4J5GA

Crystal structure analysis of streptomyces aureofaciens ribonuclease sa t95a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of hydrogen bonds to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4j5gA00
3AHWA 1YVSA 1LOWA 1BANA 1B2UA 3AGOA 1BOXA 1YGWA 1JBRA 9RNTA 1I8VA 2KF5A 2KAAA 1BUJA 1I0XA 1B27A 1RHLA 1I3IA 1BRIA 3D5GA 1B2MA 1X1UA 5BIRA 1BSBA 1T2HA 1Q9EA 1BNEA 4HAAA 1GSPA 1BAOA 1BRHA 1B20A 1FYSA 4GSPA 1BNFA 3AGNA 1RNTA 2KF6A 1RCLA 1GMRA 1BU4A 3DH2A 1BRJA 1BGSA 1RGCA 1LOYA 1I2GA 3DGYA 1BNIA 5GSPA 1B2SA 1GMQA 1UCLA 1PYLA 3BIRA 1GOYA 1FW7A 1BSCA 2F5MA 3A5EA 3GSPA 4BIRA 1RSNA 6RNTA 1YNVX 2RNTA 7GSPA 1UCKA 1X1YA 4RNTA 1RTUA 1RGAA 4BU4A 1JBSA 1BNSA 1GOVA 3KCHA 1LRAA 6GSPA 2F4YA 5HOHA 1B21A 1B3SA 1AY7A 2RBIA 1BRGA 1X1XA 1RGFA 2HOHA 2SARA 3URPA 2F56A 5BU4A 1BRNL 1C54A 1BVIA 1BNRA 2F5WA 1DETA 1B2ZA 8RNTA 4J5KA 2BU4A 1RDSA 3D5IA 1I2EA 1A2PA 1RGEA 2AAEA 1RGLA 1BRSA 3Q3FA 1I3FA 2KF4A 1SARA 3AHSA 3WR2A 1RCKA 1RMSA 1CH0A 1LNIA 1BSDA 1RGKA 2KF3A 4J5GA 1BSAA 1RLSA 1BRKA 3RNTA 1RGGA 1FUTA 1FZUA 1DE3A 1RNBA 1RGHA 1BSEA 2ZA4A 3WHOA 1HYFA 1ZGXA 3HOHA 1JBTA 1TTOA 1BNGA 1AQZA 1UCJA 3BU4A 7RNTA 5RNTA 1RN1A 1TRPA 1FUSA 2GSPA 1B2XA 3D4AA 1R4YA 1I2FA 1GMPA 1MGWA 1RN4A 4GHOA 1MGRA 1TRQA 1GOUA 1T2IA 1HZ1A 1LOVA 1BIRA 2AADA 1UCIA 2C4BA 4HOHA 1I0VA 1BNJA 1X1WA 3SYUA 2BIRA 1IYYA 1PY3A 1G02A 1I70A
chains in the Genus database with same CATH superfamily
1IT8A 3MKIA 1NJI4 1QVF2 3WDGB 4LYLB 1EUIC 1E97A 1LOWA 1W6YA 1BANA 1Q40B 1YGWA 1EKMA 3HZPA 1ULJB 1LOXA 4Q53A 5A0OB 1IQYA 1I0XA 1IK3A 2YFJB 2BT3A 1BRIA 1WMOA 4QWTA 1YVBI 5DREA 4FCMA 5BIRA 1BSBA 1WQLB 3S28A 2F98A 3MHEA 3CCU3 1B20A 3EBYA 1F8NA 3NBJA 3CCQ3 1U5OA 1TUHA 3VF1A 1NDOB 1GMRA 4I4KA 2HMLB 1N5PA 2ZHXB 3DGYA 1W2ZA 3OXAA 4CPKA 5M19A 2CFWA 1Q7Y4 1B2SA 1IV7A 3T0UA 1R4CA 1US1A 1W01A 1TU5A 1NO3A 3NV0B 2I9WA 3CCV3 1BSCA 4XBYA 1K734 3A5EA 2P38A 4FR9A 3CPOA 1OHOA 2UX0A 4RNYA 1GS3A 3OW22 1UCKA 1X1YA 4RNTA 1RTUA 4H3UA 3EBTA 1IV9A 4HZ9B 1W2B2 2OTL3 2K0MA 3EJVA 1KSIA 3PS8A 3S27A 3T8NA 1MOLA 1STFI 2F4YA 3ER7A 4MJDA 4X2HA 1RRLA 1LQGC 2CX0A 1VQ63 3G16A 1AY7A 2CK3H 2RBIA 4EW5A 4EBGA 3BNEA 3FG1A 4N6LA 1RGFA 3FLJA 5IG4A 3F7XA 4WYKA 3JVCA 4O2HA 3VSYA 3X41A 1A90A 3JUNA 3FH1A 3B7CA 1GY7A 2R41A 1DMNA 2BMQB 3S67A 1TIJA 5G1LA 3LMLA 4J5KA 1RDSA 1ZS7A 3ZG0A 3CCS3 1T5YA 2HMJB 3SOAA 4NREA 1DMQA 3DGLA 4FCJA 1AV4A 1CYVA 1WMPA 2HMKB 2W9PA 1I3FA 2KF4A 3PXMA 3F7SA 5M1AA 3L0RA 3UB1A 3CC73 2KF3A 2A15A 3EB8A 1RLSA 4EV5A 1BRKA 4K1VA 2WGQA 1EEJA 4FMDA 3CCJ3 1RNBA 1HU9A 1O7PB 1DE3A 3K9MC 3UNLA 2ZA4A 5CF1A 4LMIA 5IF6A 1Q864 4X2OA 1HYFA 1ZGXA 1D6ZA 3F40A 3GZRA 2JQ5A 1JBTA 1M904 4HM3B 4HM8B 2XFSA 5STDA 1BUQA 1V57A 2W04A 5RNTA 2OWPA 5IG5A 1JB2A 1G96A 1LNHA 2OOVC 2CX1A 2QA43 4WWUC 1FUSA 2JDIH 4GL6A 8CHOA 