4J5GA

Crystal structure analysis of streptomyces aureofaciens ribonuclease sa t95a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of hydrogen bonds to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4j5gA00
3D5GA 4RNTA 5GSPA 1IYYA 1FYSA 1BSCA 5BIRA 2GSPA 1BUJA 4BIRA 1AY7A 5HOHA 1BIRA 1X1YA 2C4BA 1JBRA 3GSPA 4HOHA 7GSPA 1BNRA 1LNIA 1JBSA 1I3FA 1X1WA 1B2ZA 1RGFA 1BRNL 1RN4A 1I2FA 1BVIA 1FZUA 1FW7A 1B3SA 1BOXA 2F4YA 1RGKA 1BSBA 1RHLA 1TTOA 3HOHA 1Q9EA 1RGCA 1LOVA 1RNBA 1RDSA 1BAOA 1BRIA 1RGLA 1ZGXA 1YNVX 1B2SA 2KF4A 8RNTA 1X1XA 2AAEA 4J5KA 3RNTA 9RNTA 4J5GA 1BGSA 1A2PA 5BU4A 7RNTA 1BU4A 3AGOA 3AHWA 1B2XA 1BRGA 1T2IA 1I8VA 6GSPA 1BNGA 1MGRA 1RGEA 1YGWA 1B20A 3Q3FA 1X1UA 4HAAA 1I2GA 1RN1A 5RNTA 1I70A 3A5EA 1I3IA 3D5IA 1MGWA 2AADA 1I0XA 1BANA 1HZ1A 1I0VA 1UCLA 1B21A 1UCKA 4GHOA 1B2MA 1GMQA 1RGGA 4BU4A 1BNJA 1BNFA 1HYFA 1BNSA 1BRJA 1DETA 1GMPA 1GOYA 3SYUA 1JBTA 3URPA 2KAAA 3KCHA 1C54A 2KF6A 6RNTA 1RTUA 1FUSA 1R4YA 3BU4A 2RNTA 3BIRA 1RNTA 2BU4A 1BRSA 1RLSA 1BNEA 2KF5A 2KF3A 3AHSA 1LOWA 1PY3A 1I2EA 1TRPA 1SARA 1BNIA 1BRHA 1FUTA 1B2UA 1CH0A 3WR2A 3DGYA 1BSAA 1GSPA 2F56A 2F5WA 1RCLA 2BIRA 1YVSA 1T2HA 1G02A 1DE3A 1LOYA 3WHOA 1B27A 1BSEA 3DH2A 1UCJA 1TRQA 1GMRA 1RCKA 1RSNA 3D4AA 1PYLA 1RGHA 2F5MA 2RBIA 4GSPA 1GOUA 2ZA4A 1LRAA 1RGAA 1RMSA 3AGNA 1UCIA 2SARA 1BSDA 2HOHA 1GOVA 1BRKA 1AQZA
chains in the Genus database with same CATH superfamily
3D5GA 1LQMB 2CX1A 2H0GA 1JJ22 4J9AA 1EKMA 1FYSA 1V74A 2XF3A 2YFLB 4KFEA 3I0YA 3S29A 3D9RA 5BIRA 1HKXA 1Q40A 1AY7A 1W6CA 2OOVA 3BB9A 3OWYA 2Z76A 3ECFA 4KVHA 5EVHA 3S67A 3HI7A 3CNXA 1LNIA 4EV2A 1ZS7A 1C7HA 1W00A 1RGFA 2UX0A 2OTJ3 2P05A 4GB5A 2W03A 3F8XA 4N6OB 4ORLA 4OVMA 1I2FA 3V92A 1UUGB 3MKIA 1WTHA 1BVIA 1FZUA 5DRVA 4MMZB 3SX1A 3I563 4XM4A 2JQ5A 5CF2A 1DVDA 1BOXA 3BLZA 1UUVB 1BSBA 4U13A 2LQVA 1GY6A 2W56A 2HMKB 3X42A 3M8CA 1RGCA 1RJOA 3S5CA 3WA2X 1IQYA 2K3DA 2STDA 4K1VA 4O3VA 2W6JH 1BAOA 1CYVA 2OWPA 4HM1B 5G1LA 5M1AA 2QA43 1DMQA 4NPBA 3GWRA 3G4S3 1X1XA 2IUKA 4J5KA 5FGOA 9RNTA 1K9M4 1EUIC 1DVCA 3K9MC 4R9LA 5D82A 3D3LA 1LVNA 2Y73A 2B24B 3F7SA 4KT3B 3NBRA 1SPUA 3N8BA 1A90A 4FCMA 3AHWA 3CC43 3DMCA 1ROVA 3KSPA 3K7CA 6GSPA 1BNGA 3EJVA 3NBBA 2CX0A 3EX9A 2H0HA 3VSYA 1QVG2 2HMMB 3DGLA 4STDA 2CK3H 1MWTA 4LEHA 2HMJB 1VQQA 5D83A 1I2GA 1US1A 4OUQA 4WWUC 2J8XB 1QALA 5ELJA 1EG9B 3CMA3 5CF1A 1I3IA 3HIGA 3S28A 1MGWA 1UGHI 3OX9A 5JBSA 1ROAA 3B8LA 1BANA 1I0VA 3BNBA 3N9HA 1JN5A 2P0MA 1N5HA 3G8ZA 1GS3A 3B4PA 1OCVA 4GHOA 1B2MA 3GRDA 4LGQA 1D6YA 1NU3A 1GOYA 2UUGC 3DGMA 4HM0B 2B1XB 3GZXB 1K8A4 3JUNA 3JUMA 3G713 2W0QA 3ZFZA 2CKFB 1N8QA 2KF6A 6RNTA 1WNHA 3EBTA 4NHFA 1NO3A 1RNTA 2HMNB 2CFKA 3DUKA 3A76A 1BRSA 1RLSA 1BNEA 2KF5A 2KF3A 1IVVA 3LMLA 1O7HB 4QWTA 1JKGA 2WOHA 3F14A 1WMNA 2GXFA 3LTDA 