 2HYXA 10GSA 2V2GA 4F03A 1PL1A 5IPHA 2RUFA 3US3A 3S9FA 2DIYA 4FYBA 1GWCA 3O3TA 1GSFA 2TRXA 4XS1A 3ZIJA 4XS4A 2KOKA 3GIXA 3RPNA 5E59A 1AW9A 1H4OA 2MBTA 4F0BA 4E8HA 11GSA 3FR3A 3IK9A 2H71A 2DJ0A 2WULA 1QK8A 2B7JA 4Q5FA 4ZBBA 5IMAA 4V1Ag 1HYUA 5AIVA 5D9TA 4MF5A 4IP6A 1Z6NA 5H5QA 4OFTA 4RQXA 3P8WA 2BMXA 5IO2A 1SKWB 3UBKA 5IMFA 1GTUA 3DXBA 1G0TA 2YOIA 3VLNA 2GDRA 3FR9A 6GSTA 3TKQA 2OBIA 3FR6A 1BEDA 1M2BA 2WCIA 1TRSA 4PQ1A 1ILOA 4MABA 3KH7A 4ZBDA 1OC9B 3FZ9A 5KN2A 3EVIA 1B48A 2O8VB 3L78A 1SD8A 1AIUA 1FAAA 1F2EA 1AQVA 3FZAA 4HJ2A 1BQ7A 1FVKA 4I97A 5HQPA 2Z9SA 2L5LA 3OR5A 5A4WA 3VWUA 4L8EA 3W8JA 3TOTA 3UVTA 3ZRDA 5JCGA 2NBSA 1YJ6A 1A23A 1X5EA 5DJMA 2N5AA 1GUMA 1SJIA 3M0FA 4OWYA 3ERGA 5AGYA 4ZBAA 5DJLA 2X99A 4MPGA 3VWVA 4O5RA 1K0OA 2O85A 1X9MB 5IPGA 1R26A 1K0NA 4DSSA 1DBYA 2C3QA 4TR0A 3KP9A 4TXOB 2QKEA 2KP2A 1OAZA 2OADA 12GSA 4Q5QA 2VD0A 3DEXA 1EV4A 3W8SA 3D4MA 3Q74A 3LG6A 1I9DA 4JU5A 1EEJA 2KHPA 3FZ5A 2JSYA 1K0CA 3IC4A 2N5BA 1EOGA 2H66A 2E2GA 1O7UA 2GQMA 3H4KA 2YWNA 3D21A 2HSYA 3Q6OA 2RM5A 3FY7A 2EIQA 5J9CA 3CBUA 2LQOA 2K18A 3EURA 3F4RA 1GSSA 1OYJA 4ZILA 3EC3A 1XW9A 1A0RP 3QOUA 1BYEA 4KW6A 2LTKA 2C0DA 2LQQA 2QSIA 2GSQA 2V6OA 2H75A 2YZHA 1XWAA 4GCIA 4BVYA 1Q4JA 5IMCA 3TRQA 4MH2A 4WF5A 2PVOC 3MDKA 2R5GA 2FNOA 5ECIB 1WOUA 3TKRA 1Z6MA 4LLRA 1HNBA 2LNTA 4K0GA 1H75A 1AUCA 1M0UA 1SYRA 3UEMA 3ZIVA 1KTEA 4ZIJA 6GSVA 2XC2A 1GP1A 3HJOA 1CQGA 4NMUA 1YKAA 5F05A 3GUSA 2B7KA 3TUEA 1XVQA 2I81A 3GKKA 4ISDA 2R6KA 4N10A 3HVSA 5CRWA 3DRNA 1K3OA 2ZUPA 1LBKA 3F4SA 3LXZA 14GSA 1Q98A 2LNSA 2V6KA 3HDCA 1T7PB 5D96A 1NHYA 4TN8A 4AF2A 3ZFLA 3DKSA 2HT9A 3ZITA 2HSHA 1TW9A 3L9UA 1XXUA 1ZYEA 2H0IA 2H72A 1BJXA 1OC9A 4TR1A 4KE3A 1F9MA 4ZB9A 4X0XA 3H8QA 5H5SA 1GRXA 1QXHA 2L4CA 1K3LA 3QAGA 3L9VA 1YDKA 3GH6A 4KX4A 2DMLA 4O92A 4Q5RA 5HFKA 5ECPB 4DVCA 2JSZA 1OC3A 5JCWA 2PMTA 4CDOA 4CW9A 3Q18A 4F0CA 2ZNMA 3KP8A 4N0VA 4WF4A 1VF3A 3KEBA 1GLPA 1U88A 1XFLA 3DVXA 5DQSA 4EO3A 3E9JB 1UC7A 1GTIA 5B7CA 3MSZA 4XRAA 3UARA 3GYKA 3UAPA 1NSWA 3F0IA 4TXVA 4IS0A 3VI5A 1YKCA 1ACVA 3PGTA 1JHBA 2L6CA 4RI7A 5H5RA 3EU4A 4LA1A 3UVHA 1AQXA 1A8YA 5F8BA 4G2EA 2IMKA 3QFAC 4XS4B 3RAZA 3F4TA 4ZXGA 2RLIA 1ZZYA 4K7OA 2VUPA 3MWHA 19GSA 3IHQA 2C0GA 2C8UA 4MZWA 3HYPA 3NIVA 2K8SA 3P2AA 1YQ1A 5LCZA 4KH7A 3BCIA 2PGTA 2PUKC 1SJ6A 4HUAA 3LYPA 3KCMA 3IAS2 2GVPA 4IN0A 2F3MA 1VRSD 1FW1A 4LMWA 1K0AA 1ON4A 2R2JA 5CNWA 2CX3A 2VL9A 3C1RA 2VLTA 3DYRA 3C1SA 4ZL9A 2MBSA
chains in the Genus database with same CATH superfamily
5EVOA 4FYCA 2QGVA 2FD3A 1R4WA 1GSQA 3HA9A 4IGJA 5DVBA 2GQKA 2DSAA 1V9WA 3A2XA 4EIQA 1MDJA 4KB3A 2VLUA 1U3IA 3BD2A 5ECHB 3IC8A 2DC5A 2PBJA 3APOA 3HJPA 4G10A 1WPIA 2IN3A 1GSEA 2CVKA 3IR4A 2CA8A 1YEPA 4BVXB 2FWEA 2O89A 3LYKA 5HFGA 3APSA 2VCWA 4DEJA 1TOFA 3C71A 3H1NA 2WRTA 3HD5A 3KGKA 3GURA 1ERUA 4Z7XA 5ABRA 2LJRA 1KBNA 3EMPA 1BX9A 2H1BA 2H73A 3WT1A 2L6DA 4RUVA 2KP1A 2WFCA 2GQLA 1THXA 4KDXA 1J9BA 4DSSB 2OACA 3BOAA 4OFNA 2DJ2A 1YEXA 3I69A 2VOCA 1EGOA 2LEGA 1TK5B 4OO4A 2DMMA 2A4VA 4LL1B 1Z7RA 1FHEA 1EWXA 1ZL9A 1VF2A 1JZWA 3QMXA 1M2DA 1Y25A 2KLXA 2VIMA 3D0ZA 4ML6A 3HVVA 5GAND 1RK4A 1T3BA 2HRFA 3TRPA 3KJYA 4K5RA 1QMVA 1XPVA 4MDCA 4AGSA 5D9XA 2C0FA 3FHKA 3HXSA 5HR0A 4OCFA 2F9SA 5HR3A 4OO5A 5KN1A 4KF9A 5J41A 2BJXA 5INYA 2DKHA 1PL2A 1TK8B 1FB6A 1HD2A 5CRHA 3UMAA 4JZQA 2PN8A 2V41A 2YP6A 5KEJA 1PGTA 2F8AA 3EWLA 1OE7A 1Z9HA 3ZZXA 2F51A 2IPAA 3K8NA 3J7Yk 2C3NA 1PX6A 1BAYA 4GSNA 1DSBA 6GSSA 5CP1A 4PUFC 4MLYA 2DLXA 2ON7A 4TKYA 2ALBA 3HKRA 3O76A 4POBA 1EV9A 4RQRA 4K7NA 2VCTA 5CAXA 4K2DA 3ZL5A 5ECNB 1UN2A 1GTAA 1GSDA 1XWBA 3D6IA 4IKHA 3TJJA 3ZREA 2P0GA 4HEA2 3HJMA 6GSWA 2VM1A 3ZTLA 3CRUA 3ME8A 1MDIA 3VFIA 3G7JA 1K0BA 1DE2A 1GSUA 2H1DA 3ERWA 5ECOB 2CAQA 4TR1B 2A2SA 3G7YA 1MD3A 3GRXA 5KN0A 1GLQA 1WIKA 2CV4A 4BVXA 2XHFA 3V1WA 2YNXA 2L59A 1XWKA 4GQCA 3ZYWA 3CRTA 2B5XA 3TJBA 7GSSA 1V98A 2H1AA 1V58A 2YJHA 3G9BA 3TOUA 4EE0A 4EVMA 1GNWA 2PU9C 3C8EA 4AJ7A 2K6VA 5DCGA 1FOVA 2A2RA 2HFDA 4O7HA 3GHAA 1XOBA 6GSYA 3WGDA 3IPZA 1EEMA 3BCKA 1ZYPA 2HE3A 2XBIA 5KOXA 5BMUA 1U87A 2GSRA 3PINA 2QC7A 3SWLA 1U3AA 4F82A 3L9SA 5GZZB 4QL9A 3ZVJA 2B1LA 6GSXA 2H0HA 1PMTA 1X5DA 1X0RA 4ZB8A 3FKFA 1AXDA 1JFUA 1OVNA 3H79A 1SJZA 1T4YA 1G7OA 4BPYA 1XZOA 4G0LA 3WD6A 3UJ1A 1W89A 1M9AA 4PUAA 4MJEA 1F3BA 1G6WA 3F6FA 3F3RA 1GULA 3RHCA 2FY6A 1QGVA 3F8UA 4YQMA 1TXXA 2GZYA 3HVXA 1S3DA 2HNLA 2O87A 3CSHA 2XPDA 1J0FA 4K6XA 4MJCA 4USSA 4O5UA 2K8VA 5G1KA 2WJUA 2MMOA 2GS3A 2NPBA 3ZFBA 5IIZA 2NVLA 3KMOA 1B4QA 1XWCA 5IO0A 2HRAA 3E0UA 4ID0A 1Z5YE 3W6GA 3MNGA 2B5EA 1EP8A 1SU9A 8GSSA 2H30A 3KZQA 1WRYA 4TOPA 3VI7A 2I1UA 1O85A 4OD7A 4JBBA 4IBPA 4IP1A 4ECCA 4IVFA 2OJLA 2GZZA 2WB9A 2K9FA 1O8XA 2CX4A 3ED3A 5CO3A 4NV5A 2C1YA 2R4VA 5HR2A 1O6JA 3IBHA 1KEBA 4KSOA 4GWRA 3U6VA 4POMA 2MMNA 4KGIA 4YKFA 4D73A 3HCZA 2C3TA 2YPMA 4Z2RA 2OKAA 1MTCA 1TI1A 5CRDA 4EUYA 1F37A 1AAZA 1R7HA 2C80A 3NOFA 4HZ2A 5ECRB 4PQIA 5G2ZA 1M3IA 1Z3EA 1ABAA 4ZL8A 4ECJA 4MA9A 5G31A 5IMVA 3LFLA 2H1GA 1OE8A 5E4WA 2HRKA 5ELGA 4QQ7A 3APQA 5FT3A 17GSA 4NV2A 2A2PA 5KN3A 2L57A 2XPEA 2VCVA 4TRXA 1Z7PA 4WETA 2MMZA 4K9ZA 4GSSA 4GLTA 1WE0A 3TCOA 1BG5A 1A2LA 2TRCP 4NPBA 3KMNA 1EGRA 4HOJA 4F2IA 2IL3A 3KXOA 4X1UA 2FLSA 2YJ7A 3HZ4A 2DJKA 1PKZA 1MEKA 5C04A 1XBSA 1M9BA 5JWQB 1QQ2A 1ERWA 1A2JA 2YCDA 1F6MC 2FWFA 4JE1A 4ECIA 5CYYA 4TR4A 4KCEA 2DJ3A 2IWTA 5JWRB 1ZYQB 1YY7A 4LL4B 2VCZA 4IQ1A 1SL1B 1M99A 4PTSA 4EF0A 3SBCA 4OCEA 1SD9A 3GH9A 4ACSA 5GSSA 3A2VA 3KH9A 1K3YA 1O8WA 1PFOA 2HLSA 2ES7A 4IHUA 4IQAA 1DE1A 1A0FA 2X49A 2GSSA 4FYUA 1SL2B 1PX7A 2WGRA 3U5RE 4JR4A 1G6YA 4V2NA 3CSIA 2YV7A 5DALB 2C4JA 3WGXA 3GFKA 4X4JA 2G2QA 5ECMB 2AV4A 4NWYA 4FQUA 1A24A 3A2WA 3IA1A 3TRXA 2FA4A 2LUSA 1WJKA 2HZFA 3CTFA 5F07A 3DMLA 3RHBA 2WZ9A 2GLRA 3D4TA 3C73A 2IMEA 2CVDA 3RBTA 3TKSA 3L0HA 2YWOA 4H86A 1WP0A 3LJRA 4CY6A 5IMDA 2FA8A 5JWOB 4WR4A 3CMIA 4YKGA 3P90A 5F0GA 1ZCPA 2JZSA 2L4QA 5COHA 2IJYA 3ZVJD 1OC8A 4AJ8A 2B6MA 2YANA 2VAFA 2REMA 5G5FA 1SYXA 1EZKA 4O32A 1RQMA 1YF1A 3GKXA 1K0MA 2ON5A 2X4AA 1SKSB 4I8BA 1LJRA 2R0GA 4DSRA 2GZPA 3VPTA 2BTOT 3KD0A 4GXZA 3ZLPA 2FHEA 1RW1A 4IJ3A 2DIZA 2YZUA 1V2AA 3HVNA 2I3YA 4DSQA 4JEDA 1TRUA 5GSTA 3MIXA 4P3YB 3JCML 2P5RA 2KUCA 3GX0A 2XBQA 5B8BA 3GV1A 2I9HA 5CREA 2GTUA 1XW6A 2X8GA 2IMIA 2FWGA 1QFNA 1LU4A 3IK7A 1EP7A 3GKNA 4G9HA 1JZDA 5HFIA 3LORA 3BJ5A 2EC4A 2AAWA 3L4NA 5G5EA 3LSZA 3ISOA 4MF7A 3F63A 3IV4A 3LWAA 2RM6A 4O5QA 2PWJA 2H6YA 4EC0A 2FGXA 3M9JA 5D9VA 4OFMA 1TJDA 1AC1A 1VF4A 2VCXA 3PPUA 2HXKA 3GNJA 4XIHA 1GSYA 1B9XC 1PQNA 3BBYA 2VD1A 3ZMLA 1K0DA 4J56E 1X9WB 4L0WA 4YQUA 4XHMA 2X8CA 3P7XA 4KNDA 1ST9A 1S3RA 2H6XA 1PSQA 2TIRA 4IJIA 5EY6A 4WEYA 3TB2A 2FUG2 2AJQB 3WGEA 1WWJA 5DALA 4GQFA 2H0GA 4KDUA 5ENUA 2VM2A 3GX8A 5CRGA 5BRTA 1HNCA 1XW5A 1GH2A 3Q19A 1R5PA 3QPMA 2VCQA 1XG8A 2PPTA 1MDKA 5DAKA 4I2UA 1ZOFA 3DVWA 5AIXA 3GTUA 4GTUA 1SK2A 2LJKA 3A5IA 4ZL7A 1W4VA 4XS6A 4D73B 2LRTA 3FMWA 3EE2A 2JZRA 1ML6A 4MZBA 2HZEB 2OE0A 2AYTA 1FO5A 4XRDA 1TRWA 3D5JA 4KAEA 1S3CA 1VF1A 1JLWA 1PD21 4MF6A 1U6TA 2CVBA 4Z2UA 4NXIA 1UA5A 2V1MA 2V32A 3G7IA 3R2QA 1OKTA 3KTLA 4X43A 3CYNA 3GN3A 4WXTA 2CT6A 1O73A 1A8LA 1GTBA 3TGZA 3UOMA 3KTBA 2LV3A 5FHIA 3WYWA 1TTZA 2CQ9A 3F6DA 4EL1A 2MZCA 4V1Ap 2VL2A 13GSA 3ZMKA 2M72A 1YF0A 3M1GA 2OE3A 1TKDB 2OE1A 3A3TA 4OMVA 3RPPA 4ILFA 2LKUA 2R0PA 4FH8A 1JZOA 4MP4A 3NZNA 3IXRA 2YN1A 3IOSA 4KDYA 2GSTA 1J08A 5G30A 3TDGA 4TVEA 3M9KA 1XVWA 2X8HA 2IFQA 1IYIA 3LQ7A 2AUVA 3LEFA 3WT2A 3VK9A 1X9SB 4EDYA 3QAVA 3IAM2 1XCCA 4GRFA 3IDVA 4MK3A 5A5KA 4HI7A 4E8EA 4KCAA 2IIYA 2AHEA 2B5YA 3LGCA 4WR5A 5IOWA 1SKRB 5ECLB 2CAIA 1T8EB 1S3AA 3GKMA 3IE3A 3GL5A 1SK0A 2OA7A 3EYTA 5AISA 1DUGA 5IOXA 4BWQA 3O6TA 3D22A 6GSUA 4HDEA 1TP9A 1SL0B 1NW2A 4PURA 4ULXA 1EOHA 5D8IA 3TKSC 5ID2B 5B6NA 4HQZA 3DWVA 3VPQA 1AQWA 1HQOA 2H01A 3A5WA 1O81A 2HSMA 1TU7A 4WBRD 3FZ4A 1I5GA 1PN9A 4IELA 2J9HA 2NTOA 4PQHA 1SK1A 2RUEA 5JCUA 4G19A 1XIYA 1Y6EA 2R3XA 5LNKe 4CHSA 2ZCTA 1TK0B 2MMAA 1THOA 4HQSA 4MMMA 1ZMAA 4TW5A 4F9ZA 1JZRA 3MYDA 3AY8A 2HI7A 3GSSA 4V2MA 2FCHA 1URMA 3CXGA 1E2YA 4HJMA 5LD0A 2L5OA 1IYHA 4KUNA 2LSTA 3J7Yb 2H70A 5F06A 1WMJA 1YZXA 4YH2A 3CTGA 2YWMA 4HSCX 3F3QA 3KIJA 4MJAA 2UZ8A 1TI3A 4MH3A 3M8NA 1B9YC 4K1FA 4GF0A 2HZEA 3M3MA 1TDIA 3DGQA 5GAPD 3EPTA 3TKPA 4LMVA 2X64A 2E7PA 1GUHA 4I2TA 2N5FA 16GSA 3QCPA 5A4VA 2H6ZA 5EPFA 5ECKB 4N11A 5ELAA 2LJAA 3I6AA 3QR6A 3UBLA 2C0EA 1R5AA 2O7KA 2E2MA 5J3RA 4QL7A 4NHWA 3DD3A 