4J6YA

Hfq from pseudomonas aeruginosa crystallized in gtp presence
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j6yA00
4M7DF 4PJOB 1BIAA 2DEQA 4Y91A 4M7AC 4EMKB 4QVDA 4C8QE 2FYKA 2RB6A 3BDUA 4JRKA 3EFSA 2DTOA 3JCMg 1N9RA 4F7UG 1D3BA 3JCMh 3BY7A 3JCMQ 3JCMP 5LJ3e 4M75A 4M78B 4XTUA 2DTIA 2E1HA 4N0AA 4C8QF 5GAN6 1M8VA 4M75C 1BIBA 4M75E 4XU1A 4C92A 4RCBA 4PNOA 2FB7A 3QUIA 3RIRA 3INZA 4M77G 4X9CA 1U1SA 4JUVA 4X9DA 4C92C 4C92E 4NL3A 4HT8A 1JBMA 2DZ9A 3JCMf 4M7DA 4A54A 4M7DC 1Y96A 4XTVA 4PJOA 4M7DE 2E65A 2ZGWA 2EJFA 4EMKA 1KQ2A 5GAMg 3SWNB 4F7UB 1X01A 3RKYA 5GAOr 4MMKA 5GANh 4PJOE 4C8QA 3JB9F 5GMKe 2DZCA 4A53A 3FB9A 2EWNA 4C8QC 4M77D 5GAOq 2QTXA 1WQWA 2EJ9A 1M5Q1 4PJOF 4M78E 1TH7A 2E10A 4XU2A 4M77B 2RD1A 3BW1A 4M7AG 5LJ3d 3V7SA 4NOYA 5GANf 4J6YA 4RCCA 4HA8A 1KQ1A 4M78F 4N0AC 4XTZA 2YLCA 5LJ3j 5GMKl 3JCMe 1U1TA 3JCMd 4NL2A 3JCMJ 2DXUA 3L2ZA 2RM4A 1I4K1 1MGQA 3QSUA 1LNXA 5GAN7 1N9SA 5GMKi 2VXFA 1WQ7A 2RA2A 3JB9I 1I5LA 3L1AA 3HFNA 3JCMW 2EJGA 4XTWA 2DKGA 4C92G 3JB9H 4M7AD 4XU0A 3V7CA 1H641 4PJOC 5GAMh 1JRIA 5GAN2 4EMKC 3EFRA 5GAN5 3PGGA 3V7RA 4F7UF 4M7AB 4M78A 5LJ5g 1LJOA 1LOJA 5GMKm 5LJ5h 5GMKj 5DY9A 4M77E 4J6XA 4M78C 4MMLA 5GAOn 4M75D 4J5YA 5GANe 3V8JA 3QHSA 4XTXA 1D3BB 5GANd 1B34B 2Y90A 3JCMV 4C8QG 3FIFA 4XTYA 4EMHA 5I21A 4J6WA 3V8KA 4C92D 4M75B 3RUXA 5GAMf 5GANj 4M77F 3JB9J 5GAN4 3RKWA 4C92B 4M7DD 3JCMc 5LJ5f 4XQ3A 1HK9A 3SWNA 4F7UA 3JCMX 2E41A 4M75G 3SB2A 4QVCA 4JRIA 5CAIA 4PJOD 3JCMb 4M7DB 3SWNC 3M4GA 4F7UE 2K57A 1I81A 5LJ3g 4V2SA 5LJ3h 4C8QD 2JN0A 1WNLA 1HXDA 3AHUA 4M7AE 3GIBA 3JB9G 4M78D 2VC8A 3QO3A 3RERA 4M7DG 4M77A 1B34A 4C8QB 5GAOl 2YHTA 2DJZA 5GAOp 3HFOA 4M77C 2DVEA 4PJOG 5GAN8 5GAMe 4M7AF 5GAMd 3VU3C 2E64A 1WPYA 2CGHA 5LJ3f 5GAMj 3BFMA 4DQ2A 5LJ5e 4M78G 1YCYA 5LJ5d 2I2LA 4EMGA 2YLBA 3RKXA 3JB9D 4M75F 2HNIA 3FJPA 4XU3A 5GMKh 5LJ5j 3V8LA 2DTHA 2VXEA 5GAOm 4C92F 4WF2A 4HT9A 5GANg 2DXTA 4OP0A 5GAN3 3HSBA 4M7AA 2EAYA 3RESA 4JLIA 1I8FA 1Y96B
chains in the Genus database with same CATH superfamily
