4J6YA

Hfq from pseudomonas aeruginosa crystallized in gtp presence
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j6yA00
4XQ3A 4DQ2A 5GAOr 3FIFA 4XTXA 1LNXA 4JLIA 4JRKA 5LJ5j 4J6YA 4M75C 2DVEA 4M78D 1HXDA 3QO3A 4EMGA 2ZGWA 4MMKA 3V7RA 3RKYA 2E64A 3JB9D 3EFSA 4M7DD 4RCCA 5GAN7 3GIBA 5GANh 4XU2A 5LJ3j 2VC8A 3RIRA 2CGHA 5GAOq 5GANe 3FB9A 2RA2A 3L1AA 4XTUA 4C8QC 4EMKB 5I21A 3JCMQ 4PJOC 4M7AA 3JCMd 4QVCA 4M77A 5GANf 1M8VA 2E1HA 5GAN8 1M5Q1 2QTXA 5GANg 4MMLA 1I5LA 4M7AE 4M77E 4F7UA 4HT9A 4J6XA 1D3BA 3SWNC 4M7AG 1N9RA 2DZ9A 1X01A 2I2LA 3JCMc 4M77G 4C92A 5GAN5 3SB2A 3AHUA 4M78B 5GAOp 4PJOB 1I81A 4M75D 4C92E 5GAOm 1Y96B 4X9DA 5GAN4 2RM4A 4C92G 5GMKi 1HK9A 2FYKA 1WQWA 4N0AA 4M77F 5GAMd 3BFMA 4PJOD 2EJFA 2VXEA 4XTWA 4C8QD 4F7UF 4XTYA 3JB9J 4M7DE 1B34B 2E65A 2DTOA 3JB9I 3JCMb 5GANj 3EFRA 3FJPA 2E41A 1JRIA 1WNLA 3JCMh 2RB6A 3V7SA 3V8JA 1BIBA 2DTIA 4M75B 4JUVA 5GMKm 3JCMe 4NL2A 3JCMf 2HNIA 5DY9A 3QSUA 4M7AC 4M77C 3RKWA 4EMKA 3JCMg 3BY7A 4XTVA 3V8KA 4C8QB 5GAOl 3V7CA 4A53A 4C92C 5LJ5d 5GMKh 5GAMh 2DEQA 1WQ7A 4M7AF 4OP0A 3SWNB 3JCMW 2VXFA 4M78A 3RKXA 5GAMe 5GMKe 4HT8A 2EJGA 3RESA 5LJ3d 4M7DA 3HFNA 1Y96A 4M78E 4EMHA 4PJOE 4F7UB 2E10A 4N0AC 5GAMf 4C92F 1U1TA 2DKGA 4M78G 2JN0A 5GAMg 4NL3A 3JB9G 5GAN3 1BIAA 4A54A 4M7DG 4XU1A 3HFOA 4J6WA 4M77D 5GMKl 3PGGA 2YLBA 4Y91A 3RUXA 2DXUA 2YLCA 3JCMV 4M78F 1U1SA 3JB9F 2K57A 3HSBA 4XU0A 4C92D 3JCMX 1LOJA 4M7DF 2DTHA 2YHTA 1H641 5CAIA 2EAYA 3QUIA 5GAN2 4J5YA 4M75A 1I4K1 1YCYA 2EWNA 5LJ5h 1KQ1A 2DZCA 4M75E 1JBMA 4EMKC 3V8LA 5GAOn 5LJ5e 4M75G 4PNOA 2FB7A 4V2SA 1MGQA 5LJ3h 4WF2A 4XU3A 4M7AB 5GMKj 1WPYA 4M77B 5LJ5f 4C8QA 5GAMj 4RCBA 4QVDA 3JCMP 1KQ2A 4PJOA 5LJ3e 4X9CA 5LJ5g 3QHSA 5GANd 3VU3C 4C8QE 1D3BB 4JRIA 4M78C 5GAN6 3RERA 4M75F 4PJOG 5LJ3f 3INZA 1N9SA 3SWNA 4C8QG 4C92B 3JCMJ 4M7DC 2DJZA 5LJ3g 4HA8A 3JB9H 4M7AD 3L2ZA 3M4GA 2DXTA 1I8FA 3BW1A 1B34A 1TH7A 4PJOF 4F7UE 4NOYA 2Y90A 2EJ9A 1LJOA 4XTZA 3BDUA 4C8QF 2RD1A 4M7DB 4F7UG
chains in the Genus database with same CATH superfamily
1B3QA 1R0BG 1VQKA 2CP6A 1Q82R 4EMGA 4XK8E 3KFVA 3QKJA 3GIBA 2XKOC 1VQ4Q 3FB9A 1KIKA 1BI1A 1RAFB 2RK1A 5LL6S 3DLLA 1T3LA 1X01A 2YRDA 5GAOp 3OBWA 4CI0C 2MWOA 1QKWA 1A0NB 4Z02A 4C92E 3QG1A 5FWCA 3VKIA 3QIIA 1VIFA 3EFOB 2DL5A 2EJFA 4FM4B 3RDVA 4C0GA 5CKDA 3M9QA 4QQDA 2QK0A 2ZPGB 2CP0A 3TVTA 1MV3A 4XTVA 2Y4XA 3UF4A 2L89A 1RAHB 2GQVA 4AG2C 5IH2A 3LYIA 3RKXA 4HT8A 3M4YA 1FXXA 5LJ3d 2FG0A 4A54A 4XU1A 1WHLA 4Y92A 2GQIA 4RTWA 1M9SA 1LCKA 4LNPA 5KYUA 1W2BP 4ELZC 1VQPQ 1WX6A 3EGXA 3HP9A 4RG8A 2AIRB 5LJ3h 3EG1A 1BYMA 1M2VB 5GANd 2JTFA 2F2XA 4PJOG 2DMOA 2D6FA 1WHMA 2VUBA 3UATA 4HCKA 2FHDA 4HCZA 2ROLA 2EQJA 1AD5A 1JJ2A 2DM1A 1LNXA 3ZEHA 4RTVA 2MCNA 1Y7XA 5GANh 4XAXB 2DERA 1BI2A 4EPCA 4XTUA 4KRTA 2DL7A 5GAN8 4LE9A 4MMLA 3OMGA 2K2MA 1GXIE 4B9WA 4KH0B 2L3SA 3LH0A 4IUTA 1YHQQ 2MIOA 1QMCA 4HVWA 4M77F 4OMNA 1NYFA 2EKHA 2HL3A 1OOTA 1XJWB 2EBPA 2DTOA 1AT1B 3M0SA 3LGLA 3P8BB 2NUPB 3V8JA 1J3TA 3ME9A 5AYFA 2RQTA 1GFDA 1RLQC 3EGUA 1KG1A 1SHFA 3CCQQ 5KH6A 1EIFA 2OTJT 2ZPIB 4JJDA 4KUIA 3CBOA 1BKBA 3CCUQ 4IUVA 1IO6A 1KC8U 1M2OA 5CKBA 2KYBA 4OB2B 2BIVA 1NYGA 4QKUA 2OTLT 2CT3A 1X6OA 1O75A 3S6WA 2K57A 2MMPA 2X4XA 4J9EA 2HSEB 4M7DF 1OU8A 2V8KA 5CAIA 1Y07A 3EGDA 1R8OB 4LDYA 1S72A 2QEXA 2BZ8A 4EMKC 3HTRA 1KD1R 2HAXA 3DKMA 3JCMP 4M77B 5LJ5g 1K9MC 1VQ6T 4C8QE 3CCRQ 1ZBJA 9ATCB 1VQMA 4ZGJB 1V29B 4LDVA 4HA8A 2QG9B 3G71A 4DBQA 1QWFA 2PVGB 3LW5E 4F7UE 2D8HA 1UDLA 5KYYA 2L2PA 3OSVA 2PUOB 2CP3A 4J6YA 3S3MA 4M75C 1VQ7Q 4JRQA 3QO3A 3EFSA 1SG5A 2CDTA 3RIRA 1T0JA 2KQWA 2WSEE 3QDRB 1UB4A 1KD1U 4MZTA 1YJNA 1YJWQ 4M7AE 3SWNC 2I2LA 4D8KA 1E7OA 3CCET 3SB2A 4E6RA 4PJOB 4M75D 1Y96B 2DL8A 2G6FX 4C92G 2EW3A 2C0OA 3CC2A 2KAFA 2D1XA 5I22A 2DILA 3OYIA 1JJ2S 1OX8A 3CCVA 3GBQA 4XTYA 1WI7A 2QTVA 1PD1A 1BU1A 1G3YA 2E41A 1JRIA 1KHCA 3C4SA 4C0DB 1M1KR 1Z9ZA 5AT1B 4FT4A 8ATCB 3CMEA 5KCHA 1N27A 4J9BA 1WLPB 1QVFA 1K8AR 1PHTA 1YBYA 1QCNA 2CSIA 5J3BA 5IXBA 4M78E 3EH1A 2HCKA 1B07A 4MDWA 1UGSB 2VKNA 1TSFA 2COYA 3PGGA 3RMSA 3JCMX 1MMAA 2EYWA 1PKTA 1KK7A 2HBPA 3PNWC 4AFUC 2QDYB 1B7TA 2P4TA 3A8HB 2O4XB 5LJ5e 1M1KU 4V2SA 2CZ7B 5LJ5f 3A1PA 4KGVB 4C5IA 2F5KA 5GAN6 3G4SA 1N9SA 1BBZA 2RQWA 1TUGB 1X43A 5LJ3g 2YUOA 4F17A 1K8AU 2MWPA 1WHJA 2PZ1A 1KJWA 3BDUA 5HKCA 2R58A 4LDXA 4JLIA 2B86A 2EPDA 3OW2A 1Q86R 1BB9A 2RJEA 2DX1A 3L1AA 2K79A 5CO7A 2CUDA 5GANg 1PSFA 4A4HA 4F7UA 1D3BA 2ZPFB 1UECA 1EX4A 4BDYA 1I81A 5FWBA 4MZMA 1W4SA 3EG2A 2ATCB 4KH1B 3M5AA 2BZXA 1VQLT 3CCMT 4J7IA 5CIUA 1Q95G 1WNLA 3QJYA 3P8HA 4D8DA 4QQ6A 2FPFA 4ZTJA 5CKFA 3OYHA 4L6V5 4CC3A 3X25B 5L8RE 1OI1A 1Q86U 4A53A 1BK2A 1TWBA 2LJ0A 1RL2A 3E2UA 1SKUB 2VXFA 2L3PA 2EJGA 3RESA 8AT1B 1Q81C 4EMHA 1ZSGA 4C0FA 3CC7T 3EFOA 1E6GA 4OB3B 4WCIA 2DPPB 2KNBB 2RI3A 1MMGA 2BE7D 2CZ0B 4FIBA 1IB8A 1KQ1A 2KMTA 4NS5A 2JNGA 1QVFS 5LJ3e 4X9CA 6AT1B 2OAUA 1VQ4T 5LJ3f 1IHWA 1ZQ1A 4C8QG 5C0MA 3M0TA 1AWOA 4RTZA 5I2MA 2ZZDA 3VS7A 1JXMA 2JOYA 2JMAA 3OYLA 4F7UG 1UUEA 1VIEA 1GRIA 4XQ3A 2RH2A 1JEGA 2K4YA 1LVKA 2FL7A 1ZBXA 1SF9A 3I5SA 1OV3A 1NJIC 2DL3A 2YUQA 2A28A 4RTXA 2A36A 2FVUA 2J6KA 2CGHA 3URGA 5GANe 4PJOC 3IQLA 5GANf 2O9VA 1M2VA 4DBHA 2QTXA 3M0PA 2JUFA 2V8IA 3H41A 1PRLC 2JM8A 4PFZA 4M7AG 2QDLA 2YXYA 1W6XA 5GAN4 3TU4K 1U8RA 4ZN1A 4C0ZA 1ZSZA 3I55A 1RI9A 5KYWB 4PJOD 4CRIA 2KR3A 3GNFB 4E7HA 4M7DE 3LH5A 1Q7YR 1AEYA 3OW2S 2DRKA 2V1RA 1X6GA 3PMTA 3UT1A 4EDUA 1N6AA 4DOVA 1JB0E 5ECAA 2HQHA 3D7SB 4A4GA 1X27A 1VQPT 1GL5A 2NUTB 2X9HA 1K0XA 3MJXA 4FYVB 3OYBA 3M53A 3MHXA 1VQ9A 3G6EQ 4FYYB 2NUZA 2KYMA 2LCSA 1OULA 4PJLA 1AZEA 3J7AF 2GFUA 5KE3A 1U1TA 2PVDB 4M78G 2FRYA 2D0NA 2X4WA 3CXCP 3CPWS 3OS0A 1GCQC 3MP1A 3NPFA 1YIJA 1U5SA 1W2BA 3EH2A 5J39A 2NUPA 3SHWA 2EWNA 4ZGDB 3QYGB 3JRZA 2K5IA 4DBFA 3L2VA 1NLPC 4VUBA 3I56A 3M55A 4WF2A 1H92A 1KQ2A 2D0QB 3RERA 4M75F 1C1AA 1YJ9A 2QQ9A 4BY6C 2BUDA 1YITA 2XMFA 1TH7A 1YHQT 1V76A 3RKYA 2COWA 3OS5A 2MPXC 4D6WA 1U06A 4EIKA 1SSFA 2DVEA 1AHJB 3CMAQ 1CKBA 2VC8A 1DJ7B 1FMWA 5I21A 4EMKB 4IKFA 2RN8A 4M77A 1YWOA 2V8JA 3CD6Q 1VYUA 4B9XA 3CCQT 3PVQA 1UGVA 1M4ZA 4X9DA 3L2UA 3CCUT 1BCMA 1VQ8Q 1RI0A 3CCJQ 3HHTB 1YI2Q 1F1BB 1RABB 2VXEA 5KE2A 3JB9J 3OB9A 3TSZA 1N8RR 3OQ5A 1FYNA 2KY9A 2LZ6B 4GLKA 4F14A 4M75B 3OYAA 4FL6A 2KE9A 2WSCE 2FPEA 2XK0A 3VJPA 5GJVB 3CBPA 1S1NA 2RO0A 2M51A 4C92C 1XTDA 4FT2A 3SWNB 1BI0A 4M7DA 1Y96A 4IUUA 4LN2A 3CCRT 3WVDB 2LRQA 1WXUA 2M02A 3GF5A 2ESWA 1FMKA 3EG3A 2EGAA 2J05A 5EG2A 1Y0MA 4OGEA 4C92D 2DF6A 1LOJA 3VYHB 2ED0A 2YHTA 3JB9I 2DETA 1N8RU 4E7IA 4FCYA 2KRSA 1ZUUA 2EGEA 1VQ7T 1M1FA 2LX7A 5FLXE 5KCOA 1GCPA 5GMKj 1D1BA 4RCBA 1UFFA 3H0FA 3ZBDA 3I35A 3M0RA 2MYSA 1YJWT 2DXTA 4N4HA 4JS5A 2IG0A 4IIMA 4JZ3A 2RPNA 1D0XA 2BKDN 5CCAA 