1GMPA 2RSXA 5IERA 1NU3A 3G6E3 1RN4A 1YHQ3 3CXC2 5ELUA 1OF5B 1ZO2A 3MWZA 3TDGA 1TRQA 2Z76A 4K61A 1S5AA 1GOUA 1HZ1A 4BL3A 3ECFA 5JBSA 4HOHA 1JRQA 4N6MA 2W6JH 2BIRA 3DM8A 4L8OA 4O02B 4N6NB 1YIJ3 1I70A 2Z7AA 1J2BA 1K8A4 2UUGC 1M1XB 3KFQC 2GBXB 1QALA 3BNDA 4KFEA 1RRHA 5CLKA 3Q90A 1D6YA 2HMOB 4BTYA 2BMRB 4R9LA 1JN5A 2WO0A 3CMA3 1B2UA 2CFLA 1BOXA 4R4KA 1IDPA 4N6OB 1FGMA 1KC84 1VQL3 1BUJA 7STDA 3I0YA 4OVMA 1GY5A 2E2VA 3CCE3 3HIGA 1NWWA 1DVCA 5G1KA 5AYSC 1B2MA 1RKYA 1IVUA 5KP4A 4XBXA 1W4NA 3WA3A 4G1MB 1WNHA 3JUQA 3MPHA 1JB5A 1QJGA 2C11A 1A2KA 1O7NB 1QAFA 3MG3A 1FYSA 1NB3I 2GEYA 2B24B 2KF6A 3AGNA 3CU3A 4RBNA 5D83A 1FA3A 2R4IA 2WOFA 2C10A 3NM7A 3G8ZA 4MMYB 3CME3 3G0KA 3B4PA 4ZM8A 1QVG2 1Q824 1SQWA 4XM4A 1BNIA 4WP5A 2L1SA 1MWSA 2XGNA 1N9EA 2V1LA 5EQLA 2INXA 3BIRA 4J9AA 5AIFA 1FW7A 2GBWB 4HVNA 3PCSA 2CFDA 4KVHA 4BIRA 2KXGA 3IJEB 1RSNA 1YNVX 3CD63 1GD3A 1TP6A 3I563 2GU1A 3OWYA 1JBSA 1GOVA 4H61A 6GSPA 2D1WA 4ILFA 1OUNA 4CJNA 3FGYA 1W6GA 1B21A 3LYGA 4LEHA 5IG0A 2IUKA 3S29A 3LTCA 3MG2A 4XBTA 1VQ43 5IENA 4JF8A 1BRNL 2F56A 2BHMA 3WODG 5JPPA 4BTXA 1TFOA 4HM7B 3UJMA 3SEDA 2F5WA 4BTWA 1DETA 4EYCA 1CQSA 1GD4A 3DY5A 2GU3A 1NB5I 1OGZA 2QGUA 2BU4A 4K90B 1OH0A 3DUKA 3ZFZA 3LTDA 3SXXA 5BXQA 1I2EA 4LZIA 1RGEA 1SIHA 3DZLA 2AAEA 1RGLA 3OWUA 1BRSA 3G713 4OUQA 2W9QA 1K28A 5AYRB 1RCKA 3ALAA 3LTBA 1UW1A 2E2TA 1RGKA 2CWUA 2FXTA 4IIAA 4WYKB 1BSAA 1ROAA 3EE1A 3WMDA 1SJWA 1FGTA 4MMZB 3LXUX 3RNTA 1RGGA 1FUTA 1FZUA 3SVAA 5KP1A 1RGHA 1L5GB 1M9GA 4O3VA 3WHOA 4HM6B 2IYJA 2CC3A 2P09A 1VQ83 4N6TA 2LYXA 3UL5A 5AEUB 1VQ93 3EX9A 2Z6BA 5LC6A 2ML6A 1SPUA 1EQKA 3SX1A 1A67A 4KFFA 2XR8B 1JV2B 2GSPA 5AI1A 1B2XA 2Z77A 1OHSA 2HMMB 3KIIA 1ROVA 1UUGB 5IG3A 3K5TA 3VGNA 4NHFA 1MGRA 1UI7A 4HM2B 3MG1A 1T2IA 1LOVA 3FG4A 4KT3B 1AVKA 3GZYB 1BIRA 4HM0B 1AVLA 1I0VA 1BNJA 3JUMA 2CH9A 3KKGA 5DRVA 3SYUA 1YGEA 2QEX3 1PY3A 3CNXA 4KZ1A 1G02A 1RGCA 1BGSA 2OTJ3 3AHWA 1JJ22 3U97A 5HGRA 2W0QA 4TX4A 3Q2PA 2GXFA 3BLZA 3NQZA 1CYUA 3BB9A 3X3XA 3NM2A 1C7HA 1I8VA 9RNTA 2KAAA 1UUWB 3FKAA 4I5QA 2STDA 1B27A 3D5GA 1I3IA 3KE7A 5TGNA 3FCSB 1X1UA 1IT7A 1T2HA 2PZVA 1FUWA 3V98A 1Q9EA 1BNEA 3K0ZA 4IT7A 2WOHA 3CC43 2IMJA 1GSPA 5IEPA 2H0HA 1VQ53 3D9RA 3BNBA 1JN5B 2IUJA 3G4S3 3WA2X 1YI23 4OK0A 1FGOA 1RCLA 1W02A 2CFKA 3EQQB 2F86B 4HM4B 3E99A 3KSED 1TFKA 1V74A 3X40A 4HKVB 1YJ93 2PNCA 1A2VA 3NUVA 3NHXA 5GSPA 1GMQA 1UCLA 1AR0A 1IVWA 1Y4KA 3PGBA 3B4OA 3KSPA 3SOYA 1PU4A 2RCDA 4R80A 2F5MA 3RGAA 3D79A 2XSHB 3GSPA 3H3HA 2P0XA 1UUVB 3PZWA 2GEXA 3CNMA 2XEPA 4O8SA 3NX0A 2OQEA 2RNTA 7GSPA 4BU4A 1DMMA 3K63A 3CCL3 3CCM3 5D81A 3KCHA 1LRAA 4WHAA 3GZXB 1JNQA 3LT8A 3F9SA 4HJLB 2M7OA 3DGOA 4FMBA 4N6V0 4FMCA 3NBRA 4IPBA 3MSOA 1LQMB 1JKGB 1GYBA 2H0GA 1BRGA 1W7CA 2Y73A 2HOHA 1VQP3 1FGRA 2SARA 3DGMA 5BU4A 1C54A 3EN8A 