2VUBA 2GTJA 4HKEA 2H8HA 3JCMQ 4YTLA 2RJEA 2ZCFB 2LQNA 4R55A 4RCBA 2XDPA 1QCOA 4OMNA 4X9DA 3VS1A 3ULRB 2ED0A 2ZPFB 1VQNT 4OVAA 5DM7R 1WI7A 1UHFA 1KD1C 1VQOQ 1M9SA 3JB9F 3QWXX 2KT8A 4KGVB 3OYDA 2AZVA 5GJVB 1YJ9T 2DL4A 2ED1A 4BD3A 3AT1B 1SKUB 5IAYA 3OS2A 2D1XA 2CKKA 3OYHA 3PMTA 4MZMA 1PKSA 2D9TA 4N4IA 2C0TA 2L2PA 2NWMA 4RUGA 3CMEQ 1UGSB 3L2ZA 4PJMA 8ATCB 1YITA 5CQXA 1K0SA 1IO6A 3HHTB 3V7CA 3DLMA 3MEVA 3OQ5A 6AT1B 5KYNA 4RMOA 1IRXA 4KGZB 4M75D 3THKA 3R6NA 3DKMA 1VQ9Q 4A4FA 4DA4A 3RUXA 5GAN4 4C0GA 1VQ6Q 3J7AF 3P8HA 3CXCS 5CK9A 4F7UA 2A36A 3LGFA 4FT4A 4IIOA 1K9MU 2KXDA 4LD6A 2K57A 1H3ZA 3S3MA 2DYIA 1QWFA 2E5KA 2L3SA 1ZBXA 4OMFB 2BZYA 2E64A 5LJ3f 3OYMA 1Q95G 3EG0A 1YIJT 1G5VA 4OF1A 2QQSA 1I5OB 3UATA 1LCKA 4EIKA 1NPPA 1KQSS 2J06A 1G8XA 3VYGA 4ZTJA 1I07A 1QVGP 1K73C 2RHZA 4FW2A 3EGDA 3JCMg 1QWEA 2K3XA 2PZ1A 2DL7A 1WHGA 1YWOA 2W0ZA 5GAN6 2PVOB 5HY6A 3CC4Q 1NEGA 2BIVA 3I5RA 2QQBA 3INZA 2BKDN 2O4XA 3CQTA 3VS0A 4A4EA 2M51A 5KH6A 1SPKA 1LPLA 3X24B 1OQKA 5CKEA 2HEQA 2QAZA 1WJRA 4N4HA 1YI2Q 3NMZC 3RBBB 3I55T 2E6ZA 1ZUKA 2CS7A 2GBQA 3CCEQ 1QKWA 2CP6A 5D7UA 1K8AC 2HQEA 4B6MA 3VJPA 3CC2Q 5LJ3j 3CCLQ 5KE3A 4NL2A 1NYFA 2R5AA 1YHQQ 2R5MA 1K8AR 1ZA1B 3EFRA 2RQTA 1KHCA 2DM1A 2MF2A 2YWWA 3M0RA 1NM7A 2DPPB 1Q86U 1TUCA 2YRDA 2MOXA 2K79A 4N4GA 2XICA 1G3TA 2EQMA 4XTXA 1VQ8A 2FRYA 1YJNA 2KYMA 1WYXA 3X26B 4FYYB 1WA7A 4FW1A 5LJ5f 3TEEA 4PJOD 2RHUA 2RJDA 4E47A 2LTOA 1I81A 5LJ3h 3FRNA 3M54A 4ELYC 4M78D 4DBRA 1VQ7A 1AWOA 3HRSA 2IPOB 2YT6A 3JAME 3JRZA 1UGVA 4PFPA 4XK8E 1VQOT 2OI3A 2NLUA 2CP5A 4JRPA 3CBOA 2A37A 2K3YA 3G7ZA 3V8LA 4ME7A 2RF0A 1YJWA 1Q7YR 1S72Q 2HL5C 5GAOm 3HSBA 2DA9A 4KH0B 4M7AC 4IUVA 4IUUA 1ZSZA 1C0MA 1RAHB 4J8OA 3C95A 3LLRA 2EW3A 2BE9B 3QUIA 4M77G 4AFQC 1BB9A 2DZ9A 2QA4A 3RR6A 2EJFA 1KQ2A 1ZLMA 4KUDK 2RN8A 1M1GA 4DBQA 4C8QA 3OYKA 1NLOC 2LCLA 2L3QA 2MI6A 5CKBA 1JJ2A 2QTXA 4K11A 2FZGB 1UGRB 2DL3A 4IIMA 1YITQ 3L2RA 2CZ6B 4BACA 4ZGJB 1WJSA 2DK3A 1QMCA 1ARKA 1KQ1A 2JT4A 1PG5B 1IHWA 5HK0A 4Z89A 3QWYA 5GAN7 2CZ1B 2HQHA 2B86A 2E5QA 1UJ0A 1WZOA 1AVZC 4WCIA 3V7RA 4M7AB 2LZ6B 4C0DC 1R77A 5LJ5h 1H8KA 3PVQA 2DMOA 5FW9A 1M1KU 2EQUA 1VYUA 4C92D 2H3JA 2PNIA 1UE9A 1EX4A 1JEGA 2K4YA 1V1CA 4JRIA 3JCMb 2RK2A 2FG0A 1K9MC 1X6BA 2JN0A 3RMSA 4C0ZA 2NUPA 1B7TA 3JSCA 2CYZB 4LE9A 2YHTA 5GAOp 2RO0A 1M2VA 2DVEA 4M7AF 1ACMB 2KR3A 2JVVA 1GCQC 3VRZA 5GAMj 4R56A 1XOVA 1X43A 2I2LA 4J9CA 2F69A 3KUFA 3M5AA 2DF6A 5M9OA 4HCKA 1TOVA 3CCET 2E4HA 1VQPT 2NUTA 2LC4A 1WJQA 3CC2T 1RL2A 3CCLT 2ZPEB 4C0DB 