5IAYA 2E5QA 3EG9B 2E3HA 4GLMA 2O9SA 1G8XA 3E1SA 1W70A 2O4XA 2X35A 2Z0WA 4OF1A 1M5Q1 2JT4A 2KK4A 3AHUA 1ARKA 3VV0A 3QYHB 2J06A 1HK9A 4N0AA 5GAMd 4PLIA 3GPLA 4JLGA 3I55Q 3M56A 3THKA 4JRPA 1PD0A 1C6VX 2QQBA 5HCKA 1AWXA 3C0CA 1KC8R 1AWWA 1G5VA 1VQOQ 3QSUA 2GGRA 1HJDA 3G1JA 2OTJA 2LT4A 2MF2A 2F5TX 1WJQA 4ZNXA 4DA4A 1OX9A 2L8DA 5DLOA 5GAMh 3OS2A 5EC7A 4KT0E 4HCCA 2FO0A 1RAGB 2VGMA 4OB1B 2R5AA 2J6OA 4C5GA 2YT6A 2P0KA 2OTLA 3JB9G 3CCLQ 4JJCA 1KSWA 2K3BA 2VWFA 4A4FA 2YLBA 1QVGP 2CYZB 1VQ5Q 3HSBA 3SEMA 4P5NA 5IT9E 2EAYA 3J81E 2XI9A 2W0ZA 5GAOn 1WXTA 1PC0A 2YWWA 3EHRA 1VQ6A 1UG1A 2X4YA 3MO8A 4HVUA 1Q81U 3C95A 1P92A 1WFWA 1KQSP 3ZL7C 4N4GA 1C0MA 2JTEA 2P0PA 1I8FA 2NYSA 2XDDA 3NTKA 4PJOF 2CP5A 1ZA1B 1KHIA 1QLYA 4JJBA 1N5ZA 2CZ6B 3KBGA 2O01E 2C0TA 5IXFA 1SRLA 4RCCA 2YDLA 4FU6A 2M0OA 2KVQG 2RJFA 3HRSA 4TVRA 4C8QC 1UTIA 1X2QA 2QQSA 2LQWA 3CCEA 2DK3A 2AK5A 3S3NA 2DZ9A 3JCMc 5M9OA 1PM3A 4BE1A 1VQKQ 3KUFA 2WSFE 2ENMA 1MHNA 3BFMA 4C8QD 2VGNA 1ZA2B 1NJIU 1B34B 3JSCA 1QW1A 5I2SA 1K73R 3MEVA 3V7SA 3FC3A 2DTIA 3PIOA 1HD3A 5HY6A 4NL2A 1SRMA 4II1A 2LVMA 2CSQA 4JZ4A 4M7AC 1WJSA 1OPKA 2DVJA 1TG0A 3NMZC 2DO3A 2RNAA 2QGFB 1TUCA 4J9FA 3L2QA 1MUZA 3OA6A 1K1ZA 4RKUE 2M16A 4IUQA 1M8MA 2LJ3A 4NL3A 1XNIA 4CC2A 5KYWA 3HFOA 2B8AA 4C5HA 2DXUA 4PLLA 3HPWA 4AG1C 2EQUA 3MEWA 2AT1B 4LD6A 3CCSA 2FRWA 1K73U 4OB0B 3V8LA 1JU5C 2QQRA 1MGQA 4LUEA 1WPYA 1I5OB 2NUTA 3FJ5A 5A0DA 4FW1A 1HYOA 2XD0A 4M78C 2KEAA 1Q82C 1ZLMA 3MEAA 4E7KA 1IGUA 1Z9QA 1TTHB 4ZGEB 1FX7A 3OYDA 3M54A 3H8ZA 1UHFA 4DQ2A 2X3XD 2K9GA 2HD0A 4LDUA 2KXDA 2EYQA 2HEQA 2JMCA 3L42A 4M78D 2ZGWA 1JXOA 4MDXA 5KYUB 3VUZA 2VYTA 3ZFJA 2I0NA 2W10A 4E7JA 4RUGA 5IHKA 2HKNA 2JS0A 4E7ZA 1H3HA 2YRVA 1I5LA 3EGXB 2DL4A 5A2QE 3QBYA 1N9RA 5GAN5 2A37A 4OGCA 2DA9A 5GAOm 4AT1B 2COZA 1CSKA 2EYZA 3G6ET 2LT1A 4BY6B 1K9AA 2EQIA 1VQLA 1GFCA 3CCMA 4AFQC 2DD5A 2QXFA 1ZSZC 4DOWA 1U3OA 1FMVA 2CREA 4FW2A 5GMKm 1BIBA 2RJDA 3WVEB 3NTHA 1NG2A 2P84A 1OZ3A 2JXBA 1WGSA 2GFAA 2AKKA 3KXTA 4EMKA 1VA7A 1MMDA 4L59A 2O88A 1MMNA 2DEQA 1WQ7A 3JCMW 2VB6A 4J7FA 4RG2A 3NFCA 5FROA 3CC7A 1RAAB 3HFNA 5GAMg 1M90C 3TEEA 3CXCA 4LDWA 4XU0A 4A63B 2GTJA 2FZCB 4J83A 1H641 5CVIA 4M75A 1O9SA 2EYXA 3ER0A 3CMAT 2KRNA 1VQ4A 1GBRA 3MPUB 4OMPA 5D6WA 3PFSA 1QKXA 4C92B 4R0KA 3SWNA 2JTMA 2WACA 3EAEA 3CD6T 3DB4A 1NEGA 2RD1A 3META 3GP8A 1VQ8T 2XIDA 5D7UA 1IHVA 3CCJT 2J7IA 2L3QA 5LJ5j 1YI2T 1PWTA 2BE9B 2QEXQ 1S72Q 2E64A 3CC4A 2DXBA 2EKOA 1BI3A 1T0HA 4AFZC 4BDZA 3MP8A 2E1HA 3E9GA 1VQMQ 2CUBA 4M77E 4HT9A 3HL8A 3G71Q 1SEMA 2FEIA 4A4EA 3EG0A 2RHIA 1VYVA 2FYKA 1JO8A 4Y28E 4A4KA 1VQNA 4J9IA 3NTIA 2E65A 3JCMb 5CQXA 4C5EA 1PCXA 3U23A 1SPKA 1SHGA 1YJNQ 4JPBW 3H9NA 4PJMA 1ACMB 5GAMe 3CC2Q 4PJOE 4IIOA 4OMMA 5GAMf 3R6NA 3CCVQ 4FSSA 1PRMC 3VS1A 2HMAA 1KD1C 5HK3A 2DFUA 3JCMV 3UWNA 2K5FA 2ZPEB 1R77A 2YUNA 2HBWA 3O5ZA 1D1CA 1I4K1 3H6ZA 4CC4B 3OYJA 3CMEQ 4PNOA 2FB7A 2KSSA 2JVVA 2LX9A 2K3YA 1RUWA 3AT1B 3T9NA 4ESRA 4ANJA 1QQJA 4N4IA 2XU8A 2RQUA 2F2WA 3JB9H 2EQMA 1UGRB 1YHQA 2RMOA 1QCFA 4NOYA 4C8QF 4XTZA 3LGFA 1NM7A 3X28B 1RAIB 2RHUA 1K9MR 1TOVA 1VUBA 3RR6A 2D8JA 2RJCA 3NGPA 2VV5A 4MMKA 3I55T 3JB9D 3I9QA 1M1GA 2RHZA 5LJ3j 3M57A 2QA4A 2GF7A 7AT1B 1YP5A 1UGQB 3LX7A 1VYTA 1PNJA 2CS7A 2JZ2A 2DBMA 3G4SQ 1TS9A 3CCQA 1VQOT 2LQNA 3VRYA 1M3AA 1HSQA 3CCUA 2GBQA 1M1KC 4ELYC 1I07A 5FU6C 5J26A 3CCLT 3A5ZB 1K8AC 4PK4A 1G83A 3VUBA 5GANj 1K9MU 2RB6A 2SRCA 1VQ5T 2KBTA 1YCSB 3PMIA 3GLXA 5C6SA 3FDRA 4C8QB 4E7LA 2A3LA 3E9FA 1IXDA 2MAMA 1X2KA 2GTOA 3CCRA 4F16A 4F7UB 4AFSC 1PKSA 2JN0A 3VYGA 2IIMA 4QVZA 5GJWB 3RUXA 2K6DA 4M78F 1QVGA 1NPRA 1D1AA 4E47A 1OPLA 1OU9A 1YITT 3X26B 4BI4A 4BUGA 4HKEA 1VQ7A 2DZCA 2X3WD 4KULA 1JBMA 3TCJA 2PNIA 4XU3A 2E12A 4M7AB 4PJOA 3F70A 2AKLA 2O31A 1H3ZA 3QWYA 4QT7A 1M3BA 1YJWA 2PU9B 2CZ1B 2ZPHB 3L2RA 2E5KA 3L2ZA 4DEXA 1ZX6A 3A8MB 1KQSA 1Q86C 2EJ9A 1LJOA 5CKHA 2HZYA 2CT4A 3OYFA 2V26A 5GAOr 1VQKT 2RHXA 4XTXA 3QWXX 1HXDA 4F04B 3V7RA 2AZSA 2ED1A 2JJ9A 3CC4Q 4BI8B 3CPFA 2LNVA 2LJ1A 2R57A 2RA2A 2ECZA 1Q82U 3JCMd 4HVVA 2A0FB 1QCOA 5CKEA 4M77G 4M78B 4X1VA 1WHKA 2RM4A 2KT8A 2EIFA 2K3XA 1QP2A 1W2BS 3LLRA 2K5LA 3MP6A 2OJ2A 2PQWA 4LUDA 2XDBA 4Z8AA 1VQNQ 1NE8A 1SSHA 1GCQA 2KT1A 2Y4YA 3JCMh 3G7ZA 4JUVA 4KBMB 3SDZA 2BTTA 5DM7R 4PJNA 2HNIA 3RKWA 5D6XA 4IURA 1G3TA 4J9DA 1M90R 1G3SA 3A8LB 4BB7A 2HDAA 4OP0A 2OAWA 1QVPA 4QQGA 4Z89A 2M9UA 4M7DG 5KYXB 5A0GA 1UJ0A 2IVWA 2G3RA 1OZ2A 5DLQE 4DEYA 1AOJA 4Y91A 1EZZB 5KYNA 2OX7A 1ZSZB 2F1LA 2RHYA 4BD3A 1Q81R 5FU7B 2E70A 4RTTA 1X75C 2QAZA 3GNGA 1T3SA 3RMQA 2CP7A 1UEBA 2LDMA 1G2BA 1VQ9Q 4R55A 3ASKA 3OYYA 3QZ5B 1M90U 4J9GA 3M4GA 2RK2A 4J9CA 3REBB 2KGTA 3OYEA 3WXMB 3X20B 1YIJQ 2F69A 1QVGS 1QP3A 1ZHIA 2DYIA 1WA7A 2L5QA 3VS0A 3A8OB 2E6NA 2LCLA 3X24B 3I56Q 2QA4Q 1MNDA 1D0YA 2C06A 4FYXB 1M30A 4BE0A 3DB3A 1YJ9Q 5FRNA 4C92A 1NJIR 1Q7YC 4KUDK 1YITQ 1KQSS 1KFZA 1TUDA 1WQWA 1X6BA 2DD4A 3LWIA 1VOMA 3QJ6A 2CH4W 4ORZA 3M0UA 4BE2A 3Q1JA 4X34A 2M0YA 2ZAEA 4B6MA 5DY9A 2GCXA 2DEUA 3QXEB 3SD4A 3PTAA 3OMCA 4JDSA 3V7CA 4ZTFA 5GMKh 1UHCA 2A08A 2KI7A 1RACB 1K76A 2K7AA 1YN8A 4J6WA 2LMJA 4FSXA 4OVAA 1LPLA 2R5MA 1U1SA 1ABQA 3JB9F 1AVZC 4PKCC 5GAN2 3QUIA 3VS2A 4J5YA 3MCAB 3OYKA 2H3JA 4M75E 3QZ9B 1WZOA 1S72T 3E19A 2QEXT 3S3OA 2LTOA 1UE9A 4O6JA 2DIGA 2P4RA 3PVLA 1VQMT 4M7AD 3FLGA 2RF0A 3G71T 1D09B 2E6ZA 2MOXA 4PJJA 1XOVA 4YTLA 2J6FA 1JJ2P 4M7DB 3FRNA 3FEOA 4LXCA 3REAB 2CP2A 4M4ZA 1RAEB 2JS2A 4E2FB 4JRKA 2KRMA 3RBBB 2KROA 1GBQA 2MI6A 2EVRA 4JJNK 4PFPA 4RTUA 1RLPC 3JCMQ 2BZYA 4J6XA 3QPHA 5I11A 1N8RC 2FPDA 1YJNT 1I0CA 3G6EA 1QWEA 3BDLA 4J9HA 3I5RA 2CKKA 4KGZB 1IZ6A 2DRMA 1YFNA 2AHJB 4OMQA 3EHQA 3CC2T 4XTWA 2DIQA 1OQKA 2FZKB 1WXBA 3CCVT 3OSSC 2HQEA 3GOXA 2SEMA 2X51A 3EFRA 4Z88A 1AZGB 2QYZA 1H8KA 2JM9A 4AMCA 2DXCA 4DBRA 2HKQB 4GY5A 4HXJA 2KXCA 3J80E 1PG5B 3JCMg 1UJYA 1R0CB 3BE3A 2LP5A 3TSWA 1ABOA 1CKAA 3CMET 5GAOl 2E3IA 3CCST 1IRXA 3M58A 3TREA 1V1CA 3OBYA 4C92F 2DKGA 1AWJA 1ZUYA 2QASA 5GAN3 4R56A 5FU7C 1TXQA 3DLMA 5GMKl 4WTOB 3OYGA 2K2VA 1PSEA 5FU6B 2YLCA 2VASA 2X4JA 2XDPA 2PTKA 3OYNA 2OI3A 3M0QA 3CMAA 4L5GA 2OTJQ 5L23A 3L2WA 3VS3A 4C8QA 4QVDA 3JV3A 3QDFA 3A98A 3C94A 3RNJA 3INZA 3HKSA 3CD6A 4JS4A 2OTLQ 3G4ST 3CEYA 2VVKA 4E7SA 2Y90A 1VQ8A 1K0SA 1JQQA 3CCJA 3CBMA 2GNCA 2LQ8A 1YI2A 1Y57A 3FIFA 3PE0A 4QW2A 2E4HA 3CPWA 3H0IA 1OYXA 3UA7A 2DYBA 5HK0A 5GAOq 2RQVA 1VQ6Q 1K4US 2HL5C 4M7AA 4QVCA 4IUPA 5IHIA 2XICA 1M27C 2EGCA 4OMFB 2QGGA 2DAQA 1KC8C 2H8HA 2AZVA 3UPUA 4RMOA 2YUPA 3O8VA 1M3CA 1NLOC 2JW4A 3C12A 2PUKB 2IPOB 2RI5A 4PL6A 3EGDB 3R6OA 3JCMe 1WHHA 3UDCA 3OYMA 3JCMf 1ZUKA 4M77C 2ABLA 3CCEQ 3V8KA 3VS4A 1QVFP 3PIPA 1E6HA 3HRTA 2DNUA 4M78A 1NZ9A 2LQKA 3VRZA 5A0LA 1D0ZA 4J8OA 2LC4A 3EG9A 2XG8D 