5CXOA 4N3VA 3FG3A 2Q07A 4AEQA 4N6UA 3LT9A 2RGQA 1QAKA 1B2ZA 5FW5A 1RN7A 1MWRA 5KP3A 3X42A 3FSDA 1JKGA 1UGHI 3JUPA 2XFTA 4BL2A 2K3DA 3Q1CA 4CDLA 2OCTA 4DKIA 1A2PA 3NQYA 3QK9A 1KWIA 2J8XB 1UI8A 3PCRA 3Q3FA 1EG9B 4WFOA 1W5ZA 1SARA 3AHSA 2RFRA 5G2GA 3SLUA 3CCR3 1CEWI 1CH0A 1LNIA 3STDA 3GRDA 4PEJA 1W00A 2CW9A 1WMNA 1M1K4 1TJDA 2YFLB 3CC23 2O9UX 5CK6A 1LVNA 1JB4A 5AEWB 2ML5A 3X3ZA 5BVBA 3LOYA 3IPTA 2XF3A 3HIIA 1LXEA 3O8YA 2IA7A 5FGOA 1AQZA 5I97A 1G0TA 1RJOA 7RNTA 1JZOA 2W2CA 4HZBB 1IVVA 1SIIA 1RN1A 2P0MA 1MWTA 3FF0A 2QIYA 5EVHA 1TRPA 2ZL8A 1FGQA 6STDA 1S723 1VQO3 2BO9B 2CG1A 1MGWA 1Q40A 2LQVA 1N8QA 3F8XA 1ISKA 5LC7A 1OPYA 3OWSA 1PFPA 2XGLA 3LTAA 4R9KA 1IQXA 1MNLA 1Q42A 2ZDJA 2CIUA 4LSOA 5JPUA 2C4BA 2W03A 2D42A 3EN1B 2FGTA 1VQN3 2F99A 1JZDA 1ULIB 3AMOB 1YVSA 5ELJA 2H0IA 1OHPA 1VZZA 3AGOA 1GY6A 3PYJA 1JBRA 2BMOB 2KF5A 1E3RA 4MEIA 2XSOB 3DXOA 4J8TA 1Q7HA 1YJW3 1RHLA 1W6CA 2UGIA 4L8PA 1T3BA 3RDEA 3AMOA 3LH4A 4CCVA 4XDVA 3BNCA 3IMAB 4HAAA 1UGIA 3S5CA 3NV0A 3I553 3EF8A 1OGXA 1BAOA 1BRHA 1IQ8A 1O7MB 1STDA 3A76A 3FF2A 1N5HA 3GWRA 4R1KA 4GSPA 3ZG5A 4AKYA 1BNFA 1RNTA 1KQS2 1K9M4 3OX9A 3U1WA 2E2UA 1V58A 1BU4A 3DH2A 1BRJA 3K7CA 4FCZA 4AKZA 3ROBA 1ASKA 1I2GA 1LOYA 5AIGA 1N8R4 3T8UA 1PYLA 1NNVA 3MYTA 2OOVA 1GOYA 1N9JA 3JUOA 1IU7A 4EC6A 3H51A 2KRTA 1YJN3 2MF7A 5EEOA 5M18A 2P05A 3N8BA 3WOEB 1O7WB 6RNTA 3HX8A 2L4VA 4EV2A 1RGAA 3J7Yd 4JRFA 1BNSA 1HKXA 3HK4A 4LGQA 4HYZA 5D82A 5HOHA 1VQ73 1B3SA 1ZX2A 4FMAA 2MC8A 1K41A 2KCDA 2XRXB 1X1XA 3URPA 1BVIA 4L7KA 2HMNB 3KN4A 3DMCA 3F14A 3OV4A 2WGOA 1VQK3 1BNRA 1VQQA 2CKFB 1DYUA 3X3YA 4K1UA 8RNTA 1E3VA 1QMAA 2Y74A 5IW9A 2B1XB 3B8LA 4XDWA 2IY2A 3D5IA 4RZMA 2YX9A 3V99A 2W56B 3WOFB 2CG0A 4U13A 3EC9A 3RGRA 3NXJA 3CPW2 2YFIB 4EXRA 4RNZA 4HM5B 1OCVA 4MMXB 4NPBA 1Z1SA 1MWUA 1RMSA 2CFGA 3WR2A 4J5GA 1BSDA 1U8CB 2CHCA 2K54A 2SBLA 3F8HA 5AIHA 1EA2A 5AIIA 2W56A 1IVXA 2XH9A 3HI7A 1BSEA 2CWVA 1OF5A 4STDA 1O7GB 5IEOA 3HOHA 3GZBA 4GB5A 1TTOA 1BNGA 1UCJA 1YIT3 3FZWA 3BU4A 1Q814 2CWTA 3N54B 2BNGA 1D6UA 2O3OA 4HM1B 3LZAA 3N9HA 3D4AA 1OACA 1I2FA 1R4YA 3EHCA 3UL6A 1DVDA 3NBBA 4XB5A 2FNQA 3D3LA 3GAXA 3M8CA 4GHOA 2OQEC 3DGNA 3KZTA 3V92A 1WTHA 1UDII 5CF2A 4HBRA 4KFDA 1KD14 1UCIA 1VQM3 1X1WA 4ORLA 3QRDA 1IYYA 1O7HB 2AADA
chains in the Genus database with same CATH topology
3AHWA 1YVSA 1LOWA 1BANA 1B2UA 3AGOA 1BOXA 1YGWA 1JBRA 9RNTA 1I8VA 2KF5A 2KAAA 1BUJA 1I0XA 1B27A 1RHLA 1I3IA 1BRIA 3D5GA 1B2MA 1X1UA 5BIRA 1BSBA 1T2HA 1Q9EA 1BNEA 4HAAA 1GSPA 1BAOA 1BRHA 1B20A 1FYSA 4GSPA 1BNFA 3AGNA 1RNTA 2KF6A 1RCLA 1GMRA 1BU4A 3DH2A 1BRJA 1BGSA 1RGCA 1LOYA 1I2GA 3DGYA 1BNIA 5GSPA 1B2SA 1GMQA 1UCLA 1PYLA 3BIRA 1GOYA 1FW7A 1BSCA 2F5MA 3A5EA 3GSPA 4BIRA 1RSNA 6RNTA 1YNVX 2RNTA 7GSPA 1UCKA 1X1YA 4RNTA 1RTUA 1RGAA 4BU4A 