1BNIA 4H61A 4HKVB 4MMXB 3CC23 1Q824 4HM3B 4MJDA 3CCL3 3GZRA 1B2UA 5DREA 3WR2A 1KC84 1OACA 1BSAA 1O7GB 2Z77A 3QRDA 2IA7A 1YVSA 3AMOA 2FNQA 2QIYA 5IW9A 5A0OB 5KP1A 1S723 1BSEA 3RGRA 1KSIA 1LNHA 5IENA 4TX4A 4JRFA 1VQ43 3HX8A 1ISKA 3CCV3 1RCKA 1RSNA 3D4AA 1A67A 1PYLA 1KD14 2F5MA 3BNDA 4GSPA 1GOUA 5G2GA 1A2VA 3CU3A 1QAFA 3Q2PA 1Q42A 3AGNA 3MSOA 3WA3A 1N9EA 3MHEA 1VQ73 3KFQC 3STDA 1R4CA 2XEPA 3Q90A 4PEJA 2GBWB 1Z1SA 2GU1A 4RNTA 5IEOA 5GSPA 3CCM3 1IYYA 2ML5A 2Z6BA 1BSCA 1T5YA 2GSPA 2XGNA 4ZM8A 2XFSA 4L8PA 4R80A 3CC73 2W9QA 2C4BA 1MWUA 3GSPA 3UJMA 5IF6A 3WOEB 1IU7A 1FGRA 2RSXA 3MYTA 2P09A 1VQ63 3S27A 1IT7A 1Q7HA 1RN4A 3KKGA 1F8NA 2R4IA 3CXC2 2CH9A 1ZX2A 3JVCA 5KP3A 2RFRA 3PZWA 1FW7A 1MWRA 1STDA 2XSOB 3NQZA 1O7NB 5KP4A 3CCS3 2BO9B 4K90B 3EHCA 3HOHA 3NXJA 1Q9EA 2CWVA 1G0TA 1LOVA 2Q07A 1GY7A 5AIIA 5JPPA 1ZO2A 2HMOB 2RGQA 1QAKA 1ZGXA 3DGNA 3KE7A 8RNTA 3X3XA 1YHQ3 3H51A 2ML6A 3Q1CA 1OHSA 4J8TA 3BNCA 3MG1A 2BMQB 3MPHA 3LOYA 4O02B 1BU4A 3AGOA 1SJWA 1W2ZA 4GL6A 4N6UA 3JUQA 1RRHA 4R4KA 1BRGA 1FGQA 3TDGA 5IERA 1MGRA 2CWUA 3Q3FA 2WGQA 1JB5A 1IT8A 1FGOA 4HAAA 3GZYB 1O7PB 2XFTA 5RNTA 1I70A 1E3RA 2XRXB 3KSED 2QEX3 1IQXA 3ROBA 4EXRA 5IG5A 1DYUA 3NQYA 3FCSB 1B21A 2KRTA 1CYUA 3DM8A 2O9UX 4HZBB 1W6GA 3B4OA 4HBRA 1GMQA 1RGGA 4BU4A 3CPOA 3SYUA 1BNSA 3G16A 2IUJA 2W9PA 1VQN3 1QJGA 4XBXA 3WODG 4HYZA 3KCHA 3SEDA 4BL2A 2XR8B 4L7KA 1TP6A 4X2HA 1T3BA 5STDA 3LT9A 1FUSA 1R4YA 4I4KA 2OOVC 2BU4A 1VQL3 2CW9A 4O8SA 1AVKA 1JB4A 1TIJA 3MG3A 4HZ9B 1JV2B 1DMNA 2Z7AA 2P38A 1TRPA 1YIJ3 4HM8B 1SARA 4MMYB 5EQLA 1W2B2 5EEOA 1BRHA 4HJLB 1FGMA 2OQEA 4ILFA 2L1SA 3DZLA 1CH0A 4HM2B 2F56A 4XB5A 2F5WA 5ELUA 4LSOA 2BIRA 1AVLA 2I9WA 1G02A 3PS8A 1S5AA 1N5PA 3FLJA 3GZBA 4HVNA 1SQWA 4WFOA 3EN1B 3GAXA 4N6NB 3SVAA 1UCJA 1WMPA 3PYJA 1TRQA 1GMRA 3SXXA 1Q864 1JKGB 3UL6A 3EN8A 4HM5B 1ASKA 1RN7A 2MC8A 4MEIA 4WYKB 5I97A 1LRAA 1RGAA 3LXUX 3BNEA 1FGTA 2SARA 3WDGB 1BRKA 1AQZA 1J2BA 3LT8A 4K61A 2H0IA 3AMOB 1K41A 3PGBA 2E2TA 3LTCA 1M904 4FMDA 1BUJA 1NJI4 2CWTA 4Q53A 4BIRA 1UGIA 2CHCA 1BIRA 1X1YA 3N54B 3NUVA 1JBRA 1JZDA 4BL3A 4R1KA 2C10A 7GSPA 1BNRA 3O8YA 1UDII 1W4NA 3CNMA 1I3FA 1UW1A 4R9KA 1BRNL 2O3OA 4I5QA 4WHAA 5IEPA 4X2OA 4EYCA 4NREA 1Q814 2R41A 3KIIA 1AR0A 1IV9A 4LMIA 3SOAA 5CLKA 3CCJ3 3G6E3 1Q7Y4 3KN4A 1YVBI 4LYLB 1TU5A 1G96A 2V1LA 2F4YA 1RGKA 3FG1A 1IVXA 2D42A 2RCDA 1L5GB 1TTOA 2BNGA 4CPKA 3FSDA 1VQ93 1VQK3 2INXA 5JPUA 1BRIA 1RGLA 4KFFA 5TGNA 3ZG0A 1B2SA 1RRLA 2KF4A 4N3VA 2LYXA 1IK3A 1OF5B 3PCRA 4BTYA 2CFDA 2YFJB 4J5GA 1BGSA 3OWUA 1W02A 1JB2A 3EF8A 4CCVA 1IQ8A 1A2PA 3F40A 1YI23 3D79A 3T8UA 4LZIA 3QK9A 1B2XA 3EB8A 1E3VA 1MOLA 3NX0A 4FMCA 1UI7A 1OH0A 2ZL8A 1B20A 1X1UA 1Q40B 1SIIA 1WQLB 4N6MA 5AI1A 1RN1A 4N6LA 3JUOA 2CFGA 3NV0A 3D5IA 3FG3A 2MF7A 4AKZA 5AIFA 1I0XA 1GYBA 