3HRUA 3MKDA 4M77D 5KYYB 1YWPA 5IHNA 1WJRA 4GBQA 1WYXA 2DJQA 1VQPA 3MEUA 2HSPA 1YCYA 2M1HA 1W1FA 2L3RA 2QQAA 1WHGA 4Q5WA 1NPPA 2H3EB 2HQXA 4M75G 2QI2A 2MK5A 3LWHA 2A7YA 3CC4T 2YSQA 5FRMA 3QHSA 4KGXB 4ME7A 4CC7A 4MZPA 4M7DC 2CH4A 2DJZA 3CQTA 3H0HA 1NBEB 5KYXA 2L0AA 4PFOA 1I1JA 4ATOA 3UA6A 1WIEA 4O5VA 3CCSQ 1EFNA 3OW2P 5CQYA 4C0DC 3JAME 3P8DA 4M7DD 2C0IA 5GAN7 1VQNT 4XU2A 4HCBA 2NLUA 5CK9A 4OMOA 4UC4A 1VQOA 1NEBA 1M8VA 1YNZA 2DE0X 3NHNA 1XQHA 1K73C 5CR2A 3CXCS 2FZGB 1MV0B 1Y71A 5GMKi 3CPWP 2DLPA 4F7UF 4ZN3A 3CCLA 1UGPB 3FJPA 1G3WA 1VQ5A 3PT9A 2O2OA 3OYCA 3VS6A 2ZPBB 2ROTA 1X69A 3BY7A 2F2VA 2EYYA 4LD9K 1Q7YU 5LJ5d 1RADB 2V1QA 4FYWB 1VQ9T 4M7AF 2KDSA 4OMLA 5IN1A 5GMKe 3ULRB 4BACA 1VQLQ 3VS5A 2LCCA 2E10A 4N0AC 1BCOA 3CCMQ 1BIAA 2EFIA 1MNEA 4K11A 2PVOB 1OEBA 2XHCA 3SFMA 2DTHA 1YIJT 1TU0B 4RTYA 2LNHB 3OS1A 2RI2A 5LJ5h 5D6YA 2YRCA 2RQRA 1WDXA 2EQKA 5GAMj 3OY9A 3I56T 2P0QA 3M59A 3VU3C 1IREB 1D3BB 4JRIA 2QA4T 3JCMJ 3CC7Q 2D9TA 4BI3A 3TQ7P 1YJ9T 1IGQA 3A8GB 2ZCFB 3BW1A 5FW9A 1B34A 1FWZA 2DBKA 2NWMA 3N5BB
chains in the Genus database with same CATH topology
4XQ3A 2RH2A 2F69A 4DQ2A 1QVGS 1VQKA 2HD0A 4LDUA 2K4YA 1QP3A 1ZHIA 2FL7A 1ZBXA 2EYQA 3L42A 4EMGA 4M78D 2L5QA 1NJIC 2ZGWA 4XK8E 3QKJA 3GIBA 2FVUA 3A8OB 2E6NA 2LCLA 3VUZA 3X24B 4MDXA 2VYTA 2CGHA 3URGA 3ZFJA 5GANe 2XKOC 3FB9A 4E7JA 4PJOC 1BI1A 2OTJA 5GANf 2C06A 4BE0A 2QTXA 2YRVA 3DB3A 2JUFA 2V8IA 1I5LA 2RK1A 5LL6S 5A2QE 3DLLA 3QBYA 1N9RA 5GAN5 1X01A 5FRNA 4C92A 4M7AG 1Q7YC 5GAOp 3OBWA 4OGCA 2MWOA 4CI0C 4KUDK 4Z02A 1KQSS 4C92E 5GAOm 3QG1A 5GAN4 3G6ET 3TU4K 2LT1A 3VKIA 4BY6B 1U8RA 3QIIA 1VIFA 4ZN1A 1WQWA 1VQLA 4C0ZA 3I55A 3CCMA 4PJOD 2EJFA 4CRIA 2DD4A 3LWIA 2DD5A 3QJ6A 4FM4B 2QXFA 3GNFB 4E7HA 4C0GA 4M7DE 4DOWA 4BE2A 3Q1JA 5CKDA 3M9QA 4QQDA 3OW2S 2ZPGB 4X34A 5GMKm 1BIBA 3PMTA 2RJDA 3UT1A 4EDUA 3WVEB 3NTHA 1N6AA 1OZ3A 4DOVA 1JB0E 1WGSA 2GFAA 5DY9A 2GCXA 3KXTA 4A4GA 4EMKA 3QXEB 1VQPT 3SD4A 3PTAA 4XTVA 2Y4XA 3OMCA 4JDSA 2L89A 2GQVA 3V7CA 4L59A 3OYBA 3M53A 3MHXA 1VQ9A 3LYIA 4ZTFA 5GMKh 2DEQA 1WQ7A 3JCMW 3RKXA 4J7FA 4RG2A 4HT8A 3M4YA 1FXXA 3NFCA 5LJ3d 5FROA 3CC7A 3HFNA 3J7AF 2GFUA 5KE3A 1U1TA 2PVDB 4M78G 5GAMg 1M90C 4A54A 4XU1A 2X4WA 3TEEA 3CPWS 4J6WA 4FSXA 4OVAA 3OS0A 3CXCA 1M9SA 2R5MA 4LDWA 1U1SA 3MP1A 1YIJA 3JB9F 4XU0A 4ELZC 4J83A 4PKCC 1W2BA 1H641 5J39A 3QUIA 5CVIA 5GAN2 4J5YA 4M75A 1O9SA 2EWNA 3MCAB 4ZGDB 3QYGB 3JRZA 3OYKA 2H3JA 2K5IA 4M75E 3QZ9B 3HP9A 3ER0A 3L2VA 4RG8A 1S72T 3E19A 4VUBA 2QEXT 3I56A 3S3OA 3M55A 5LJ3h 2LTOA 4WF2A 4O6JA 1BYMA 2DIGA 1KQ2A 2D0QB 1VQ4A 5D6WA 5GANd 2JTFA 3PFSA 3RERA 4M75F 4PJOG 4C92B 3SWNA 2JTMA 2WACA 2D6FA 1YJ9A 2QQ9A 3EAEA 2VUBA 4BY6C 1VQMT 3FLGA 2BUDA 4M7AD 3CD6T 3G71T 1YITA 3DB4A 1TH7A 2E6ZA 2FHDA 1YHQT 1XOVA 4YTLA 4HCZA 2RD1A 2EQJA 3META 3RKYA 3FRNA 3FEOA 3GP8A 3OS5A 4M7DB 1JJ2A 1VQ8T 2XIDA 3CCJT 1LNXA 4D6WA 4JRKA 5LJ5j 1SSFA 3ZEHA 1YI2T 2DVEA 1AHJB 3CC4A 2E64A 1Y7XA 5GANh 2MI6A 4XAXB 1BI2A 2VC8A 4JJNK 2DXBA 4EPCA 1DJ7B 2EKOA 4XTUA 4EMKB 5I21A 3JCMQ 4IKFA 1BI3A 4M77A 3MP8A 4BDZA 2E1HA 5GAN8 3E9GA 4MMLA 3OMGA 2V8JA 1GXIE 4M77E 4B9WA 4HT9A 4J6XA 3HL8A 3QPHA 1N8RC 4B9XA 3CCQT 1YJNT 3LH0A 4IUTA 3G6EA 4A4EA 3BDLA 1M4ZA 4X9DA 3L2UA 2RHIA 2CKKA 3CCUT 2FYKA 1IZ6A 1RI0A 4M77F 4Y28E 2AHJB 3CC2T 4A4KA 3HHTB 2VXEA 4XTWA 1VQNA 2DIQA 5KE2A 3OB9A 3JB9J 3NTIA 3CCVT 3OSSC 2HQEA 3GOXA 2E65A 3OQ5A 2DTOA 3JCMb 3EFRA 2KY9A 3LGLA 5CQXA 3P8BB 4GLKA 3V8JA 4M75B 3OYAA 2DXCA 4FL6A 2WSCE 4C5EA 3ME9A 2XK0A 3VJPA 4GY5A 5AYFA 3CBPA 3J80E 1KG1A 3JCMg 5KH6A 1EIFA 2RO0A 3CMET 5GAOl 2OTJT 2ZPIB 4KUIA 3CCST 4C92C 3CBOA 1BKBA 1XTDA 4FT2A 4IUVA 3SWNB 1KC8U 1BI0A 5CKBA 5GAMe 3M58A 4M7DA 1Y96A 3OBYA 3TREA 4IUUA 4PJOE 4OB2B 3CCRT 5GAMf 2BIVA 4C92F 2DKGA 3WVDB 2LRQA 5GAN3 4R56A 3GF5A 2OTLT 5FU7C 1KD1C 3DLMA 5GMKl 5EG2A 5HK3A 1X6OA 2K2VA 1PSEA 5FU6B 2YLCA 3JCMV 3UWNA 3OYGA 2K5FA 2ZPEB 1O75A 3S6WA 2K57A 2MMPA 4OGEA 4C92D 2X4XA 1LOJA 2X4JA 3VYHB 4M7DF 2V8KA 2YHTA 3JB9I 5CAIA 1Y07A 2XDPA 1N8RU 4LDYA 1I4K1 1R8OB 3H6ZA 3OYNA 4E7IA 3OYJA 1S72A 2QEXA 3CMAA 4L5GA 4EMKC 1VQ7T 3OYEA 1M1FA 5FLXE 5KCOA 3L2WA 4PNOA 2FB7A 2KSSA 3DKMA 5GMKj 2HAXA 3JCMP 4M77B 4C8QA 2JVVA 2LX9A 2K3YA 4RCBA 4QVDA 5LJ5g 1K9MC 1VQ6T 3T9NA 4C8QE 3C94A 3INZA 1VQMA 4N4IA 3ZBDA 2XU8A 3HKSA 4ZGJB 3CD6A 1V29B 4LDVA 3G4ST 4HA8A 4JS4A 3G71A 3JB9H 1YJWT 2DXTA 1UGRB 2EQMA 4N4HA 1YHQA 3CEYA 2PVGB 4JS5A 2IG0A 3LW5E 4F7UE 4NOYA 2Y90A 4XTZA 4C8QF 3LGFA 1VQ8A 3X28B 2BKDN 2RHUA 5CCAA 3CCJA 3CBMA 3OSVA 2LQ8A 2PUOB 5IAYA 1YI2A 2E5QA 3FIFA 1VUBA 4QW2A 4J6YA 3S3MA 2RJCA 4M75C 4JRQA 3QO3A 2VV5A 4MMKA 3I55T 3JB9D 3EFSA 3E1SA 3CPWA 1M1GA 1OYXA 2RHZA 5LJ3j 3M57A 2QA4A 2GF7A 3RIRA 5HK0A 5GAOq 2O4XA 1UGQB 2X35A 3LX7A 4OF1A 2KQWA 2WSEE 3QDRB 2CS7A 2JZ2A 4IUPA 4QVCA 4M7AA 1M5Q1 1UB4A 2XICA 3CCQA 4MZTA 1VQOT 1YJNA 1KD1U 4M7AE 3SWNC 2I2LA 2KK4A 3CCET 4OMFB 3SB2A 3AHUA 4PJOB 3CCUA 4M75D 3VV0A 1Y96B 2DAQA 3QYHB 1M1KC 4C92G 4ELYC 1HK9A 1KC8C 3CC2A 2KAFA 4N0AA 5GAMd 3UPUA 4RMOA 3OYIA 1JJ2S 4PLIA 3O8VA 3CCVA 3GPLA 5FU6C 4JLGA 4XTYA 3M56A 5J26A 3CCLT 3A5ZB 4JRPA 3C12A 1K8AC 2PUKB 2QQBA 3VUBA 5GANj 1G3YA 2E41A 1JRIA 1K9MU 1KHCA 2RB6A 2RI5A 3C4SA 4PL6A 3R6OA 4C0DB 3JCMe 3UDCA 1VQ5T 1G5VA 3OYMA 4FT4A 3PMIA 3JCMf 3QSUA 4M77C 3CMEA 3GLXA 5KCHA 3V8KA 2LT4A 2MF2A 2F5TX 1WJQA 3FDRA 4C8QB 5C6SA 4E7LA 1N27A 2A3LA 2L8DA 3E9FA 4DA4A 1QVFA 3PIPA 5DLOA 5GAMh 3OS2A 1YBYA 2MAMA 3HRTA 4KT0E 4HCCA 4M78A 2XD0A 5J3BA 3CCRA 2VGMA 1NZ9A 4M78E 4OB1B 2LQKA 2R5AA 4F7UB 4C5GA 2P0KA 5A0LA 2OTLA 2JN0A 3JB9G 4MDWA 1UGSB 4J8OA 3VYGA 2LC4A 3HRUA 2XG8D 4QVZA 4M77D 3PGGA 4A4FA 2YLBA 2CYZB 3RMSA 3RUXA 4M78F 1QVGA 1NPRA 4E47A 1YITT 3HSBA 1WJRA 3JCMX 3X26B 1VQPA 4P5NA 3MEUA 5IT9E 2EAYA 4BI4A 4BUGA 4HKEA 3J81E 1YCYA 2HBPA 3PNWC 2M1HA 1VQ7A 2DZCA 2L3RA 2XI9A 2QQAA 4KULA 1JBMA 2P4TA 2QDYB 3A8HB 2O4XB 4Q5WA 5LJ5e 5GAOn 1NPPA 4M75G 2HQXA 3TCJA 1M1KU 4V2SA 4XU3A 2E12A 4M7AB 2CZ7B 4PJOA 2QI2A 3F70A 5LJ5f 3LWHA 2A7YA 3CC4T 1VQ6A 2X4YA 5FRMA 1H3ZA 3QHSA 3MO8A 1Q81U 4C5IA 4ME7A 2F5KA 5GAN6 3C95A 1P92A 1N9SA 4MZPA 3G4SA 4M7DC 1YJWA 2DJZA 5LJ3g 2PU9B 2CZ1B 2ZPHB 3L2RA 1K8AU 2MWPA 3L2ZA 3A8MB 4N4GA 2P0PA 1KQSA 1I8FA 2XDDA 3NTKA 4PJOF 1Q86C 2EJ9A 1LJOA 5CKHA 3BDUA 1KHIA 5HKCA 2R58A 4ATOA 3OYFA 5GAOr 4LDXA 1VQKT 2CZ6B 2RHXA 3KBGA 4XTXA 4JLIA 2O01E 4O5VA 1HXDA 5CQYA 4C0DC 3V7RA 3JAME 3P8DA 4M7DD 4RCCA 5GAN7 3OW2A 1VQNT 4XU2A 4FU6A 4HCBA 2M0OA 4BI8B 2KVQG 2LNVA 2NLUA 2RJFA 3CPFA 2RJEA 3HRSA 4TVRA 3L1AA 2R57A 2RA2A 4C8QC 5CO7A 1Q82U 5CK9A 4UC4A 3JCMd 1VQOA 1M8VA 2QQSA 1YJ9T 5GANg 1PSFA 4A4HA 3CCEA 1XQHA 2DK3A 4F7UA 1D3BA 2ZPFB 3S3NA 2DZ9A 5CKEA 4M77G 3JCMc 4M78B 5M9OA 4BDYA 1I81A 1K73C 5CR2A 3CXCS 2RM4A 