4J5RA

Targ1 (c6orf130), terminal adp-ribose glycohydrolase 1 bound to adp-hpd
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
SRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords O-acetyl-ADP-ribose deacetylase 1
total genus 48
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j5rA00
5FSVA 4J5SA 1LANA 4GVVA 1NJRA 3EW5A 4ETJA 5FSZA 1VHUA 3SIHA 3KR4A 5E3BA 3SIJA 4ZY0A 5DUSA 4ABLA 2X47A 3T8WA 5FSYA 4K3NA 5FSUA 3KQXA 3V45A 5D8NA 1LCPA 2FAVA 5CB3A 1TXZA 4ESSA 3EWOA 1GYTA 3SIGA 3IJ3A 1LAPA 1LAMA 3H8GA 1ZR5A 4TU0A 3EWPA 5CMSA 3EJFA 3V2BA 4GVWA 3JZTA 4J4ZA 3GPQA 3VFQA 2BFRA 2L8RA 4JLLA 1SPVA 1BLLE 3Q6ZA 4ZX9A 1BPNA 2ACFA 3JRUA 1TY8A 3IIDA 4ZX8A 3IIFA 3KQZA 2J9AA 4J5QA 4KYBA 1ZR3A 4JCAA 4R7MA 4K0CA 4UMLA 3GPOA 3PEIA 5HIHA 1BPMA 4JGKA 1HJZA 3KZWA 3H8EA 3EJGA 2EWBA 4ETKA 4KSIA 5AILA 5CBMA 2FG1A 2EEEA 4ABKA 4J5RA 4ZY2A 3GPGA 2BFQA 4JVVA 4X2TA 4ZYQA 1YD9A 3EWQA 5FSXA 4ZI6A 2LGRA 3EKEA 3GQEA 5CB5A 3SIIA 3EWRA 3H8FA 4R76A 2VRIA 2AFCA 2FXKA 3KR5A 2XD7A 3ETIA 5HOLA 3GQOA 4R6TA 4ZY1A 4GUAA 4IQYA 3Q71A 4D86A 2DX6A
chains in the Genus database with same CATH superfamily
5FSVA 4J5SA 1LANA 4GVVA 1NJRA 3EW5A 4ETJA 2RNKA 2JZDA 5FSZA 1VHUA 3SIHA 3KR4A 5E3BA 3SIJA 4ZY0A 5DUSA 4ABLA 2X47A 3T8WA 5FSYA 4K3NA 5FSUA 3KQXA 3V45A 5D8NA 1LCPA 2FAVA 5CB3A 2JZEA 1TXZA 4ESSA 3EWOA 1GYTA 3SIGA 3IJ3A 1LAPA 1LAMA 3H8GA 1ZR5A 4TU0A 3EWPA 5CMSA 3EJFA 3V2BA 4GVWA 3JZTA 4J4ZA 3GPQA 3VFQA 2BFRA 2L8RA 4JLLA 1SPVA 1BLLE 2KQVA 3Q6ZA 4ZX9A 1BPNA 2ACFA 3JRUA 1TY8A 3IIDA 4ZX8A 3IIFA 3KQZA 2J9AA 4J5QA 4KYBA 2W2GA 1ZR3A 4JCAA 4R7MA 4K0CA 4UMLA 3GPOA 3PEIA 5HIHA 1BPMA 4JGKA 1HJZA 2WCTA 3KZWA 3H8EA 3EJGA 2EWBA 4ETKA 4KSIA 5AILA 5CBMA 2FG1A 2EEEA 4ABKA 4J5RA 4ZY2A 3GPGA 2BFQA 4JVVA 4X2TA 4ZYQA 1YD9A 3EWQA 5FSXA 4ZI6A 2LGRA 3EKEA 3GQEA 5CB5A 3SIIA 3EWRA 3H8FA 4R76A 2VRIA 2AFCA 2FXKA 3KR5A 2XD7A 3ETIA 5HOLA 3GQOA 4R6TA 4ZY1A 4GUAA 4IQYA 2JZFA 3Q71A 4D86A 2DX6A
chains in the Genus database with same CATH topology