3CCR3 1V58A 1UCLA 2WGOA 3ALAA 3X41A 1UCKA 3OV4A 4K1UA 1MWSA 3UB1A 1OGZA 1BNJA 1BNFA 3EQQB 1FUWA 1GMPA 8CHOA 1JBTA 2JDIH 3VF1A 4CJNA 2YFIB 3WMDA 1C54A 2F98A 3BU4A 2RNTA 3LTBA 1NB3I 5AEWB 4RZMA 5G1KA 2KCDA 2W56B 1PY3A 1I2EA 1Y4KA 3X40A 3MG2A 3NHXA 4EV5A 3K5TA 2E2UA 4HM7B 3UNLA 3LTAA 3DXOA 1IDPA 1VQO3 3DGYA 4FMBA 4DKIA 2XSHB 1O7MB 2Y74A 1OUNA 4KFDA 1RCLA 5IG4A 4JF8A 5FW5A 1T2HA 1ULJB 4RBNA 5LC6A 3WHOA 4IT7A 3EC9A 1YJN3 2IMJA 2D1WA 2WO0A 3SOYA 4EC6A 1B27A 2PZVA 1AV4A 1RKYA 2GEXA 1E97A 3EE1A 4HM4B 1UI8A 1RGHA 1BUQA 1K28A 2C11A 3OWSA 2KXGA 1LQGC 3IJEB 5CXOA 3CCE3 2HOHA 3OXAA 1GOVA 2CC3A 3T0UA 5AYSC 4CDLA 1M9GA 3FG4A 1CEWI 3ZG5A 1ULIB 1JN5B 3L0RA 3FGYA 2A15A 2K0MA 1LOXA 1M1XB 3DY5A 5HOHA 3IPTA 3K0ZA 4AKYA 4XDVA 5AEUB 4XDWA 5M18A 1TJDA 4HOHA 1YJW3 4L8OA 2BMOB 1SIHA 2OCTA 2YX9A 3UL5A 1JBSA 3F7XA 2OTL3 1X1WA 1B2ZA 3B7CA 3H3HA 5M19A 3WOFB 6STDA 3EBYA 2XGLA 1STFI 2GEYA 1JZOA 1EQKA 1TUHA 3SLUA 1OGXA 1B3SA 3FZWA 1W5ZA 4XBTA 1OHPA 1TFKA 1W01A 1TFOA 5IG0A 1RHLA 1A2KA 1W7CA 2M7OA 1JNQA 2W2CA 1WMOA 3NM7A 2FGTA 3KZTA 5BXQA 3FKAA 1RDSA 1RNBA 5IG3A 2ZHXB 1LXEA 2W04A 1GD4A 5AIHA 3HZPA 1YNVX 3OW22 1MNLA 7STDA 3CCQ3 1PU4A 2AAEA 3RNTA 1VQ83 1NB5I 2OQEC 2XH9A 5BU4A 1NWWA 1PFPA 2CFWA 2F99A 7RNTA 1N8R4 2BMRB 2E2VA 2CG0A 3CCU3 1YJ93 1T2IA 2QGUA 1I8VA 5CK6A 4N6V0 3FH1A 3MWZA 1IV7A 5AYRB 1YIT3 3LZAA 1RGEA 1YGWA 3RDEA 1QVF2 1GY5A 3T8NA 4WYKA 1QMAA 4RNYA 1N9JA 3A5EA 3CD63 1EA2A 2AADA 3U1WA 2FXTA 3VGNA 1HZ1A 4BTWA 3X3YA 1VQM3 4BTXA 3PXMA 3I553 1D6UA 5D81A 3E99A 5LC7A 4FCJA 3V98A 4RNZA 2IY2A 4EW5A 1UUWB 1HYFA 1BRJA 1DETA 1OPYA 2BT3A 2L4VA 3DGOA 4N6TA 3URPA 3LH4A 4FMAA 3CME3 1VQP3 4IIAA 4XBYA 2KAAA 5HGRA 2K54A 1KWIA 1RTUA 2GBXB 2GU3A 2ZDJA 3JUPA 3BIRA 1OHOA 4IPBA 1FA3A 5BVBA 4H3UA 3AHSA 1DMMA 3NV0B 2SBLA 4O2HA 1LOWA 4FCZA 4FR9A 2BHMA 3HK4A 3CPW2 2CFLA 4HM6B 2PNCA 1M1K4 3V99A 1FUTA 2UGIA 2CIUA 3F9SA 1D6ZA 1NNVA 4G1MB 1GSPA 2P0XA 3LYGA 1EEJA 1KQS2 3FF2A 3U97A 1IVUA 1LOYA 2IYJA 3PCSA 1DE3A 3K63A 1HU9A 5AIGA 3X3ZA 1K734 3DH2A 3G0KA 2CG1A 1VQ53 3ER7A 3NBJA 3IMAB 1OF5A 1U8CB 3NM2A 3RGAA 3HIIA 2RBIA 1VZZA 2HMLB 3J7Yd 2ZA4A 1GD3A 3F8HA 4WP5A 4EBGA 1RMSA 2WOFA 2F86B 1JRQA 1V57A 1UCIA 4OK0A 1YGEA 1BSDA 1U5OA 1O7WB 1W6YA 4AEQA 1IVWA 3FF0A 1CQSA 1NDOB 4KZ1A
chains in the Genus database with same CATH topology
3D5GA 4RNTA 5GSPA 1IYYA 1FYSA 1BSCA 5BIRA 2GSPA 1BUJA 4BIRA 1AY7A 5HOHA 1BIRA 1X1YA 2C4BA 1JBRA 3GSPA 4HOHA 7GSPA 1BNRA 1LNIA 1JBSA 1I3FA 1X1WA 1B2ZA 1RGFA 1BRNL 1RN4A 1I2FA 1BVIA 1FZUA 1FW7A 1B3SA 1BOXA 2F4YA 1RGKA 1BSBA 1RHLA 1TTOA 3HOHA 1Q9EA 1RGCA 1LOVA 1RNBA 1RDSA 1BAOA 1BRIA 1RGLA 1ZGXA 1YNVX 1B2SA 2KF4A 8RNTA 1X1XA 2AAEA 4J5KA 3RNTA 9RNTA 4J5GA 1BGSA 1A2PA 5BU4A 7RNTA 1BU4A 3AGOA 3AHWA 1B2XA 1BRGA 1T2IA 1I8VA 6GSPA 1BNGA 1MGRA 1RGEA 