2JTMA 3UPUA 4KUIA 3BY7A 2VKNA 4J9GA 4D8KA 2VV5A 4M75C 1BIBA 2O01E 5I11A 4FIBA 1AEYA 4E7ZA 1JXMA 4ZNXA 3RIRA 4X9CA 5CCAA 2LCSA 1JBMA 3OW2S 1Q81U 1Y96A 2KROA 4E7IA 3A8HB 1XQHA 2GQVA 1X01A 4MMKA 1MUZA 2DZCA 1RAEB 3G4ST 1TH7A 2X4YA 1VQLQ 3G1JA 2X4WA 2DEUA 2DXBA 1N27A 3M59A 1OOTA 3JCMd 2P0KA 1KFZA 3CEYA 1BYMA 1VQ8Q 1X75C 3HFNA 4PJLA 3UDCA 3OYGA 1C1AA 3D7SB 3QPHA 4EMKC 3CCMT 3META 1ZUYA 4M78A 5FWBA 3H0HA 2OTJT 1Q86C 3M0UA 4PKCC 3M58A 4M75B 4GLKA 2KY9A 4QQ6A 1ZA2B 1VQ7Q 1Q86R 3CXCA 3GNGA 1AHJB 1AT1B 3ZL7C 3JB9G 1AD5A 1E7OA 2HSPA 4PLLA 1SSFA 2YRVA 4DBHA 3RERA 4M7DG 1MV0B 4FU6A 1YJWQ 5KYXB 2G6FX 3A8MB 4QVZA 4X1VA 3MHXA 2LVMA 2DD5A 3H0IA 1SSHA 3PMIA 3G6ET 3OMCA 2LT1A 2RH2A 1YCYA 4M75F 1KJWA 3L2QA 2QXFA 3OA6A 4BB7A 2GNCA 2RI3A 1KQSA 4OB0B 4OMPA 2DEQA 3TSWA 4EMKB 4C8QE 1WFWA 4FYXB 4FYVB 1VQ6A 1RAAB 2QA4Q 3CCST 1SRLA 5LJ3e 1D1AA 2HSEB 2DTIA 3GNFB 2K3BA 1NJIR 3QDRB 1QP3A 4M75E 4LDVA 5CKHA 2GCXA 3OBYA 1WHMA 5KYUA 4M7DA 2CSQA 1AZGB 1IZ6A 2BE7D 4J7FA 4FM4B 2XD0A 3F70A 2EWNA 1MMGA 2DBKA 1KSWA 2OJ2A 5IH2A 5HKCA 2HD0A 2HQXA 5J39A 2FPEA 3BW1A 8AT1B 2BZXA 2RJCA 5LJ3d 1D0ZA 2L89A 2M1HA 4ZTFA 3H8ZA 1GL5A 3TU4K 3QSUA 1G83A 1I5LA 1VQ4Q 3L1AA 2M16A 3CPWS 4A4HA 2EYQA 5GAN2 3GOXA 3PGGA 1UJYA 2YUOA 3HRTA 2GFUA 5EC7A 9ATCB 2EBPA 2QI2A 1D3BB 1M1KC 2XKOC 1HJDA 5GANj 3ER0A 3V8KA 2DRKA 4ORZA 1M27C 3MPUB 2RQUA 2EPDA 3KFVA 3CD6A 5CAIA 2CDTA 4BI3A 2M0OA 1VQ5Q 1WXTA 1QW1A 1TU0B 2EYZA 1Z9ZA 1GCPA 1UEBA 4RTYA 3A1PA 2FO0A 2WSEE 2DJZA 4KT0E 1RUWA 1AZEA 3OYAA 3VU3C 1CKBA 5LJ5e 1RLQC 1PRLC 3LW5E 4FT2A 2M02A 4MDWA 1AWJA 4A4GA 4LDWA 1CKAA 4OP0A 5GAN3 2J05A 1M90U 1I8FA 3FEOA 2X4XA 4Y91A 3I56A 1W2BP 4JRKA 2KAFA 1D0YA 2QEXT 1QKXA 1VQKA 2LX9A 3E19A 4OB3B 1M8VA 3DLLA 4J9BA 1VQ8T 1IREB 3EHRA 3MEAA 3M0SA 1YJNT 3ASKA 3CPFA 4C92C 4ZN3A 2PVGB 2QDLA 3JCMf 2KBTA 2JTFA 4XTVA 1Q81C 1GFDA 2AZSA 2PQWA 5GAOr 4PJOE 1V29B 1VQ7T 1WHHA 1M5Q1 4M78E 3L2VA 1PD1A 2P4TA 2J7IA 2RD1A 1S72A 2GQIA 2CH4A 1V76A 3EG3A 2M0YA 5C6SA 2LCCA 1NYGA 1WDXA 2XDBA 1YJWT 1X2KA 2DRMA 1U3OA 5D6YA 1MV3A 3JB9H 3X25B 5KYYB 5D6XA 1JRIA 5HCKA 3OYBA 2JW4A 4TVRA 4DOVA 2LQ8A 2V8KA 5GMKj 2LQWA 2EYWA 5FLXE 2Y90A 3JCMV 4OMQA 1KD1R 1UDLA 7AT1B 3OYLA 3ZEHA 1UFFA 4C92B 1UG1A 2AHJB 3R6OA 3SWNA 3VUBA 2E41A 2EYXA 4BI4A 3G71A 