1JBSA 1BNSA 1GOVA 3KCHA 1LRAA 6GSPA 2F4YA 5HOHA 1B21A 1B3SA 1AY7A 2RBIA 1BRGA 1X1XA 1RGFA 2HOHA 2SARA 3URPA 2F56A 5BU4A 1BRNL 1C54A 1BVIA 1BNRA 2F5WA 1DETA 1B2ZA 8RNTA 4J5KA 2BU4A 1RDSA 3D5IA 1I2EA 1A2PA 1RGEA 2AAEA 1RGLA 1BRSA 3Q3FA 1I3FA 2KF4A 1SARA 3AHSA 3WR2A 1RCKA 1RMSA 1CH0A 1LNIA 1BSDA 1RGKA 2KF3A 4J5GA 1BSAA 1RLSA 1BRKA 3RNTA 1RGGA 1FUTA 1FZUA 1DE3A 1RNBA 1RGHA 1BSEA 2ZA4A 3WHOA 1HYFA 1ZGXA 3HOHA 1JBTA 1TTOA 1BNGA 1AQZA 1UCJA 3BU4A 7RNTA 5RNTA 1RN1A 1TRPA 1FUSA 2GSPA 1B2XA 3D4AA 1R4YA 1I2FA 1GMPA 1MGWA 1RN4A 4GHOA 1MGRA 1TRQA 1GOUA 1T2IA 1HZ1A 1LOVA 1BIRA 2AADA 1UCIA 2C4BA 4HOHA 1I0VA 1BNJA 1X1WA 3SYUA 2BIRA 1IYYA 1PY3A 1G02A 1I70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHW A;  1YVS A;  1LOW A;  1BAN A;  1B2U A;  3AGO A;  1BOX A;  1YGW A;  1JBR A;  9RNT A;  1I8V A;  2KF5 A;  2KAA A;  1BUJ A;  1I0X A;  1B27 A;  1RHL A;  1I3I A;  1BRI A;  3D5G A;  1B2M A;  1X1U A;  5BIR A;  1BSB A;  1T2H A;  1Q9E A;  1BNE A;  4HAA A;  1GSP A;  1BAO A;  1BRH A;  1B20 A;  1FYS A;  4GSP A;  1BNF A;  3AGN A;  1RNT A;  2KF6 A;  1RCL A;  1GMR A;  1BU4 A;  3DH2 A;  1BRJ A;  1BGS A;  1RGC A;  1LOY A;  1I2G A;  3DGY A;  1BNI A;  5GSP A;  1B2S A;  1GMQ A;  1UCL A;  1PYL A;  3BIR A;  1GOY A;  1FW7 A;  1BSC A;  2F5M A;  3A5E A;  3GSP A;  4BIR A;  1RSN A;  6RNT A;  1YNV X;  2RNT A;  7GSP A;  1UCK A;  1X1Y A;  4RNT A;  1RTU A;  1RGA A;  4BU4 A;  1JBS A;  1BNS A;  1GOV A;  3KCH A;  1LRA A;  6GSP A;  2F4Y A;  5HOH A;  1B21 A;  1B3S A;  1AY7 A;  2RBI A;  1BRG A;  1X1X A;  1RGF A;  2HOH A;  2SAR A;  3URP A;  2F56 A;  5BU4 A;  1BRN L;  1C54 A;  1BVI A;  1BNR A;  2F5W A;  1DET A;  1B2Z A;  8RNT A;  4J5K A;  2BU4 A;  1RDS A;  3D5I A;  1I2E A;  1A2P A;  1RGE A;  2AAE A;  1RGL A;  1BRS A;  3Q3F A;  1I3F A;  2KF4 A;  1SAR A;  3AHS A;  3WR2 A;  1RCK A;  1RMS A;  1CH0 A;  1LNI A;  1BSD A;  1RGK A;  2KF3 A;  4J5G A;  1BSA A;  1RLS A;  1BRK A;  3RNT A;  1RGG A;  1FUT A;  1FZU A;  1DE3 A;  1RNB A;  1RGH A;  1BSE A;  2ZA4 A;  3WHO A;  1HYF A;  1ZGX A;  3HOH A;  1JBT A;  1TTO A;  1BNG A;  1AQZ A;  1UCJ A;  3BU4 A;  7RNT A;  5RNT A;  1RN1 A;  1TRP A;  1FUS A;  2GSP A;  1B2X A;  3D4A A;  1R4Y A;  1I2F A;  1GMP A;  1MGW A;  1RN4 A;  4GHO A;  1MGR A;  1TRQ A;  1GOU A;  1T2I A;  1HZ1 A;  1LOV A;  1BIR A;  2AAD A;  1UCI A;  2C4B A;  4HOH A;  1I0V A;  1BNJ A;  1X1W A;  3SYU A;  2BIR A;  1IYY A;  1PY3 A;  1G02 A;  1I70 A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  3MKI A;  1NJI 4;  1QVF 2;  3WDG B;  4LYL B;  1EUI C;  1E97 A;  1LOW A;  1W6Y A;  1BAN A;  1Q40 B;  1YGW A;  1EKM A;  3HZP A;  1ULJ B;  1LOX A;  4Q53 A;  5A0O B;  1IQY A;  1I0X A;  1IK3 A;  2YFJ B;  2BT3 A;  1BRI A;  1WMO A;  4QWT A;  1YVB I;  5DRE A;  4FCM A;  5BIR A;  