4MZMA 1W4SA 1Y71A 5GMKi 4BE1A 2EIFA 2K3XA 1QP2A 3KUFA 2WSFE 1W2BS 3M5AA 1MHNA 3LLRA 1VQLT 3BFMA 2K5LA 4F7UF 4C8QD 2VGNA 3MP6A 4ZN3A 1NJIU 2PQWA 3CCMT 3CCLA 2XDBA 1B34B 3JSCA 1QW1A 1NE8A 5I2SA 4J7IA 5CIUA 1UGPB 2Y4YA 3FJPA 3JCMh 1WNLA 3G7ZA 1G3WA 3MEVA 3QJYA 3PT9A 3V7SA 2DTIA 3FC3A 4JUVA 1VQ5A 3P8HA 4KBMB 3SDZA 3PIOA 3OYCA 4QQ6A 5HY6A 5DM7R 4ZTJA 4NL2A 5CKFA 2ZPBB 3OYHA 4II1A 2LVMA 2HNIA 4L6V5 4M7AC 3X25B 3RKWA 1WJSA 5D6XA 5L8RE 3BY7A 1OI1A 4LD9K 1Q7YU 1Q86U 4IURA 1G3TA 4A53A 1G3SA 3A8LB 2DO3A 4BB7A 5LJ5d 1RL2A 1VQ9T 4M7AF 4OP0A 2VXFA 2KDSA 5IN1A 5GMKe 3L2QA 2EJGA 3RESA 1Q81C 3OA6A 4RKUE 4BACA 4EMHA 1QVPA 2LCCA 2M16A 2E10A 4IUQA 4N0AC 4QQGA 4C0FA 3CC7T 2M9UA 4OB3B 4NL3A 1BIAA 2EFIA 1XNIA 4M7DG 2DPPB 5A0GA 2IVWA 2G3RA 1OZ2A 3HFOA 5DLQE 2B8AA 4C5HA 2PVOB 4Y91A 2DXUA 2RI3A 4PLLA 2XHCA 3SFMA 3HPWA 2DTHA 2EQUA 1YIJT 2RHYA 3MEWA 4BD3A 2RI2A 5FU7B 3OS1A 2E70A 2CZ0B 1X75C 4LD6A 3CCSA 5LJ5h 4FIBA 1KQ1A 2KMTA 3GNGA 3RMQA 5D6YA 1K73U 1UEBA 4OB0B 3V8LA 2LDMA 4NS5A 2QQRA 2JNGA 3CMAT 1MGQA 2EQKA 5GAMj 1WPYA 3OY9A 1QVFS 3I56T 2P0QA 5A0DA 4R55A 5LJ3e 4X9CA 3M59A 2OAUA 3VU3C 1IREB 1VQ4T 1D3BB 3ASKA 3OYYA 4JRIA 4M78C 2QA4T 1Q82C 3QZ5B 5LJ3f 3JCMJ 1ZQ1A 4C8QG 5C0MA 3MEAA 1M90U 2D9TA 4E7KA 4BI3A 3M4GA 2RK2A 5I2MA 4ZGEB 1FX7A 3A8GB 2ZZDA 2ZCFB 3BW1A 3OYDA 1B34A 1FWZA 2JOYA 3M54A 3H8ZA 3N5BB 3OYLA 4F7UG 3WXMB 1VIEA 3X20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQ3 A;  4DQ2 A;  5GAO r;  3FIF A;  4XTX A;  1LNX A;  4JLI A;  4JRK A;  5LJ5 j;  4J6Y A;  4M75 C;  2DVE A;  4M78 D;  1HXD A;  3QO3 A;  4EMG A;  2ZGW A;  4MMK A;  3V7R A;  3RKY A;  2E64 A;  3JB9 D;  3EFS A;  4M7D D;  4RCC A;  5GAN 7;  3GIB A;  5GAN h;  4XU2 A;  5LJ3 j;  2VC8 A;  3RIR A;  2CGH A;  5GAO q;  5GAN e;  3FB9 A;  2RA2 A;  3L1A A;  4XTU A;  4C8Q C;  4EMK B;  5I21 A;  3JCM Q;  4PJO C;  4M7A A;  3JCM d;  4QVC A;  4M77 A;  5GAN f;  1M8V A;  2E1H A;  5GAN 8;  1M5Q 1;  2QTX A;  5GAN g;  4MML A;  1I5L A;  4M7A E;  4M77 E;  4F7U A;  4HT9 A;  4J6X A;  1D3B A;  3SWN C;  4M7A G;  1N9R A;  2DZ9 A;  1X01 A;  2I2L A;  3JCM c;  4M77 G;  4C92 A;  5GAN 5;  3SB2 A;  3AHU A;  4M78 B;  5GAO p;  4PJO B;  1I81 A;  4M75 D;  4C92 E;  5GAO m;  1Y96 B;  4X9D A;  5GAN 4;  2RM4 A;  4C92 G;  5GMK i;  1HK9 A;  2FYK A;  1WQW A;  4N0A A;  4M77 F;  5GAM d;  3BFM A;  4PJO D;  2EJF A;  2VXE A;  4XTW A;  4C8Q D;  4F7U F;  4XTY A;  3JB9 J;  4M7D E;  1B34 B;  2E65 A;  2DTO A;  3JB9 I;  3JCM b;  5GAN j;  3EFR A;  3FJP A;  2E41 A;  1JRI A;  1WNL A;  3JCM h;  2RB6 A;  3V7S A;  3V8J A;  1BIB A;  2DTI A;  4M75 B;  4JUV A;  5GMK m;  3JCM e;  4NL2 A;  3JCM f;  2HNI A;  5DY9 A;  3QSU A;  4M7A C;  4M77 C;  3RKW A;  4EMK A;  3JCM g;  3BY7 A;  4XTV A;  3V8K A;  4C8Q B;  5GAO l;  3V7C A;  4A53 A;  4C92 C;  5LJ5 d;  5GMK h;  5GAM h;  2DEQ A;  1WQ7 A;  4M7A F;  4OP0 A;  3SWN B;  3JCM W;  2VXF A;  4M78 A;  3RKX A;  5GAM e;  5GMK e;  4HT8 A;  2EJG A;  3RES A;  5LJ3 d;  4M7D A;  3HFN A;  1Y96 A;  4M78 E;  4EMH A;  4PJO E;  4F7U B;  2E10 A;  4N0A C;  5GAM f;  4C92 F;  1U1T A;  2DKG A;  4M78 G;  2JN0 A;  5GAM g;  4NL3 A;  3JB9 G;  5GAN 3;  1BIA A;  4A54 A;  4M7D G;  4XU1 A;  3HFO A;  4J6W A;  4M77 D;  5GMK l;  3PGG A;  2YLB A;  4Y91 A;  3RUX A;  2DXU A;  2YLC A;  3JCM V;  4M78 F;  1U1S A;  3JB9 F;  2K57 A;  3HSB A;  4XU0 A;  4C92 D;  3JCM X;  1LOJ A;  4M7D F;  2DTH A;  2YHT A;  1H64 1;  5CAI A;  2EAY A;  3QUI A;  5GAN 2;  4J5Y A;  4M75 A;  1I4K 1;  1YCY A;  2EWN A;  5LJ5 h;  1KQ1 A;  2DZC A;  4M75 E;  1JBM A;  4EMK C;  3V8L A;  5GAO n;  5LJ5 e;  4M75 G;  4PNO A;  2FB7 A;  4V2S A;  1MGQ A;  5LJ3 h;  4WF2 A;  4XU3 A;  4M7A B;  5GMK j;  1WPY A;  4M77 B;  5LJ5 f;  4C8Q A;  5GAM j;  4RCB A;  4QVD A;  3JCM P;  1KQ2 A;  4PJO A;  5LJ3 e;  4X9C A;  5LJ5 g;  3QHS A;  5GAN d;  3VU3 C;  4C8Q E;  1D3B B;  4JRI A;  4M78 C;  5GAN 6;  3RER A;  4M75 F;  4PJO G;  5LJ3 f;  3INZ A;  1N9S A;  3SWN A;  4C8Q G;  4C92 B;  3JCM J;  4M7D C;  2DJZ A;  5LJ3 g;  4HA8 A;  3JB9 H;  4M7A D;  3L2Z A;  3M4G A;  2DXT A;  1I8F A;  3BW1 A;  1B34 A;  1TH7 A;  4PJO F;  4F7U E;  4NOY A;  2Y90 A;  2EJ9 A;  1LJO A;  4XTZ A;  3BDU A;  4C8Q F;  2RD1 A;  4M7D B;  4F7U G; 
#chains in the Genus database with same CATH topology
 1B3Q A;  1R0B G;  1VQK A;  2CP6 A;  1Q82 R;  4EMG A;  4XK8 E;  3KFV A;  3QKJ A;  3GIB A;  2XKO C;  1VQ4 Q;  3FB9 A;  1KIK A;  1BI1 A;  1RAF B;  2RK1 A;  5LL6 S;  3DLL A;  1T3L A;  1X01 A;  2YRD A;  5GAO p;  3OBW A;  4CI0 C;  2MWO A;  1QKW A;  1A0N B;  4Z02 A;  4C92 E;  3QG1 A;  5FWC A;  3VKI A;  3QII A;  1VIF A;  3EFO B;  2DL5 A;  2EJF A;  4FM4 B;  3RDV A;  4C0G A;  5CKD A;  3M9Q A;  4QQD A;  2QK0 A;  2ZPG B;  2CP0 A;  3TVT A;  1MV3 A;  4XTV A;  2Y4X A;  3UF4 A;  2L89 A;  1RAH B;  2GQV A;  4AG2 C;  5IH2 A;  3LYI A;  3RKX A;  4HT8 A;  3M4Y A;  1FXX A;  5LJ3 d;  2FG0 A;  4A54 A;  4XU1 A;  1WHL A;  4Y92 A;  2GQI A;  4RTW A;  1M9S A;  1LCK A;  4LNP A;  5KYU A;  1W2B P;  4ELZ C;  1VQP Q;  1WX6 A;  3EGX A;  3HP9 A;  4RG8 A;  2AIR B;  5LJ3 h;  3EG1 A;  1BYM A;  1M2V B;  5GAN d;  2JTF A;  2F2X A;  4PJO G;  2DMO A;  2D6F A;  1WHM A;  2VUB A;  3UAT A;  4HCK A;  2FHD A;  4HCZ A;  2ROL A;  2EQJ A;  1AD5 A;  1JJ2 A;  2DM1 A;  1LNX A;  3ZEH A;  4RTV A;  2MCN A;  1Y7X A;  5GAN h;  4XAX B;  2DER A;  1BI2 A;  4EPC A;  4XTU A;  4KRT A;  2DL7 A;  5GAN 8;  4LE9 A;  4MML A;  3OMG A;  2K2M A;  1GXI E;  4B9W A;  4KH0 B;  2L3S A;  3LH0 A;  4IUT A;  1YHQ Q;  2MIO A;  1QMC A;  4HVW A;  4M77 F;  4OMN A;  1NYF A;  2EKH A;  2HL3 A;  1OOT A;  1XJW B;  2EBP A;  2DTO A;  1AT1 B;  3M0S A;  3LGL A;  3P8B B;  2NUP B;  3V8J A;  1J3T A;  3ME9 A;  5AYF A;  2RQT A;  1GFD A;  1RLQ C;  3EGU A;  1KG1 A;  1SHF A;  3CCQ Q;  5KH6 A;  1EIF A;  2OTJ T;  2ZPI B;  4JJD A;  4KUI A;  3CBO A;  1BKB A;  3CCU Q;  4IUV A;  1IO6 A;  1KC8 U;  1M2O A;  5CKB A;  2KYB A;  4OB2 B;  2BIV A;  1NYG A;  4QKU A;  2OTL T;  2CT3 A;  1X6O A;  1O75 A;  3S6W A;  2K57 A;  2MMP A;  2X4X A;  4J9E A;  2HSE B;  4M7D F;  1OU8 A;  2V8K A;  5CAI A;  1Y07 A;  3EGD A;  1R8O B;  4LDY A;  1S72 A;  2QEX A;  2BZ8 A;  4EMK C;  3HTR A;  1KD1 R;  2HAX A;  3DKM A;  3JCM P;  4M77 B;  5LJ5 g;  1K9M C;  1VQ6 T;  4C8Q E;  3CCR Q;  1ZBJ A;  9ATC B;  1VQM A;  4ZGJ B;  1V29 B;  4LDV A;  4HA8 A;  2QG9 B;  3G71 A;  4DBQ A;  1QWF A;  2PVG B;  3LW5 E;  4F7U E;  2D8H A;  1UDL A;  5KYY A;  2L2P A;  3OSV A;  2PUO B;  2CP3 A;  4J6Y A;  3S3M A;  4M75 C;  1VQ7 Q;  4JRQ A;  3QO3 A;  3EFS A;  1SG5 A;  2CDT A;  3RIR A;  1T0J A;  2KQW A;  2WSE E;  3QDR B;  1UB4 A;  1KD1 U;  4MZT A;  1YJN A;  1YJW Q;  4M7A E;  3SWN C;  2I2L A;  4D8K