4A63B 1M2OA 1YP5A 4C8QD 4KULA 2XIDA 2QQRA 2X35A 1KC8U 1WGSA 2VC8A 4Q5WA 1PNJA 3OYFA 2YUQA 4MZTA 4JJBA 3P8BB 3EGXA 1W70A 2E12A 5GAMd 2MYSA 2JM8A 2X9HA 2X51A 1LVKA 4XU3A 4OMLA 5GMKh 2HBWA 4WTOB 1ZX6A 5IN1A 4C92F 1PM3A 1ZQ1A 2CT4A 3REAB 2JJ9A 3CCRA 3GPLA 4NL3A 3A8GB 2DE0X 3JCMh 2QDYB 5CR2A 1GFCA 1OPKA 2CZ0B 5FU6C 2K5IA 3LX7A 3FJ5A 4ATOA 1QCFA 5A0GA 4C92E 3QZ5B 3OYYA 3OW2A 5KYWA 2EGAA 2GF7A 2CSIA 1EFNA 2E3IA 1AWXA 2IVWA 4QT7A 2HMAA 2RQVA 1HYOA 2A3LA 3MP1A 4M7AG 4RCCA 3OYEA 3J81E 1SG5A 1K73R 1E6HA 3KXTA 2EGEA 1KHIA 2ATCB 4M4ZA 2D0QB 1OV3A 5IHNA 1Q82U 1NEBA 1RABB 1WXUA 4BI8B 2P84A 1LJOA 2KMTA 3CD6Q 4GY5A 3QJ6A 2EYYA 4A4KA 1JO8A 1B34B 5FU6B 4F17A 2FZCB 2Z0WA 2EKOA 5I2SA 4QQGA 4EPCA 3CCUA 2AKKA 3CMAA 3QIIA 2DIGA 3C4SA 3S3OA 2ZAEA 1P92A 2WSCE 1VQLA 2EGCA 2GTOA 1WNLA 2RNAA 2J6KA 2KEAA 1QCNA 3HFOA 5IXBA 4KBMB 2YXYA 2CGHA 1QQJA 2F2XA 3I56Q 3SHWA 3QXEB 1VQKQ 4BUGA 4ZGDB 1WIEA 2LX7A 5EG2A 1I1JA 1QVFS 2WSFE 1RI9A 2EAYA 2H3EB 4E7LA 5ECAA 1M90C 3BDUA 3TVTA 2P4RA 1FMVA 1FXXA 1M90R 3VKIA 2MWOA 2X3WD 1BBZA 4DEXA 4FCYA 4C5EA 3CC7A 2FEIA 1XNIA 2OX7A 1G2BA 1PCXA 4PJJA 2JOYA 2VYTA 4F7UB 3RMQA 2DLPA 1OULA 2D6FA 4BE2A 3CMET 4RTVA 4CC3A 1PSEA 4KGXB 4B9WA 3A8OB 3EG9A 4R0KA 4C5GA 5IHIA 1JJ2P 3OYCA 4LD9K 4JJDA 1BI2A 4CI0C 2GFAA 2DKGA 1VQ9T 1M8MA 3CPWA 1U8RA 1OU8A 4F7UF 1X69A 1S1NA 2LJ3A 1UHCA 1JQQA 2KRSA 1VQ6T 2LMJA 4J5YA 1O9SA 3TQ7P 3V8JA 3G71Q 1R0BG 3E2UA 5GANd 1OZ2A 2V8JA 1HSQA 5GAMf 1TUGB 2OTLA 1KIKA 2KRNA 4M7DD 3KBGA 4PLIA 1MNEA 1M3CA 2O4XB 2F2VA 2KQWA 2RMOA 4F7UE 3DB4A 1RADB 3OBWA 2YUNA 3GF5A 4L6V5 2I0NA 3I9QA 3QO3A 4D6WA 1N6AA 1KC8C 4M77A 4C0FA 5GAOl 2NYSA 2D8HA 2NUZA 3OYIA 1VQ4A 3CCRQ 5J26A 4OMMA 3GBQA 2COZA 2CZ7B 3VV0A 1UTIA 1X6GA 5FRMA 4F04B 1G3SA 1NE8A 4CC7A 4WF2A 3VS4A 2BZ8A 1EZZB 2V1QA 1AWWA 4O6JA 5KYXA 4PL6A 1NBEB 1RACB 3CC4T 2BUDA 1VYVA 1ZSZC 4RTTA 4Y28E 1TWBA 2CP7A 1SRMA 4XTUA 3CCJA 2CP3A 2ROTA 1VQ5A 4FL6A 1PSFA 1K9MR 2EVRA 2RK1A 1QVPA 2MPXC 4A54A 1YI2T 3NTIA 4EMKA 3CD6T 1GBRA 4O5VA 2K5FA 5GMKe 2PUKB 4C8QC 4QW2A 2YRCA 1YHQT 2EQIA 3JCMe 2A0FB 2DX1A 3OSVA 1VQMA 3X20B 3PFSA 1WQ7A 1JU5C 3JCMW 2EJGA 5CVIA 1K1ZA 5GAMh 3CCUQ 1Q82C 3CMAQ 3I55A 3I56T 3MEUA 1LOJA 2XDDA 1VQKT 2K2VA 5GAOn 1ZSZB 2DL5A 3VYHB 1Y57A 1A0NB 1TTHB 1D09B 1UUEA 3RKWA 1OZ3A 