1BSB A;  1WQL B;  3S28 A;  2F98 A;  3MHE A;  3CCU 3;  1B20 A;  3EBY A;  1F8N A;  3NBJ A;  3CCQ 3;  1U5O A;  1TUH A;  3VF1 A;  1NDO B;  1GMR A;  4I4K A;  2HML B;  1N5P A;  2ZHX B;  3DGY A;  1W2Z A;  3OXA A;  4CPK A;  5M19 A;  2CFW A;  1Q7Y 4;  1B2S A;  1IV7 A;  3T0U A;  1R4C A;  1US1 A;  1W01 A;  1TU5 A;  1NO3 A;  3NV0 B;  2I9W A;  3CCV 3;  1BSC A;  4XBY A;  1K73 4;  3A5E A;  2P38 A;  4FR9 A;  3CPO A;  1OHO A;  2UX0 A;  4RNY A;  1GS3 A;  3OW2 2;  1UCK A;  1X1Y A;  4RNT A;  1RTU A;  4H3U A;  3EBT A;  1IV9 A;  4HZ9 B;  1W2B 2;  2OTL 3;  2K0M A;  3EJV A;  1KSI A;  3PS8 A;  3S27 A;  3T8N A;  1MOL A;  1STF I;  2F4Y A;  3ER7 A;  4MJD A;  4X2H A;  1RRL A;  1LQG C;  2CX0 A;  1VQ6 3;  3G16 A;  1AY7 A;  2CK3 H;  2RBI A;  4EW5 A;  4EBG A;  3BNE A;  3FG1 A;  4N6L A;  1RGF A;  3FLJ A;  5IG4 A;  3F7X A;  4WYK A;  3JVC A;  4O2H A;  3VSY A;  3X41 A;  1A90 A;  3JUN A;  3FH1 A;  3B7C A;  1GY7 A;  2R41 A;  1DMN A;  2BMQ B;  3S67 A;  1TIJ A;  5G1L A;  3LML A;  4J5K A;  1RDS A;  1ZS7 A;  3ZG0 A;  3CCS 3;  1T5Y A;  2HMJ B;  3SOA A;  4NRE A;  1DMQ A;  3DGL A;  4FCJ A;  1AV4 A;  1CYV A;  1WMP A;  2HMK B;  2W9P A;  1I3F A;  2KF4 A;  3PXM A;  3F7S A;  5M1A A;  3L0R A;  3UB1 A;  3CC7 3;  2KF3 A;  2A15 A;  3EB8 A;  1RLS A;  4EV5 A;  1BRK A;  4K1V A;  2WGQ A;  1EEJ A;  4FMD A;  3CCJ 3;  1RNB A;  1HU9 A;  1O7P B;  1DE3 A;  3K9M C;  3UNL A;  2ZA4 A;  5CF1 A;  4LMI A;  5IF6 A;  1Q86 4;  4X2O A;  1HYF A;  1ZGX A;  1D6Z A;  3F40 A;  3GZR A;  2JQ5 A;  1JBT A;  1M90 4;  4HM3 B;  4HM8 B;  2XFS A;  5STD A;  1BUQ A;  1V57 A;  2W04 A;  5RNT A;  2OWP A;  5IG5 A;  1JB2 A;  1G96 A;  1LNH A;  2OOV C;  2CX1 A;  2QA4 3;  4WWU C;  1FUS A;  2JDI H;  4GL6 A;  8CHO A;  1GMP A;  2RSX A;  5IER A;  1NU3 A;  3G6E 3;  1RN4 A;  1YHQ 3;  3CXC 2;  5ELU A;  1OF5 B;  1ZO2 A;  3MWZ A;  3TDG A;  1TRQ A;  2Z76 A;  4K61 A;  1S5A A;  1GOU A;  1HZ1 A;  4BL3 A;  3ECF A;  5JBS A;  4HOH A;  1JRQ A;  4N6M A;  2W6J H;  2BIR A;  3DM8 A;  4L8O A;  4O02 B;  4N6N B;  1YIJ 3;  1I70 A;  2Z7A A;  1J2B A;  1K8A 4;  2UUG C;  1M1X B;  3KFQ C;  2GBX B;  1QAL A;  3BND A;  4KFE A;  1RRH A;  5CLK A;  3Q90 A;  1D6Y A;  2HMO B;  4BTY A;  2BMR B;  4R9L A;  1JN5 A;  2WO0 A;  3CMA 3;  1B2U A;  2CFL A;  1BOX A;  4R4K A;  1IDP A;  4N6O B;  1FGM A;  1KC8 4;  1VQL 3;  1BUJ A;  7STD A;  3I0Y A;  4OVM A;  1GY5 A;  2E2V A;  3CCE 3;  3HIG A;  1NWW A;  1DVC A;  5G1K A;  5AYS C;  1B2M A;  1RKY A;  1IVU A;  5KP4 A;  4XBX A;  1W4N A;  3WA3 A;  4G1M B;  1WNH A;  3JUQ A;  3MPH A;  1JB5 A;  1QJG A;  2C11 A;  1A2K A;  1O7N B;  1QAF A;  3MG3 A;  1FYS A;  1NB3 I;  2GEY A;  2B24 B;  2KF6 A;  3AGN A;  3CU3 A;  4RBN A;  5D83 A;  1FA3 A;  2R4I A;  2WOF A;  2C10 A;  3NM7 A;  3G8Z A;  4MMY B;  3CME 3;  3G0K