A;  1E7O A;  3CCE T;  3SB2 A;  4E6R A;  4PJO B;  4M75 D;  1Y96 B;  2DL8 A;  2G6F X;  4C92 G;  2EW3 A;  2C0O A;  3CC2 A;  2KAF A;  2D1X A;  5I22 A;  2DIL A;  3OYI A;  1JJ2 S;  1OX8 A;  3CCV A;  3GBQ A;  4XTY A;  1WI7 A;  2QTV A;  1PD1 A;  1BU1 A;  1G3Y A;  2E41 A;  1JRI A;  1KHC A;  3C4S A;  4C0D B;  1M1K R;  1Z9Z A;  5AT1 B;  4FT4 A;  8ATC B;  3CME A;  5KCH A;  1N27 A;  4J9B A;  1WLP B;  1QVF A;  1K8A R;  1PHT A;  1YBY A;  1QCN A;  2CSI A;  5J3B A;  5IXB A;  4M78 E;  3EH1 A;  2HCK A;  1B07 A;  4MDW A;  1UGS B;  2VKN A;  1TSF A;  2COY A;  3PGG A;  3RMS A;  3JCM X;  1MMA A;  2EYW A;  1PKT A;  1KK7 A;  2HBP A;  3PNW C;  4AFU C;  2QDY B;  1B7T A;  2P4T A;  3A8H B;  2O4X B;  5LJ5 e;  1M1K U;  4V2S A;  2CZ7 B;  5LJ5 f;  3A1P A;  4KGV B;  4C5I A;  2F5K A;  5GAN 6;  3G4S A;  1N9S A;  1BBZ A;  2RQW A;  1TUG B;  1X43 A;  5LJ3 g;  2YUO A;  4F17 A;  1K8A U;  2MWP A;  1WHJ A;  2PZ1 A;  1KJW A;  3BDU A;  5HKC A;  2R58 A;  4LDX A;  4JLI A;  2B86 A;  2EPD A;  3OW2 A;  1Q86 R;  1BB9 A;  2RJE A;  2DX1 A;  3L1A A;  2K79 A;  5CO7 A;  2CUD A;  5GAN g;  1PSF A;  4A4H A;  4F7U A;  1D3B A;  2ZPF B;  1UEC A;  1EX4 A;  4BDY A;  1I81 A;  5FWB A;  4MZM A;  1W4S A;  3EG2 A;  2ATC B;  4KH1 B;  3M5A A;  2BZX A;  1VQL T;  3CCM T;  4J7I A;  5CIU A;  1Q95 G;  1WNL A;  3QJY A;  3P8H A;  4D8D A;  4QQ6 A;  2FPF A;  4ZTJ A;  5CKF A;  3OYH A;  4L6V 5;  4CC3 A;  3X25 B;  5L8R E;  1OI1 A;  1Q86 U;  4A53 A;  1BK2 A;  1TWB A;  2LJ0 A;  1RL2 A;  3E2U A;  1SKU B;  2VXF A;  2L3P A;  2EJG A;  3RES A;  8AT1 B;  1Q81 C;  4EMH A;  1ZSG A;  4C0F A;  3CC7 T;  3EFO A;  1E6G A;  4OB3 B;  4WCI A;  2DPP B;  2KNB B;  2RI3 A;  1MMG A;  2BE7 D;  2CZ0 B;  4FIB A;  1IB8 A;  1KQ1 A;  2KMT A;  4NS5 A;  2JNG A;  1QVF S;  5LJ3 e;  4X9C A;  6AT1 B;  2OAU A;  1VQ4 T;  5LJ3 f;  1IHW A;  1ZQ1 A;  4C8Q G;  5C0M A;  3M0T A;  1AWO A;  4RTZ A;  5I2M A;  2ZZD A;  3VS7 A;  1JXM A;  2JOY A;  2JMA A;  3OYL A;  4F7U G;  1UUE A;  1VIE A;  1GRI A;  4XQ3 A;  2RH2 A;  1JEG A;  2K4Y A;  1LVK A;  2FL7 A;  1ZBX A;  1SF9 A;  3I5S A;  1OV3 A;  1NJI C;  2DL3 A;  2YUQ A;  2A28 A;  4RTX A;  2A36 A;  2FVU A;  2J6K A;  2CGH A;  3URG A;  5GAN e;  4PJO C;  3IQL A;  5GAN f;  2O9V A;  1M2V A;  4DBH A;  2QTX A;  3M0P A;  2JUF A;  2V8I A;  3H41 A;  1PRL C;  2JM8 A;  4PFZ A;  4M7A G;  2QDL A;  2YXY A;  1W6X A;  5GAN 4;  3TU4 K;  1U8R A;  4ZN1 A;  4C0Z A;  1ZSZ A;  3I55 A;  1RI9 A;  5KYW B;  4PJO D;  4CRI A;  2KR3 A;  3GNF B;  4E7H A;  4M7D E;  3LH5 A;  1Q7Y R;  1AEY A;  3OW2 S;  2DRK A;  2V1R A;  1X6G A;  3PMT A;  3UT1 A;  4EDU A;  1N6A A;  4DOV A;  1JB0 E;  5ECA A;  2HQH A;  3D7S B;  4A4G A;  1X27 A;  1VQP T;  1GL5 A;  2NUT B;  2X9H A;  1K0X A;  3MJX A;  4FYV B;  3OYB A;  3M53 A;  3MHX A;  1VQ9 A;  3G6E Q;  4FYY B;  2NUZ A;  2KYM A;  2LCS A;  1OUL A;  4PJL A;  1AZE A;  3J7A F;  2GFU A;  5KE3 A;  1U1T A;  2PVD B;  4M78 G;  2FRY A;  2D0N A;  2X4W A;  3CXC P;  3CPW S;  3OS0 A;  1GCQ C;  3MP1 A;  3NPF A;  1YIJ A;  1U5S A;  1W2B A;  3EH2 A;  5J39 A;  2NUP A;  3SHW A;  2EWN A;  4ZGD B;  3QYG B;  3JRZ A;  2K5I A;  4DBF A;  3L2V A;  1NLP C;  4VUB A;  3I56 A;  3M55 A;  4WF2 A;  1H92 A;  1KQ2 A;  2D0Q B;  3RER A;  4M75 F;  1C1A A;  1YJ9 A;  2QQ9 A;  4BY6 C;  2BUD A;  1YIT A;  2XMF A;  1TH7 A;  1YHQ T;  1V76 A;  3RKY A;  2COW A;  3OS5 A;  2MPX C;  4D6W A;  1U06 A;  4EIK A;  1SSF A;  2DVE A;  1AHJ B;  3CMA Q;  1CKB A;  2VC8 A;  1DJ7 B;  1FMW A;  5I21 A;  4EMK B;  4IKF A;  2RN8 A;  4M77 A;  1YWO A;  2V8J A;  3CD6 Q;  1VYU A;  4B9X A;  3CCQ T;  3PVQ A;  1UGV A;  1M4Z A;  4X9D A;  3L2U A;  3CCU T;  1BCM A;  1VQ8 Q;  1RI0 A;  3CCJ Q;  3HHT B;  1YI2 Q;  1F1B B;  1RAB B;  2VXE A;  5KE2 A;  3JB9 J;  3OB9 A;  3TSZ A;  1N8R R;  3OQ5 A;  1FYN A;  2KY9 A;  2LZ6 B;  4GLK A;  4F14 A;  4M75 B;  3OYA A;  4FL6 A;  2KE9 A;  2WSC E;  2FPE A;  2XK0 A;  3VJP A;  5GJV B;  3CBP A;  1S1N A;  2RO0 A;  2M51 A;  4C92 C;  1XTD A;  4FT2 A;  3SWN B;  1BI0 A;  4M7D A;  1Y96 A;  4IUU A;  4LN2 A;  3CCR T;  3WVD B;  2LRQ A;  1WXU A;  2M02 A;  3GF5 A;  2ESW A;  1FMK A;  3EG3 A;  2EGA A;  2J05 A;  5EG2 A;  1Y0M A;  4OGE A;  4C92 D;  2DF6 A;  1LOJ A;  3VYH B;  2ED0 A;  2YHT A;  3JB9 I;  2DET A;  1N8R U;  4E7I A;  4FCY A;  2KRS A;  1ZUU A;  2EGE A;  1VQ7 T;  1M1F A;  2LX7 A;  5FLX E;  5KCO A;  1GCP A;  5GMK j;  1D1B A;  4RCB A;  1UFF A;  3H0F A;  3ZBD A;  3I35 A;  3M0R A;  2MYS A;  1YJW T;  2DXT A;  4N4H A;  4JS5 A;  2IG0 A;  4IIM A;  4JZ3 A;  2RPN A;  1D0X A;  2BKD N;  5CCA A;  5IAY A;  2E5Q A;  3EG9 B;  2E3H A;  4GLM A;  2O9S A;  1G8X A;  3E1S A;  1W70 A;  2O4X A;  2X35 A;  2Z0W A;  4OF1 A;  1M5Q 1;  2JT4 A;  2KK4 A;  3AHU A;  1ARK A;  3VV0 A;  3QYH B;  2J06 A;  1HK9 A;  4N0A A;  5GAM d;  4PLI A;  3GPL A;  4JLG A;  3I55 Q;  3M56 A;  3THK A;  4JRP A;  1PD0 A;  1C6V X;  2QQB A;  5HCK A;  1AWX A;  3C0C A;  1KC8 R;  1AWW A;  1G5V A;  1VQO Q;  3QSU A;  2GGR A;  1HJD A;  3G1J A;  2OTJ A;  2LT4 A;  2MF2 A;  2F5T X;  1WJQ A;  4ZNX A;  4DA4 A;  1OX9 A;  2L8D A;  5DLO A;  5GAM h;  3OS2 A;  5EC7 A;  4KT0 E;  4HCC A;  2FO0 A;  1RAG B;  2VGM A;  4OB1 B;  2R5A A;  2J6O A;  4C5G A;  2YT6 A;  2P0K A;  2OTL A;  3JB9 G;  3CCL Q;  4JJC A;  1KSW A;  2K3B A;  2VWF A;  4A4F A;  2YLB A;  1QVG P;  2CYZ B;  1VQ5 Q;  3HSB A;  3SEM A;  4P5N A;  5IT9 E;  2EAY A;  3J81 E;  2XI9 A;  2W0Z A;  5GAO n;  1WXT A;  1PC0 A;  2YWW A;  3EHR A;  1VQ6 A;  1UG1 A;  2X4Y A;  3MO8 A;  4HVU A;  1Q81 U;  3C95 A;  1P92 A;  1WFW A;  1KQS P;  3ZL7 C;  4N4G A;  1C0M A;  2JTE A;  2P0P A;  1I8F A;  2NYS A;  2XDD A;  3NTK A;  4PJO F;  2CP5 A;  1ZA1 B;  1KHI A;  1QLY A;  4JJB A;  1N5Z A;  2CZ6 B;  3KBG A;  2O01 E;  2C0T A;  5IXF A;  1SRL A;  4RCC A;  2YDL A;  4FU6 A;  2M0O A;  2KVQ G;  2RJF A;  3HRS A;  4TVR A;  4C8Q C;  1UTI A;  1X2Q A;  2QQS A;  2LQW A;  3CCE A;  2DK3 A;  2AK5 A;  3S3N A;  2DZ9 A;  3JCM c;  5M9O A;  1PM3 A;  4BE1 A;  1VQK Q;  3KUF A;  2WSF E;  2ENM A;  1MHN A;  3BFM A;  4C8Q D;  2VGN A;  1ZA2 B;  1NJI U;  1B34 B;  3JSC A;  1QW1 A;  5I2S A;  1K73 R;  3MEV A;  3V7S A;  3FC3 A;  2DTI A;  3PIO A;  1HD3 A;  5HY6 A;  4NL2 A;  1SRM A;  4II1 A;  2LVM A;  2CSQ A;  4JZ4 A;  4M7A C;  1WJS A;  1OPK A;  2DVJ A;  1TG0 A;  3NMZ C;  2DO3 A;  2RNA A;  2QGF B;  1TUC A;  4J9F A;  3L2Q A;  1MUZ A;  3OA6 A;  1K1Z A;  4RKU E;  2M16 A;  4IUQ A;  1M8M A;  2LJ3 A;  4NL3 A;  1XNI A;  4CC2 A;  5KYW A;  3HFO A;  2B8A A;  4C5H A;  2DXU A;  4PLL A;  3HPW A;  4AG1 C;  2EQU A;  3MEW A;  2AT1 B;  4LD6 A;  3CCS A;  2FRW A;  1K73 U;  4OB0 B;  3V8L A;  1JU5 C;  2QQR A;  1MGQ A;  4LUE A;  1WPY A;  1I5O B;  2NUT A;  