5FSVA 4J5SA 1LANA 4GVVA 1NJRA 3EW5A 4ETJA 5FSZA 1VHUA 3SIHA 3KR4A 5E3BA 3SIJA 4ZY0A 5DUSA 4ABLA 2X47A 3T8WA 5FSYA 4K3NA 5FSUA 3KQXA 3V45A 5D8NA 1LCPA 2FAVA 5CB3A 1TXZA 4ESSA 3EWOA 1GYTA 3SIGA 3IJ3A 1LAPA 1LAMA 3H8GA 1ZR5A 4TU0A 3EWPA 5CMSA 3EJFA 3V2BA 4GVWA 3JZTA 4J4ZA 3GPQA 3VFQA 2BFRA 2L8RA 4JLLA 1SPVA 1BLLE 3Q6ZA 4ZX9A 1BPNA 2ACFA 3JRUA 1TY8A 3IIDA 4ZX8A 3IIFA 3KQZA 2J9AA 4J5QA 4KYBA 1ZR3A 4JCAA 4R7MA 4K0CA 4UMLA 3GPOA 3PEIA 5HIHA 1BPMA 4JGKA 1HJZA 3KZWA 3H8EA 3EJGA 2EWBA 4ETKA 4KSIA 5AILA 5CBMA 2FG1A 2EEEA 4ABKA 4J5RA 4ZY2A 3GPGA 2BFQA 4JVVA 4X2TA 4ZYQA 1YD9A 3EWQA 5FSXA 4ZI6A 2LGRA 3EKEA 3GQEA 5CB5A 3SIIA 3EWRA 3H8FA 4R76A 2VRIA 2AFCA 2FXKA 3KR5A 2XD7A 3ETIA 5HOLA 3GQOA 4R6TA 4ZY1A 4GUAA 4IQYA 3Q71A 4D86A 2DX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSV A;  4J5S A;  1LAN A;  4GVV A;  1NJR A;  3EW5 A;  4ETJ A;  5FSZ A;  1VHU A;  3SIH A;  3KR4 A;  5E3B A;  3SIJ A;  4ZY0 A;  5DUS A;  4ABL A;  2X47 A;  3T8W A;  5FSY A;  4K3N A;  5FSU A;  3KQX A;  3V45 A;  5D8N A;  1LCP A;  2FAV A;  5CB3 A;  1TXZ A;  4ESS A;  3EWO A;  1GYT A;  3SIG A;  3IJ3 A;  1LAP A;  1LAM A;  3H8G A;  1ZR5 A;  4TU0 A;  3EWP A;  5CMS A;  3EJF A;  3V2B A;  4GVW A;  3JZT A;  4J4Z A;  3GPQ A;  3VFQ A;  2BFR A;  2L8R A;  4JLL A;  1SPV A;  1BLL E;  3Q6Z A;  4ZX9 A;  1BPN A;  2ACF A;  3JRU A;  1TY8 A;  3IID A;  4ZX8 A;  3IIF A;  3KQZ A;  2J9A A;  4J5Q A;  4KYB A;  1ZR3 A;  4JCA A;  4R7M A;  4K0C A;  4UML A;  3GPO A;  3PEI A;  5HIH A;  1BPM A;  4JGK A;  1HJZ A;  3KZW A;  3H8E A;  3EJG A;  2EWB A;  4ETK A;  4KSI A;  5AIL A;  5CBM A;  2FG1 A;  2EEE A;  4ABK A;  4J5R A;  4ZY2 A;  3GPG A;  2BFQ A;  4JVV A;  4X2T A;  4ZYQ A;  1YD9 A;  3EWQ A;  5FSX A;  4ZI6 A;  2LGR A;  3EKE A;  3GQE A;  5CB5 A;  3SII A;  3EWR A;  3H8F A;  4R76 A;  2VRI A;  2AFC A;  2FXK A;  3KR5 A;  2XD7 A;  3ETI A;  5HOL A;  3GQO A;  4R6T A;  4ZY1 A;  4GUA A;  4IQY A;  3Q71 A;  4D86 A;  2DX6 A; 
#chains in the Genus database with same CATH topology