5L71A 3GA4A 2H19A 4I6XA 2PVQA 3HZ8A 3UIWA 2VL3A 3TJFA 3EU3A 3VWWA 4MJBA 2LRCA 3PH9A 4J2FA 1B4PA 1ZGNA 3CSJA 3QFBC 2CZ2A 4NHZA 5HR1A 3LXTA 3TJGA 2J23A 3TKSE 5DBQA 2MYGA 4K8MA 2E0QA 2GT5A 1PA3A 4MPFA 4FIWA 2JL4A 18GSA 1B8XA 3FEUA 4KA0A 3H93A 3GMFA 4YAVA 2WS2A 4BL7A 2DJ1A 2M46A 4K7IA 4ECBA 4NAXA 3EMXA 1V40A 5D9WA 5G1LA 3VWXA 1HNAA 5DCHA 2WDUA 2LRNA 3PR8A 2F8FA 4HZ4A 4L5LA 3ERFA 4POLA 1V57A 2YV9A 3QDNA 3C7MA 1N2AA 5D73A 4TXOA 2H74A 2D2ZA 2LS5A 3N9JA 1ZYNA 1E6BA 2JADA 4L5OA 1MD4A 1NHOA 1KNGA 1FB0A 4MZCA 2H76A 2CZ3A 4EDZA 3EINA 4HS1A 3ME7A 5EL8A 2R0CA 1VGLA 3FYGA 5DAKB 1X5CA 2PERA 5ID2A 5D93A 3GTUB 1A2MA 4IW9A 1OKDA 4V2LA 1PKWA 4A5PA 3HY2A 4J57E 2FWHA 3F9UA 4K0NA 3UL3A 4AJ6A 9GSSA 4PGTA 2EIRA 2NDOA 4MCUA 1XOAA 1FVJA 2DBCA 1F3AA 1T4ZA 2I4AA 4EKZA 2B1KA 3QAWA 1M7TA 2DJJA 2JZTA 1UVZA 4TR3A 5B6MA 2VL2C 2HRNA 2IMFA 1CQHA 3QD9A 3IRAA 2JU5A 4EXJA 1T1VA 1M2AA 2P5QA 2B3SA 4G0IA 22GSA 4JR6A 3CQFA 1SENA 1N8JA 4RI6A 1XWGA 3R3EA 4G0KA 5A4UA 5AN1A 4L0UA 3E3EA 3FW2A 5J9BA 3TJKA 2IMDA 2GT6A 3I9V2 3GSTA 5DDLA 4BWSA 2P31A 4MNNA 4BA7A 2VLVA 3GL3A 4CY8A 2GGTA 2OBKA 5IM9A 4WBJA 4YQVA 4KSMA 4PNGA 5ECQB 1QUWA 4Q5NA 1GNEA 1PRXA 3FK8A 2IFQB 2YWIA 4FO5A 4GSTA 4N30A 3HHVA 3N5OA 3DIEA 2M80A 1T00A 5FWGA 3KM6A 5ECSA 4PXOA 2A4HA 1GL8A 2VO4A 1ERTA 2AB6A 1M3JA 4N0ZA 5IQYA 4XTSA 2EIOA 3FRCA 2RIIA 1C72A 2G0FA 5J5NA 4ZB6A 5J4UA 4I5QA 1G7EA 3MAKA 3I43A 2H8LA 1GUKA 5IMZA 4JRRA 1TRVA 1TU8A 4POKA 1USBA 20GSA 4YAPA 2JACA 2R37A 5B8AA 4XCSA 4ML1A 1JLVA 4EIPA 4PNFA 5DQYA 1FG4A 5C00A 3RDWA 1NM3A 4HU7A 4PX1A 4HU9A 3VURA 1ERVA 4WKWA 2HYXA 10GSA 2V2GA 4F03A 1PL1A 5IPHA 2RUFA 3US3A 3S9FA 2DIYA 4FYBA 1GWCA 3O3TA 1GSFA 2TRXA 4XS1A 3ZIJA 4XS4A 4BVYB 2KOKA 3GIXA 3RPNA 5E59A 1AW9A 1H4OA 2MBTA 4F0BA 4E8HA 11GSA 3FR3A 3IK9A 4BIKA 2H71A 2DJ0A 2WULA 1QK8A 3LW9A 2B7JA 4Q5FA 4ZBBA 5IMAA 4V1Ag 1HYUA 5AIVA 5D9TA 4MF5A 4IP6A 1Z6NA 5H5QA 4OFTA 4RQXA 3P8WA 2BMXA 5IO2A 1SKWB 3UBKA 5IMFA 1GTUA 3DXBA 1G0TA 2YOIA 3VLNA 2GDRA 3FR9A 6GSTA 3TKQA 2OBIA 3FR6A 1BEDA 1M2BA 2WCIA 1TRSA 4PQ1A 1ILOA 4MABA 3KH7A 4ZBDA 1OC9B 4K5SA 3FZ9A 5KN2A 3EVIA 1B48A 2O8VB 3L78A 1SD8A 1AIUA 1FAAA 1F2EA 1AQVA 3FZAA 4HJ2A 1BQ7A 1FVKA 4I97A 5HQPA 2Z9SA 2L5LA 3OR5A 5A4WA 3VWUA 4L8EA 3W8JA 3TOTA 3UVTA 3ZRDA 5JCGA 2NBSA 1YJ6A 1A23A 1X5EA 5DJMA 2N5AA 1GUMA 1SJIA 3M0FA 4OWYA 4BL7B 3ERGA 5AGYA 4ZBAA 5DJLA 2X99A 4MPGA 3VWVA 4O5RA 1K0OA 2O85A 1X9MB 5IPGA 1R26A 1K0NA 4DSSA 1DBYA 2C3QA 4K2XA 4TR0A 3KP9A 4TXOB 2QKEA 2KP2A 1OAZA 2OADA 12GSA 4Q5QA 2VD0A 3DEXA 1EV4A 3W8SA 3D4MA 3Q74A 3LG6A 1I9DA 4JU5A 1EEJA 2KHPA 2DKIA 3FZ5A 2JSYA 1K0CA 3IC4A 2N5BA 1EOGA 2H66A 2E2GA 1O7UA 2GQMA 3H4KA 2YWNA 3D21A 2HSYA 3Q6OA 2RM5A 3FY7A 2EIQA 5J9CA 3CBUA 2LQOA 2K18A 3EURA 3F4RA 1GSSA 1OYJA 4ZILA 3EC3A 1XW9A 1A0RP 3QOUA 1BYEA 4KW6A 2LTKA 2C0DA 2LQQA 2QSIA 2GSQA 2V6OA 2H75A 2YZHA 1XWAA 3IHGA 4GCIA 4Z2TA 4BVYA 1Q4JA 5IMCA 3TRQA 4MH2A 4WF5A 2PVOC 3MDKA 2R5GA 2FNOA 5ECIB 1WOUA 3TKRA 1Z6MA 4LLRA 1HNBA 2LNTA 4K0GA 1H75A 1AUCA 1M0UA 1SYRA 3UEMA 3ZIVA 1KTEA 4ICYA 4ZIJA 6GSVA 2XC2A 1GP1A 3HJOA 1CQGA 4NMUA 1YKAA 5F05A 3GUSA 2B7KA 3TUEA 1XVQA 2I81A 3GKKA 4ISDA 2R6KA 4N10A 3HVSA 5CRWA 3DRNA 1K3OA 2ZUPA 1LBKA 3F4SA 3LXZA 14GSA 1Q98A 2LNSA 2V6KA 3HDCA 1T7PB 5D96A 1NHYA 4TN8A 4AF2A 3ZFLA 3DKSA 2HT9A 3ZITA 2HSHA 1TW9A 3L9UA 1XXUA 1ZYEA 2H0IA 2H72A 1BJXA 1OC9A 4TR1A 4KE3A 1F9MA 4ZB9A 4X0XA 5KOWA 3H8QA 5H5SA 1GRXA 1QXHA 2L4CA 1K3LA 3QAGA 3L9VA 1YDKA 3GH6A 4KX4A 2DMLA 4O92A 4Q5RA 5HFKA 5ECPB 4DVCA 2JSZA 1OC3A 5JCWA 2PMTA 4CDOA 4CW9A 2QA2A 3Q18A 4F0CA 2ZNMA 3KP8A 1PN0A 4N0VA 4WF4A 1VF3A 3KEBA 1GLPA 1U88A 1XFLA 3DVXA 5DQSA 4EO3A 3E9JB 1UC7A 1GTIA 5B7CA 3MSZA 4XRAA 3UARA 3GYKA 3UAPA 1NSWA 3F0IA 4TXVA 4IS0A 3VI5A 1YKCA 1ACVA 3PGTA 1JHBA 2L6CA 4RI7A 5H5RA 3EU4A 4LA1A 3UVHA 1AQXA 1A8YA 5F8BA 4G2EA 2IMKA 3QFAC 4XS4B 3RAZA 3F4TA 4ZXGA 2RLIA 1ZZYA 4K7OA 2VUPA 3MWHA 19GSA 3IHQA 2C0GA 2C8UA 4MZWA 3HYPA 3NIVA 2K8SA 3P2AA 2QA1A 1YQ1A 5LCZA 4KH7A 3BCIA 2PGTA 2PUKC 1SJ6A 4HUAA 3LYPA 3KCMA 3IAS2 2GVPA 4IN0A 2F3MA 1VRSD 1FW1A 4LMWA 1K0AA 1FOHA 1ON4A 2R2JA 5CNWA 2CX3A 2VL9A 3C1RA 2VLTA 3DYRA 3C1SA 4ZL9A 2MBSA
chains in the Genus database with same CATH topology
5EVOA 4FYCA 2QGVA 2FD3A 1R4WA 1GSQA 3HA9A 4IGJA 5DVBA 2GQKA 2DSAA 1V9WA 3A2XA 4EIQA 1MDJA 4KB3A 2VLUA 1U3IA 3BD2A 5ECHB 3IC8A 2DC5A 2PBJA 3APOA 3HJPA 4G10A 1WPIA 2IN3A 1GSEA 2CVKA 3IR4A 2CA8A 1YEPA 4BVXB 2FWEA 2O89A 3LYKA 5HFGA 3APSA 2VCWA 4DEJA 1TOFA 3C71A 3H1NA 2WRTA 3HD5A 3KGKA 3GURA 1ERUA 4Z7XA 5ABRA 2LJRA 1KBNA 3EMPA 1BX9A 2H1BA 2H73A 3WT1A 2L6DA 4RUVA 2KP1A 2WFCA 2GQLA 1THXA 4KDXA 1J9BA 4DSSB 2OACA 3BOAA 4OFNA 2DJ2A 1YEXA 3I69A 2VOCA 1EGOA 2LEGA 1TK5B 4OO4A 2DMMA 2A4VA 4LL1B 1Z7RA 1FHEA 1EWXA 1ZL9A 1VF2A 1JZWA 3QMXA 1M2DA 1Y25A 2KLXA 2VIMA 3D0ZA 4ML6A 3HVVA 5GAND 1RK4A 1T3BA 2HRFA 3TRPA 3KJYA 4K5RA 1QMVA 1XPVA 4MDCA 4AGSA 5D9XA 2C0FA 3FHKA 3HXSA 5HR0A 4OCFA 2F9SA 5HR3A 4OO5A 5KN1A 4KF9A 5J41A 2BJXA 5INYA 2DKHA 1PL2A 1TK8B 1FB6A 1HD2A 5CRHA 3UMAA 4JZQA 2PN8A 2V41A 2YP6A 5KEJA 1PGTA 2F8AA 3EWLA 1OE7A 1Z9HA 3ZZXA 2F51A 2IPAA 3K8NA 3J7Yk 2C3NA 1PX6A 1BAYA 4GSNA 1DSBA 6GSSA 5CP1A 4PUFC 4MLYA 2DLXA 2ON7A 4TKYA 2ALBA 3HKRA 3O76A 4POBA 1EV9A 4RQRA 4K7NA 2VCTA 5CAXA 4K2DA 3ZL5A 5ECNB 1UN2A 1GTAA 1GSDA 1XWBA 3D6IA 4IKHA 3TJJA 3ZREA 2P0GA 4HEA2 3HJMA 6GSWA 2VM1A 3ZTLA 3CRUA 3ME8A 1MDIA 3VFIA 3G7JA 1K0BA 1DE2A 1GSUA 2H1DA 3ERWA 5ECOB 2CAQA 4TR1B 2A2SA 3G7YA 1MD3A 3GRXA 5KN0A 1GLQA 1WIKA 2CV4A 4BVXA 2XHFA 3V1WA 2YNXA 2L59A 1XWKA 4GQCA 3ZYWA 3CRTA 2B5XA 3TJBA 7GSSA 1V98A 2H1AA 1V58A 2YJHA 3G9BA 3TOUA 4EE0A 4EVMA 1GNWA 2PU9C 3C8EA 4AJ7A 2K6VA 5DCGA 1FOVA 2A2RA 2HFDA 4O7HA 3GHAA 1XOBA 6GSYA 3WGDA 3IPZA 1EEMA 3BCKA 1ZYPA 2HE3A 2XBIA 5KOXA 5BMUA 1U87A 2GSRA 3PINA 2QC7A 3SWLA 1U3AA 4F82A 3L9SA 5GZZB 4QL9A 3ZVJA 2B1LA 6GSXA 2H0HA 1PMTA 1X5DA 1X0RA 4ZB8A 3FKFA 1AXDA 1JFUA 1OVNA 3H79A 1SJZA 1T4YA 1G7OA 4BPYA 1XZOA 4G0LA 3WD6A 3UJ1A 1W89A 1M9AA 4PUAA 4MJEA 1F3BA 1G6WA 3F6FA 3F3RA 1GULA 3RHCA 2FY6A 1QGVA 3F8UA 4YQMA 1TXXA 2GZYA 3HVXA 1S3DA 2HNLA 2O87A 3CSHA 2XPDA 1J0FA 4K6XA 4MJCA 4USSA 4O5UA 2K8VA 5G1KA 2WJUA 2MMOA 2GS3A 2NPBA 3ZFBA 5IIZA 2NVLA 3KMOA 1B4QA 1XWCA 5IO0A 2HRAA 3E0UA 4ID0A 1Z5YE 3W6GA 3MNGA 2B5EA 1EP8A 1SU9A 8GSSA 2H30A 3KZQA 1WRYA 4TOPA 3VI7A 2I1UA 1O85A 4OD7A 4JBBA 4IBPA 4IP1A 4ECCA 4IVFA 2OJLA 2GZZA 2WB9A 2K9FA 1O8XA 2CX4A 3ED3A 5CO3A 4NV5A 2C1YA 2R4VA 5HR2A 1O6JA 3IBHA 1KEBA 4KSOA 4GWRA 3U6VA 4POMA 2MMNA 4KGIA 4YKFA 4D73A 3HCZA 2C3TA 2YPMA 4Z2RA 2OKAA 1MTCA 1TI1A 5CRDA 4EUYA 1F37A 1AAZA 1R7HA 2C80A 3NOFA 4HZ2A 5ECRB 4PQIA 5G2ZA 1Z3EA 1ABAA 4ZL8A 4ECJA 4MA9A 5G31A 5IMVA 3LFLA 2H1GA 1OE8A 5E4WA 2HRKA 5ELGA 4QQ7A 3APQA 5FT3A 17GSA 4NV2A 2A2PA 5KN3A 2L57A 2XPEA 2VCVA 4TRXA 1Z7PA 4WETA 2MMZA 4K9ZA 4GSSA 4GLTA 1WE0A 3TCOA 1BG5A 1A2LA 2TRCP 4NPBA 3KMNA 1EGRA 4HOJA 4F2IA 2IL3A 3KXOA 4X1UA 2FLSA 2YJ7A 3HZ4A 2DJKA 1PKZA 1MEKA 5C04A 1XBSA 1M9BA 5JWQB 1QQ2A 1ERWA 1A2JA 2YCDA 1F6MC 2FWFA 4JE1A 4ECIA 5CYYA 4TR4A 4KCEA 2DJ3A 2IWTA 5JWRB 1ZYQB 1YY7A 4LL4B 2VCZA 4IQ1A 1SL1B 1M99A 4PTSA 4EF0A 3SBCA 4OCEA 1SD9A 3GH9A 4ACSA 5GSSA 3A2VA 3KH9A 1K3YA 1O8WA 2HLSA 2ES7A 4IHUA 4IQAA 1DE1A 1A0FA 2X49A 2GSSA 4FYUA 1SL2B 1PX7A 2WGRA 3U5RE 4JR4A 1G6YA 4V2NA 3CSIA 2YV7A 5DALB 2C4JA 3WGXA 3GFKA 4X4JA 2G2QA 5ECMB 2AV4A 4NWYA 4FQUA 1A24A 3A2WA 3IA1A 3TRXA 2FA4A 2LUSA 1WJKA 2HZFA 3CTFA 5F07A 3DMLA 3RHBA 2WZ9A 2GLRA 3D4TA 3C73A 2IMEA 2CVDA 3RBTA 3TKSA 3L0HA 2YWOA 4H86A 1WP0A 3LJRA 4CY6A 5IMDA 2FA8A 5JWOB 4WR4A 3CMIA 4YKGA 3P90A 5F0GA 1ZCPA 2JZSA 2L4QA 5COHA 2IJYA 3ZVJD 1OC8A 4AJ8A 2B6MA 2YANA 2VAFA 2REMA 5G5FA 1SYXA 1EZKA 4O32A 1RQMA 1YF1A 3GKXA 1K0MA 2ON5A 2X4AA 1SKSB 4I8BA 1LJRA 2R0GA 4DSRA 2GZPA 3VPTA 2BTOT 3KD0A 4GXZA 3ZLPA 2FHEA 1RW1A 4IJ3A 2DIZA 2YZUA 1V2AA 2I3YA 4DSQA 4JEDA 1TRUA 5GSTA 3MIXA 4P3YB 3JCML 2P5RA 2KUCA 3GX0A 2XBQA 5B8BA 3GV1A 2I9HA 5CREA 2GTUA 1XW6A 2X8GA 2IMIA 2FWGA 1QFNA 1LU4A 3IK7A 1EP7A 3GKNA 4G9HA 1JZDA 5HFIA 3LORA 3BJ5A 2EC4A 2AAWA 3L4NA 5G5EA 3LSZA 3ISOA 4MF7A 3F63A 3IV4A 3LWAA 2RM6A 4O5QA 2PWJA 2H6YA 4EC0A 2FGXA 3M9JA 5D9VA 4OFMA 1TJDA 1AC1A 1VF4A 2VCXA 3PPUA 2HXKA 3GNJA 4XIHA 1GSYA 1B9XC 1PQNA 3BBYA 2VD1A 3ZMLA 1K0DA 4J56E 1X9WB 4L0WA 4YQUA 4XHMA 2X8CA 3P7XA 4KNDA 1ST9A 2H6XA 1PSQA 2TIRA 4IJIA 5EY6A 4WEYA 3TB2A 2FUG2 2AJQB 3WGEA 1WWJA 5DALA 4GQFA 2H0GA 4KDUA 5ENUA 2VM2A 3GX8A 5CRGA 5BRTA 1HNCA 