1YGWA 1B20A 3Q3FA 1X1UA 4HAAA 1I2GA 1RN1A 5RNTA 1I70A 3A5EA 1I3IA 3D5IA 1MGWA 2AADA 1I0XA 1BANA 1HZ1A 1I0VA 1UCLA 1B21A 1UCKA 4GHOA 1B2MA 1GMQA 1RGGA 4BU4A 1BNJA 1BNFA 1HYFA 1BNSA 1BRJA 1DETA 1GMPA 1GOYA 3SYUA 1JBTA 3URPA 2KAAA 3KCHA 1C54A 2KF6A 6RNTA 1RTUA 1FUSA 1R4YA 3BU4A 2RNTA 3BIRA 1RNTA 2BU4A 1BRSA 1RLSA 1BNEA 2KF5A 2KF3A 3AHSA 1LOWA 1PY3A 1I2EA 1TRPA 1SARA 1BNIA 1BRHA 1FUTA 1B2UA 1CH0A 3WR2A 3DGYA 1BSAA 1GSPA 2F56A 2F5WA 1RCLA 2BIRA 1YVSA 1T2HA 1G02A 1DE3A 1LOYA 3WHOA 1B27A 1BSEA 3DH2A 1UCJA 1TRQA 1GMRA 1RCKA 1RSNA 3D4AA 1PYLA 1RGHA 2F5MA 2RBIA 4GSPA 1GOUA 2ZA4A 1LRAA 1RGAA 1RMSA 3AGNA 1UCIA 2SARA 1BSDA 2HOHA 1GOVA 1BRKA 1AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5G A;  4RNT A;  5GSP A;  1IYY A;  1FYS A;  1BSC A;  5BIR A;  2GSP A;  1BUJ A;  4BIR A;  1AY7 A;  5HOH A;  1BIR A;  1X1Y A;  2C4B A;  1JBR A;  3GSP A;  4HOH A;  7GSP A;  1BNR A;  1LNI A;  1JBS A;  1I3F A;  1X1W A;  1B2Z A;  1RGF A;  1BRN L;  1RN4 A;  1I2F A;  1BVI A;  1FZU A;  1FW7 A;  1B3S A;  1BOX A;  2F4Y A;  1RGK A;  1BSB A;  1RHL A;  1TTO A;  3HOH A;  1Q9E A;  1RGC A;  1LOV A;  1RNB A;  1RDS A;  1BAO A;  1BRI A;  1RGL A;  1ZGX A;  1YNV X;  1B2S A;  2KF4 A;  8RNT A;  1X1X A;  2AAE A;  4J5K A;  3RNT A;  9RNT A;  4J5G A;  1BGS A;  1A2P A;  5BU4 A;  7RNT A;  1BU4 A;  3AGO A;  3AHW A;  1B2X A;  1BRG A;  1T2I A;  1I8V A;  6GSP A;  1BNG A;  1MGR A;  1RGE A;  1YGW A;  1B20 A;  3Q3F A;  1X1U A;  4HAA A;  1I2G A;  1RN1 A;  5RNT A;  1I70 A;  3A5E A;  1I3I A;  3D5I A;  1MGW A;  2AAD A;  1I0X A;  1BAN A;  1HZ1 A;  1I0V A;  1UCL A;  1B21 A;  1UCK A;  4GHO A;  1B2M A;  1GMQ A;  1RGG A;  4BU4 A;  1BNJ A;  1BNF A;  1HYF A;  1BNS A;  1BRJ A;  1DET A;  1GMP A;  1GOY A;  3SYU A;  1JBT A;  3URP A;  2KAA A;  3KCH A;  1C54 A;  2KF6 A;  6RNT A;  1RTU A;  1FUS A;  1R4Y A;  3BU4 A;  2RNT A;  3BIR A;  1RNT A;  2BU4 A;  1BRS A;  1RLS A;  1BNE A;  2KF5 A;  2KF3 A;  3AHS A;  1LOW A;  1PY3 A;  1I2E A;  1TRP A;  1SAR A;  1BNI A;  1BRH A;  1FUT A;  1B2U A;  1CH0 A;  3WR2 A;  3DGY A;  1BSA A;  1GSP A;  2F56 A;  2F5W A;  1RCL A;  2BIR A;  1YVS A;  1T2H A;  1G02 A;  1DE3 A;  1LOY A;  3WHO A;  1B27 A;  1BSE A;  3DH2 A;  1UCJ A;  1TRQ A;  1GMR A;  1RCK A;  1RSN A;  3D4A A;  1PYL A;  1RGH A;  2F5M A;  2RBI A;  4GSP A;  1GOU A;  2ZA4 A;  1LRA A;  1RGA A;  1RMS A;  3AGN A;  1UCI A;  2SAR A;  1BSD A;  2HOH A;  1GOV A;  1BRK A;  1AQZ A; 
#chains in the Genus database with same CATH topology