5J3BA 3JCMX 3SDZA 4QVCA 2XI9A 3OB9A 2ABLA 1GRIA 4IUTA 1Y7XA 4BE1A 5DLQE 4C8QB 3VS6A 1YBYA 5HK3A 1QVGS 3M0PA 3CXCP 3MP6A 1OPLA 1S72T 3ZFJA 1IXDA 3H9NA 4JJCA 1VA7A 4A53A 3EH2A 4ANJA 2RB6A 1N9RA 3QKJA 3CC7Q 1D1CA 4C8QF 4RTZA 2L0AA 1KQSP 1J3TA 3OS1A 2JMCA 2LRQA 1RAFB 4LDYA 3G71T 1YITT 3T9NA 1MHNA 3NGPA 3QG1A 4VUBA 3FB9A 3CBPA 3A8LB 2KXCA 2NUPB 2F1LA 1M2VB 5GANf 2AIRB 4D8DA 1KG1A 4N0AC 1G3YA 1MGQA 5GMKi 2JS2A 2KVQG 1M3AA 3MEWA 4C92G 4PJOC 2XHCA 2OTLQ 3CCRT 3PIPA 2CUBA 2DVJA 1R0CB 5GMKm 4M77E 4J6XA 4M78C 2FZKB 2K2MA 3FIFA 4J6WA 1RI0A 1QP2A 1W6XA 2RPNA 2VGMA 1Y07A 5KYYA 4X34A 2QK0A 2QASA 3M4GA 4E7JA 2C06A 1I0CA 2DL8A 1OYXA 3GIBA 4HVVA 1MMAA 5KCHA 2V26A 3IQLA 3TCJA 2IIMA 1NPRA 3MCAB 1VIEA 1NLPC 5A0LA 3M56A 1B07A 3CCJQ 1PKTA 4HT9A 1HD3A 2RHXA 5LL6S 1YIJQ 2KI7A 3OY9A 1M1KR 2P0QA 3QYGB 4PJOB 3M53A 2J6FA 4NS5A 1BI0A 1WHKA 1M30A 4M78B 2AKLA 1WXBA 3UA7A 3QJYA 3HRUA 3CMAT 3EAEA 2HKQB 4M7DC 3DB3A 1VQPA 2HBPA 4HVWA 1BK2A 4AMCA 1VQLT 1RAGB 5GANh 1UGPB 1VQMQ 3LGLA 1K0XA 1K4US 1WQWA 4PJOF 3HP9A 3JV3A 2QG9B 3FC3A 4BE0A 2KT1A 4J6YA 4HA8A 3TSZA 4M78F 2RHYA 2EFIA 3I55Q 4E6RA 4CC2A 2DXUA 2MWPA 3JB9I 2B8AA 3OYNA 1ABQA 2E3HA 4P5NA 2FVUA 3G4SA 1Q7YU 1PWTA 2QYZA 2DERA 1FMWA 4BY6C 2HAXA 4QKUA 4ZN1A 1Q81R 3JB9J 3CBMA 1IGQA 1R8OB 2LT4A 3CCVA 2JS0A 1T3SA 4E7HA 1HK9A 2WACA 1DJ7B 3CC7T 4M7DB 2DIQA 3LYIA 4AFUC 3CCMA 2FPFA 3AHUA 2OTJA 3O8VA 1YCSB 4FSXA 1B34A 3PT9A 1RAIB 3FLGA 2K9GA 2RI5A 3I35A 5GAMe 3URGA 3EG1A 2RQWA 3EHQA 3VS5A 2RQRA 4Z02A 3EFOB 4EMGA 2YLBA 4AFSC 4L5GA 3M0TA 2PVDB 2QA4T 1PD0A 1T0JA 1FMKA 1TXQA 3GP8A 4M7DF 2JM9A 4JZ3A 3EFSA 2YSQA 4F7UG 3C12A 4BY6B 1D1BA 3UF4A 2L8DA 2ECZA 3G6EA 1JXOA 1K76A 4JZ4A 2OTLT 2X3XD 3NFCA 4J9FA 2HCKA 3U23A 1OX8A 3E1SA 5CO7A 3RNJA 3OMGA 4M7DE 4II1A 2ZGWA 4RG2A 3RKYA 3Q1JA 4RTWA 4M77D 3CCSA 2CP2A 2K5LA 2E10A 3X28B 2BTTA 4XU2A 3OW2P 1C6VX 5A0DA 3SFMA 1VQ4T 4KH1B 1TG0A 4BDZA 1I4K1 1LNXA 4E7KA 4F16A 1M4ZA 1ABOA 2ZPBB 2A7YA 2KRMA 2VWFA 2Y4YA 4Y92A 5GAN5 3CCQA 4ELZC 3QZ9B 2DD4A 3LH5A 1WLPB 3M4YA 2JZ2A 4MMLA 4HCBA 3PTAA 2IG0A 1EIFA 4LNPA 3CCJT 2PU9B 4KRTA 4XTYA 2R58A 1MNDA 1VQ5T 3N5BB 4EDUA 4DEYA 1GBQA 5FROA 4XQ3A 4IKFA 1BI1A 1W4SA 1Y0MA 3SWNC 3J80E 2QTVA 1VIFA 2HL3A 2ZZDA 1ZSGA 1N8RU 2QQAA 2G3RA 1QVGA 1SHGA 4HXJA 1OU9A 