1XW5A 1GH2A 3Q19A 1R5PA 3QPMA 2VCQA 2PPTA 1MDKA 5DAKA 4I2UA 1ZOFA 3DVWA 5AIXA 3GTUA 4GTUA 1SK2A 2LJKA 3A5IA 4ZL7A 1W4VA 4XS6A 4D73B 2LRTA 3FMWA 3EE2A 2JZRA 1ML6A 4MZBA 2HZEB 2OE0A 2AYTA 1FO5A 4XRDA 1TRWA 3D5JA 4KAEA 1S3CA 1VF1A 1JLWA 1PD21 4MF6A 1U6TA 2CVBA 4Z2UA 4NXIA 1UA5A 2V1MA 2V32A 3G7IA 3R2QA 1OKTA 3KTLA 4X43A 3CYNA 3GN3A 4WXTA 2CT6A 1O73A 1A8LA 1GTBA 3TGZA 3UOMA 3KTBA 2LV3A 5FHIA 3WYWA 1TTZA 2CQ9A 3F6DA 4EL1A 2MZCA 4V1Ap 2VL2A 13GSA 3ZMKA 2M72A 1YF0A 3M1GA 2OE3A 1TKDB 2OE1A 3A3TA 4OMVA 3RPPA 4ILFA 2LKUA 2R0PA 4FH8A 1JZOA 4MP4A 3NZNA 3IXRA 2YN1A 3IOSA 4KDYA 2GSTA 1J08A 5G30A 3TDGA 4TVEA 3M9KA 1XVWA 2X8HA 2IFQA 1IYIA 3LQ7A 2AUVA 3LEFA 3WT2A 3VK9A 1X9SB 4EDYA 3QAVA 3IAM2 1XCCA 4GRFA 3IDVA 4MK3A 5A5KA 4HI7A 4E8EA 4KCAA 2IIYA 2AHEA 2B5YA 3LGCA 4WR5A 5IOWA 1SKRB 5ECLB 2CAIA 1T8EB 1S3AA 3GKMA 3IE3A 3GL5A 1SK0A 2OA7A 3EYTA 5AISA 1DUGA 5IOXA 4BWQA 3O6TA 3D22A 6GSUA 4HDEA 1TP9A 1SL0B 1NW2A 4PURA 4ULXA 1EOHA 5D8IA 3TKSC 5ID2B 5B6NA 4HQZA 3DWVA 3VPQA 1AQWA 1HQOA 2H01A 3A5WA 1O81A 2HSMA 1TU7A 4WBRD 3FZ4A 1I5GA 1PN9A 4IELA 2J9HA 2NTOA 4PQHA 1SK1A 2RUEA 5JCUA 4G19A 1XIYA 1Y6EA 2R3XA 5LNKe 4CHSA 2ZCTA 1TK0B 2MMAA 1THOA 4HQSA 4MMMA 1ZMAA 4TW5A 4F9ZA 1JZRA 3MYDA 3AY8A 2HI7A 3GSSA 4V2MA 2FCHA 1URMA 3CXGA 1E2YA 4HJMA 5LD0A 2L5OA 1IYHA 4KUNA 2LSTA 3J7Yb 2H70A 5F06A 1WMJA 1YZXA 4YH2A 3CTGA 2YWMA 4MJAA 3F3QA 3KIJA 2UZ8A 1TI3A 4MH3A 3M8NA 1B9YC 4K1FA 4GF0A 2HZEA 3M3MA 1TDIA 3DGQA 5GAPD 3EPTA 3TKPA 4LMVA 2X64A 2E7PA 1GUHA 4I2TA 2N5FA 16GSA 3QCPA 5A4VA 2H6ZA 5EPFA 5ECKB 4N11A 5ELAA 2LJAA 3I6AA 3QR6A 3UBLA 2C0EA 1R5AA 2O7KA 2E2MA 5J3RA 4QL7A 4NHWA 3DD3A 5L71A 3GA4A 2H19A 4I6XA 2PVQA 3HZ8A 3UIWA 2VL3A 3TJFA 3EU3A 3VWWA 4MJBA 2LRCA 3PH9A 4J2FA 1B4PA 1ZGNA 3CSJA 3QFBC 2CZ2A 4NHZA 5HR1A 3LXTA 3TJGA 2J23A 3TKSE 5DBQA 2MYGA 4K8MA 2E0QA 2GT5A 1PA3A 4MPFA 4FIWA 2JL4A 18GSA 1B8XA 3FEUA 4KA0A 3H93A 3GMFA 4YAVA 2WS2A 4BL7A 2DJ1A 2M46A 4K7IA 4ECBA 4NAXA 3EMXA 1V40A 5D9WA 5G1LA 3VWXA 1HNAA 5DCHA 2WDUA 2LRNA 3PR8A 2F8FA 4HZ4A 4L5LA 3ERFA 4POLA 1V57A 2YV9A 3QDNA 3C7MA 1N2AA 5D73A 4TXOA 2H74A 2D2ZA 2LS5A 3N9JA 1ZYNA 1E6BA 2JADA 4L5OA 1MD4A 1NHOA 1KNGA 1FB0A 4MZCA 2H76A 2CZ3A 4EDZA 3EINA 4HS1A 3ME7A 5EL8A 2R0CA 1VGLA 3FYGA 5DAKB 1X5CA 2PERA 5ID2A 5D93A 3GTUB 1A2MA 4IW9A 1OKDA 4V2LA 1PKWA 4A5PA 3HY2A 4J57E 2FWHA 3F9UA 4K0NA 3UL3A 4AJ6A 9GSSA 4PGTA 2EIRA 2NDOA 4MCUA 1XOAA 1FVJA 2DBCA 1F3AA 1T4ZA 2I4AA 4EKZA 2B1KA 3QAWA 1M7TA 2DJJA 2JZTA 1UVZA 4TR3A 5B6MA 2VL2C 2HRNA 2IMFA 1CQHA 3QD9A 3IRAA 2JU5A 4EXJA 1T1VA 1M2AA 2P5QA 2B3SA 4G0IA 22GSA 4JR6A 1SENA 1N8JA 4RI6A 1XWGA 3R3EA 4G0KA 5A4UA 5AN1A 4L0UA 3E3EA 3FW2A 5J9BA 3TJKA 2IMDA 2GT6A 3I9V2 3GSTA 5DDLA 4BWSA 2P31A 4MNNA 4BA7A 2VLVA 3GL3A 4CY8A 2GGTA 2OBKA 5IM9A 4WBJA 4YQVA 4KSMA 4PNGA 5ECQB 1QUWA 4Q5NA 1GNEA 1PRXA 3FK8A 2IFQB 2YWIA 4FO5A 4GSTA 4N30A 3HHVA 3N5OA 3DIEA 2M80A 1T00A 5FWGA 3KM6A 5ECSA 4PXOA 2A4HA 1GL8A 2VO4A 1ERTA 2AB6A 4N0ZA 5IQYA 4XTSA 2EIOA 3FRCA 2RIIA 1C72A 2G0FA 5J5NA 4ZB6A 5J4UA 4I5QA 1G7EA 3MAKA 3I43A 2H8LA 1GUKA 5IMZA 4JRRA 1TRVA 1TU8A 4POKA 1USBA 20GSA 4YAPA 2JACA 2R37A 5B8AA 4XCSA 4ML1A 1JLVA 4EIPA 4PNFA 5DQYA 1FG4A 5C00A 3RDWA 1NM3A 4HU7A 4PX1A 4HU9A 3VURA 1ERVA 4WKWA 2HYXA 10GSA 2V2GA 4F03A 1PL1A 5IPHA 2RUFA 3US3A 3S9FA 2DIYA 4FYBA 1GWCA 3O3TA 1GSFA 2TRXA 4XS1A 3ZIJA 4XS4A 4BVYB 2KOKA 3GIXA 3RPNA 5E59A 1AW9A 1H4OA 2MBTA 4F0BA 4E8HA 11GSA 3FR3A 3IK9A 2H71A 2DJ0A 2WULA 1QK8A 3LW9A 2B7JA 4Q5FA 4ZBBA 5IMAA 4V1Ag 1HYUA 5AIVA 5D9TA 4MF5A 4IP6A 1Z6NA 5H5QA 4OFTA 4RQXA 3P8WA 2BMXA 5IO2A 1SKWB 3UBKA 5IMFA 1GTUA 3DXBA 1G0TA 2YOIA 3VLNA 2GDRA 3FR9A 6GSTA 3TKQA 2OBIA 3FR6A 1BEDA 1M2BA 2WCIA 1TRSA 4PQ1A 1ILOA 4MABA 3KH7A 4ZBDA 1OC9B 4K5SA 3FZ9A 5KN2A 3EVIA 1B48A 2O8VB 3L78A 1SD8A 1AIUA 1FAAA 1F2EA 1AQVA 3FZAA 4HJ2A 1BQ7A 1FVKA 4I97A 5HQPA 2Z9SA 2L5LA 3OR5A 5A4WA 3VWUA 4L8EA 3W8JA 3TOTA 3UVTA 3ZRDA 5JCGA 2NBSA 1YJ6A 1A23A 1X5EA 5DJMA 2N5AA 1GUMA 1SJIA 3M0FA 4OWYA 4BL7B 3ERGA 5AGYA 4ZBAA 5DJLA 2X99A 4MPGA 3VWVA 4O5RA 1K0OA 2O85A 1X9MB 5IPGA 1R26A 1K0NA 4DSSA 1DBYA 2C3QA 4K2XA 4TR0A 3KP9A 4TXOB 2QKEA 2KP2A 1OAZA 2OADA 12GSA 4Q5QA 2VD0A 3DEXA 1EV4A 3W8SA 3D4MA 3Q74A 3LG6A 1I9DA 4JU5A 1EEJA 2KHPA 2DKIA 3FZ5A 2JSYA 1K0CA 3IC4A 2N5BA 1EOGA 2H66A 2E2GA 1O7UA 2GQMA 3H4KA 2YWNA 3D21A 2HSYA 3Q6OA 2RM5A 3FY7A 2EIQA 5J9CA 3CBUA 2LQOA 2K18A 3EURA 3F4RA 1GSSA 1OYJA 4ZILA 3EC3A 1XW9A 1A0RP 3QOUA 1BYEA 4KW6A 2LTKA 2C0DA 2LQQA 2QSIA 2GSQA 2V6OA 2H75A 2YZHA 1XWAA 3IHGA 4GCIA 4Z2TA 4BVYA 1Q4JA 5IMCA 3TRQA 4MH2A 4WF5A 2PVOC 3MDKA 2R5GA 2FNOA 5ECIB 1WOUA 3TKRA 1Z6MA 4LLRA 1HNBA 2LNTA 4K0GA 1H75A 1AUCA 1M0UA 1SYRA 3UEMA 3ZIVA 1KTEA 4ICYA 4ZIJA 6GSVA 2XC2A 1GP1A 3HJOA 1CQGA 4NMUA 1YKAA 5F05A 3GUSA 2B7KA 3TUEA 1XVQA 2I81A 3GKKA 4ISDA 2R6KA 4N10A 3HVSA 5CRWA 3DRNA 1K3OA 2ZUPA 1LBKA 3F4SA 3LXZA 14GSA 1Q98A 2LNSA 2V6KA 3HDCA 1T7PB 5D96A 1NHYA 4TN8A 4AF2A 3ZFLA 3DKSA 2HT9A 3ZITA 2HSHA 1TW9A 3L9UA 1XXUA 1ZYEA 2H0IA 2H72A 1BJXA 1OC9A 4TR1A 4KE3A 1F9MA 4ZB9A 4X0XA 5KOWA 3H8QA 5H5SA 1GRXA 1QXHA 2L4CA 1K3LA 3QAGA 3L9VA 1YDKA 3GH6A 4KX4A 2DMLA 4O92A 4Q5RA 5HFKA 5ECPB 4DVCA 2JSZA 1OC3A 5JCWA 2PMTA 4CDOA 4CW9A 2QA2A 3Q18A 4F0CA 2ZNMA 3KP8A 1PN0A 4N0VA 4WF4A 1VF3A 3KEBA 1GLPA 1U88A 1XFLA 3DVXA 5DQSA 4EO3A 3E9JB 1UC7A 1GTIA 5B7CA 3MSZA 4XRAA 3UARA 3GYKA 3UAPA 1NSWA 3F0IA 4TXVA 4IS0A 3VI5A 1YKCA 1ACVA 3PGTA 1JHBA 2L6CA 4RI7A 5H5RA 3EU4A 4LA1A 3UVHA 1AQXA 1A8YA 5F8BA 4G2EA 2IMKA 3QFAC 4XS4B 3RAZA 3F4TA 4ZXGA 2RLIA 1ZZYA 4K7OA 2VUPA 3MWHA 19GSA 3IHQA 2C0GA 2C8UA 4MZWA 3HYPA 3NIVA 2K8SA 3P2AA 2QA1A 1YQ1A 5LCZA 4KH7A 3BCIA 2PGTA 2PUKC 1SJ6A 4HUAA 3LYPA 3KCMA 3IAS2 2GVPA 4IN0A 2F3MA 1VRSD 1FW1A 4LMWA 1K0AA 1FOHA 1ON4A 2R2JA 5CNWA 2CX3A 2VL9A 3C1RA 2VLTA 3DYRA 3C1SA 4ZL9A 2MBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVO A;  4FYC A;  2QGV A;  2FD3 A;  1R4W A;  1GSQ A;  3HA9 A;  4IGJ A;  5DVB A;  2GQK A;  2DSA A;  1V9W A;  3A2X A;  1MDJ A;  4KB3 A;  2VLU A;  1U3I A;  3BD2 A;  5ECH B;  2DC5 A;  2PBJ A;  3APO A;  3HJP A;  4G10 A;  1WPI A;  2IN3 A;  1GSE A;  2CVK A;  3IR4 A;  2CA8 A;  1YEP A;  2FWE A;  2O89 A;  3LYK A;  5HFG A;  3APS A;  2VCW A;  4DEJ A;  1TOF A;  3C71 A;  3H1N A;  2WRT A;  3HD5 A;  3KGK A;  3GUR A;  1ERU A;  4Z7X A;  5ABR A;  2LJR A;  1KBN A;  3EMP A;  1BX9 A;  2H1B A;  2H73 A;  3WT1 A;  2L6D A;  4RUV A;  2KP1 A;  2WFC A;  2GQL A;  1THX A;  4KDX A;  1J9B A;  4DSS B;  2OAC A;  3BOA A;  4OFN A;  2DJ2 A;  1YEX A;  3I69 A;  2VOC A;  1EGO A;  2LEG A;  1TK5 B;  4OO4 A;  2DMM A;  2A4V A;  4LL1 B;  1Z7R A;  1FHE A;  1EWX A;  1ZL9 A;  1VF2 A;  1JZW A;  3QMX A;  1M2D A;  1Y25 A;  2KLX A;  2VIM A;  3D0Z A;  4ML6 A;  3HVV A;  5GAN D;  1RK4 A;  1T3B A;  2HRF A;  3TRP A;  3KJY A;  1QMV A;  1XPV A;  4MDC A;  4AGS A;  5D9X A;  2C0F A;  3FHK A;  3HXS A;  5HR0 A;  4OCF A;  2F9S A;  5HR3 A;  4OO5 A;  5KN1 A;  5J41 A;  2BJX A;  5INY A;  1PL2 A;  1TK8 B;  1FB6 A;  1HD2 A;  5CRH A;  3UMA A;  4JZQ A;  2PN8 A;  2V41 A;  2YP6 A;  5KEJ A;  1PGT A;  2F8A A;  3EWL A;  1OE7 A;  1Z9H A;  3ZZX A;  2F51 A;  2IPA A;  3K8N A;  3J7Y k;  2C3N A;  1PX6 A;  1BAY A;  4GSN A;  1DSB A;  6GSS A;  5CP1 A;  4PUF C;  4MLY A;  2DLX A;  2ON7 A;  4TKY A;  2ALB A;  3HKR A;  3O76 A;  4POB A;  1EV9 A;  4RQR A;  4K7N A;  2VCT A;  5CAX A;  4K2D A;  3ZL5 A;  5ECN B;  1UN2 A;  1GTA A;  1GSD A;  1XWB A;  3D6I A;  4IKH A;  3TJJ A;  3ZRE A;  2P0G A;  4HEA 2;  3HJM A;  6GSW A;  2VM1 A;  3ZTL A;  3CRU A;  3ME8 A;  1MDI A;  3VFI A;  3G7J A;  1K0B A;  1DE2 A;  1GSU A;  2H1D A;  3ERW A;  5ECO B;  2CAQ A;  4TR1 B;  2A2S A;  3G7Y A;  1MD3 A;  3GRX A;  5KN0 A;  1GLQ A;  1WIK A;  2CV4 A;  4BVX A;  2XHF A;  3V1W A;  2YNX A;  2L59 A;  1XWK A;  4GQC A;  3ZYW A;  3CRT A;  2B5X A;  3TJB A;  7GSS A;  1V98 A;  2H1A A;  1V58 A;  2YJH A;  3G9B A;  3TOU A;  4EE0 A;  4EVM A;  1GNW A;  2PU9 C;  3C8E A;  4AJ7 A;  2K6V A;  5DCG A;  1FOV A;  2A2R A;  2HFD A;  4O7H A;  3GHA A;  1XOB A;  6GSY A;  3WGD A;  3IPZ A;  1EEM A;  3BCK A;  2HE3 A;  2XBI A;  1U87 A;  2GSR A;  3PIN A;  2QC7 A;  3SWL A;  1U3A A;  4F82 A;  3L9S A;  5GZZ B;  4QL9 A;  3ZVJ A;  2B1L A;  6GSX A;  2H0H A;  1PMT A;  1X5D A;  1X0R A;  4ZB8 A;  3FKF A;  1AXD A;  1JFU A;  1OVN A;  3H79 A;  1SJZ A;  1T4Y A;  1G7O A;  4BPY A;  1XZO A;  3WD6 A;  3UJ1 A;  1W89 A;  1M9A A;  4PUA A;  4MJE A;  1F3B A;  