 3D5G A;  1LQM B;  2CX1 A;  2H0G A;  1JJ2 2;  4J9A A;  1EKM A;  1FYS A;  1V74 A;  2XF3 A;  2YFL B;  4KFE A;  3I0Y A;  3S29 A;  3D9R A;  5BIR A;  1HKX A;  1Q40 A;  1AY7 A;  1W6C A;  2OOV A;  3BB9 A;  3OWY A;  2Z76 A;  3ECF A;  4KVH A;  5EVH A;  3S67 A;  3HI7 A;  3CNX A;  1LNI A;  4EV2 A;  1ZS7 A;  1C7H A;  1W00 A;  1RGF A;  2UX0 A;  2OTJ 3;  2P05 A;  4GB5 A;  2W03 A;  3F8X A;  4N6O B;  4ORL A;  4OVM A;  1I2F A;  3V92 A;  1UUG B;  3MKI A;  1WTH A;  1BVI A;  1FZU A;  5DRV A;  4MMZ B;  3SX1 A;  3I56 3;  4XM4 A;  2JQ5 A;  5CF2 A;  1DVD A;  1BOX A;  3BLZ A;  1UUV B;  1BSB A;  4U13 A;  2LQV A;  1GY6 A;  2W56 A;  2HMK B;  3X42 A;  3M8C A;  1RGC A;  1RJO A;  3S5C A;  3WA2 X;  1IQY A;  2K3D A;  2STD A;  4K1V A;  4O3V A;  2W6J H;  1BAO A;  1CYV A;  2OWP A;  4HM1 B;  5G1L A;  5M1A A;  2QA4 3;  1DMQ A;  4NPB A;  3GWR A;  3G4S 3;  1X1X A;  2IUK A;  4J5K A;  5FGO A;  9RNT A;  1K9M 4;  1EUI C;  1DVC A;  3K9M C;  4R9L A;  5D82 A;  3D3L A;  1LVN A;  2Y73 A;  2B24 B;  3F7S A;  4KT3 B;  3NBR A;  1SPU A;  3N8B A;  1A90 A;  4FCM A;  3AHW A;  3CC4 3;  3DMC A;  1ROV A;  3KSP A;  3K7C A;  6GSP A;  1BNG A;  3EJV A;  3NBB A;  2CX0 A;  3EX9 A;  2H0H A;  3VSY A;  1QVG 2;  2HMM B;  3DGL A;  4STD A;  2CK3 H;  1MWT A;  4LEH A;  2HMJ B;  1VQQ A;  5D83 A;  1I2G A;  1US1 A;  4OUQ A;  4WWU C;  2J8X B;  1QAL A;  5ELJ A;  1EG9 B;  3CMA 3;  5CF1 A;  1I3I A;  3HIG A;  3S28 A;  1MGW A;  1UGH I;  3OX9 A;  5JBS A;  1ROA A;  3B8L A;  1BAN A;  1I0V A;  3BNB A;  3N9H A;  1JN5 A;  2P0M A;  1N5H A;  3G8Z A;  1GS3 A;  3B4P A;  1OCV A;  4GHO A;  1B2M A;  3GRD A;  4LGQ A;  1D6Y A;  1NU3 A;  1GOY A;  2UUG C;  3DGM A;  4HM0 B;  2B1X B;  3GZX B;  1K8A 4;  3JUN A;  3JUM A;  3G71 3;  2W0Q A;  3ZFZ A;  2CKF B;  1N8Q A;  2KF6 A;  6RNT A;  1WNH A;  3EBT A;  4NHF A;  1NO3 A;  1RNT A;  2HMN B;  2CFK A;  3DUK A;  3A76 A;  1BRS A;  1RLS A;  1BNE A;  2KF5 A;  2KF3 A;  1IVV A;  3LML A;  1O7H B;  4QWT A;  1JKG A;  2WOH A;  3F14 A;  1WMN A;  2GXF A;  3LTD A;  1BNI A;  4H61 A;  4HKV B;  4MMX B;  3CC2 3;  1Q82 4;  4HM3 B;  4MJD A;  3CCL 3;  3GZR A;  1B2U A;  5DRE A;  3WR2 A;  1KC8 4;  1OAC A;  1BSA A;  1O7G B;  2Z77 A;  3QRD A;  2IA7 A;  1YVS A;  3AMO A;  2FNQ A;  2QIY A;  5IW9 A;  5A0O B;  5KP1 A;  1S72 3;  1BSE A;  3RGR A;  1KSI A;  1LNH A;  5IEN A;  4TX4 A;  4JRF A;  1VQ4 3;  3HX8 A;  1ISK A;  3CCV 3;  1RCK A;  1RSN A;  3D4A A;  1A67 A;  1PYL A;  1KD1 4;  2F5M A;  3BND A;  4GSP A;  1GOU A;  5G2G A;  1A2V A;  3CU3 A;  1QAF A;  3Q2P A;  1Q42 A;  3AGN A;  3MSO A;  3WA3 A;  1N9E A;  3MHE A;  1VQ7 3;  3KFQ C;  3STD A;  1R4C A;  2XEP A;  3Q90 A;  4PEJ A;  2GBW B;  1Z1S A;  2GU1 A;  4RNT A;  5IEO A;  5GSP A;  3CCM 3;  1IYY A;  2ML5 A;  2Z6B A;  1BSC A;  1T5Y A;  2GSP A;  2XGN A;  4ZM8 A;  2XFS A;  4L8P A;  4R80 A;  3CC7 3;  2W9Q A;  2C4B A;  1MWU A;  3GSP A;  3UJM A;  5IF6 A;  3WOE B;  1IU7 A;  1FGR A;  2RSX A;  3MYT A;  2P09 A;  1VQ6 3;  3S27 A;  1IT7 A;  1Q7H A;  1RN4 A;  3KKG A;  1F8N A;  2R4I A;  3CXC 2;  2CH9 A;  1ZX2 A;  3JVC A;  