A;  3B4P A;  4ZM8 A;  1QVG 2;  1Q82 4;  1SQW A;  4XM4 A;  1BNI A;  4WP5 A;  2L1S A;  1MWS A;  2XGN A;  1N9E A;  2V1L A;  5EQL A;  2INX A;  3BIR A;  4J9A A;  5AIF A;  1FW7 A;  2GBW B;  4HVN A;  3PCS A;  2CFD A;  4KVH A;  4BIR A;  2KXG A;  3IJE B;  1RSN A;  1YNV X;  3CD6 3;  1GD3 A;  1TP6 A;  3I56 3;  2GU1 A;  3OWY A;  1JBS A;  1GOV A;  4H61 A;  6GSP A;  2D1W A;  4ILF A;  1OUN A;  4CJN A;  3FGY A;  1W6G A;  1B21 A;  3LYG A;  4LEH A;  5IG0 A;  2IUK A;  3S29 A;  3LTC A;  3MG2 A;  4XBT A;  1VQ4 3;  5IEN A;  4JF8 A;  1BRN L;  2F56 A;  2BHM A;  3WOD G;  5JPP A;  4BTX A;  1TFO A;  4HM7 B;  3UJM A;  3SED A;  2F5W A;  4BTW A;  1DET A;  4EYC A;  1CQS A;  1GD4 A;  3DY5 A;  2GU3 A;  1NB5 I;  1OGZ A;  2QGU A;  2BU4 A;  4K90 B;  1OH0 A;  3DUK A;  3ZFZ A;  3LTD A;  3SXX A;  5BXQ A;  1I2E A;  4LZI A;  1RGE A;  1SIH A;  3DZL A;  2AAE A;  1RGL A;  3OWU A;  1BRS A;  3G71 3;  4OUQ A;  2W9Q A;  1K28 A;  5AYR B;  1RCK A;  3ALA A;  3LTB A;  1UW1 A;  2E2T A;  1RGK A;  2CWU A;  2FXT A;  4IIA A;  4WYK B;  1BSA A;  1ROA A;  3EE1 A;  3WMD A;  1SJW A;  1FGT A;  4MMZ B;  3LXU X;  3RNT A;  1RGG A;  1FUT A;  1FZU A;  3SVA A;  5KP1 A;  1RGH A;  1L5G B;  1M9G A;  4O3V A;  3WHO A;  4HM6 B;  2IYJ A;  2CC3 A;  2P09 A;  1VQ8 3;  4N6T A;  2LYX A;  3UL5 A;  5AEU B;  1VQ9 3;  3EX9 A;  2Z6B A;  5LC6 A;  2ML6 A;  1SPU A;  1EQK A;  3SX1 A;  1A67 A;  4KFF A;  2XR8 B;  1JV2 B;  2GSP A;  5AI1 A;  1B2X A;  2Z77 A;  1OHS A;  2HMM B;  3KII A;  1ROV A;  1UUG B;  5IG3 A;  3K5T A;  3VGN A;  4NHF A;  1MGR A;  1UI7 A;  4HM2 B;  3MG1 A;  1T2I A;  1LOV A;  3FG4 A;  4KT3 B;  1AVK A;  3GZY B;  1BIR A;  4HM0 B;  1AVL A;  1I0V A;  1BNJ A;  3JUM A;  2CH9 A;  3KKG A;  5DRV A;  3SYU A;  1YGE A;  2QEX 3;  1PY3 A;  3CNX A;  4KZ1 A;  1G02 A;  1RGC A;  1BGS A;  2OTJ 3;  3AHW A;  1JJ2 2;  3U97 A;  5HGR A;  2W0Q A;  4TX4 A;  3Q2P A;  2GXF A;  3BLZ A;  3NQZ A;  1CYU A;  3BB9 A;  3X3X A;  3NM2 A;  1C7H A;  1I8V A;  9RNT A;  2KAA A;  1UUW B;  3FKA A;  4I5Q A;  2STD A;  1B27 A;  3D5G A;  1I3I A;  3KE7 A;  5TGN A;  3FCS B;  1X1U A;  1IT7 A;  1T2H A;  2PZV A;  1FUW A;  3V98 A;  1Q9E A;  1BNE A;  3K0Z A;  4IT7 A;  2WOH A;  3CC4 3;  2IMJ A;  1GSP A;  5IEP A;  2H0H A;  1VQ5 3;  3D9R A;  3BNB A;  1JN5 B;  2IUJ A;  3G4S 3;  3WA2 X;  1YI2 3;  4OK0 A;  1FGO A;  1RCL A;  1W02 A;  2CFK A;  3EQQ B;  2F86 B;  4HM4 B;  3E99 A;  3KSE D;  1TFK A;  1V74 A;  3X40 A;  4HKV B;  1YJ9 3;  2PNC A;  1A2V A;  3NUV A;  3NHX A;  5GSP A;  1GMQ A;  1UCL A;  1AR0 A;  1IVW A;  1Y4K A;  3PGB A;  3B4O A;  3KSP A;  3SOY A;  1PU4 A;  2RCD A;  4R80 A;  2F5M A;  3RGA A;  3D79 A;  2XSH B;  3GSP A;  3H3H A;  2P0X A;  1UUV B;  3PZW A;  2GEX A;  3CNM A;  2XEP A;  4O8S A;  3NX0 A;  2OQE A;  2RNT A;  7GSP A;  4BU4 