1G6W A;  3F6F A;  3F3R A;  1GUL A;  3RHC A;  2FY6 A;  1QGV A;  3F8U A;  4YQM A;  1TXX A;  2GZY A;  3HVX A;  1S3D A;  2HNL A;  2O87 A;  3CSH A;  2XPD A;  1J0F A;  4K6X A;  4MJC A;  2K8V A;  5G1K A;  2WJU A;  2MMO A;  2GS3 A;  2NPB A;  3ZFB A;  5IIZ A;  2NVL A;  3KMO A;  1B4Q A;  1XWC A;  5IO0 A;  3E0U A;  4ID0 A;  1Z5Y E;  3W6G A;  3MNG A;  2B5E A;  1EP8 A;  1SU9 A;  8GSS A;  2H30 A;  3KZQ A;  1WRY A;  4TOP A;  3VI7 A;  2I1U A;  1O85 A;  4OD7 A;  4JBB A;  4IBP A;  4IP1 A;  4ECC A;  4IVF A;  2OJL A;  2GZZ A;  2WB9 A;  2K9F A;  1O8X A;  2CX4 A;  3ED3 A;  5CO3 A;  4NV5 A;  2C1Y A;  2R4V A;  5HR2 A;  1O6J A;  3IBH A;  1KEB A;  4KSO A;  4GWR A;  3U6V A;  4POM A;  2MMN A;  4KGI A;  4D73 A;  3HCZ A;  2C3T A;  2YPM A;  2OKA A;  1MTC A;  1TI1 A;  5CRD A;  4EUY A;  1F37 A;  1AAZ A;  1R7H A;  2C80 A;  3NOF A;  4HZ2 A;  5ECR B;  4PQI A;  5G2Z A;  1Z3E A;  1ABA A;  4ZL8 A;  4ECJ A;  4MA9 A;  5G31 A;  5IMV A;  3LFL A;  2H1G A;  1OE8 A;  5E4W A;  5ELG A;  4QQ7 A;  3APQ A;  5FT3 A;  17GS A;  4NV2 A;  5KN3 A;  2L57 A;  2XPE A;  2VCV A;  4TRX A;  1Z7P A;  4WET A;  2MMZ A;  4K9Z A;  4GSS A;  4GLT A;  1WE0 A;  3TCO A;  1BG5 A;  1A2L A;  2TRC P;  4NPB A;  3KMN A;  1EGR A;  4HOJ A;  4F2I A;  2IL3 A;  3KXO A;  4X1U A;  2FLS A;  2YJ7 A;  3HZ4 A;  2DJK A;  1PKZ A;  1MEK A;  5C04 A;  1XBS A;  1M9B A;  5JWQ B;  1QQ2 A;  1ERW A;  1A2J A;  2YCD A;  1F6M C;  2FWF A;  4JE1 A;  4ECI A;  5CYY A;  4TR4 A;  4KCE A;  2DJ3 A;  2IWT A;  5JWR B;  1ZYQ B;  1YY7 A;  4LL4 B;  2VCZ A;  4IQ1 A;  1SL1 B;  1M99 A;  4EF0 A;  3SBC A;  4OCE A;  1SD9 A;  3GH9 A;  4ACS A;  5GSS A;  3A2V A;  3KH9 A;  1K3Y A;  1O8W A;  2HLS A;  2ES7 A;  4IHU A;  4IQA A;  1DE1 A;  1A0F A;  2GSS A;  4FYU A;  1SL2 B;  1PX7 A;  2WGR A;  3U5R E;  4JR4 A;  1G6Y A;  4V2N A;  3CSI A;  2YV7 A;  5DAL B;  2C4J A;  3WGX A;  3GFK A;  2G2Q A;  5ECM B;  2AV4 A;  4NWY A;  1A24 A;  3A2W A;  3IA1 A;  3TRX A;  2FA4 A;  2LUS A;  1WJK A;  2HZF A;  3CTF A;  5F07 A;  3DML A;  3RHB A;  2WZ9 A;  2GLR A;  3D4T A;  3C73 A;  2IME A;  2CVD A;  3RBT A;  3TKS A;  3L0H A;  2YWO A;  4H86 A;  1WP0 A;  3LJR A;  5IMD A;  2FA8 A;  5JWO B;  4WR4 A;  3CMI A;  3P90 A;  5F0G A;  1ZCP A;  2JZS A;  2L4Q A;  5COH A;  2IJY A;  3ZVJ D;  1OC8 A;  4AJ8 A;  2B6M A;  2YAN A;  2VAF A;  2REM A;  5G5F A;  1SYX A;  1EZK A;  4O32 A;  1RQM A;  1YF1 A;  3GKX A;  1K0M A;  2ON5 A;  1SKS B;  4I8B A;  1LJR A;  4DSR A;  2GZP A;  3VPT A;  2BTO T;  3KD0 A;  4GXZ A;  3ZLP A;  2FHE A;  1RW1 A;  4IJ3 A;  2DIZ A;  2YZU A;  1V2A A;  2I3Y A;  4DSQ A;  4JED A;  1TRU A;  5GST A;  4P3Y B;  3JCM L;  2P5R A;  2KUC A;  3GX0 A;  2XBQ A;  5B8B A;  3GV1 A;  2I9H A;  5CRE A;  2GTU A;  1XW6 A;  2X8G A;  2IMI A;  2FWG A;  1QFN A;  1LU4 A;  3IK7 A;  1EP7 A;  3GKN A;  4G9H A;  1JZD A;  5HFI A;  3LOR A;  3BJ5 A;  2EC4 A;  2AAW A;  3L4N A;  5G5E A;  3LSZ A;  3ISO A;  4MF7 A;  3F63 A;  3IV4 A;  3LWA A;  2RM6 A;  2PWJ A;  2H6Y A;  4EC0 A;  2FGX A;  3M9J A;  5D9V A;  4OFM A;  1TJD A;  1AC1 A;  1VF4 A;  2VCX A;  2HXK A;  3GNJ A;  4XIH A;  1GSY A;  1B9X C;  1PQN A;  3BBY A;  2VD1 A;  3ZML A;  1K0D A;  4J56 E;  1X9W B;  4L0W A;  4YQU A;  4XHM A;  2X8C A;  3P7X A;  4KND A;  1ST9 A;  2H6X A;  1PSQ A;  2TIR A;  4IJI A;  5EY6 A;  4WEY A;  3TB2 A;  2FUG 2;  2AJQ B;  3WGE A;  5DAL A;  1WWJ A;  4GQF A;  2H0G A;  4KDU A;  5ENU A;  2VM2 A;  3GX8 A;  5CRG A;  1HNC A;  1XW5 A;  1GH2 A;  3Q19 A;  1R5P A;  3QPM A;  2VCQ A;  2PPT A;  1MDK A;  5DAK A;  4I2U A;  1ZOF A;  3DVW A;  5AIX A;  3GTU A;  4GTU A;  1SK2 A;  2LJK A;  4ZL7 A;  1W4V A;  4XS6 A;  4D73 B;  2LRT A;  3EE2 A;  2JZR A;  1ML6 A;  4MZB A;  2HZE B;  2OE0 A;  2AYT A;  1FO5 A;  4XRD A;  1TRW A;  3D5J A;  4KAE A;  1S3C A;  1VF1 A;  1JLW A;  1PD2 1;  4MF6 A;  1U6T A;  2CVB A;  4NXI A;  1UA5 A;  2V1M A;  2V32 A;  3G7I A;  3R2Q A;  1OKT A;  3KTL A;  4X43 A;  3CYN A;  3GN3 A;  4WXT A;  2CT6 A;  1O73 A;  1A8L A;  1GTB A;  3TGZ A;  3UOM A;  3KTB A;  2LV3 A;  5FHI A;  3WYW A;  1TTZ A;  2CQ9 A;  3F6D A;  4EL1 A;  2MZC A;  4V1A p;  2VL2 A;  13GS A;  3ZMK A;  2M72 A;  1YF0 A;  3M1G A;  2OE3 A;  1TKD B;  2OE1 A;  3A3T A;  4OMV A;  3RPP A;  4ILF A;  2LKU A;  4FH8 A;  1JZO A;  4MP4 A;  3NZN A;  3IXR A;  2YN1 A;  3IOS A;  4KDY A;  2GST A;  1J08 A;  5G30 A;  3TDG A;  4TVE A;  3M9K A;  1XVW A;  2X8H A;  2IFQ A;  1IYI A;  3LQ7 A;  2AUV A;  3LEF A;  3WT2 A;  3VK9 A;  1X9S B;  4EDY A;  3QAV A;  3IAM 2;  1XCC A;  4GRF A;  3IDV A;  4MK3 A;  5A5K A;  4HI7 A;  4E8E A;  4KCA A;  2IIY A;  2AHE A;  2B5Y A;  3LGC A;  4WR5 A;  5IOW A;  1SKR B;  5ECL B;  2CAI A;  1T8E B;  1S3A A;  3GKM A;  3IE3 A;  3GL5 A;  1SK0 A;  2OA7 A;  3EYT A;  5AIS A;  1DUG A;  5IOX A;  4BWQ A;  3O6T A;  3D22 A;  6GSU A;  4HDE A;  1TP9 A;  1SL0 B;  1NW2 A;  4PUR A;  4ULX A;  1EOH A;  5D8I A;  3TKS C;  5ID2 B;  5B6N A;  4HQZ A;  3DWV A;  3VPQ A;  1AQW A;  1HQO A;  2H01 A;  3A5W A;  1O81 A;  1TU7 A;  4WBR D;  3FZ4 A;  1I5G A;  1PN9 A;  4IEL A;  2J9H A;  2NTO A;  4PQH A;  1SK1 A;  2RUE A;  5JCU A;  4G19 A;  1XIY A;  1Y6E A;  2R3X A;  5LNK e;  4CHS A;  2ZCT A;  1TK0 B;  2MMA A;  1THO A;  4HQS A;  4MMM A;  1ZMA A;  4TW5 A;  4F9Z A;  1JZR A;  3AY8 A;  2HI7 A;  3GSS A;  4V2M A;  2FCH A;  1URM A;  3CXG A;  1E2Y A;  4HJM A;  5LD0 A;  2L5O A;  1IYH A;  4KUN A;  2LST A;  3J7Y b;  2H70 A;  5F06 A;  1WMJ A;  1YZX A;  4YH2 A;  3CTG A;  2YWM A;  4MJA A;  3F3Q A;  3KIJ A;  1TI3 A;  4MH3 A;  3M8N A;  1B9Y C;  4K1F A;  4GF0 A;  2HZE A;  3M3M A;  1TDI A;  3DGQ A;  5GAP D;  3TKP A;  4LMV A;  2X64 A;  2E7P A;  1GUH A;  4I2T A;  2N5F A;  16GS A;  3QCP A;  5A4V A;  2H6Z A;  5EPF A;  5ECK B;  4N11 A;  5ELA A;  2LJA A;  3I6A A;  3QR6 A;  3UBL A;  2C0E A;  1R5A A;  2O7K A;  2E2M A;  5J3R A;  4QL7 A;  4NHW A;  3DD3 A;  5L71 A;  3GA4 A;  2H19 A;  4I6X A;  2PVQ A;  3HZ8 A;  3UIW A;  2VL3 A;  3TJF A;  3EU3 A;  3VWW A;  4MJB A;  2LRC A;  3PH9 A;  4J2F A;  1B4P A;  1ZGN A;  3CSJ A;  3QFB C;  2CZ2 A;  4NHZ A;  5HR1 A;  3LXT A;  3TJG A;  2J23 A;  3TKS E;  5DBQ A;  2MYG A;  4K8M A;  2E0Q A;  2GT5 A;  1PA3 A;  4MPF A;  4FIW A;  2JL4 A;  18GS A;  1B8X A;  3FEU A;  4KA0 A;  3H93 A;  3GMF A;  4YAV A;  2WS2 A;  4BL7 A;  2DJ1 A;  2M46 A;  4K7I A;  4ECB A;  4NAX A;  3EMX A;  1V40 A;  5D9W A;  5G1L A;  3VWX A;  1HNA A;  5DCH A;  2WDU A;  2LRN A;  3PR8 A;  2F8F A;  4HZ4 A;  4L5L A;  3ERF A;  4POL A;  1V57 A;  2YV9 A;  3QDN A;  3C7M A;  1N2A A;  5D73 A;  4TXO A;  2H74 A;  2D2Z A;  2LS5 A;  3N9J A;  1E6B A;  2JAD A;  4L5O A;  1MD4 A;  1NHO A;  1KNG A;  1FB0 A;  4MZC A;  2H76 A;  2CZ3 A;  4EDZ A;  3EIN A;  4HS1 A;  3ME7 A;  5EL8 A;  1VGL A;  3FYG A;  5DAK B;  1X5C A;  2PER A;  5ID2 A;  5D93 A;  3GTU B;  1A2M A;  4IW9 A;  1OKD A;  4V2L A;  1PKW A;  3HY2 A;  4J57 E;  2FWH A;  3F9U A;  4K0N A;  3UL3 A;  4AJ6 A;  9GSS A;  4PGT A;  2EIR A;  2NDO A;  4MCU A;  1XOA A;  1FVJ A;  2DBC A;  1F3A A;  1T4Z A;  2I4A A;  4EKZ A;  2B1K A;  3QAW A;  1M7T A;  2DJJ A;  2JZT A;  1UVZ A;  4TR3 A;  5B6M A;  2VL2 C;  2HRN A;  2IMF A;  1CQH A;  3QD9 A;  3IRA A;  2JU5 A;  4EXJ A;  1T1V A;  1M2A A;  2P5Q A;  2B3S A;  22GS A;  4JR6 A;  1SEN A;  1N8J A;  4RI6 A;  1XWG A;  5A4U A;  5AN1 A;  4L0U A;  3E3E A;  3FW2 A;  5J9B A;  3TJK A;  2IMD A;  2GT6 A;  3I9V 2;  3GST A;  5DDL A;  4BWS A;  2P31 A;  4BA7 A;  2VLV A;  3GL3 A;  2GGT A;  2OBK A;  5IM9 A;  4WBJ A;  4YQV A;  4KSM A;  4PNG A;  5ECQ B;  1QUW A;  4Q5N A;  1GNE A;  1PRX A;  3FK8 A;  2IFQ B;  2YWI A;  4FO5 A;  4GST A;  4N30 A;  3HHV A;  3N5O A;  3DIE A;  2M80 A;  1T00 A;  5FWG A;  3KM6 A;  5ECS A;  4PXO A;  1GL8 A;  2VO4 A;  1ERT A;  2AB6 A;  4N0Z A;  5IQY A;  4XTS A;  2EIO A;  3FRC A;  2RII A;  1C72 A;  2G0F A;  5J5N A;  4ZB6 A;  5J4U A;  4I5Q A;  1G7E A;  3MAK A;  3I43 A;  2H8L A;  1GUK A;  5IMZ A;  4JRR A;  1TRV A;  1TU8 A;  4POK A;  1USB A;  20GS A;  4YAP A;  2JAC A;  2R37 A;  5B8A A;  4XCS A;  4ML1 A;  1JLV A;  4PNF A;  5DQY A;  1FG4 A;  5C00 A;  3RDW A;  1NM3 A;  4HU7 A;  4PX1 A;  4HU9 A;  3VUR A;  1ERV A;  4WKW A;  2HYX A;  10GS A;  2V2G A;  4F03 A;  1PL1 A;  5IPH A;  2RUF A;  3US3 A;  3S9F A;  2DIY A;  4FYB A;  1GWC A;  3O3T A;  1GSF A;  2TRX A;  4XS1 A;  3ZIJ A;  4XS4 A;  2KOK A;  3GIX A;  3RPN A;  5E59 A;  1AW9 A;  1H4O A;  2MBT A;  4F0B A;  4E8H A;  11GS A;  