 5FSV A;  4J5S A;  1LAN A;  4GVV A;  1NJR A;  3EW5 A;  4ETJ A;  2RNK A;  2JZD A;  5FSZ A;  1VHU A;  3SIH A;  3KR4 A;  5E3B A;  3SIJ A;  4ZY0 A;  5DUS A;  4ABL A;  2X47 A;  3T8W A;  5FSY A;  4K3N A;  5FSU A;  3KQX A;  3V45 A;  5D8N A;  1LCP A;  2FAV A;  5CB3 A;  2JZE A;  1TXZ A;  4ESS A;  3EWO A;  1GYT A;  3SIG A;  3IJ3 A;  1LAP A;  1LAM A;  3H8G A;  1ZR5 A;  4TU0 A;  3EWP A;  5CMS A;  3EJF A;  3V2B A;  4GVW A;  3JZT A;  4J4Z A;  3GPQ A;  3VFQ A;  2BFR A;  2L8R A;  4JLL A;  1SPV A;  1BLL E;  2KQV A;  3Q6Z A;  4ZX9 A;  1BPN A;  2ACF A;  3JRU A;  1TY8 A;  3IID A;  4ZX8 A;  3IIF A;  3KQZ A;  2J9A A;  4J5Q A;  4KYB A;  2W2G A;  1ZR3 A;  4JCA A;  4R7M A;  4K0C A;  4UML A;  3GPO A;  3PEI A;  5HIH A;  1BPM A;  4JGK A;  1HJZ A;  2WCT A;  3KZW A;  3H8E A;  3EJG A;  2EWB A;  4ETK A;  4KSI A;  5AIL A;  5CBM A;  2FG1 A;  2EEE A;  4ABK A;  4J5R A;  4ZY2 A;  3GPG A;  2BFQ A;  4JVV A;  4X2T A;  4ZYQ A;  1YD9 A;  3EWQ A;  5FSX A;  4ZI6 A;  2LGR A;  3EKE A;  3GQE A;  5CB5 A;  3SII A;  3EWR A;  3H8F A;  4R76 A;  2VRI A;  2AFC A;  2FXK A;  3KR5 A;  2XD7 A;  3ETI A;  5HOL A;  3GQO A;  4R6T A;  4ZY1 A;  4GUA A;  4IQY A;  2JZF A;  3Q71 A;  4D86 A;  2DX6 A; 
#chains in the Genus database with same CATH homology
 5FSV A;  4J5S A;  1LAN A;  4GVV A;  1NJR A;  3EW5 A;  4ETJ A;  5FSZ A;  1VHU A;  3SIH A;  3KR4 A;  5E3B A;  3SIJ A;  4ZY0 A;  5DUS A;  4ABL A;  2X47 A;  3T8W A;  5FSY A;  4K3N A;  5FSU A;  3KQX A;  3V45 A;  5D8N A;  1LCP A;  2FAV A;  5CB3 A;  1TXZ A;  4ESS A;  3EWO A;  1GYT A;  3SIG A;  3IJ3 A;  1LAP A;  1LAM A;  3H8G A;  1ZR5 A;  4TU0 A;  3EWP A;  5CMS A;  3EJF A;  3V2B A;  4GVW A;  3JZT A;  4J4Z A;  3GPQ A;  3VFQ A;  2BFR A;  2L8R A;  4JLL A;  1SPV A;  1BLL E;  3Q6Z A;  4ZX9 A;  1BPN A;  2ACF A;  3JRU A;  1TY8 A;  3IID A;  4ZX8 A;  3IIF A;  3KQZ A;  2J9A A;  4J5Q A;  4KYB A;  1ZR3 A;  4JCA A;  4R7M A;  4K0C A;  4UML A;  3GPO A;  3PEI A;  5HIH A;  1BPM A;  4JGK A;  1HJZ A;  3KZW A;  3H8E A;  3EJG A;  2EWB A;  4ETK A;  4KSI A;  5AIL A;  5CBM A;  2FG1 A;  2EEE A;  4ABK A;  4J5R A;  4ZY2 A;  3GPG A;  2BFQ A;  4JVV A;  4X2T A;  4ZYQ A;  1YD9 A;  3EWQ A;  5FSX A;  4ZI6 A;  2LGR A;  3EKE A;  3GQE A;  5CB5 A;  3SII A;  3EWR A;  3H8F A;  4R76 A;  2VRI A;  2AFC A;  2FXK A;  3KR5 A;  2XD7 A;  3ETI A;  5HOL A;  3GQO A;  4R6T A;  4ZY1 A;  4GUA A;  4IQY A;  3Q71 A;  4D86 A;  2DX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...