3FJ5 A;  5A0D A;  4FW1 A;  1HYO A;  2XD0 A;  4M78 C;  2KEA A;  1Q82 C;  1ZLM A;  3MEA A;  4E7K A;  1IGU A;  1Z9Q A;  1TTH B;  4ZGE B;  1FX7 A;  3OYD A;  3M54 A;  3H8Z A;  1UHF A;  4DQ2 A;  2X3X D;  2K9G A;  2HD0 A;  4LDU A;  2KXD A;  2EYQ A;  2HEQ A;  2JMC A;  3L42 A;  4M78 D;  2ZGW A;  1JXO A;  4MDX A;  5KYU B;  3VUZ A;  2VYT A;  3ZFJ A;  2I0N A;  2W10 A;  4E7J A;  4RUG A;  5IHK A;  2HKN A;  2JS0 A;  4E7Z A;  1H3H A;  2YRV A;  1I5L A;  3EGX B;  2DL4 A;  5A2Q E;  3QBY A;  1N9R A;  5GAN 5;  2A37 A;  4OGC A;  2DA9 A;  5GAO m;  4AT1 B;  2COZ A;  1CSK A;  2EYZ A;  3G6E T;  2LT1 A;  4BY6 B;  1K9A A;  2EQI A;  1VQL A;  1GFC A;  3CCM A;  4AFQ C;  2DD5 A;  2QXF A;  1ZSZ C;  4DOW A;  1U3O A;  1FMV A;  2CRE A;  4FW2 A;  5GMK m;  1BIB A;  2RJD A;  3WVE B;  3NTH A;  1NG2 A;  2P84 A;  1OZ3 A;  2JXB A;  1WGS A;  2GFA A;  2AKK A;  3KXT A;  4EMK A;  1VA7 A;  1MMD A;  4L59 A;  2O88 A;  1MMN A;  2DEQ A;  1WQ7 A;  3JCM W;  2VB6 A;  4J7F A;  4RG2 A;  3NFC A;  5FRO A;  3CC7 A;  1RAA B;  3HFN A;  5GAM g;  1M90 C;  3TEE A;  3CXC A;  4LDW A;  4XU0 A;  4A63 B;  2GTJ A;  2FZC B;  4J83 A;  1H64 1;  5CVI A;  4M75 A;  1O9S A;  2EYX A;  3ER0 A;  3CMA T;  2KRN A;  1VQ4 A;  1GBR A;  3MPU B;  4OMP A;  5D6W A;  3PFS A;  1QKX A;  4C92 B;  4R0K A;  3SWN A;  2JTM A;  2WAC A;  3EAE A;  3CD6 T;  3DB4 A;  1NEG A;  2RD1 A;  3MET A;  3GP8 A;  1VQ8 T;  2XID A;  5D7U A;  1IHV A;  3CCJ T;  2J7I A;  2L3Q A;  5LJ5 j;  1YI2 T;  1PWT A;  2BE9 B;  2QEX Q;  1S72 Q;  2E64 A;  3CC4 A;  2DXB A;  2EKO A;  1BI3 A;  1T0H A;  4AFZ C;  4BDZ A;  3MP8 A;  2E1H A;  3E9G A;  1VQM Q;  2CUB A;  4M77 E;  4HT9 A;  3HL8 A;  3G71 Q;  1SEM A;  2FEI A;  4A4E A;  3EG0 A;  2RHI A;  1VYV A;  2FYK A;  1JO8 A;  4Y28 E;  4A4K A;  1VQN A;  4J9I A;  3NTI A;  2E65 A;  3JCM b;  5CQX A;  4C5E A;  1PCX A;  3U23 A;  1SPK A;  1SHG A;  1YJN Q;  4JPB W;  3H9N A;  4PJM A;  1ACM B;  5GAM e;  3CC2 Q;  4PJO E;  4IIO A;  4OMM A;  5GAM f;  3R6N A;  3CCV Q;  4FSS A;  1PRM C;  3VS1 A;  2HMA A;  1KD1 C;  5HK3 A;  2DFU A;  3JCM V;  3UWN A;  2K5F A;  2ZPE B;  1R77 A;  2YUN A;  2HBW A;  3O5Z A;  1D1C A;  1I4K 1;  3H6Z A;  4CC4 B;  3OYJ A;  3CME Q;  4PNO A;  2FB7 A;  2KSS A;  2JVV A;  2LX9 A;  2K3Y A;  1RUW A;  3AT1 B;  3T9N A;  4ESR A;  4ANJ A;  1QQJ A;  4N4I A;  2XU8 A;  2RQU A;  2F2W A;  3JB9 H;  2EQM A;  1UGR B;  1YHQ A;  2RMO A;  1QCF A;  4NOY A;  4C8Q F;  4XTZ A;  3LGF A;  1NM7 A;  3X28 B;  1RAI B;  2RHU A;  1K9M R;  1TOV A;  1VUB A;  3RR6 A;  2D8J A;  2RJC A;  3NGP A;  2VV5 A;  4MMK A;  3I55 T;  3JB9 D;  3I9Q A;  1M1G A;  2RHZ A;  5LJ3 j;  3M57 A;  2QA4 A;  2GF7 A;  7AT1 B;  1YP5 A;  1UGQ B;  3LX7 A;  1VYT A;  1PNJ A;  2CS7 A;  2JZ2 A;  2DBM A;  3G4S Q;  1TS9 A;  3CCQ A;  1VQO T;  2LQN A;  3VRY A;  1M3A A;  1HSQ A;  3CCU A;  2GBQ A;  1M1K C;  4ELY C;  1I07 A;  5FU6 C;  5J26 A;  3CCL T;  3A5Z B;  1K8A C;  4PK4 A;  1G83 A;  3VUB A;  5GAN j;  1K9M U;  2RB6 A;  2SRC A;  1VQ5 T;  2KBT A;  1YCS B;  3PMI A;  3GLX A;  5C6S A;  3FDR A;  4C8Q B;  4E7L A;  2A3L A;  3E9F A;  1IXD A;  2MAM A;  1X2K A;  2GTO A;  3CCR A;  4F16 A;  4F7U B;  4AFS C;  1PKS A;  2JN0 A;  3VYG A;  2IIM A;  4QVZ A;  5GJW B;  3RUX A;  2K6D A;  4M78 F;  1QVG A;  1NPR A;  1D1A A;  4E47 A;  1OPL A;  1OU9 A;  1YIT T;  3X26 B;  4BI4 A;  4BUG A;  4HKE A;  1VQ7 A;  2DZC A;  2X3W D;  4KUL A;  1JBM A;  3TCJ A;  2PNI A;  4XU3 A;  2E12 A;  4M7A B;  4PJO A;  3F70 A;  2AKL A;  2O31 A;  1H3Z A;  3QWY A;  4QT7 A;  1M3B A;  1YJW A;  2PU9 B;  2CZ1 B;  2ZPH B;  3L2R A;  2E5K A;  3L2Z A;  4DEX A;  1ZX6 A;  3A8M B;  1KQS A;  1Q86 C;  2EJ9 A;  1LJO A;  5CKH A;  2HZY A;  2CT4 A;  3OYF A;  2V26 A;  5GAO r;  1VQK T;  2RHX A;  4XTX A;  3QWX X;  1HXD A;  4F04 B;  3V7R A;  2AZS A;  2ED1 A;  2JJ9 A;  3CC4 Q;  4BI8 B;  3CPF A;  2LNV A;  2LJ1 A;  2R57 A;  2RA2 A;  2ECZ A;  1Q82 U;  3JCM d;  4HVV A;  2A0F B;  1QCO A;  5CKE A;  4M77 G;  4M78 B;  4X1V A;  1WHK A;  2RM4 A;  2KT8 A;  2EIF A;  2K3X A;  1QP2 A;  1W2B S;  3LLR A;  2K5L A;  3MP6 A;  2OJ2 A;  2PQW A;  4LUD A;  2XDB A;  4Z8A A;  1VQN Q;  1NE8 A;  1SSH A;  1GCQ A;  2KT1 A;  2Y4Y A;  3JCM h;  3G7Z A;  4JUV A;  4KBM B;  3SDZ A;  2BTT A;  5DM7 R;  4PJN A;  2HNI A;  3RKW A;  5D6X A;  4IUR A;  1G3T A;  4J9D A;  1M90 R;  1G3S A;  3A8L B;  4BB7 A;  2HDA A;  4OP0 A;  2OAW A;  1QVP A;  4QQG A;  4Z89 A;  2M9U A;  4M7D G;  5KYX B;  5A0G A;  1UJ0 A;  2IVW A;  2G3R A;  1OZ2 A;  5DLQ E;  4DEY A;  1AOJ A;  4Y91 A;  1EZZ B;  5KYN A;  2OX7 A;  1ZSZ B;  2F1L A;  2RHY A;  4BD3 A;  1Q81 R;  5FU7 B;  2E70 A;  4RTT A;  1X75 C;  2QAZ A;  3GNG A;  1T3S A;  3RMQ A;  2CP7 A;  1UEB A;  2LDM A;  1G2B A;  1VQ9 Q;  4R55 A;  3ASK A;  3OYY A;  3QZ5 B;  1M90 U;  4J9G A;  3M4G A;  2RK2 A;  4J9C A;  3REB B;  2KGT A;  3OYE A;  3WXM B;  3X20 B;  1YIJ Q;  2F69 A;  1QVG S;  1QP3 A;  1ZHI A;  2DYI A;  1WA7 A;  2L5Q A;  3VS0 A;  3A8O B;  2E6N A;  2LCL A;  3X24 B;  3I56 Q;  2QA4 Q;  1MND A;  1D0Y A;  2C06 A;  4FYX B;  1M30 A;  4BE0 A;  3DB3 A;  1YJ9 Q;  5FRN A;  4C92 A;  1NJI R;  1Q7Y C;  4KUD K;  1YIT Q;  1KQS S;  1KFZ A;  1TUD A;  1WQW A;  1X6B A;  2DD4 A;  3LWI A;  1VOM A;  3QJ6 A;  2CH4 W;  4ORZ A;  3M0U A;  4BE2 A;  3Q1J A;  4X34 A;  2M0Y A;  2ZAE A;  4B6M A;  5DY9 A;  2GCX A;  2DEU A;  3QXE B;  3SD4 A;  3PTA A;  3OMC A;  4JDS A;  3V7C A;  4ZTF A;  5GMK h;  1UHC A;  2A08 A;  2KI7 A;  1RAC B;  1K76 A;  2K7A A;  1YN8 A;  4J6W A;  2LMJ A;  4FSX A;  4OVA A;  1LPL A;  2R5M A;  1U1S A;  1ABQ A;  3JB9 F;  1AVZ C;  4PKC C;  5GAN 2;  3QUI A;  3VS2 A;  4J5Y A;  3MCA B;  3OYK A;  2H3J A;  4M75 E;  3QZ9 B;  1WZO A;  1S72 T;  3E19 A;  2QEX T;  3S3O A;  2LTO A;  1UE9 A;  4O6J A;  2DIG A;  2P4R A;  3PVL A;  1VQM T;  4M7A D;  3FLG A;  2RF0 A;  3G71 T;  1D09 B;  2E6Z A;  2MOX A;  4PJJ A;  1XOV A;  4YTL A;  2J6F A;  1JJ2 P;  4M7D B;  3FRN A;  3FEO A;  4LXC A;  3REA B;  2CP2 A;  4M4Z A;  1RAE B;  2JS2 A;  4E2F B;  4JRK A;  2KRM A;  3RBB B;  2KRO A;  1GBQ A;  2MI6 A;  2EVR A;  4JJN K;  4PFP A;  4RTU A;  1RLP C;  3JCM Q;  2BZY A;  4J6X A;  3QPH A;  5I11 A;  1N8R C;  2FPD A;  1YJN T;  1I0C A;  3G6E A;  1QWE A;  3BDL A;  4J9H A;  3I5R A;  2CKK A;  4KGZ B;  1IZ6 A;  2DRM A;  1YFN A;  2AHJ B;  4OMQ A;  3EHQ A;  3CC2 T;  4XTW A;  2DIQ A;  1OQK A;  2FZK B;  1WXB A;  3CCV T;  3OSS C;  2HQE A;  3GOX A;  2SEM A;  2X51 A;  3EFR A;  4Z88 A;  1AZG B;  2QYZ A;  1H8K A;  2JM9 A;  4AMC A;  2DXC A;  4DBR A;  2HKQ B;  4GY5 A;  4HXJ A;  2KXC A;  3J80 E;  1PG5 B;  3JCM g;  1UJY A;  1R0C B;  3BE3 A;  2LP5 A;  3TSW A;  1ABO A;  1CKA A;  3CME T;  5GAO l;  2E3I A;  3CCS T;  1IRX A;  