3FR3 A;  3IK9 A;  2H71 A;  2DJ0 A;  2WUL A;  1QK8 A;  2B7J A;  4Q5F A;  4ZBB A;  5IMA A;  4V1A g;  1HYU A;  5AIV A;  5D9T A;  4MF5 A;  4IP6 A;  1Z6N A;  5H5Q A;  4OFT A;  4RQX A;  3P8W A;  2BMX A;  5IO2 A;  1SKW B;  3UBK A;  5IMF A;  1GTU A;  3DXB A;  1G0T A;  2YOI A;  3VLN A;  2GDR A;  3FR9 A;  6GST A;  3TKQ A;  2OBI A;  3FR6 A;  1BED A;  1M2B A;  2WCI A;  1TRS A;  4PQ1 A;  1ILO A;  4MAB A;  3KH7 A;  4ZBD A;  1OC9 B;  3FZ9 A;  5KN2 A;  3EVI A;  1B48 A;  2O8V B;  3L78 A;  1SD8 A;  1AIU A;  1FAA A;  1F2E A;  1AQV A;  3FZA A;  4HJ2 A;  1BQ7 A;  1FVK A;  4I97 A;  5HQP A;  2Z9S A;  2L5L A;  3OR5 A;  5A4W A;  3VWU A;  4L8E A;  3W8J A;  3TOT A;  3UVT A;  3ZRD A;  5JCG A;  2NBS A;  1YJ6 A;  1A23 A;  1X5E A;  5DJM A;  2N5A A;  1GUM A;  1SJI A;  3M0F A;  4OWY A;  3ERG A;  5AGY A;  4ZBA A;  5DJL A;  2X99 A;  4MPG A;  3VWV A;  4O5R A;  1K0O A;  2O85 A;  1X9M B;  5IPG A;  1R26 A;  1K0N A;  4DSS A;  1DBY A;  2C3Q A;  4TR0 A;  3KP9 A;  4TXO B;  2QKE A;  2KP2 A;  1OAZ A;  2OAD A;  12GS A;  4Q5Q A;  2VD0 A;  3DEX A;  1EV4 A;  3W8S A;  3D4M A;  3Q74 A;  3LG6 A;  1I9D A;  4JU5 A;  1EEJ A;  2KHP A;  3FZ5 A;  2JSY A;  1K0C A;  3IC4 A;  2N5B A;  1EOG A;  2H66 A;  2E2G A;  1O7U A;  2GQM A;  3H4K A;  2YWN A;  3D21 A;  2HSY A;  3Q6O A;  2RM5 A;  3FY7 A;  2EIQ A;  5J9C A;  3CBU A;  2LQO A;  2K18 A;  3EUR A;  3F4R A;  1GSS A;  1OYJ A;  4ZIL A;  3EC3 A;  1XW9 A;  1A0R P;  3QOU A;  1BYE A;  4KW6 A;  2LTK A;  2C0D A;  2LQQ A;  2QSI A;  2GSQ A;  2V6O A;  2H75 A;  2YZH A;  1XWA A;  4GCI A;  4BVY A;  1Q4J A;  5IMC A;  3TRQ A;  4MH2 A;  4WF5 A;  2PVO C;  3MDK A;  2R5G A;  2FNO A;  5ECI B;  1WOU A;  3TKR A;  1Z6M A;  4LLR A;  1HNB A;  2LNT A;  4K0G A;  1H75 A;  1AUC A;  1M0U A;  1SYR A;  3UEM A;  3ZIV A;  1KTE A;  4ZIJ A;  6GSV A;  2XC2 A;  1GP1 A;  3HJO A;  1CQG A;  4NMU A;  1YKA A;  5F05 A;  3GUS A;  2B7K A;  3TUE A;  1XVQ A;  2I81 A;  3GKK A;  4ISD A;  2R6K A;  4N10 A;  3HVS A;  5CRW A;  3DRN A;  1K3O A;  2ZUP A;  1LBK A;  3F4S A;  3LXZ A;  14GS A;  1Q98 A;  2LNS A;  2V6K A;  3HDC A;  1T7P B;  5D96 A;  1NHY A;  4TN8 A;  4AF2 A;  3ZFL A;  3DKS A;  2HT9 A;  3ZIT A;  2HSH A;  1TW9 A;  3L9U A;  1XXU A;  1ZYE A;  2H0I A;  2H72 A;  1BJX A;  1OC9 A;  4TR1 A;  4KE3 A;  1F9M A;  4ZB9 A;  4X0X A;  3H8Q A;  5H5S A;  1GRX A;  1QXH A;  2L4C A;  1K3L A;  3QAG A;  3L9V A;  1YDK A;  3GH6 A;  4KX4 A;  2DML A;  4O92 A;  4Q5R A;  5HFK A;  5ECP B;  4DVC A;  2JSZ A;  1OC3 A;  5JCW A;  2PMT A;  4CDO A;  4CW9 A;  3Q18 A;  4F0C A;  2ZNM A;  3KP8 A;  4N0V A;  4WF4 A;  1VF3 A;  3KEB A;  1GLP A;  1U88 A;  1XFL A;  3DVX A;  5DQS A;  4EO3 A;  3E9J B;  1UC7 A;  1GTI A;  5B7C A;  3MSZ A;  4XRA A;  3UAR A;  3GYK A;  3UAP A;  1NSW A;  3F0I A;  4TXV A;  4IS0 A;  3VI5 A;  1YKC A;  1ACV A;  3PGT A;  1JHB A;  2L6C A;  4RI7 A;  5H5R A;  3EU4 A;  4LA1 A;  3UVH A;  1AQX A;  1A8Y A;  5F8B A;  4G2E A;  2IMK A;  3QFA C;  4XS4 B;  3RAZ A;  3F4T A;  4ZXG A;  2RLI A;  1ZZY A;  4K7O A;  2VUP A;  3MWH A;  19GS A;  3IHQ A;  2C0G A;  2C8U A;  4MZW A;  3HYP A;  3NIV A;  2K8S A;  3P2A A;  1YQ1 A;  5LCZ A;  4KH7 A;  3BCI A;  2PGT A;  2PUK C;  1SJ6 A;  4HUA A;  3LYP A;  3KCM A;  3IAS 2;  2GVP A;  4IN0 A;  2F3M A;  1VRS D;  1FW1 A;  4LMW A;  1K0A A;  1ON4 A;  2R2J A;  5CNW A;  2CX3 A;  2VL9 A;  3C1R A;  2VLT A;  3DYR A;  3C1S A;  4ZL9 A;  2MBS A; 
#chains in the Genus database with same CATH topology
 5EVO A;  4FYC A;  2QGV A;  2FD3 A;  1R4W A;  1GSQ A;  3HA9 A;  4IGJ A;  5DVB A;  2GQK A;  2DSA A;  1V9W A;  3A2X A;  4EIQ A;  1MDJ A;  4KB3 A;  2VLU A;  1U3I A;  3BD2 A;  5ECH B;  3IC8 A;  2DC5 A;  2PBJ A;  3APO A;  3HJP A;  4G10 A;  1WPI A;  2IN3 A;  1GSE A;  2CVK A;  3IR4 A;  2CA8 A;  1YEP A;  4BVX B;  2FWE A;  2O89 A;  3LYK A;  5HFG A;  3APS A;  2VCW A;  4DEJ A;  1TOF A;  3C71 A;  3H1N A;  2WRT A;  3HD5 A;  3KGK A;  3GUR A;  1ERU A;  4Z7X A;  5ABR A;  2LJR A;  1KBN A;  3EMP A;  1BX9 A;  2H1B A;  2H73 A;  3WT1 A;  2L6D A;  4RUV A;  2KP1 A;  2WFC A;  2GQL A;  1THX A;  4KDX A;  1J9B A;  4DSS B;  2OAC A;  3BOA A;  4OFN A;  2DJ2 A;  1YEX A;  3I69 A;  2VOC A;  1EGO A;  2LEG A;  1TK5 B;  4OO4 A;  2DMM A;  2A4V A;  4LL1 B;  1Z7R A;  1FHE A;  1EWX A;  1ZL9 A;  1VF2 A;  1JZW A;  3QMX A;  1M2D A;  1Y25 A;  2KLX A;  2VIM A;  3D0Z A;  4ML6 A;  3HVV A;  5GAN D;  1RK4 A;  1T3B A;  2HRF A;  3TRP A;  3KJY A;  4K5R A;  1QMV A;  1XPV A;  4MDC A;  4AGS A;  5D9X A;  2C0F A;  3FHK A;  3HXS A;  5HR0 A;  4OCF A;  2F9S A;  5HR3 A;  4OO5 A;  5KN1 A;  4KF9 A;  5J41 A;  2BJX A;  5INY A;  2DKH A;  1PL2 A;  1TK8 B;  1FB6 A;  1HD2 A;  5CRH A;  3UMA A;  4JZQ A;  2PN8 A;  2V41 A;  2YP6 A;  5KEJ A;  1PGT A;  2F8A A;  3EWL A;  1OE7 A;  1Z9H A;  3ZZX A;  2F51 A;  2IPA A;  3K8N A;  3J7Y k;  2C3N A;  1PX6 A;  1BAY A;  4GSN A;  1DSB A;  6GSS A;  5CP1 A;  4PUF C;  4MLY A;  2DLX A;  2ON7 A;  4TKY A;  2ALB A;  3HKR A;  3O76 A;  4POB A;  1EV9 A;  4RQR A;  4K7N A;  2VCT A;  5CAX A;  4K2D A;  3ZL5 A;  5ECN B;  1UN2 A;  1GTA A;  1GSD A;  1XWB A;  3D6I A;  4IKH A;  3TJJ A;  3ZRE A;  2P0G A;  4HEA 2;  3HJM A;  6GSW A;  2VM1 A;  3ZTL A;  3CRU A;  3ME8 A;  1MDI A;  3VFI A;  3G7J A;  1K0B A;  1DE2 A;  1GSU A;  2H1D A;  3ERW A;  5ECO B;  2CAQ A;  4TR1 B;  2A2S A;  3G7Y A;  1MD3 A;  3GRX A;  5KN0 A;  1GLQ A;  1WIK A;  2CV4 A;  4BVX A;  2XHF A;  3V1W A;  2YNX A;  2L59 A;  1XWK A;  4GQC A;  3ZYW A;  3CRT A;  2B5X A;  3TJB A;  7GSS A;  1V98 A;  2H1A A;  1V58 A;  2YJH A;  3G9B A;  3TOU A;  4EE0 A;  4EVM A;  1GNW A;  2PU9 C;  3C8E A;  4AJ7 A;  2K6V A;  5DCG A;  1FOV A;  2A2R A;  2HFD A;  4O7H A;  3GHA A;  1XOB A;  6GSY A;  3WGD A;  3IPZ A;  1EEM A;  3BCK A;  1ZYP A;  2HE3 A;  2XBI A;  5KOX A;  5BMU A;  1U87 A;  2GSR A;  3PIN A;  2QC7 A;  3SWL A;  1U3A A;  4F82 A;  3L9S A;  5GZZ B;  4QL9 A;  3ZVJ A;  2B1L A;  6GSX A;  2H0H A;  1PMT A;  1X5D A;  1X0R A;  4ZB8 A;  3FKF A;  1AXD A;  1JFU A;  1OVN A;  3H79 A;  1SJZ A;  1T4Y A;  1G7O A;  4BPY A;  1XZO A;  4G0L A;  3WD6 A;  3UJ1 A;  1W89 A;  1M9A A;  4PUA A;  4MJE A;  1F3B A;  1G6W A;  3F6F A;  3F3R A;  1GUL A;  3RHC A;  2FY6 A;  1QGV A;  3F8U A;  4YQM A;  1TXX A;  2GZY A;  3HVX A;  1S3D A;  2HNL A;  2O87 A;  3CSH A;  2XPD A;  1J0F A;  4K6X A;  4MJC A;  4USS A;  4O5U A;  2K8V A;  5G1K A;  2WJU A;  2MMO A;  2GS3 A;  2NPB A;  3ZFB A;  5IIZ A;  2NVL A;  3KMO A;  1B4Q A;  1XWC A;  5IO0 A;  2HRA A;  3E0U A;  4ID0 A;  1Z5Y E;  3W6G A;  3MNG A;  2B5E A;  1EP8 A;  1SU9 A;  8GSS A;  2H30 A;  3KZQ A;  1WRY A;  4TOP A;  3VI7 A;  2I1U A;  1O85 A;  4OD7 A;  4JBB A;  4IBP A;  4IP1 A;  4ECC A;  4IVF A;  2OJL A;  2GZZ A;  2WB9 A;  2K9F A;  1O8X A;  2CX4 A;  3ED3 A;  5CO3 A;  4NV5 A;  2C1Y A;  2R4V A;  5HR2 A;  1O6J A;  3IBH A;  1KEB A;  4KSO A;  4GWR A;  3U6V A;  4POM A;  2MMN A;  4KGI A;  4YKF A;  4D73 A;  3HCZ A;  2C3T A;  2YPM A;  4Z2R A;  2OKA A;  1MTC A;  1TI1 A;  5CRD A;  4EUY A;  1F37 A;  1AAZ A;  1R7H A;  2C80 A;  3NOF A;  4HZ2 A;  5ECR B;  4PQI A;  5G2Z A;  1M3I A;  1Z3E A;  1ABA A;  4ZL8 A;  4ECJ A;  4MA9 A;  5G31 A;  5IMV A;  3LFL A;  2H1G A;  1OE8 A;  5E4W A;  2HRK A;  5ELG A;  4QQ7 A;  3APQ A;  5FT3 A;  17GS A;  4NV2 A;  2A2P A;  5KN3 A;  2L57 A;  2XPE A;  2VCV A;  4TRX A;  1Z7P A;  4WET A;  2MMZ A;  4K9Z A;  4GSS A;  4GLT A;  1WE0 A;  3TCO A;  1BG5 A;  1A2L A;  2TRC P;  4NPB A;  3KMN A;  1EGR A;  4HOJ A;  4F2I A;  2IL3 A;  3KXO A;  4X1U A;  2FLS A;  2YJ7 A;  3HZ4 A;  2DJK A;  1PKZ A;  1MEK A;  5C04 A;  1XBS A;  1M9B A;  5JWQ B;  1QQ2 A;  1ERW A;  1A2J A;  2YCD A;  1F6M C;  2FWF A;  4JE1 A;  4ECI A;  5CYY A;  4TR4 A;  4KCE A;  2DJ3 A;  2IWT A;  5JWR B;  1ZYQ B;  1YY7 A;  4LL4 B;  2VCZ A;  4IQ1 A;  1SL1 B;  1M99 A;  4PTS A;  4EF0 A;  3SBC A;  4OCE A;  1SD9 A;  3GH9 A;  4ACS A;  5GSS A;  3A2V A;  3KH9 A;  1K3Y A;  1O8W A;  1PFO A;  2HLS A;  2ES7 A;  4IHU A;  4IQA A;  1DE1 A;  1A0F A;  2X49 A;  2GSS A;  4FYU A;  1SL2 B;  1PX7 A;  2WGR A;  3U5R E;  4JR4 A;  1G6Y A;  4V2N A;  3CSI A;  2YV7 A;  5DAL B;  2C4J A;  3WGX A;  3GFK A;  4X4J A;  2G2Q A;  5ECM B;  2AV4 A;  4NWY A;  4FQU A;  1A24 A;  3A2W A;  3IA1 A;  3TRX A;  2FA4 A;  2LUS A;  1WJK A;  2HZF A;  3CTF A;  5F07 A;  3DML A;  3RHB A;  2WZ9 A;  2GLR A;  3D4T A;  3C73 A;  2IME A;  2CVD A;  3RBT A;  3TKS A;  3L0H A;  2YWO A;  4H86 