A;  1DMM A;  3K63 A;  3CCL 3;  3CCM 3;  5D81 A;  3KCH A;  1LRA A;  4WHA A;  3GZX B;  1JNQ A;  3LT8 A;  3F9S A;  4HJL B;  2M7O A;  3DGO A;  4FMB A;  4N6V 0;  4FMC A;  3NBR A;  4IPB A;  3MSO A;  1LQM B;  1JKG B;  1GYB A;  2H0G A;  1BRG A;  1W7C A;  2Y73 A;  2HOH A;  1VQP 3;  1FGR A;  2SAR A;  3DGM A;  5BU4 A;  1C54 A;  3EN8 A;  5CXO A;  4N3V A;  3FG3 A;  2Q07 A;  4AEQ A;  4N6U A;  3LT9 A;  2RGQ A;  1QAK A;  1B2Z A;  5FW5 A;  1RN7 A;  1MWR A;  5KP3 A;  3X42 A;  3FSD A;  1JKG A;  1UGH I;  3JUP A;  2XFT A;  4BL2 A;  2K3D A;  3Q1C A;  4CDL A;  2OCT A;  4DKI A;  1A2P A;  3NQY A;  3QK9 A;  1KWI A;  2J8X B;  1UI8 A;  3PCR A;  3Q3F A;  1EG9 B;  4WFO A;  1W5Z A;  1SAR A;  3AHS A;  2RFR A;  5G2G A;  3SLU A;  3CCR 3;  1CEW I;  1CH0 A;  1LNI A;  3STD A;  3GRD A;  4PEJ A;  1W00 A;  2CW9 A;  1WMN A;  1M1K 4;  1TJD A;  2YFL B;  3CC2 3;  2O9U X;  5CK6 A;  1LVN A;  1JB4 A;  5AEW B;  2ML5 A;  3X3Z A;  5BVB A;  3LOY A;  3IPT A;  2XF3 A;  3HII A;  1LXE A;  3O8Y A;  2IA7 A;  5FGO A;  1AQZ A;  5I97 A;  1G0T A;  1RJO A;  7RNT A;  1JZO A;  2W2C A;  4HZB B;  1IVV A;  1SII A;  1RN1 A;  2P0M A;  1MWT A;  3FF0 A;  2QIY A;  5EVH A;  1TRP A;  2ZL8 A;  1FGQ A;  6STD A;  1S72 3;  1VQO 3;  2BO9 B;  2CG1 A;  1MGW A;  1Q40 A;  2LQV A;  1N8Q A;  3F8X A;  1ISK A;  5LC7 A;  1OPY A;  3OWS A;  1PFP A;  2XGL A;  3LTA A;  4R9K A;  1IQX A;  1MNL A;  1Q42 A;  2ZDJ A;  2CIU A;  4LSO A;  5JPU A;  2C4B A;  2W03 A;  2D42 A;  3EN1 B;  2FGT A;  1VQN 3;  2F99 A;  1JZD A;  1ULI B;  3AMO B;  1YVS A;  5ELJ A;  2H0I A;  1OHP A;  1VZZ A;  3AGO A;  1GY6 A;  3PYJ A;  1JBR A;  2BMO B;  2KF5 A;  1E3R A;  4MEI A;  2XSO B;  3DXO A;  4J8T A;  1Q7H A;  1YJW 3;  1RHL A;  1W6C A;  2UGI A;  4L8P A;  1T3B A;  3RDE A;  3AMO A;  3LH4 A;  4CCV A;  4XDV A;  3BNC A;  3IMA B;  4HAA A;  1UGI A;  3S5C A;  3NV0 A;  3I55 3;  3EF8 A;  1OGX A;  1BAO A;  1BRH A;  1IQ8 A;  1O7M B;  1STD A;  3A76 A;  3FF2 A;  1N5H A;  3GWR A;  4R1K A;  4GSP A;  3ZG5 A;  4AKY A;  1BNF A;  1RNT A;  1KQS 2;  1K9M 4;  3OX9 A;  3U1W A;  2E2U A;  1V58 A;  1BU4 A;  3DH2 A;  1BRJ A;  3K7C A;  4FCZ A;  4AKZ A;  3ROB A;  1ASK A;  1I2G A;  1LOY A;  5AIG A;  1N8R 4;  3T8U A;  1PYL A;  1NNV A;  3MYT A;  2OOV A;  1GOY A;  1N9J A;  3JUO A;  1IU7 A;  4EC6 A;  3H51 A;  2KRT A;  1YJN 3;  2MF7 A;  5EEO A;  5M18 A;  2P05 A;  3N8B A;  3WOE B;  1O7W B;  6RNT A;  3HX8 A;  2L4V A;  4EV2 A;  1RGA A;  3J7Y d;  4JRF A;  1BNS A;  1HKX A;  3HK4 A;  4LGQ A;  4HYZ A;  5D82 A;  5HOH A;  1VQ7 3;  1B3S A;  1ZX2 A;  4FMA A;  2MC8 A;  1K41 A;  2KCD A;  2XRX B;  1X1X A;  3URP A;  1BVI A;  4L7K A;  2HMN B;  3KN4 A;  3DMC A;  3F14 A;  3OV4 A;  2WGO A;  1VQK 3;  1BNR A;  1VQQ A;  2CKF B;  1DYU A;  3X3Y A;  4K1U A;  8RNT A;  1E3V A;  