5KP3 A;  2RFR A;  3PZW A;  1FW7 A;  1MWR A;  1STD A;  2XSO B;  3NQZ A;  1O7N B;  5KP4 A;  3CCS 3;  2BO9 B;  4K90 B;  3EHC A;  3HOH A;  3NXJ A;  1Q9E A;  2CWV A;  1G0T A;  1LOV A;  2Q07 A;  1GY7 A;  5AII A;  5JPP A;  1ZO2 A;  2HMO B;  2RGQ A;  1QAK A;  1ZGX A;  3DGN A;  3KE7 A;  8RNT A;  3X3X A;  1YHQ 3;  3H51 A;  2ML6 A;  3Q1C A;  1OHS A;  4J8T A;  3BNC A;  3MG1 A;  2BMQ B;  3MPH A;  3LOY A;  4O02 B;  1BU4 A;  3AGO A;  1SJW A;  1W2Z A;  4GL6 A;  4N6U A;  3JUQ A;  1RRH A;  4R4K A;  1BRG A;  1FGQ A;  3TDG A;  5IER A;  1MGR A;  2CWU A;  3Q3F A;  2WGQ A;  1JB5 A;  1IT8 A;  1FGO A;  4HAA A;  3GZY B;  1O7P B;  2XFT A;  5RNT A;  1I70 A;  1E3R A;  2XRX B;  3KSE D;  2QEX 3;  1IQX A;  3ROB A;  4EXR A;  5IG5 A;  1DYU A;  3NQY A;  3FCS B;  1B21 A;  2KRT A;  1CYU A;  3DM8 A;  2O9U X;  4HZB B;  1W6G A;  3B4O A;  4HBR A;  1GMQ A;  1RGG A;  4BU4 A;  3CPO A;  3SYU A;  1BNS A;  3G16 A;  2IUJ A;  2W9P A;  1VQN 3;  1QJG A;  4XBX A;  3WOD G;  4HYZ A;  3KCH A;  3SED A;  4BL2 A;  2XR8 B;  4L7K A;  1TP6 A;  4X2H A;  1T3B A;  5STD A;  3LT9 A;  1FUS A;  1R4Y A;  4I4K A;  2OOV C;  2BU4 A;  1VQL 3;  2CW9 A;  4O8S A;  1AVK A;  1JB4 A;  1TIJ A;  3MG3 A;  4HZ9 B;  1JV2 B;  1DMN A;  2Z7A A;  2P38 A;  1TRP A;  1YIJ 3;  4HM8 B;  1SAR A;  4MMY B;  5EQL A;  1W2B 2;  5EEO A;  1BRH A;  4HJL B;  1FGM A;  2OQE A;  4ILF A;  2L1S A;  3DZL A;  1CH0 A;  4HM2 B;  2F56 A;  4XB5 A;  2F5W A;  5ELU A;  4LSO A;  2BIR A;  1AVL A;  2I9W A;  1G02 A;  3PS8 A;  1S5A A;  1N5P A;  3FLJ A;  3GZB A;  4HVN A;  1SQW A;  4WFO A;  3EN1 B;  3GAX A;  4N6N B;  3SVA A;  1UCJ A;  1WMP A;  3PYJ A;  1TRQ A;  1GMR A;  3SXX A;  1Q86 4;  1JKG B;  3UL6 A;  3EN8 A;  4HM5 B;  1ASK A;  1RN7 A;  2MC8 A;  4MEI A;  4WYK B;  5I97 A;  1LRA A;  1RGA A;  3LXU X;  3BNE A;  1FGT A;  2SAR A;  3WDG B;  1BRK A;  1AQZ A;  1J2B A;  3LT8 A;  4K61 A;  2H0I A;  3AMO B;  1K41 A;  3PGB A;  2E2T A;  3LTC A;  1M90 4;  4FMD A;  1BUJ A;  1NJI 4;  2CWT A;  4Q53 A;  4BIR A;  1UGI A;  2CHC A;  1BIR A;  1X1Y A;  3N54 B;  3NUV A;  1JBR A;  1JZD A;  4BL3 A;  4R1K A;  2C10 A;  7GSP A;  1BNR A;  3O8Y A;  1UDI I;  1W4N A;  3CNM A;  1I3F A;  1UW1 A;  4R9K A;  1BRN L;  2O3O A;  4I5Q A;  4WHA A;  5IEP A;  4X2O A;  4EYC A;  4NRE A;  1Q81 4;  2R41 A;  3KII A;  1AR0 A;  1IV9 A;  4LMI A;  3SOA A;  5CLK A;  3CCJ 3;  3G6E 3;  1Q7Y 4;  3KN4 A;  1YVB I;  4LYL B;  1TU5 A;  1G96 A;  2V1L A;  2F4Y A;  1RGK A;  3FG1 A;  1IVX A;  2D42 A;  2RCD A;  1L5G B;  1TTO A;  2BNG A;  4CPK A;  3FSD A;  1VQ9 3;  1VQK 3;  2INX A;  5JPU A;  1BRI A;  1RGL A;  4KFF A;  5TGN A;  3ZG0 A;  1B2S A;  1RRL A;  2KF4 A;  4N3V A;  2LYX A;  1IK3 A;  1OF5 B;  3PCR A;  4BTY A;  2CFD A;  2YFJ B;  4J5G A;  1BGS A;  3OWU A;  1W02 A;  1JB2 A;  3EF8 A;  