3M58 A;  3TRE A;  1V1C A;  3OBY A;  4C92 F;  2DKG A;  1AWJ A;  1ZUY A;  2QAS A;  5GAN 3;  4R56 A;  5FU7 C;  1TXQ A;  3DLM A;  5GMK l;  4WTO B;  3OYG A;  2K2V A;  1PSE A;  5FU6 B;  2YLC A;  2VAS A;  2X4J A;  2XDP A;  2PTK A;  3OYN A;  2OI3 A;  3M0Q A;  3CMA A;  4L5G A;  2OTJ Q;  5L23 A;  3L2W A;  3VS3 A;  4C8Q A;  4QVD A;  3JV3 A;  3QDF A;  3A98 A;  3C94 A;  3RNJ A;  3INZ A;  3HKS A;  3CD6 A;  4JS4 A;  2OTL Q;  3G4S T;  3CEY A;  2VVK A;  4E7S A;  2Y90 A;  1VQ8 A;  1K0S A;  1JQQ A;  3CCJ A;  3CBM A;  2GNC A;  2LQ8 A;  1YI2 A;  1Y57 A;  3FIF A;  3PE0 A;  4QW2 A;  2E4H A;  3CPW A;  3H0I A;  1OYX A;  3UA7 A;  2DYB A;  5HK0 A;  5GAO q;  2RQV A;  1VQ6 Q;  1K4U S;  2HL5 C;  4M7A A;  4QVC A;  4IUP A;  5IHI A;  2XIC A;  1M27 C;  2EGC A;  4OMF B;  2QGG A;  2DAQ A;  1KC8 C;  2H8H A;  2AZV A;  3UPU A;  4RMO A;  2YUP A;  3O8V A;  1M3C A;  1NLO C;  2JW4 A;  3C12 A;  2PUK B;  2IPO B;  2RI5 A;  4PL6 A;  3EGD B;  3R6O A;  3JCM e;  1WHH A;  3UDC A;  3OYM A;  3JCM f;  1ZUK A;  4M77 C;  2ABL A;  3CCE Q;  3V8K A;  3VS4 A;  1QVF P;  3PIP A;  1E6H A;  3HRT A;  2DNU A;  4M78 A;  1NZ9 A;  2LQK A;  3VRZ A;  5A0L A;  1D0Z A;  4J8O A;  2LC4 A;  3EG9 A;  2XG8 D;  3HRU A;  3MKD A;  4M77 D;  5KYY B;  1YWP A;  5IHN A;  1WJR A;  4GBQ A;  1WYX A;  2DJQ A;  1VQP A;  3MEU A;  2HSP A;  1YCY A;  2M1H A;  1W1F A;  2L3R A;  2QQA A;  1WHG A;  4Q5W A;  1NPP A;  2H3E B;  2HQX A;  4M75 G;  2QI2 A;  2MK5 A;  3LWH A;  2A7Y A;  3CC4 T;  2YSQ A;  5FRM A;  3QHS A;  4KGX B;  4ME7 A;  4CC7 A;  4MZP A;  4M7D C;  2CH4 A;  2DJZ A;  3CQT A;  3H0H A;  1NBE B;  5KYX A;  2L0A A;  4PFO A;  1I1J A;  4ATO A;  3UA6 A;  1WIE A;  4O5V A;  3CCS Q;  1EFN A;  3OW2 P;  5CQY A;  4C0D C;  3JAM E;  3P8D A;  4M7D D;  2C0I A;  5GAN 7;  1VQN T;  4XU2 A;  4HCB A;  2NLU A;  5CK9 A;  4OMO A;  4UC4 A;  1VQO A;  1NEB A;  1M8V A;  1YNZ A;  2DE0 X;  3NHN A;  1XQH A;  1K73 C;  5CR2 A;  3CXC S;  2FZG B;  1MV0 B;  1Y71 A;  5GMK i;  3CPW P;  2DLP A;  4F7U F;  4ZN3 A;  3CCL A;  1UGP B;  3FJP A;  1G3W A;  1VQ5 A;  3PT9 A;  2O2O A;  3OYC A;  3VS6 A;  2ZPB B;  2ROT A;  1X69 A;  3BY7 A;  2F2V A;  2EYY A;  4LD9 K;  1Q7Y U;  5LJ5 d;  1RAD B;  2V1Q A;  4FYW B;  1VQ9 T;  4M7A F;  2KDS A;  4OML A;  5IN1 A;  5GMK e;  3ULR B;  4BAC A;  1VQL Q;  3VS5 A;  2LCC A;  2E10 A;  4N0A C;  1BCO A;  3CCM Q;  1BIA A;  2EFI A;  1MNE A;  4K11 A;  2PVO B;  1OEB A;  2XHC A;  3SFM A;  2DTH A;  1YIJ T;  1TU0 B;  4RTY A;  2LNH B;  3OS1 A;  2RI2 A;  5LJ5 h;  5D6Y A;  2YRC A;  2RQR A;  1WDX A;  2EQK A;  5GAM j;  3OY9 A;  3I56 T;  2P0Q A;  3M59 A;  3VU3 C;  1IRE B;  1D3B B;  4JRI A;  2QA4 T;  3JCM J;  3CC7 Q;  2D9T A;  4BI3 A;  3TQ7 P;  1YJ9 T;  1IGQ A;  3A8G B;  2ZCF B;  3BW1 A;  5FW9 A;  1B34 A;  1FWZ A;  2DBK A;  2NWM A;  3N5B B; 
#chains in the Genus database with same CATH homology
 4XQ3 A;  2RH2 A;  2F69 A;  4DQ2 A;  1QVG S;  1VQK A;  2HD0 A;  4LDU A;  2K4Y A;  1QP3 A;  1ZHI A;  2FL7 A;  1ZBX A;  2EYQ A;  3L42 A;  4EMG A;  4M78 D;  2L5Q A;  1NJI C;  2ZGW A;  4XK8 E;  3QKJ A;  3GIB A;  2FVU A;  3A8O B;  2E6N A;  2LCL A;  3VUZ A;  3X24 B;  4MDX A;  2VYT A;  2CGH A;  3URG A;  3ZFJ A;  5GAN e;  2XKO C;  3FB9 A;  4E7J A;  4PJO C;  1BI1 A;  2OTJ A;  5GAN f;  2C06 A;  4BE0 A;  2QTX A;  2YRV A;  3DB3 A;  2JUF A;  2V8I A;  1I5L A;  2RK1 A;  5LL6 S;  5A2Q E;  3DLL A;  3QBY A;  1N9R A;  5GAN 5;  1X01 A;  5FRN A;  4C92 A;  4M7A G;  1Q7Y C;  5GAO p;  3OBW A;  4OGC A;  2MWO A;  4CI0 C;  4KUD K;  4Z02 A;  1KQS S;  4C92 E;  5GAO m;  3QG1 A;  5GAN 4;  3G6E T;  3TU4 K;  2LT1 A;  3VKI A;  4BY6 B;  1U8R A;  3QII A;  1VIF A;  4ZN1 A;  1WQW A;  1VQL A;  4C0Z A;  3I55 A;  3CCM A;  4PJO D;  2EJF A;  4CRI A;  2DD4 A;  3LWI A;  2DD5 A;  3QJ6 A;  4FM4 B;  2QXF A;  3GNF B;  4E7H A;  4C0G A;  4M7D E;  4DOW A;  4BE2 A;  3Q1J A;  5CKD A;  3M9Q A;  4QQD A;  3OW2 S;  2ZPG B;  4X34 A;  5GMK m;  1BIB A;  3PMT A;  2RJD A;  3UT1 A;  4EDU A;  3WVE B;  3NTH A;  1N6A A;  1OZ3 A;  4DOV A;  1JB0 E;  1WGS A;  2GFA A;  5DY9 A;  2GCX A;  3KXT A;  4A4G A;  4EMK A;  3QXE B;  1VQP T;  3SD4 A;  3PTA A;  4XTV A;  2Y4X A;  3OMC A;  4JDS A;  2L89 A;  2GQV A;  3V7C A;  4L59 A;  3OYB A;  3M53 A;  3MHX A;  1VQ9 A;  3LYI A;  4ZTF A;  5GMK h;  2DEQ A;  1WQ7 A;  3JCM W;  3RKX A;  4J7F A;  4RG2 A;  4HT8 A;  3M4Y A;  1FXX A;  3NFC A;  5LJ3 d;  5FRO A;  3CC7 A;  3HFN A;  3J7A F;  2GFU A;  5KE3 A;  1U1T A;  2PVD B;  4M78 G;  5GAM g;  1M90 C;  4A54 A;  4XU1 A;  2X4W A;  3TEE A;  3CPW S;  4J6W A;  4FSX A;  4OVA A;  3OS0 A;  3CXC A;  1M9S A;  2R5M A;  4LDW A;  1U1S A;  3MP1 A;  1YIJ A;  3JB9 F;  4XU0 A;  4ELZ C;  4J83 A;  4PKC C;  1W2B A;  1H64 1;  5J39 A;  3QUI A;  5CVI A;  5GAN 2;  4J5Y A;  4M75 A;  1O9S A;  2EWN A;  3MCA B;  4ZGD B;  3QYG B;  3JRZ A;  3OYK A;  2H3J A;  2K5I A;  4M75 E;  3QZ9 B;  3HP9 A;  3ER0 A;  3L2V A;  4RG8 A;  1S72 T;  3E19 A;  4VUB A;  2QEX T;  3I56 A;  3S3O A;  3M55 A;  5LJ3 h;  2LTO A;  4WF2 A;  4O6J A;  1BYM A;  2DIG A;  1KQ2 A;  2D0Q B;  1VQ4 A;  5D6W A;  5GAN d;  2JTF A;  3PFS A;  3RER A;  4M75 F;  4PJO G;  4C92 B;  3SWN A;  2JTM A;  2WAC A;  2D6F A;  1YJ9 A;  2QQ9 A;  3EAE A;  2VUB A;  4BY6 C;  1VQM T;  3FLG A;  2BUD A;  4M7A D;  3CD6 T;  3G71 T;  1YIT A;  3DB4 A;  1TH7 A;  2E6Z A;  2FHD A;  1YHQ T;  1XOV A;  4YTL A;  4HCZ A;  2RD1 A;  2EQJ A;  3MET A;  3RKY A;  3FRN A;  3FEO A;  3GP8 A;  3OS5 A;  4M7D B;  1JJ2 A;  1VQ8 T;  2XID A;  3CCJ T;  1LNX A;  4D6W A;  4JRK A;  5LJ5 j;  1SSF A;  3ZEH A;  1YI2 T;  2DVE A;  1AHJ B;  3CC4 A;  2E64 A;  1Y7X A;  5GAN h;  2MI6 A;  4XAX B;  1BI2 A;  2VC8 A;  4JJN K;  2DXB A;  4EPC A;  1DJ7 B;  2EKO A;  4XTU A;  4EMK B;  5I21 A;  3JCM Q;  4IKF A;  1BI3 A;  4M77 A;  3MP8 A;  4BDZ A;  2E1H A;  5GAN 8;  3E9G A;  4MML A;  3OMG A;  2V8J A;  1GXI E;  4M77 E;  4B9W A;  4HT9 A;  4J6X A;  3HL8 A;  3QPH A;  1N8R C;  4B9X A;  3CCQ T;  1YJN T;  3LH0 A;  4IUT A;  3G6E A;  4A4E A;  3BDL A;  1M4Z A;  4X9D A;  3L2U A;  2RHI A;  2CKK A;  3CCU T;  2FYK A;  1IZ6 A;  1RI0 A;  4M77 F;  4Y28 E;  2AHJ B;  3CC2 T;  4A4K A;  3HHT B;  2VXE A;  4XTW A;  1VQN A;  2DIQ A;  5KE2 A;  3OB9 A;  3JB9 J;  3NTI A;  3CCV T;  3OSS C;  2HQE A;  3GOX A;  2E65 A;  3OQ5 A;  2DTO A;  3JCM b;  3EFR A;  2KY9 A;  3LGL A;  5CQX A;  3P8B B;  4GLK A;  3V8J A;  4M75 B;  3OYA A;  2DXC A;  4FL6 A;  2WSC E;  4C5E A;  3ME9 A;  2XK0 A;  3VJP A;  4GY5 A;  5AYF A;  3CBP A;  3J80 E;  1KG1 A;  3JCM g;  5KH6 A;  1EIF A;  2RO0 A;  3CME T;  5GAO l;  2OTJ T;  2ZPI B;  4KUI A;  3CCS T;  4C92 C;  3CBO A;  1BKB A;  1XTD A;  4FT2 A;  4IUV A;  3SWN B;  1KC8 U;  1BI0 A;  5CKB A;  5GAM