A;  1WP0 A;  3LJR A;  4CY6 A;  5IMD A;  2FA8 A;  5JWO B;  4WR4 A;  3CMI A;  4YKG A;  3P90 A;  5F0G A;  1ZCP A;  2JZS A;  2L4Q A;  5COH A;  2IJY A;  3ZVJ D;  1OC8 A;  4AJ8 A;  2B6M A;  2YAN A;  2VAF A;  2REM A;  5G5F A;  1SYX A;  1EZK A;  4O32 A;  1RQM A;  1YF1 A;  3GKX A;  1K0M A;  2ON5 A;  2X4A A;  1SKS B;  4I8B A;  1LJR A;  2R0G A;  4DSR A;  2GZP A;  3VPT A;  2BTO T;  3KD0 A;  4GXZ A;  3ZLP A;  2FHE A;  1RW1 A;  4IJ3 A;  2DIZ A;  2YZU A;  1V2A A;  3HVN A;  2I3Y A;  4DSQ A;  4JED A;  1TRU A;  5GST A;  3MIX A;  4P3Y B;  3JCM L;  2P5R A;  2KUC A;  3GX0 A;  2XBQ A;  5B8B A;  3GV1 A;  2I9H A;  5CRE A;  2GTU A;  1XW6 A;  2X8G A;  2IMI A;  2FWG A;  1QFN A;  1LU4 A;  3IK7 A;  1EP7 A;  3GKN A;  4G9H A;  1JZD A;  5HFI A;  3LOR A;  3BJ5 A;  2EC4 A;  2AAW A;  3L4N A;  5G5E A;  3LSZ A;  3ISO A;  4MF7 A;  3F63 A;  3IV4 A;  3LWA A;  2RM6 A;  4O5Q A;  2PWJ A;  2H6Y A;  4EC0 A;  2FGX A;  3M9J A;  5D9V A;  4OFM A;  1TJD A;  1AC1 A;  1VF4 A;  2VCX A;  3PPU A;  2HXK A;  3GNJ A;  4XIH A;  1GSY A;  1B9X C;  1PQN A;  3BBY A;  2VD1 A;  3ZML A;  1K0D A;  4J56 E;  1X9W B;  4L0W A;  4YQU A;  4XHM A;  2X8C A;  3P7X A;  4KND A;  1ST9 A;  1S3R A;  2H6X A;  1PSQ A;  2TIR A;  4IJI A;  5EY6 A;  4WEY A;  3TB2 A;  2FUG 2;  2AJQ B;  3WGE A;  1WWJ A;  5DAL A;  4GQF A;  2H0G A;  4KDU A;  5ENU A;  2VM2 A;  3GX8 A;  5CRG A;  5BRT A;  1HNC A;  1XW5 A;  1GH2 A;  3Q19 A;  1R5P A;  3QPM A;  2VCQ A;  1XG8 A;  2PPT A;  1MDK A;  5DAK A;  4I2U A;  1ZOF A;  3DVW A;  5AIX A;  3GTU A;  4GTU A;  1SK2 A;  2LJK A;  3A5I A;  4ZL7 A;  1W4V A;  4XS6 A;  4D73 B;  2LRT A;  3FMW A;  3EE2 A;  2JZR A;  1ML6 A;  4MZB A;  2HZE B;  2OE0 A;  2AYT A;  1FO5 A;  4XRD A;  1TRW A;  3D5J A;  4KAE A;  1S3C A;  1VF1 A;  1JLW A;  1PD2 1;  4MF6 A;  1U6T A;  2CVB A;  4Z2U A;  4NXI A;  1UA5 A;  2V1M A;  2V32 A;  3G7I A;  3R2Q A;  1OKT A;  3KTL A;  4X43 A;  3CYN A;  3GN3 A;  4WXT A;  2CT6 A;  1O73 A;  1A8L A;  1GTB A;  3TGZ A;  3UOM A;  3KTB A;  2LV3 A;  5FHI A;  3WYW A;  1TTZ A;  2CQ9 A;  3F6D A;  4EL1 A;  2MZC A;  4V1A p;  2VL2 A;  13GS A;  3ZMK A;  2M72 A;  1YF0 A;  3M1G A;  2OE3 A;  1TKD B;  2OE1 A;  3A3T A;  4OMV A;  3RPP A;  4ILF A;  2LKU A;  2R0P A;  4FH8 A;  1JZO A;  4MP4 A;  3NZN A;  3IXR A;  2YN1 A;  3IOS A;  4KDY A;  2GST A;  1J08 A;  5G30 A;  3TDG A;  4TVE A;  3M9K A;  1XVW A;  2X8H A;  2IFQ A;  1IYI A;  3LQ7 A;  2AUV A;  3LEF A;  3WT2 A;  3VK9 A;  1X9S B;  4EDY A;  3QAV A;  3IAM 2;  1XCC A;  4GRF A;  3IDV A;  4MK3 A;  5A5K A;  4HI7 A;  4E8E A;  4KCA A;  2IIY A;  2AHE A;  2B5Y A;  3LGC A;  4WR5 A;  5IOW A;  1SKR B;  5ECL B;  2CAI A;  1T8E B;  1S3A A;  3GKM A;  3IE3 A;  3GL5 A;  1SK0 A;  2OA7 A;  3EYT A;  5AIS A;  1DUG A;  5IOX A;  4BWQ A;  3O6T A;  3D22 A;  6GSU A;  4HDE A;  1TP9 A;  1SL0 B;  1NW2 A;  4PUR A;  4ULX A;  1EOH A;  5D8I A;  3TKS C;  5ID2 B;  5B6N A;  4HQZ A;  3DWV A;  3VPQ A;  1AQW A;  1HQO A;  2H01 A;  3A5W A;  1O81 A;  2HSM A;  1TU7 A;  4WBR D;  3FZ4 A;  1I5G A;  1PN9 A;  4IEL A;  2J9H A;  2NTO A;  4PQH A;  1SK1 A;  2RUE A;  5JCU A;  4G19 A;  1XIY A;  1Y6E A;  2R3X A;  5LNK e;  4CHS A;  2ZCT A;  1TK0 B;  2MMA A;  1THO A;  4HQS A;  4MMM A;  1ZMA A;  4TW5 A;  4F9Z A;  1JZR A;  3MYD A;  3AY8 A;  2HI7 A;  3GSS A;  4V2M A;  2FCH A;  1URM A;  3CXG A;  1E2Y A;  4HJM A;  5LD0 A;  2L5O A;  1IYH A;  4KUN A;  2LST A;  3J7Y b;  2H70 A;  5F06 A;  1WMJ A;  1YZX A;  4YH2 A;  3CTG A;  2YWM A;  4HSC X;  3F3Q A;  3KIJ A;  4MJA A;  2UZ8 A;  1TI3 A;  4MH3 A;  3M8N A;  1B9Y C;  4K1F A;  4GF0 A;  2HZE A;  3M3M A;  1TDI A;  3DGQ A;  5GAP D;  3EPT A;  3TKP A;  4LMV A;  2X64 A;  2E7P A;  1GUH A;  4I2T A;  2N5F A;  16GS A;  3QCP A;  5A4V A;  2H6Z A;  5EPF A;  5ECK B;  4N11 A;  5ELA A;  2LJA A;  3I6A A;  3QR6 A;  3UBL A;  2C0E A;  1R5A A;  2O7K A;  2E2M A;  5J3R A;  4QL7 A;  4NHW A;  3DD3 A;  5L71 A;  3GA4 A;  2H19 A;  4I6X A;  2PVQ A;  3HZ8 A;  3UIW A;  2VL3 A;  3TJF A;  3EU3 A;  3VWW A;  4MJB A;  2LRC A;  3PH9 A;  4J2F A;  1B4P A;  1ZGN A;  3CSJ A;  3QFB C;  2CZ2 A;  4NHZ A;  5HR1 A;  3LXT A;  3TJG A;  2J23 A;  3TKS E;  5DBQ A;  2MYG A;  4K8M A;  2E0Q A;  2GT5 A;  1PA3 A;  4MPF A;  4FIW A;  2JL4 A;  18GS A;  1B8X A;  3FEU A;  4KA0 A;  3H93 A;  3GMF A;  4YAV A;  2WS2 A;  4BL7 A;  2DJ1 A;  2M46 A;  4K7I A;  4ECB A;  4NAX A;  3EMX A;  1V40 A;  5D9W A;  5G1L A;  3VWX A;  1HNA A;  5DCH A;  2WDU A;  2LRN A;  3PR8 A;  2F8F A;  4HZ4 A;  4L5L A;  3ERF A;  4POL A;  1V57 A;  2YV9 A;  3QDN A;  3C7M A;  1N2A A;  5D73 A;  4TXO A;  2H74 A;  2D2Z A;  2LS5 A;  3N9J A;  1ZYN A;  1E6B A;  2JAD A;  4L5O A;  1MD4 A;  1NHO A;  1KNG A;  1FB0 A;  4MZC A;  2H76 A;  2CZ3 A;  4EDZ A;  3EIN A;  4HS1 A;  3ME7 A;  5EL8 A;  2R0C A;  1VGL A;  3FYG A;  5DAK B;  1X5C A;  2PER A;  5ID2 A;  5D93 A;  3GTU B;  1A2M A;  4IW9 A;  1OKD A;  4V2L A;  1PKW A;  4A5P A;  3HY2 A;  4J57 E;  2FWH A;  3F9U A;  4K0N A;  3UL3 A;  4AJ6 A;  9GSS A;  4PGT A;  2EIR A;  2NDO A;  4MCU A;  1XOA A;  1FVJ A;  2DBC A;  1F3A A;  1T4Z A;  2I4A A;  4EKZ A;  2B1K A;  3QAW A;  1M7T A;  2DJJ A;  2JZT A;  1UVZ A;  4TR3 A;  5B6M A;  2VL2 C;  2HRN A;  2IMF A;  1CQH A;  3QD9 A;  3IRA A;  2JU5 A;  4EXJ A;  1T1V A;  1M2A A;  2P5Q A;  2B3S A;  4G0I A;  22GS A;  4JR6 A;  3CQF A;  1SEN A;  1N8J A;  4RI6 A;  1XWG A;  3R3E A;  4G0K A;  5A4U A;  5AN1 A;  4L0U A;  3E3E A;  3FW2 A;  5J9B A;  3TJK A;  2IMD A;  2GT6 A;  3I9V 2;  3GST A;  5DDL A;  4BWS A;  2P31 A;  4MNN A;  4BA7 A;  2VLV A;  3GL3 A;  4CY8 A;  2GGT A;  2OBK A;  5IM9 A;  4WBJ A;  4YQV A;  4KSM A;  4PNG A;  5ECQ B;  1QUW A;  4Q5N A;  1GNE A;  1PRX A;  3FK8 A;  2IFQ B;  2YWI A;  4FO5 A;  4GST A;  4N30 A;  3HHV A;  3N5O A;  3DIE A;  2M80 A;  1T00 A;  5FWG A;  3KM6 A;  5ECS A;  4PXO A;  2A4H A;  1GL8 A;  2VO4 A;  1ERT A;  2AB6 A;  1M3J A;  4N0Z A;  5IQY A;  4XTS A;  2EIO A;  3FRC A;  2RII A;  1C72 A;  2G0F A;  5J5N A;  4ZB6 A;  5J4U A;  4I5Q A;  1G7E A;  3MAK A;  3I43 A;  2H8L A;  1GUK A;  5IMZ A;  4JRR A;  1TRV A;  1TU8 A;  4POK A;  1USB A;  20GS A;  4YAP A;  2JAC A;  2R37 A;  5B8A A;  4XCS A;  4ML1 A;  1JLV A;  4EIP A;  4PNF A;  5DQY A;  1FG4 A;  5C00 A;  3RDW A;  1NM3 A;  4HU7 A;  4PX1 A;  4HU9 A;  3VUR A;  1ERV A;  4WKW A;  2HYX A;  10GS A;  2V2G A;  4F03 A;  1PL1 A;  5IPH A;  2RUF A;  3US3 A;  3S9F A;  2DIY A;  4FYB A;  1GWC A;  3O3T A;  1GSF A;  2TRX A;  4XS1 A;  3ZIJ A;  4XS4 A;  4BVY B;  2KOK A;  3GIX A;  3RPN A;  5E59 A;  1AW9 A;  1H4O A;  2MBT A;  4F0B A;  4E8H A;  11GS A;  3FR3 A;  3IK9 A;  4BIK A;  2H71 A;  2DJ0 A;  2WUL A;  1QK8 A;  3LW9 A;  2B7J A;  4Q5F A;  4ZBB A;  5IMA A;  4V1A g;  1HYU A;  5AIV A;  5D9T A;  4MF5 A;  4IP6 A;  1Z6N A;  5H5Q A;  4OFT A;  4RQX A;  3P8W A;  2BMX A;  5IO2 A;  1SKW B;  3UBK A;  5IMF A;  1GTU A;  3DXB A;  1G0T A;  2YOI A;  3VLN A;  2GDR A;  3FR9 A;  6GST A;  3TKQ A;  2OBI A;  3FR6 A;  1BED A;  1M2B A;  2WCI A;  1TRS A;  4PQ1 A;  1ILO A;  4MAB A;  3KH7 A;  4ZBD A;  1OC9 B;  4K5S A;  3FZ9 A;  5KN2 A;  3EVI A;  1B48 A;  2O8V B;  3L78 A;  1SD8 A;  1AIU A;  1FAA A;  1F2E A;  1AQV A;  3FZA A;  4HJ2 A;  1BQ7 A;  1FVK A;  4I97 A;  5HQP A;  2Z9S A;  2L5L A;  3OR5 A;  5A4W A;  3VWU A;  4L8E A;  3W8J A;  3TOT A;  3UVT A;  3ZRD A;  5JCG A;  2NBS A;  1YJ6 A;  1A23 A;  1X5E A;  5DJM A;  2N5A A;  1GUM A;  1SJI A;  3M0F A;  4OWY A;  4BL7 B;  3ERG A;  5AGY A;  4ZBA A;  5DJL A;  2X99 A;  4MPG A;  3VWV A;  4O5R A;  1K0O A;  2O85 A;  1X9M B;  5IPG A;  1R26 A;  1K0N A;  4DSS A;  1DBY A;  2C3Q A;  4K2X A;  4TR0 A;  3KP9 A;  4TXO B;  2QKE A;  2KP2 A;  1OAZ A;  2OAD A;  12GS A;  4Q5Q A;  2VD0 A;  3DEX A;  1EV4 A;  3W8S A;  3D4M A;  3Q74 A;  3LG6 A;  1I9D A;  4JU5 A;  1EEJ A;  2KHP A;  2DKI A;  3FZ5 A;  2JSY A;  1K0C A;  3IC4 A;  2N5B A;  1EOG A;  2H66 A;  2E2G A;  1O7U A;  2GQM A;  3H4K A;  2YWN A;  3D21 A;  2HSY A;  3Q6O A;  2RM5 A;  3FY7 A;  2EIQ A;  5J9C A;  3CBU A;  2LQO A;  2K18 A;  3EUR A;  3F4R A;  1GSS A;  1OYJ A;  4ZIL A;  3EC3 A;  1XW9 A;  1A0R P;  3QOU A;  1BYE A;  4KW6 A;  2LTK A;  2C0D A;  2LQQ A;  2QSI A;  2GSQ A;  2V6O A;  2H75 A;  2YZH A;  1XWA A;  3IHG A;  4GCI A;  4Z2T A;  4BVY A;  1Q4J A;  5IMC A;  3TRQ A;  4MH2 A;  4WF5 A;  2PVO C;  3MDK A;  2R5G A;  2FNO A;  5ECI B;  1WOU A;  3TKR A;  1Z6M A;  4LLR A;  1HNB A;  2LNT A;  4K0G A;  