4CCV A;  1IQ8 A;  1A2P A;  3F40 A;  1YI2 3;  3D79 A;  3T8U A;  4LZI A;  3QK9 A;  1B2X A;  3EB8 A;  1E3V A;  1MOL A;  3NX0 A;  4FMC A;  1UI7 A;  1OH0 A;  2ZL8 A;  1B20 A;  1X1U A;  1Q40 B;  1SII A;  1WQL B;  4N6M A;  5AI1 A;  1RN1 A;  4N6L A;  3JUO A;  2CFG A;  3NV0 A;  3D5I A;  3FG3 A;  2MF7 A;  4AKZ A;  5AIF A;  1I0X A;  1GYB A;  3CCR 3;  1V58 A;  1UCL A;  2WGO A;  3ALA A;  3X41 A;  1UCK A;  3OV4 A;  4K1U A;  1MWS A;  3UB1 A;  1OGZ A;  1BNJ A;  1BNF A;  3EQQ B;  1FUW A;  1GMP A;  8CHO A;  1JBT A;  2JDI H;  3VF1 A;  4CJN A;  2YFI B;  3WMD A;  1C54 A;  2F98 A;  3BU4 A;  2RNT A;  3LTB A;  1NB3 I;  5AEW B;  4RZM A;  5G1K A;  2KCD A;  2W56 B;  1PY3 A;  1I2E A;  1Y4K A;  3X40 A;  3MG2 A;  3NHX A;  4EV5 A;  3K5T A;  2E2U A;  4HM7 B;  3UNL A;  3LTA A;  3DXO A;  1IDP A;  1VQO 3;  3DGY A;  4FMB A;  4DKI A;  2XSH B;  1O7M B;  2Y74 A;  1OUN A;  4KFD A;  1RCL A;  5IG4 A;  4JF8 A;  5FW5 A;  1T2H A;  1ULJ B;  4RBN A;  5LC6 A;  3WHO A;  4IT7 A;  3EC9 A;  1YJN 3;  2IMJ A;  2D1W A;  2WO0 A;  3SOY A;  4EC6 A;  1B27 A;  2PZV A;  1AV4 A;  1RKY A;  2GEX A;  1E97 A;  3EE1 A;  4HM4 B;  1UI8 A;  1RGH A;  1BUQ A;  1K28 A;  2C11 A;  3OWS A;  2KXG A;  1LQG C;  3IJE B;  5CXO A;  3CCE 3;  2HOH A;  3OXA A;  1GOV A;  2CC3 A;  3T0U A;  5AYS C;  4CDL A;  1M9G A;  3FG4 A;  1CEW I;  3ZG5 A;  1ULI B;  1JN5 B;  3L0R A;  3FGY A;  2A15 A;  2K0M A;  1LOX A;  1M1X B;  3DY5 A;  5HOH A;  3IPT A;  3K0Z A;  4AKY A;  4XDV A;  5AEU B;  4XDW A;  5M18 A;  1TJD A;  4HOH A;  1YJW 3;  4L8O A;  2BMO B;  1SIH A;  2OCT A;  2YX9 A;  3UL5 A;  1JBS A;  3F7X A;  2OTL 3;  1X1W A;  1B2Z A;  3B7C A;  3H3H A;  5M19 A;  3WOF B;  6STD A;  3EBY A;  2XGL A;  1STF I;  2GEY A;  1JZO A;  1EQK A;  1TUH A;  3SLU A;  1OGX A;  1B3S A;  3FZW A;  1W5Z A;  4XBT A;  1OHP A;  1TFK A;  1W01 A;  1TFO A;  5IG0 A;  1RHL A;  1A2K A;  1W7C A;  2M7O A;  1JNQ A;  2W2C A;  1WMO A;  3NM7 A;  2FGT A;  3KZT A;  5BXQ A;  3FKA A;  1RDS A;  1RNB A;  5IG3 A;  2ZHX B;  1LXE A;  2W04 A;  1GD4 A;  5AIH A;  3HZP A;  1YNV X;  3OW2 2;  1MNL A;  7STD A;  3CCQ 3;  1PU4 A;  2AAE A;  3RNT A;  1VQ8 3;  1NB5 I;  2OQE C;  2XH9 A;  5BU4 A;  1NWW A;  1PFP A;  2CFW A;  2F99 A;  7RNT A;  1N8R 4;  2BMR B;  2E2V A;  2CG0 A;  3CCU 3;  1YJ9 3;  1T2I A;  2QGU A;  1I8V A;  5CK6 A;  4N6V 0;  3FH1 A;  3MWZ A;  1IV7 A;  5AYR B;  1YIT 3;  3LZA A;  1RGE A;  1YGW A;  3RDE A;  1QVF 2;  1GY5 A;  3T8N A;  4WYK A;  1QMA A;  4RNY A;  1N9J A;  3A5E A;  3CD6 3;  1EA2 A;  2AAD A;  3U1W A;  2FXT A;  3VGN A;  1HZ1 A;  4BTW A;  3X3Y A;  1VQM 3;  4BTX A;  3PXM A;  3I55 3;  1D6U A;  5D81 A;  3E99 A;  5LC7 A;  4FCJ A;  3V98 A;  4RNZ A;  2IY2 A;  4EW5 A;  1UUW B;  1HYF A;  1BRJ A;  1DET A;  1OPY A;  2BT3 A;  2L4V A;  3DGO A;  4N6T