e;  3M58 A;  4M7D A;  1Y96 A;  3OBY A;  3TRE A;  4IUU A;  4PJO E;  4OB2 B;  3CCR T;  5GAM f;  2BIV A;  4C92 F;  2DKG A;  3WVD B;  2LRQ A;  5GAN 3;  4R56 A;  3GF5 A;  2OTL T;  5FU7 C;  1KD1 C;  3DLM A;  5GMK l;  5EG2 A;  5HK3 A;  1X6O A;  2K2V A;  1PSE A;  5FU6 B;  2YLC A;  3JCM V;  3UWN A;  3OYG A;  2K5F A;  2ZPE B;  1O75 A;  3S6W A;  2K57 A;  2MMP A;  4OGE A;  4C92 D;  2X4X A;  1LOJ A;  2X4J A;  3VYH B;  4M7D F;  2V8K A;  2YHT A;  3JB9 I;  5CAI A;  1Y07 A;  2XDP A;  1N8R U;  4LDY A;  1I4K 1;  1R8O B;  3H6Z A;  3OYN A;  4E7I A;  3OYJ A;  1S72 A;  2QEX A;  3CMA A;  4L5G A;  4EMK C;  1VQ7 T;  3OYE A;  1M1F A;  5FLX E;  5KCO A;  3L2W A;  4PNO A;  2FB7 A;  2KSS A;  3DKM A;  5GMK j;  2HAX A;  3JCM P;  4M77 B;  4C8Q A;  2JVV A;  2LX9 A;  2K3Y A;  4RCB A;  4QVD A;  5LJ5 g;  1K9M C;  1VQ6 T;  3T9N A;  4C8Q E;  3C94 A;  3INZ A;  1VQM A;  4N4I A;  3ZBD A;  2XU8 A;  3HKS A;  4ZGJ B;  3CD6 A;  1V29 B;  4LDV A;  3G4S T;  4HA8 A;  4JS4 A;  3G71 A;  3JB9 H;  1YJW T;  2DXT A;  1UGR B;  2EQM A;  4N4H A;  1YHQ A;  3CEY A;  2PVG B;  4JS5 A;  2IG0 A;  3LW5 E;  4F7U E;  4NOY A;  2Y90 A;  4XTZ A;  4C8Q F;  3LGF A;  1VQ8 A;  3X28 B;  2BKD N;  2RHU A;  5CCA A;  3CCJ A;  3CBM A;  3OSV A;  2LQ8 A;  2PUO B;  5IAY A;  1YI2 A;  2E5Q A;  3FIF A;  1VUB A;  4QW2 A;  4J6Y A;  3S3M A;  2RJC A;  4M75 C;  4JRQ A;  3QO3 A;  2VV5 A;  4MMK A;  3I55 T;  3JB9 D;  3EFS A;  3E1S A;  3CPW A;  1M1G A;  1OYX A;  2RHZ A;  5LJ3 j;  3M57 A;  2QA4 A;  2GF7 A;  3RIR A;  5HK0 A;  5GAO q;  2O4X A;  1UGQ B;  2X35 A;  3LX7 A;  4OF1 A;  2KQW A;  2WSE E;  3QDR B;  2CS7 A;  2JZ2 A;  4IUP A;  4QVC A;  4M7A A;  1M5Q 1;  1UB4 A;  2XIC A;  3CCQ A;  4MZT A;  1VQO T;  1YJN A;  1KD1 U;  4M7A E;  3SWN C;  2I2L A;  2KK4 A;  3CCE T;  4OMF B;  3SB2 A;  3AHU A;  4PJO B;  3CCU A;  4M75 D;  3VV0 A;  1Y96 B;  2DAQ A;  3QYH B;  1M1K C;  4C92 G;  4ELY C;  1HK9 A;  1KC8 C;  3CC2 A;  2KAF A;  4N0A A;  5GAM d;  3UPU A;  4RMO A;  3OYI A;  1JJ2 S;  4PLI A;  3O8V A;  3CCV A;  3GPL A;  5FU6 C;  4JLG A;  4XTY A;  3M56 A;  5J26 A;  3CCL T;  3A5Z B;  4JRP A;  3C12 A;  1K8A C;  2PUK B;  2QQB A;  3VUB A;  5GAN j;  1G3Y A;  2E41 A;  1JRI A;  1K9M U;  1KHC A;  2RB6 A;  2RI5 A;  3C4S A;  4PL6 A;  3R6O A;  4C0D B;  3JCM e;  3UDC A;  1VQ5 T;  1G5V A;  3OYM A;  4FT4 A;  3PMI A;  3JCM f;  3QSU A;  4M77 C;  3CME A;  3GLX A;  5KCH A;  3V8K A;  2LT4 A;  2MF2 A;  2F5T X;  1WJQ A;  3FDR A;  4C8Q B;  5C6S A;  4E7L A;  1N27 A;  2A3L A;  2L8D A;  3E9F A;  4DA4 A;  1QVF A;  3PIP A;  5DLO A;  5GAM h;  3OS2 A;  1YBY A;  2MAM A;  3HRT A;  4KT0 E;  4HCC A;  4M78 A;  2XD0 A;  5J3B A;  3CCR A;  2VGM A;  1NZ9 A;  4M78 E;  4OB1 B;  2LQK A;  2R5A A;  4F7U B;  4C5G A;  2P0K A;  5A0L A;  2OTL A;  2JN0 A;  3JB9 G;  4MDW A;  1UGS B;  4J8O A;  3VYG A;  2LC4 A;  3HRU A;  2XG8 D;  4QVZ A;  4M77 D;  3PGG A;  4A4F A;  2YLB A;  2CYZ B;  3RMS A;  3RUX A;  4M78 F;  1QVG A;  1NPR A;  4E47 A;  1YIT T;  3HSB A;  1WJR A;  3JCM X;  3X26 B;  1VQP A;  4P5N A;  3MEU A;  5IT9 E;  2EAY A;  4BI4 A;  4BUG A;  4HKE A;  3J81 E;  1YCY A;  2HBP A;  3PNW C;  2M1H A;  1VQ7 A;  2DZC A;  2L3R A;  2XI9 A;  2QQA A;  4KUL A;  1JBM A;  2P4T A;  2QDY B;  3A8H B;  2O4X B;  4Q5W A;  5LJ5 e;  5GAO n;  1NPP A;  4M75 G;  2HQX A;  3TCJ A;  1M1K U;  4V2S A;  4XU3 A;  2E12 A;  4M7A B;  2CZ7 B;  4PJO A;  2QI2 A;  3F70 A;  5LJ5 f;  3LWH A;  2A7Y A;  3CC4 T;  1VQ6 A;  2X4Y A;  5FRM A;  1H3Z A;  3QHS A;  3MO8 A;  1Q81 U;  4C5I A;  4ME7 A;  2F5K A;  5GAN 6;  3C95 A;  1P92 A;  1N9S A;  4MZP A;  3G4S A;  4M7D C;  1YJW A;  2DJZ A;  5LJ3 g;  2PU9 B;  2CZ1 B;  2ZPH B;  3L2R A;  1K8A U;  2MWP A;  3L2Z A;  3A8M B;  4N4G A;  2P0P A;  1KQS A;  1I8F A;  2XDD A;  3NTK A;  4PJO F;  1Q86 C;  2EJ9 A;  1LJO A;  5CKH A;  3BDU A;  1KHI A;  5HKC A;  2R58 A;  4ATO A;  3OYF A;  5GAO r;  4LDX A;  1VQK T;  2CZ6 B;  2RHX A;  3KBG A;  4XTX A;  4JLI A;  2O01 E;  4O5V A;  1HXD A;  5CQY A;  4C0D C;  3V7R A;  3JAM E;  3P8D A;  4M7D D;  4RCC A;  5GAN 7;  3OW2 A;  1VQN T;  4XU2 A;  4FU6 A;  4HCB A;  2M0O A;  4BI8 B;  2KVQ G;  2LNV A;  2NLU A;  2RJF A;  3CPF A;  2RJE A;  3HRS A;  4TVR A;  3L1A A;  2R57 A;  2RA2 A;  4C8Q C;  5CO7 A;  1Q82 U;  5CK9 A;  4UC4 A;  3JCM d;  1VQO A;  1M8V A;  2QQS A;  1YJ9 T;  5GAN g;  1PSF A;  4A4H A;  3CCE A;  1XQH A;  2DK3 A;  4F7U A;  1D3B A;  2ZPF B;  3S3N A;  2DZ9 A;  5CKE A;  4M77 G;  3JCM c;  4M78 B;  5M9O A;  4BDY A;  1I81 A;  1K73 C;  5CR2 A;  3CXC S;  2RM4 A;  4MZM A;  1W4S A;  1Y71 A;  5GMK i;  4BE1 A;  2EIF A;  2K3X A;  1QP2 A;  3KUF A;  2WSF E;  1W2B S;  3M5A A;  1MHN A;  3LLR A;  1VQL T;  3BFM A;  2K5L A;  4F7U F;  4C8Q D;  2VGN A;  3MP6 A;  4ZN3 A;  1NJI U;  2PQW A;  3CCM T;  3CCL A;  2XDB A;  1B34 B;  3JSC A;  1QW1 A;  1NE8 A;  5I2S A;  4J7I A;  5CIU A;  1UGP B;  2Y4Y A;  3FJP A;  3JCM h;  1WNL A;  3G7Z A;  1G3W A;  3MEV A;  3QJY A;  3PT9 A;  3V7S A;  2DTI A;  3FC3 A;  4JUV A;  1VQ5 A;  3P8H A;  4KBM B;  3SDZ A;  3PIO A;  3OYC A;  4QQ6 A;  5HY6 A;  5DM7 R;  4ZTJ A;  4NL2 A;  5CKF A;  2ZPB B;  3OYH A;  4II1 A;  2LVM A;  2HNI A;  4L6V 5;  4M7A C;  3X25 B;  3RKW A;  1WJS A;  5D6X A;  5L8R E;  3BY7 A;  1OI1 A;  4LD9 K;  1Q7Y U;  1Q86 U;  4IUR A;  1G3T A;  4A53 A;  1G3S A;  3A8L B;  2DO3 A;  4BB7 A;  5LJ5 d;  1RL2 A;  1VQ9 T;  4M7A F;  4OP0 A;  2VXF A;  2KDS A;  5IN1 A;  5GMK e;  3L2Q A;  2EJG A;  3RES A;  1Q81 C;  3OA6 A;  4RKU E;  4BAC A;  4EMH A;  1QVP A;  2LCC A;  2M16 A;  2E10 A;  4IUQ A;  4N0A C;  4QQG A;  4C0F A;  3CC7 T;  2M9U A;  4OB3 B;  4NL3 A;  1BIA A;  2EFI A;  1XNI A;  4M7D G;  2DPP B;  5A0G A;  2IVW A;  2G3R A;  1OZ2 A;  3HFO A;  5DLQ E;  2B8A A;  4C5H A;  2PVO B;  4Y91 A;  2DXU A;  2RI3 A;  4PLL A;  2XHC A;  3SFM A;  3HPW A;  2DTH A;  2EQU A;  1YIJ T;  2RHY A;  3MEW A;  4BD3 A;  2RI2 A;  5FU7 B;  3OS1 A;  2E70 A;  2CZ0 B;  1X75 C;  4LD6 A;  3CCS A;  5LJ5 h;  4FIB A;  1KQ1 A;  2KMT A;  3GNG A;  3RMQ A;  5D6Y A;  1K73 U;  1UEB A;  4OB0 B;  3V8L A;  2LDM A;  4NS5 A;  2QQR A;  2JNG A;  3CMA T;  1MGQ A;  2EQK A;  5GAM j;  1WPY A;  3OY9 A;  1QVF S;  3I56 T;  2P0Q A;  5A0D A;  4R55 A;  5LJ3 e;  4X9C A;  3M59 A;  2OAU A;  3VU3 C;  1IRE B;  1VQ4 T;  1D3B B;  3ASK A;  3OYY A;  4JRI A;  4M78 C;  2QA4 T;  1Q82 C;  3QZ5 B;  5LJ3 f;  3JCM J;  1ZQ1 A;  4C8Q G;  5C0M A;  3MEA A;  1M90 U;  2D9T A;  4E7K A;  4BI3 A;  3M4G A;  2RK2 A;  5I2M A;  4ZGE B;  1FX7 A;  3A8G B;  2ZZD A;  2ZCF B;  3BW1 A;  3OYD A;  1B34 A;  1FWZ A;  2JOY A;  3M54 A;  3H8Z A;  3N5B B;  3OYL A;  4F7U G;  3WXM B;  1VIE A;  3X20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...