1H75 A;  1AUC A;  1M0U A;  1SYR A;  3UEM A;  3ZIV A;  1KTE A;  4ICY A;  4ZIJ A;  6GSV A;  2XC2 A;  1GP1 A;  3HJO A;  1CQG A;  4NMU A;  1YKA A;  5F05 A;  3GUS A;  2B7K A;  3TUE A;  1XVQ A;  2I81 A;  3GKK A;  4ISD A;  2R6K A;  4N10 A;  3HVS A;  5CRW A;  3DRN A;  1K3O A;  2ZUP A;  1LBK A;  3F4S A;  3LXZ A;  14GS A;  1Q98 A;  2LNS A;  2V6K A;  3HDC A;  1T7P B;  5D96 A;  1NHY A;  4TN8 A;  4AF2 A;  3ZFL A;  3DKS A;  2HT9 A;  3ZIT A;  2HSH A;  1TW9 A;  3L9U A;  1XXU A;  1ZYE A;  2H0I A;  2H72 A;  1BJX A;  1OC9 A;  4TR1 A;  4KE3 A;  1F9M A;  4ZB9 A;  4X0X A;  5KOW A;  3H8Q A;  5H5S A;  1GRX A;  1QXH A;  2L4C A;  1K3L A;  3QAG A;  3L9V A;  1YDK A;  3GH6 A;  4KX4 A;  2DML A;  4O92 A;  4Q5R A;  5HFK A;  5ECP B;  4DVC A;  2JSZ A;  1OC3 A;  5JCW A;  2PMT A;  4CDO A;  4CW9 A;  2QA2 A;  3Q18 A;  4F0C A;  2ZNM A;  3KP8 A;  1PN0 A;  4N0V A;  4WF4 A;  1VF3 A;  3KEB A;  1GLP A;  1U88 A;  1XFL A;  3DVX A;  5DQS A;  4EO3 A;  3E9J B;  1UC7 A;  1GTI A;  5B7C A;  3MSZ A;  4XRA A;  3UAR A;  3GYK A;  3UAP A;  1NSW A;  3F0I A;  4TXV A;  4IS0 A;  3VI5 A;  1YKC A;  1ACV A;  3PGT A;  1JHB A;  2L6C A;  4RI7 A;  5H5R A;  3EU4 A;  4LA1 A;  3UVH A;  1AQX A;  1A8Y A;  5F8B A;  4G2E A;  2IMK A;  3QFA C;  4XS4 B;  3RAZ A;  3F4T A;  4ZXG A;  2RLI A;  1ZZY A;  4K7O A;  2VUP A;  3MWH A;  19GS A;  3IHQ A;  2C0G A;  2C8U A;  4MZW A;  3HYP A;  3NIV A;  2K8S A;  3P2A A;  2QA1 A;  1YQ1 A;  5LCZ A;  4KH7 A;  3BCI A;  2PGT A;  2PUK C;  1SJ6 A;  4HUA A;  3LYP A;  3KCM A;  3IAS 2;  2GVP A;  4IN0 A;  2F3M A;  1VRS D;  1FW1 A;  4LMW A;  1K0A A;  1FOH A;  1ON4 A;  2R2J A;  5CNW A;  2CX3 A;  2VL9 A;  3C1R A;  2VLT A;  3DYR A;  3C1S A;  4ZL9 A;  2MBS A; 
#chains in the Genus database with same CATH homology
 5EVO A;  4FYC A;  2QGV A;  2FD3 A;  1R4W A;  1GSQ A;  3HA9 A;  4IGJ A;  5DVB A;  2GQK A;  2DSA A;  1V9W A;  3A2X A;  4EIQ A;  1MDJ A;  4KB3 A;  2VLU A;  1U3I A;  3BD2 A;  5ECH B;  3IC8 A;  2DC5 A;  2PBJ A;  3APO A;  3HJP A;  4G10 A;  1WPI A;  2IN3 A;  1GSE A;  2CVK A;  3IR4 A;  2CA8 A;  1YEP A;  4BVX B;  2FWE A;  2O89 A;  3LYK A;  5HFG A;  3APS A;  2VCW A;  4DEJ A;  1TOF A;  3C71 A;  3H1N A;  2WRT A;  3HD5 A;  3KGK A;  3GUR A;  1ERU A;  4Z7X A;  5ABR A;  2LJR A;  1KBN A;  3EMP A;  1BX9 A;  2H1B A;  2H73 A;  3WT1 A;  2L6D A;  4RUV A;  2KP1 A;  2WFC A;  2GQL A;  1THX A;  4KDX A;  1J9B A;  4DSS B;  2OAC A;  3BOA A;  4OFN A;  2DJ2 A;  1YEX A;  3I69 A;  2VOC A;  1EGO A;  2LEG A;  1TK5 B;  4OO4 A;  2DMM A;  2A4V A;  4LL1 B;  1Z7R A;  1FHE A;  1EWX A;  1ZL9 A;  1VF2 A;  1JZW A;  3QMX A;  1M2D A;  1Y25 A;  2KLX A;  2VIM A;  3D0Z A;  4ML6 A;  3HVV A;  5GAN D;  1RK4 A;  1T3B A;  2HRF A;  3TRP A;  3KJY A;  4K5R A;  1QMV A;  1XPV A;  4MDC A;  4AGS A;  5D9X A;  2C0F A;  3FHK A;  3HXS A;  5HR0 A;  4OCF A;  2F9S A;  5HR3 A;  4OO5 A;  5KN1 A;  4KF9 A;  5J41 A;  2BJX A;  5INY A;  2DKH A;  1PL2 A;  1TK8 B;  1FB6 A;  1HD2 A;  5CRH A;  3UMA A;  4JZQ A;  2PN8 A;  2V41 A;  2YP6 A;  5KEJ A;  1PGT A;  2F8A A;  3EWL A;  1OE7 A;  1Z9H A;  3ZZX A;  2F51 A;  2IPA A;  3K8N A;  3J7Y k;  2C3N A;  1PX6 A;  1BAY A;  4GSN A;  1DSB A;  6GSS A;  5CP1 A;  4PUF C;  4MLY A;  2DLX A;  2ON7 A;  4TKY A;  2ALB A;  3HKR A;  3O76 A;  4POB A;  1EV9 A;  4RQR A;  4K7N A;  2VCT A;  5CAX A;  4K2D A;  3ZL5 A;  5ECN B;  1UN2 A;  1GTA A;  1GSD A;  1XWB A;  3D6I A;  4IKH A;  3TJJ A;  3ZRE A;  2P0G A;  4HEA 2;  3HJM A;  6GSW A;  2VM1 A;  3ZTL A;  3CRU A;  3ME8 A;  1MDI A;  3VFI A;  3G7J A;  1K0B A;  1DE2 A;  1GSU A;  2H1D A;  3ERW A;  5ECO B;  2CAQ A;  4TR1 B;  2A2S A;  3G7Y A;  1MD3 A;  3GRX A;  5KN0 A;  1GLQ A;  1WIK A;  2CV4 A;  4BVX A;  2XHF A;  3V1W A;  2YNX A;  2L59 A;  1XWK A;  4GQC A;  3ZYW A;  3CRT A;  2B5X A;  3TJB A;  7GSS A;  1V98 A;  2H1A A;  1V58 A;  2YJH A;  3G9B A;  3TOU A;  4EE0 A;  4EVM A;  1GNW A;  2PU9 C;  3C8E A;  4AJ7 A;  2K6V A;  5DCG A;  1FOV A;  2A2R A;  2HFD A;  4O7H A;  3GHA A;  1XOB A;  6GSY A;  3WGD A;  3IPZ A;  1EEM A;  3BCK A;  1ZYP A;  2HE3 A;  2XBI A;  5KOX A;  5BMU A;  1U87 A;  2GSR A;  3PIN A;  2QC7 A;  3SWL A;  1U3A A;  4F82 A;  3L9S A;  5GZZ B;  4QL9 A;  3ZVJ A;  2B1L A;  6GSX A;  2H0H A;  1PMT A;  1X5D A;  1X0R A;  4ZB8 A;  3FKF A;  1AXD A;  1JFU A;  1OVN A;  3H79 A;  1SJZ A;  1T4Y A;  1G7O A;  4BPY A;  1XZO A;  4G0L A;  3WD6 A;  3UJ1 A;  1W89 A;  1M9A A;  4PUA A;  4MJE A;  1F3B A;  1G6W A;  3F6F A;  3F3R A;  1GUL A;  3RHC A;  2FY6 A;  1QGV A;  3F8U A;  4YQM A;  1TXX A;  2GZY A;  3HVX A;  1S3D A;  2HNL A;  2O87 A;  3CSH A;  2XPD A;  1J0F A;  4K6X A;  4MJC A;  4USS A;  4O5U A;  2K8V A;  5G1K A;  2WJU A;  2MMO A;  2GS3 A;  2NPB A;  3ZFB A;  5IIZ A;  2NVL A;  3KMO A;  1B4Q A;  1XWC A;  5IO0 A;  2HRA A;  3E0U A;  4ID0 A;  1Z5Y E;  3W6G A;  3MNG A;  2B5E A;  1EP8 A;  1SU9 A;  8GSS A;  2H30 A;  3KZQ A;  1WRY A;  4TOP A;  3VI7 A;  2I1U A;  1O85 A;  4OD7 A;  4JBB A;  4IBP A;  4IP1 A;  4ECC A;  4IVF A;  2OJL A;  2GZZ A;  2WB9 A;  2K9F A;  1O8X A;  2CX4 A;  3ED3 A;  5CO3 A;  4NV5 A;  2C1Y A;  2R4V A;  5HR2 A;  1O6J A;  3IBH A;  1KEB A;  4KSO A;  4GWR A;  3U6V A;  4POM A;  2MMN A;  4KGI A;  4YKF A;  4D73 A;  3HCZ A;  2C3T A;  2YPM A;  4Z2R A;  2OKA A;  1MTC A;  1TI1 A;  5CRD A;  4EUY A;  1F37 A;  1AAZ A;  1R7H A;  2C80 A;  3NOF A;  4HZ2 A;  5ECR B;  4PQI A;  5G2Z A;  1Z3E A;  1ABA A;  4ZL8 A;  4ECJ A;  4MA9 A;  5G31 A;  5IMV A;  3LFL A;  2H1G A;  1OE8 A;  5E4W A;  2HRK A;  5ELG A;  4QQ7 A;  3APQ A;  5FT3 A;  17GS A;  4NV2 A;  2A2P A;  5KN3 A;  2L57 A;  2XPE A;  2VCV A;  4TRX A;  1Z7P A;  4WET A;  2MMZ A;  4K9Z A;  4GSS A;  4GLT A;  1WE0 A;  3TCO A;  1BG5 A;  1A2L A;  2TRC P;  4NPB A;  3KMN A;  1EGR A;  4HOJ A;  4F2I A;  2IL3 A;  3KXO A;  4X1U A;  2FLS A;  2YJ7 A;  3HZ4 A;  2DJK A;  1PKZ A;  1MEK A;  5C04 A;  1XBS A;  1M9B A;  5JWQ B;  1QQ2 A;  1ERW A;  1A2J A;  2YCD A;  1F6M C;  2FWF A;  4JE1 A;  4ECI A;  5CYY A;  4TR4 A;  4KCE A;  2DJ3 A;  2IWT A;  5JWR B;  1ZYQ B;  1YY7 A;  4LL4 B;  2VCZ A;  4IQ1 A;  1SL1 B;  1M99 A;  4PTS A;  4EF0 A;  3SBC A;  4OCE A;  1SD9 A;  3GH9 A;  4ACS A;  5GSS A;  3A2V A;  3KH9 A;  1K3Y A;  1O8W A;  2HLS A;  2ES7 A;  4IHU A;  4IQA A;  1DE1 A;  1A0F A;  2X49 A;  2GSS A;  4FYU A;  1SL2 B;  1PX7 A;  2WGR A;  3U5R E;  4JR4 A;  1G6Y A;  4V2N A;  3CSI A;  2YV7 A;  5DAL B;  2C4J A;  3WGX A;  3GFK A;  4X4J A;  2G2Q A;  5ECM B;  2AV4 A;  4NWY A;  4FQU A;  1A24 A;  3A2W A;  3IA1 A;  3TRX A;  2FA4 A;  2LUS A;  1WJK A;  2HZF A;  3CTF A;  5F07 A;  3DML A;  3RHB A;  2WZ9 A;  2GLR A;  3D4T A;  3C73 A;  2IME A;  2CVD A;  3RBT A;  3TKS A;  3L0H A;  2YWO A;  4H86 A;  1WP0 A;  3LJR A;  4CY6 A;  5IMD A;  2FA8 A;  5JWO B;  4WR4 A;  3CMI A;  4YKG A;  3P90 A;  5F0G A;  1ZCP A;  2JZS A;  2L4Q A;  5COH A;  2IJY A;  3ZVJ D;  1OC8 A;  4AJ8 A;  2B6M A;  2YAN A;  2VAF A;  2REM A;  5G5F A;  1SYX A;  1EZK A;  4O32 A;  1RQM A;  1YF1 A;  3GKX A;  1K0M A;  2ON5 A;  2X4A A;  1SKS B;  4I8B A;  1LJR A;  2R0G A;  4DSR A;  2GZP A;  3VPT A;  2BTO T;  3KD0 A;  4GXZ A;  3ZLP A;  2FHE A;  1RW1 A;  4IJ3 A;  2DIZ A;  2YZU A;  1V2A A;  2I3Y A;  4DSQ A;  4JED A;  1TRU A;  5GST A;  3MIX A;  4P3Y B;  3JCM L;  2P5R A;  2KUC A;  3GX0 A;  2XBQ A;  5B8B A;  3GV1 A;  2I9H A;  5CRE A;  2GTU A;  1XW6 A;  2X8G A;  2IMI A;  2FWG A;  1QFN A;  1LU4 A;  3IK7 A;  1EP7 A;  3GKN A;  4G9H A;  1JZD A;  5HFI A;  3LOR A;  3BJ5 A;  2EC4 A;  2AAW A;  3L4N A;  5G5E A;  3LSZ A;  3ISO A;  4MF7 A;  3F63 A;  3IV4 A;  3LWA A;  2RM6 A;  4O5Q A;  2PWJ A;  2H6Y A;  4EC0 A;  2FGX A;  3M9J A;  5D9V A;  4OFM A;  1TJD A;  1AC1 A;  1VF4 A;  2VCX A;  3PPU A;  2HXK A;  3GNJ A;  4XIH A;  1GSY A;  1B9X C;  1PQN A;  3BBY A;  2VD1 A;  3ZML A;  1K0D A;  4J56 E;  1X9W B;  4L0W A;  4YQU A;  4XHM A;  2X8C A;  3P7X A;  4KND A;  1ST9 A;  2H6X A;  1PSQ A;  2TIR A;  4IJI A;  5EY6 A;  4WEY A;  3TB2 A;  2FUG 2;  2AJQ B;  3WGE A;  1WWJ A;  5DAL A;  4GQF A;  2H0G A;  4KDU A;  5ENU A;  2VM2 A;  3GX8 A;  5CRG A;  5BRT A;  1HNC A;  1XW5 A;  1GH2 A;  3Q19 A;  1R5P A;  3QPM A;  2VCQ A;  2PPT A;  1MDK A;  5DAK A;  4I2U A;  1ZOF A;  3DVW A;  5AIX A;  3GTU A;  4GTU A;  1SK2 A;  2LJK A;  3A5I A;  4ZL7 A;  1W4V A;  4XS6 A;  4D73 B;  2LRT A;  3FMW A;  3EE2 A;  2JZR A;  1ML6 A;  4MZB A;  2HZE B;  2OE0 A;  2AYT A;  1FO5 A;  4XRD A;  1TRW A;  