A;  3URP A;  3LH4 A;  4FMA A;  3CME 3;  1VQP 3;  4IIA A;  4XBY A;  2KAA A;  5HGR A;  2K54 A;  1KWI A;  1RTU A;  2GBX B;  2GU3 A;  2ZDJ A;  3JUP A;  3BIR A;  1OHO A;  4IPB A;  1FA3 A;  5BVB A;  4H3U A;  3AHS A;  1DMM A;  3NV0 B;  2SBL A;  4O2H A;  1LOW A;  4FCZ A;  4FR9 A;  2BHM A;  3HK4 A;  3CPW 2;  2CFL A;  4HM6 B;  2PNC A;  1M1K 4;  3V99 A;  1FUT A;  2UGI A;  2CIU A;  3F9S A;  1D6Z A;  1NNV A;  4G1M B;  1GSP A;  2P0X A;  3LYG A;  1EEJ A;  1KQS 2;  3FF2 A;  3U97 A;  1IVU A;  1LOY A;  2IYJ A;  3PCS A;  1DE3 A;  3K63 A;  1HU9 A;  5AIG A;  3X3Z A;  1K73 4;  3DH2 A;  3G0K A;  2CG1 A;  1VQ5 3;  3ER7 A;  3NBJ A;  3IMA B;  1OF5 A;  1U8C B;  3NM2 A;  3RGA A;  3HII A;  2RBI A;  1VZZ A;  2HML B;  3J7Y d;  2ZA4 A;  1GD3 A;  3F8H A;  4WP5 A;  4EBG A;  1RMS A;  2WOF A;  2F86 B;  1JRQ A;  1V57 A;  1UCI A;  4OK0 A;  1YGE A;  1BSD A;  1U5O A;  1O7W B;  1W6Y A;  4AEQ A;  1IVW A;  3FF0 A;  1CQS A;  1NDO B;  4KZ1 A; 
#chains in the Genus database with same CATH homology
 3D5G A;  4RNT A;  5GSP A;  1IYY A;  1FYS A;  1BSC A;  5BIR A;  2GSP A;  1BUJ A;  4BIR A;  1AY7 A;  5HOH A;  1BIR A;  1X1Y A;  2C4B A;  1JBR A;  3GSP A;  4HOH A;  7GSP A;  1BNR A;  1LNI A;  1JBS A;  1I3F A;  1X1W A;  1B2Z A;  1RGF A;  1BRN L;  1RN4 A;  1I2F A;  1BVI A;  1FZU A;  1FW7 A;  1B3S A;  1BOX A;  2F4Y A;  1RGK A;  1BSB A;  1RHL A;  1TTO A;  3HOH A;  1Q9E A;  1RGC A;  1LOV A;  1RNB A;  1RDS A;  1BAO A;  1BRI A;  1RGL A;  1ZGX A;  1YNV X;  1B2S A;  2KF4 A;  8RNT A;  1X1X A;  2AAE A;  4J5K A;  3RNT A;  9RNT A;  4J5G A;  1BGS A;  1A2P A;  5BU4 A;  7RNT A;  1BU4 A;  3AGO A;  3AHW A;  1B2X A;  1BRG A;  1T2I A;  1I8V A;  6GSP A;  1BNG A;  1MGR A;  1RGE A;  1YGW A;  1B20 A;  3Q3F A;  1X1U A;  4HAA A;  1I2G A;  1RN1 A;  5RNT A;  1I70 A;  3A5E A;  1I3I A;  3D5I A;  1MGW A;  2AAD A;  1I0X A;  1BAN A;  1HZ1 A;  1I0V A;  1UCL A;  1B21 A;  1UCK A;  4GHO A;  1B2M A;  1GMQ A;  1RGG A;  4BU4 A;  1BNJ A;  1BNF A;  1HYF A;  1BNS A;  1BRJ A;  1DET A;  1GMP A;  1GOY A;  3SYU A;  1JBT A;  3URP A;  2KAA A;  3KCH A;  1C54 A;  2KF6 A;  6RNT A;  1RTU A;  1FUS A;  1R4Y A;  3BU4 A;  2RNT A;  3BIR A;  1RNT A;  2BU4 A;  1BRS A;  1RLS A;  1BNE A;  2KF5 A;  2KF3 A;  3AHS A;  1LOW A;  1PY3 A;  1I2E A;  1TRP A;  1SAR A;  1BNI A;  1BRH A;  1FUT A;  1B2U A;  1CH0 A;  3WR2 A;  3DGY A;  1BSA A;  1GSP A;  2F56 A;  2F5W A;  1RCL A;  2BIR A;  1YVS A;  1T2H A;  1G02 A;  1DE3 A;  1LOY A;  3WHO A;  1B27 A;  1BSE A;  3DH2 A;  1UCJ A;  1TRQ A;  1GMR A;  1RCK A;  1RSN A;  3D4A A;  1PYL A;  1RGH A;  2F5M A;  2RBI A;  4GSP A;  1GOU A;  2ZA4 A;  1LRA A;  1RGA A;  1RMS A;  3AGN A;  1UCI A;  2SAR A;  1BSD A;  2HOH A;  1GOV A;  1BRK A;  1AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...