2L3RA 4AG1C 1VQMT 3ZBDA 4ZGEB 2AT1B 2DXTA 4IUQA 4LDXA 1VYTA 4M7AA 4JLIA 2KE9A 2LJ1A 1TSFA 2XG8D 2R57A 1VQPQ 1XTDA 3I5SA 4LUDA 3RDVA 1H92A 3C0CA 3NTKA 3S6WA 4OGCA 2P0PA 4JUVA 3S3NA 4JPBW 3OS0A 2ENMA 3FDRA 5L23A 2JNGA 2E65A 3QBYA 3SWNB 2Y4XA 2XU8A 3A5ZB 2AK5A 1OX9A 2QEXA 2ZPGB 4RKUE 3L2UA 3VRYA 3WVDB 1PRMC 1X6OA 3EGXB 2O2OA 3G4SQ 2RM4A 2W10A 1F1BB 4GBQA 4IUPA 2QGGA 2KDSA 1G3WA 3CCVQ 1Q7YC 5GANe 3OS5A 4EMHA 3CCMQ 4C8QG 1GXIE 2JMAA 2OTJQ 3CPWP 2CUDA 3JCMc 4UC4A 1IHVA 1VQNA 2VASA 1NJIU 4M75G 3LWHA 3M57A 5FU7C 2F5TX 2KYBA 5LJ3g 4V2SA 1BKBA 3MP8A 2PTKA 4AT1B 2DETA 5KYWB 1UB4A 1YJ9A 1YNZA 1ZUUA 5GAN8 5CIUA 3EGDB 1E6GA 1GCQA 2FPDA 1MMNA 1W2BS 3BFMA 3JB9D 1WX6A 3FJPA 1MMDA 5LJ5j 2COWA 3L42A 2MAMA 4JRQA 2MK5A 3P8DA 3G6EQ 3EG2A 4E2FB 2O31A 1NG2A 1AOJA 4JDSA 4M75A 5GJWB 2E1HA 4XU1A 3UT1A 4JJNK 2ZPHB 2FB7A 3WVEB 1U1SA 2MIOA 3CCSQ 1KC8R 4MDXA 2DAQA 2E70A 2DYBA 2C0OA 2YUPA 2OAWA 5FU7B 1VOMA 2VVKA 2KSSA 2JUFA 4MZPA 2A28A 3LWIA 3VS3A 1PC0A 1ZBJA 5A2QE 1JB0E 1YIJA 3CCQQ 5IXFA 3A98A 2VB6A 4LN2A 3L2WA 4BDYA 2RA2A 2DILA 4XTWA 4XU0A 1YN8A 2LP5A 3OYJA 3H6ZA 4PK4A 5LJ5g 3QDFA 2CT3A 1RLPC 1N5ZA 4OB1B 3NPFA 1FWZA 2L3PA 3QYHB 2QGFB 3M9QA 2FL7A 4JS4A 1VUBA 1WHLA 2LQKA 2SRCA 2PUOB 5KE2A 4OB2B 2DBMA 1W1FA 1HXDA 2O9SA 1XJWB 4M7AE 1O75A 2HZYA 1H3HA 4OGEA 1BU1A 4M77C 1KK7A 4PJOG 1N8RC 2ROLA 2M9UA 1WHJA 4JLGA 4JS5A 4M78G 5FWCA 3EG9B 1Q82R 2DTHA 2OAUA 4IURA 2FHDA 2XMFA 3UWNA 1N8RR 1TUDA 1PHTA 4LDUA 1B3QA 3RESA 1X27A 2O9VA 1BIAA 4HCZA 2FYKA 1IGUA 2DTOA 1D3BA 4J83A 2HKNA 3JCMP 4PJNA 3C94A 3LH0A 4N0AA 5AT1B 2QEXQ 4PNOA 1U06A 4HT8A 5AYFA 3CCVT 3WXMB 4PJOA 1YJNQ 1KD1U 5GAMg 1M3BA 2V8IA 2KGTA 2FRWA 2ESWA 2EIFA 3ME9A 3HTRA 5GAOq 3REBB 3BE3A 3EGUA 2RJFA 4M77B 2QQ9A 1SEMA 3V7SA 1VQOA 4XTZA 3MJXA 1U1TA 2SEMA 1N9SA 3EH1A 3E9FA 3M0QA 2E6NA 3PE0A 2RHIA 2DNUA 1NZ9A 4C5HA 3SD4A 3CMEA 1T0HA 2MMPA 1D0XA 3PIOA 2MCNA 2DXCA 1VQNQ 5DY9A 4LXCA 3HPWA 3QHSA 5I21A 2C0IA 5D6WA 2JTEA 2GGRA 4C5IA 4J9IA 4M77F 2CREA 3SEMA 1YJ9Q 1NJIC 1VQ9A 4Z8AA 2D8JA 4PFZA 3VS2A 4RTXA 2KNBB 2NUTB 4FYWB 1WPYA 2DJQA 4DQ2A 4F14A 1X2QA 1IB8A 1K9AA 2HNIA 3H41A 1BI3A 2K6DA 1CSKA 4E7SA 3O5ZA 3MO8A 3BDLA 5KCOA 1K73U 2F5KA 1QLYA 3HL8A 1Y96B 4B9XA 3NTHA 4QVDA 2LNVA 3CCQT 4RTUA 2CP0A 1M1FA 1T3LA 5FRNA 1SHFA 4LUEA 