1QMA A;  2Y74 A;  5IW9 A;  2B1X B;  3B8L A;  4XDW A;  2IY2 A;  3D5I A;  4RZM A;  2YX9 A;  3V99 A;  2W56 B;  3WOF B;  2CG0 A;  4U13 A;  3EC9 A;  3RGR A;  3NXJ A;  3CPW 2;  2YFI B;  4EXR A;  4RNZ A;  4HM5 B;  1OCV A;  4MMX B;  4NPB A;  1Z1S A;  1MWU A;  1RMS A;  2CFG A;  3WR2 A;  4J5G A;  1BSD A;  1U8C B;  2CHC A;  2K54 A;  2SBL A;  3F8H A;  5AIH A;  1EA2 A;  5AII A;  2W56 A;  1IVX A;  2XH9 A;  3HI7 A;  1BSE A;  2CWV A;  1OF5 A;  4STD A;  1O7G B;  5IEO A;  3HOH A;  3GZB A;  4GB5 A;  1TTO A;  1BNG A;  1UCJ A;  1YIT 3;  3FZW A;  3BU4 A;  1Q81 4;  2CWT A;  3N54 B;  2BNG A;  1D6U A;  2O3O A;  4HM1 B;  3LZA A;  3N9H A;  3D4A A;  1OAC A;  1I2F A;  1R4Y A;  3EHC A;  3UL6 A;  1DVD A;  3NBB A;  4XB5 A;  2FNQ A;  3D3L A;  3GAX A;  3M8C A;  4GHO A;  2OQE C;  3DGN A;  3KZT A;  3V92 A;  1WTH A;  1UDI I;  5CF2 A;  4HBR A;  4KFD A;  1KD1 4;  1UCI A;  1VQM 3;  1X1W A;  4ORL A;  3QRD A;  1IYY A;  1O7H B;  2AAD A; 
#chains in the Genus database with same CATH homology
 3AHW A;  1YVS A;  1LOW A;  1BAN A;  1B2U A;  3AGO A;  1BOX A;  1YGW A;  1JBR A;  9RNT A;  1I8V A;  2KF5 A;  2KAA A;  1BUJ A;  1I0X A;  1B27 A;  1RHL A;  1I3I A;  1BRI A;  3D5G A;  1B2M A;  1X1U A;  5BIR A;  1BSB A;  1T2H A;  1Q9E A;  1BNE A;  4HAA A;  1GSP A;  1BAO A;  1BRH A;  1B20 A;  1FYS A;  4GSP A;  1BNF A;  3AGN A;  1RNT A;  2KF6 A;  1RCL A;  1GMR A;  1BU4 A;  3DH2 A;  1BRJ A;  1BGS A;  1RGC A;  1LOY A;  1I2G A;  3DGY A;  1BNI A;  5GSP A;  1B2S A;  1GMQ A;  1UCL A;  1PYL A;  3BIR A;  1GOY A;  1FW7 A;  1BSC A;  2F5M A;  3A5E A;  3GSP A;  4BIR A;  1RSN A;  6RNT A;  1YNV X;  2RNT A;  7GSP A;  1UCK A;  1X1Y A;  4RNT A;  1RTU A;  1RGA A;  4BU4 A;  1JBS A;  1BNS A;  1GOV A;  3KCH A;  1LRA A;  6GSP A;  2F4Y A;  5HOH A;  1B21 A;  1B3S A;  1AY7 A;  2RBI A;  1BRG A;  1X1X A;  1RGF A;  2HOH A;  2SAR A;  3URP A;  2F56 A;  5BU4 A;  1BRN L;  1C54 A;  1BVI A;  1BNR A;  2F5W A;  1DET A;  1B2Z A;  8RNT A;  4J5K A;  2BU4 A;  1RDS A;  3D5I A;  1I2E A;  1A2P A;  1RGE A;  2AAE A;  1RGL A;  1BRS A;  3Q3F A;  1I3F A;  2KF4 A;  1SAR A;  3AHS A;  3WR2 A;  1RCK A;  1RMS A;  1CH0 A;  1LNI A;  1BSD A;  1RGK A;  2KF3 A;  4J5G A;  1BSA A;  1RLS A;  1BRK A;  3RNT A;  1RGG A;  1FUT A;  1FZU A;  1DE3 A;  1RNB A;  1RGH A;  1BSE A;  2ZA4 A;  3WHO A;  1HYF A;  1ZGX A;  3HOH A;  1JBT A;  1TTO A;  1BNG A;  1AQZ A;  1UCJ A;  3BU4 A;  7RNT A;  5RNT A;  1RN1 A;  1TRP A;  1FUS A;  2GSP A;  1B2X A;  3D4A A;  1R4Y A;  1I2F A;  1GMP A;  1MGW A;  1RN4 A;  4GHO A;  1MGR A;  1TRQ A;  1GOU A;  1T2I A;  1HZ1 A;  1LOV A;  1BIR A;  2AAD A;  1UCI A;  2C4B A;  4HOH A;  1I0V A;  1BNJ A;  1X1W A;  3SYU A;  2BIR A;  1IYY A;  1PY3 A;  1G02 A;  1I70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...