3D5J A;  4KAE A;  1S3C A;  1VF1 A;  1JLW A;  1PD2 1;  4MF6 A;  1U6T A;  2CVB A;  4Z2U A;  4NXI A;  1UA5 A;  2V1M A;  2V32 A;  3G7I A;  3R2Q A;  1OKT A;  3KTL A;  4X43 A;  3CYN A;  3GN3 A;  4WXT A;  2CT6 A;  1O73 A;  1A8L A;  1GTB A;  3TGZ A;  3UOM A;  3KTB A;  2LV3 A;  5FHI A;  3WYW A;  1TTZ A;  2CQ9 A;  3F6D A;  4EL1 A;  2MZC A;  4V1A p;  2VL2 A;  13GS A;  3ZMK A;  2M72 A;  1YF0 A;  3M1G A;  2OE3 A;  1TKD B;  2OE1 A;  3A3T A;  4OMV A;  3RPP A;  4ILF A;  2LKU A;  2R0P A;  4FH8 A;  1JZO A;  4MP4 A;  3NZN A;  3IXR A;  2YN1 A;  3IOS A;  4KDY A;  2GST A;  1J08 A;  5G30 A;  3TDG A;  4TVE A;  3M9K A;  1XVW A;  2X8H A;  2IFQ A;  1IYI A;  3LQ7 A;  2AUV A;  3LEF A;  3WT2 A;  3VK9 A;  1X9S B;  4EDY A;  3QAV A;  3IAM 2;  1XCC A;  4GRF A;  3IDV A;  4MK3 A;  5A5K A;  4HI7 A;  4E8E A;  4KCA A;  2IIY A;  2AHE A;  2B5Y A;  3LGC A;  4WR5 A;  5IOW A;  1SKR B;  5ECL B;  2CAI A;  1T8E B;  1S3A A;  3GKM A;  3IE3 A;  3GL5 A;  1SK0 A;  2OA7 A;  3EYT A;  5AIS A;  1DUG A;  5IOX A;  4BWQ A;  3O6T A;  3D22 A;  6GSU A;  4HDE A;  1TP9 A;  1SL0 B;  1NW2 A;  4PUR A;  4ULX A;  1EOH A;  5D8I A;  3TKS C;  5ID2 B;  5B6N A;  4HQZ A;  3DWV A;  3VPQ A;  1AQW A;  1HQO A;  2H01 A;  3A5W A;  1O81 A;  2HSM A;  1TU7 A;  4WBR D;  3FZ4 A;  1I5G A;  1PN9 A;  4IEL A;  2J9H A;  2NTO A;  4PQH A;  1SK1 A;  2RUE A;  5JCU A;  4G19 A;  1XIY A;  1Y6E A;  2R3X A;  5LNK e;  4CHS A;  2ZCT A;  1TK0 B;  2MMA A;  1THO A;  4HQS A;  4MMM A;  1ZMA A;  4TW5 A;  4F9Z A;  1JZR A;  3MYD A;  3AY8 A;  2HI7 A;  3GSS A;  4V2M A;  2FCH A;  1URM A;  3CXG A;  1E2Y A;  4HJM A;  5LD0 A;  2L5O A;  1IYH A;  4KUN A;  2LST A;  3J7Y b;  2H70 A;  5F06 A;  1WMJ A;  1YZX A;  4YH2 A;  3CTG A;  2YWM A;  4MJA A;  3F3Q A;  3KIJ A;  2UZ8 A;  1TI3 A;  4MH3 A;  3M8N A;  1B9Y C;  4K1F A;  4GF0 A;  2HZE A;  3M3M A;  1TDI A;  3DGQ A;  5GAP D;  3EPT A;  3TKP A;  4LMV A;  2X64 A;  2E7P A;  1GUH A;  4I2T A;  2N5F A;  16GS A;  3QCP A;  5A4V A;  2H6Z A;  5EPF A;  5ECK B;  4N11 A;  5ELA A;  2LJA A;  3I6A A;  3QR6 A;  3UBL A;  2C0E A;  1R5A A;  2O7K A;  2E2M A;  5J3R A;  4QL7 A;  4NHW A;  3DD3 A;  5L71 A;  3GA4 A;  2H19 A;  4I6X A;  2PVQ A;  3HZ8 A;  3UIW A;  2VL3 A;  3TJF A;  3EU3 A;  3VWW A;  4MJB A;  2LRC A;  3PH9 A;  4J2F A;  1B4P A;  1ZGN A;  3CSJ A;  3QFB C;  2CZ2 A;  4NHZ A;  5HR1 A;  3LXT A;  3TJG A;  2J23 A;  3TKS E;  5DBQ A;  2MYG A;  4K8M A;  2E0Q A;  2GT5 A;  1PA3 A;  4MPF A;  4FIW A;  2JL4 A;  18GS A;  1B8X A;  3FEU A;  4KA0 A;  3H93 A;  3GMF A;  4YAV A;  2WS2 A;  4BL7 A;  2DJ1 A;  2M46 A;  4K7I A;  4ECB A;  4NAX A;  3EMX A;  1V40 A;  5D9W A;  5G1L A;  3VWX A;  1HNA A;  5DCH A;  2WDU A;  2LRN A;  3PR8 A;  2F8F A;  4HZ4 A;  4L5L A;  3ERF A;  4POL A;  1V57 A;  2YV9 A;  3QDN A;  3C7M A;  1N2A A;  5D73 A;  4TXO A;  2H74 A;  2D2Z A;  2LS5 A;  3N9J A;  1ZYN A;  1E6B A;  2JAD A;  4L5O A;  1MD4 A;  1NHO A;  1KNG A;  1FB0 A;  4MZC A;  2H76 A;  2CZ3 A;  4EDZ A;  3EIN A;  4HS1 A;  3ME7 A;  5EL8 A;  2R0C A;  1VGL A;  3FYG A;  5DAK B;  1X5C A;  2PER A;  5ID2 A;  5D93 A;  3GTU B;  1A2M A;  4IW9 A;  1OKD A;  4V2L A;  1PKW A;  4A5P A;  3HY2 A;  4J57 E;  2FWH A;  3F9U A;  4K0N A;  3UL3 A;  4AJ6 A;  9GSS A;  4PGT A;  2EIR A;  2NDO A;  4MCU A;  1XOA A;  1FVJ A;  2DBC A;  1F3A A;  1T4Z A;  2I4A A;  4EKZ A;  2B1K A;  3QAW A;  1M7T A;  2DJJ A;  2JZT A;  1UVZ A;  4TR3 A;  5B6M A;  2VL2 C;  2HRN A;  2IMF A;  1CQH A;  3QD9 A;  3IRA A;  2JU5 A;  4EXJ A;  1T1V A;  1M2A A;  2P5Q A;  2B3S A;  4G0I A;  22GS A;  4JR6 A;  1SEN A;  1N8J A;  4RI6 A;  1XWG A;  3R3E A;  4G0K A;  5A4U A;  5AN1 A;  4L0U A;  3E3E A;  3FW2 A;  5J9B A;  3TJK A;  2IMD A;  2GT6 A;  3I9V 2;  3GST A;  5DDL A;  4BWS A;  2P31 A;  4MNN A;  4BA7 A;  2VLV A;  3GL3 A;  4CY8 A;  2GGT A;  2OBK A;  5IM9 A;  4WBJ A;  4YQV A;  4KSM A;  4PNG A;  5ECQ B;  1QUW A;  4Q5N A;  1GNE A;  1PRX A;  3FK8 A;  2IFQ B;  2YWI A;  4FO5 A;  4GST A;  4N30 A;  3HHV A;  3N5O A;  3DIE A;  2M80 A;  1T00 A;  5FWG A;  3KM6 A;  5ECS A;  4PXO A;  2A4H A;  1GL8 A;  2VO4 A;  1ERT A;  2AB6 A;  4N0Z A;  5IQY A;  4XTS A;  2EIO A;  3FRC A;  2RII A;  1C72 A;  2G0F A;  5J5N A;  4ZB6 A;  5J4U A;  4I5Q A;  1G7E A;  3MAK A;  3I43 A;  2H8L A;  1GUK A;  5IMZ A;  4JRR A;  1TRV A;  1TU8 A;  4POK A;  1USB A;  20GS A;  4YAP A;  2JAC A;  2R37 A;  5B8A A;  4XCS A;  4ML1 A;  1JLV A;  4EIP A;  4PNF A;  5DQY A;  1FG4 A;  5C00 A;  3RDW A;  1NM3 A;  4HU7 A;  4PX1 A;  4HU9 A;  3VUR A;  1ERV A;  4WKW A;  2HYX A;  10GS A;  2V2G A;  4F03 A;  1PL1 A;  5IPH A;  2RUF A;  3US3 A;  3S9F A;  2DIY A;  4FYB A;  1GWC A;  3O3T A;  1GSF A;  2TRX A;  4XS1 A;  3ZIJ A;  4XS4 A;  4BVY B;  2KOK A;  3GIX A;  3RPN A;  5E59 A;  1AW9 A;  1H4O A;  2MBT A;  4F0B A;  4E8H A;  11GS A;  3FR3 A;  3IK9 A;  2H71 A;  2DJ0 A;  2WUL A;  1QK8 A;  3LW9 A;  2B7J A;  4Q5F A;  4ZBB A;  5IMA A;  4V1A g;  1HYU A;  5AIV A;  5D9T A;  4MF5 A;  4IP6 A;  1Z6N A;  5H5Q A;  4OFT A;  4RQX A;  3P8W A;  2BMX A;  5IO2 A;  1SKW B;  3UBK A;  5IMF A;  1GTU A;  3DXB A;  1G0T A;  2YOI A;  3VLN A;  2GDR A;  3FR9 A;  6GST A;  3TKQ A;  2OBI A;  3FR6 A;  1BED A;  1M2B A;  2WCI A;  1TRS A;  4PQ1 A;  1ILO A;  4MAB A;  3KH7 A;  4ZBD A;  1OC9 B;  4K5S A;  3FZ9 A;  5KN2 A;  3EVI A;  1B48 A;  2O8V B;  3L78 A;  1SD8 A;  1AIU A;  1FAA A;  1F2E A;  1AQV A;  3FZA A;  4HJ2 A;  1BQ7 A;  1FVK A;  4I97 A;  5HQP A;  2Z9S A;  2L5L A;  3OR5 A;  5A4W A;  3VWU A;  4L8E A;  3W8J A;  3TOT A;  3UVT A;  3ZRD A;  5JCG A;  2NBS A;  1YJ6 A;  1A23 A;  1X5E A;  5DJM A;  2N5A A;  1GUM A;  1SJI A;  3M0F A;  4OWY A;  4BL7 B;  3ERG A;  5AGY A;  4ZBA A;  5DJL A;  2X99 A;  4MPG A;  3VWV A;  4O5R A;  1K0O A;  2O85 A;  1X9M B;  5IPG A;  1R26 A;  1K0N A;  4DSS A;  1DBY A;  2C3Q A;  4K2X A;  4TR0 A;  3KP9 A;  4TXO B;  2QKE A;  2KP2 A;  1OAZ A;  2OAD A;  12GS A;  4Q5Q A;  2VD0 A;  3DEX A;  1EV4 A;  3W8S A;  3D4M A;  3Q74 A;  3LG6 A;  1I9D A;  4JU5 A;  1EEJ A;  2KHP A;  2DKI A;  3FZ5 A;  2JSY A;  1K0C A;  3IC4 A;  2N5B A;  1EOG A;  2H66 A;  2E2G A;  1O7U A;  2GQM A;  3H4K A;  2YWN A;  3D21 A;  2HSY A;  3Q6O A;  2RM5 A;  3FY7 A;  2EIQ A;  5J9C A;  3CBU A;  2LQO A;  2K18 A;  3EUR A;  3F4R A;  1GSS A;  1OYJ A;  4ZIL A;  3EC3 A;  1XW9 A;  1A0R P;  3QOU A;  1BYE A;  4KW6 A;  2LTK A;  2C0D A;  2LQQ A;  2QSI A;  2GSQ A;  2V6O A;  2H75 A;  2YZH A;  1XWA A;  3IHG A;  4GCI A;  4Z2T A;  4BVY A;  1Q4J A;  5IMC A;  3TRQ A;  4MH2 A;  4WF5 A;  2PVO C;  3MDK A;  2R5G A;  2FNO A;  5ECI B;  1WOU A;  3TKR A;  1Z6M A;  4LLR A;  1HNB A;  2LNT A;  4K0G A;  1H75 A;  1AUC A;  1M0U A;  1SYR A;  3UEM A;  3ZIV A;  1KTE A;  4ICY A;  4ZIJ A;  6GSV A;  2XC2 A;  1GP1 A;  3HJO A;  1CQG A;  4NMU A;  1YKA A;  5F05 A;  3GUS A;  2B7K A;  3TUE A;  1XVQ A;  2I81 A;  3GKK A;  4ISD A;  2R6K A;  4N10 A;  3HVS A;  5CRW A;  3DRN A;  1K3O A;  2ZUP A;  1LBK A;  3F4S A;  3LXZ A;  14GS A;  1Q98 A;  2LNS A;  2V6K A;  3HDC A;  1T7P B;  5D96 A;  1NHY A;  4TN8 A;  4AF2 A;  3ZFL A;  3DKS A;  2HT9 A;  3ZIT A;  2HSH A;  1TW9 A;  3L9U A;  1XXU A;  1ZYE A;  2H0I A;  2H72 A;  1BJX A;  1OC9 A;  4TR1 A;  4KE3 A;  1F9M A;  4ZB9 A;  4X0X A;  5KOW A;  3H8Q A;  5H5S A;  1GRX A;  1QXH A;  2L4C A;  1K3L A;  3QAG A;  3L9V A;  1YDK A;  3GH6 A;  4KX4 A;  2DML A;  4O92 A;  4Q5R A;  5HFK A;  5ECP B;  4DVC A;  2JSZ A;  1OC3 A;  5JCW A;  2PMT A;  4CDO A;  4CW9 A;  2QA2 A;  3Q18 A;  4F0C A;  2ZNM A;  3KP8 A;  1PN0 A;  4N0V A;  4WF4 A;  1VF3 A;  3KEB A;  1GLP A;  1U88 A;  1XFL A;  3DVX A;  5DQS A;  4EO3 A;  3E9J B;  1UC7 A;  1GTI A;  5B7C A;  3MSZ A;  4XRA A;  3UAR A;  3GYK A;  3UAP A;  1NSW A;  3F0I A;  4TXV A;  4IS0 A;  3VI5 A;  1YKC A;  1ACV A;  3PGT A;  1JHB A;  2L6C A;  4RI7 A;  5H5R A;  3EU4 A;  4LA1 A;  3UVH A;  1AQX A;  1A8Y A;  5F8B A;  4G2E A;  2IMK A;  3QFA C;  4XS4 B;  3RAZ A;  3F4T A;  4ZXG A;  2RLI A;  1ZZY A;  4K7O A;  2VUP A;  3MWH A;  19GS A;  3IHQ A;  2C0G A;  2C8U A;  4MZW A;  3HYP A;  3NIV A;  2K8S A;  3P2A A;  2QA1 A;  1YQ1 A;  5LCZ A;  4KH7 A;  3BCI A;  2PGT A;  2PUK C;  1SJ6 A;  4HUA A;  3LYP A;  3KCM A;  3IAS 2;  2GVP A;  4IN0 A;  2F3M A;  1VRS D;  1FW1 A;  4LMW A;  1K0A A;  1FOH A;  1ON4 A;  2R2J A;  5CNW A;  2CX3 A;  2VL9 A;  3C1R A;  2VLT A;  3DYR A;  3C1S A;  4ZL9 A;  2MBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...