1OEBA 3NHNA 1TS9A 4CRIA 4AFZC 3EFOA 2EKHA 4C92A 2EQKA 2F2WA 4J7IA 5I2MA 4J9HA 3VUZA 1QVFP 2XK0A 3MKDA 1FX7A 1YWPA 2EQJA 4J9EA 4RG8A 4DOWA 3TREA 5DLOA 4QQDA 2HDAA 4DBFA 1Z9QA 2LDMA 1JJ2S 3CC4A 3H0FA 1QVFA 3M55A 5CKDA 5IHKA 4HCCA 4FSSA 2K7AA 2EJ9A 1UGQB 1K8AU 4NOYA 4PFOA 2YLCA 2LNHB 3GLXA 5GMKl 3JCMJ 1OI1A 1YI2A 1Y71A 3CCUT 4ESRA 2VXFA 2J6OA 4CC4B 3CCEA 2JXBA 1BCMA 1UECA 4M7AD 1H641 4J9DA 2L5QA 3UA6A 3HKSA 5CQYA 3CC2A 3CCLA 2KK4A 2O88A 1YFNA 2DFUA 5C0MA 1YHQA 4AG2C 2COYA 2YDLA 2CH4W 2D0NA 3OSSC 2V1RA 1SF9A 5IT9E 2RI2A 3SB2A 1U5SA 4OMOA 1BCOA 4Z88A 2VGNA 1ZHIA 1FYNA 5I22A 2X4JA 2A08A 4HVUA 4XAXB 1W2BA 5CKFA 4GLMA 5LJ5d 3RKXA 5L8RE 3VS7A 2VXEA 4L59A 2ZPIB 3E9GA 2DO3A 3PVLA 3PNWC 5GANg 5KYUB 2LJ0A
chains in the Genus database with same CATH topology
4O6JA 2VUBA 2DEQA 4EMKB 4C8QE 4PL6A 3CC4T 4HKEA 1VQ6A 2BUDA 2XG8D 4Y28E 3JCMQ 3CCST 2R57A 5LJ3e 1XTDA 4XTUA 4YTLA 2DTIA 3CCJA 3GNFB 3QDRB 2RJEA 2ZCFB 1QP3A 1VQ5A 4M75E 4LDVA 4FL6A 4R55A 3NTKA 1PSFA 4RCBA 2XDPA 3S6WA 4OGCA 5CKHA 2GCXA 2P0PA 4JUVA 4X9DA 2RK1A 3S3NA 3OBYA 4M7DA 1QVPA 4A54A 3OS0A 3FDRA 1YI2T 2ZPFB 1VQNT 2JNGA 4OVAA 3NTIA 2E65A 4EMKA 5DM7R 3CD6T 1IZ6A 3QBYA 3SWNB 4O5VA 2Y4XA 1KD1C 4J7FA 2XU8A 3A5ZB 4FM4B 1M9SA 3JB9F 2K5FA 5GMKe 2XD0A 2QEXA 3OYDA 3F70A 2PUKB 2EWNA 4C8QC 2ZPGB 4QW2A 4RKUE 3L2UA 1YJ9T 4BD3A 5HKCA 3WVDB 2HD0A 5IAYA 3OS2A 2HQXA 5J39A 3BW1A 1X6OA 2CKKA 2RJCA 3PMTA 3OYHA 1YHQT 4MZMA 5LJ3d 2D9TA 4N4IA 2L89A 2M1HA 3JCMe 4ZTFA 3H8ZA 3TU4K 1UGSB 3QSUA 3L2ZA 2RM4A 3OSVA 1VQMA 3X20B 3PFSA 1WQ7A 4IUPA 1YITA 1I5LA 3L1AA 5CQXA 3HHTB 2EJGA 2M16A 3CPWS 3JCMW 4A4HA 5CVIA 3V7CA 2KDSA 3DLMA 2EYQA 3MEVA 3OQ5A 5GAMh 5GAN2 1G3WA 4RMOA 1Q82C 3GOXA 3PGGA 3I55A 3I56T 3MEUA 3HRTA 1Q7YC 1LOJA 2XDDA 2GFUA 1VQKT 2K2VA 2QI2A 4M75D 5GANe 5GAOn 3DKMA 3VYHB 1D3BB 3OS5A 4EMHA 4C8QG 2XKOC 1M1KC 4A4FA 3ER0A 3V8KA 4DA4A 3RUXA 5GANj 3CD6A 1GXIE 5GAN4 4C0GA 3RKWA 3J7AF 3P8HA 1OZ3A 5J3BA 4UC4A 3JCMc 3CXCS 5CK9A 1VQNA 4F7UA 3JCMX 1NJIU 4M75G 3SDZA 4QVCA 3LGFA 4FT4A 5CAIA 3LWHA 4BI3A 2XI9A 2M0OA 3M57A 3OB9A 1K9MU 1QW1A 5FU7C 2F5TX 4IUTA 2K57A 4LD6A 5LJ3g 4V2SA 1BKBA 3MP8A 1H3ZA 1UEBA 1Y7XA 3S3MA 2WSEE 4BE1A 1UB4A 5DLQE 4C8QB 1YJ9A 2DJZA 4KT0E 1YBYA 5CIUA 5GAN8 5HK3A 3OYAA 1QVGS 1ZBXA 3MP6A 4OMFB 3VU3C 2E64A 1S72T 5LJ3f 3OYMA 1W2BS 3BFMA 3ZFJA 5LJ5e 1YIJT 3LW5E 1G5VA 4FT2A 3JB9D 4OF1A 2QQSA 3FJPA 5LJ5j 3L42A 2MAMA 4JRQA 4MDWA 1NPPA 3P8DA 4A4GA 1KQSS 4LDWA 4OP0A 5GAN3 3VYGA 4ZTJA 1M90U 1K73C 1I8FA 3FEOA 4A53A 2X4XA 4Y91A 2RHZA 3I56A 2RB6A 4JRKA 2KAFA 2QEXT 3JCMg 1N9RA 2K3XA 1VQKA 3QKJA 2LX9A 3E19A 4JDSA 4M75A 4OB3B 1M8VA 2E1HA 4C8QF 5GAN6 3DLLA 2PVOB 1VQ8T 1IREB 3MEAA 4XU1A 5HY6A 3UT1A 4JJNK 2ZPHB 1YJNT 2BIVA 2FB7A 3ASKA 3CPFA 2QQBA 3INZA 3WVEB 1U1SA 2BKDN 4C92C 2O4XA 4ZN3A 2PVGB 2LRQA 3OS1A 3JCMf 4A4EA 4MDXA 2DAQA 5KH6A 2JTFA 2E70A 4XTVA 1Q81C 4LDYA 3G71T 1YITT 3X24B 2PQWA 1MHNA 3T9NA 5FU7B 5CKEA 5GAOr 4PJOE 2KSSA 3QG1A 2JUFA 1V29B 3FB9A 4VUBA 4MZPA 1WJRA 3CBPA 3A8LB 4N4HA 3LWIA 1VQ7T 3I55T 1M5Q1 2E6ZA 4M78E 2CS7A 3L2VA 2P4TA 2RD1A 1S72A 1K8AC 2HQEA 5A2QE 1JB0E 5GANf 3VJPA 1YIJA 5LJ3j 1KG1A 4N0AC 5KE3A 4NL2A 1G3YA 5C6SA 1MGQA 2LCCA 2R5AA 5GMKi 2KVQG 3L2WA 4BDYA 2RA2A 2XDBA 1YJWT 3MEWA 2R5MA 5D6YA 4C92G 4XTWA 3JB9H 3X25B 4XU0A 4PJOC 2XHCA 5D6XA 1JRIA 3EFRA 3CCRT 3RERA 3PIPA 3OYBA 1KHCA 4TVRA 2MF2A 4DOVA 3OYJA 2LQ8A 2V8KA 3H6ZA 2DPPB 5LJ5g 1Q86U 5GMKm 5GMKj 4M77E 4J6XA 4M78C 5FLXE 4N4GA 2XICA 1G3TA 2EQMA 4XTXA 1VQ8A 2Y90A 3JCMV 3FIFA 4OB1B 1FWZA 4J6WA 1YJNA 3X26B 1RI0A 3QYHB 1QP2A 3OYLA 3M9QA 3ZEHA 2FL7A 4C92B 1VUBA 4JS4A 5LJ5f 2LQKA 2AHJB 2VGMA 3TEEA 2PUOB 1Y07A 3R6OA 3SWNA 3VUBA 2E41A 4X34A 2RHUA 4PJOD 5KE2A 2RJDA 4BI4A 4OB2B 3G71A 4E47A 3M4GA 2LTOA 4E7JA 2C06A 4M7AE 1I81A 5LJ3h 4C8QD 4KULA 1HXDA 2XIDA 1OYXA 3FRNA 2QQRA 2X35A 3M54A 4ELYC 4M78D 1O75A 1WGSA 2VC8A 1KC8U 4OGEA 4Q5WA 3OYFA 1VQ7A 3HRSA 5KCHA 4MZTA 4M77C 3P8BB 4PJOG 1N8RC 3JAME 3JRZA 2E12A 5GAMd 3TCJA 4M7DE 2M9UA 1NPRA 4XK8E 3MCAB 4JLGA 1VQOT 1VIEA 4JS5A 4M78G 5A0LA 2NLUA 3M56A 4XU3A 4JRPA 3CBOA 5GMKh 2K3YA 3G7ZA 3V8LA 2DTHA 4ME7A 2OAUA 1YJWA 4IURA 2FHDA 5IN1A 3UWNA 5GAOm 4C92F 1ZQ1A 5LL6S 2RHXA 4HT9A 4LDUA 3HSBA 3CCRA 3RESA 3OY9A 4NL3A 3GPLA 2P0QA 3A8GB 1BIAA 3QYGB 4HCZA 3M53A 4IUVA 4IUUA 4M7AC 4PJOB 2FYKA 2DTOA 4NS5A 1BI0A 1D3BA 2QDYB 3JCMh 5CR2A 4J83A 3JCMP 3C94A 2CZ0B 4M78B 5FU6C 2K5IA 3LH0A 4J8OA 4N0AA 3LX7A 3C95A 3LLRA 3GIBA 3QJYA 4PNOA 3QUIA 4ATOA 4M77G 5A0GA 4C92E 3HRUA 4HT8A 2DZ9A 3CMAT 5AYFA 3QZ5B 3CCVT 3EAEA 2QA4A 4M7DC 3DB3A 3WXMB 4PJOA 3OYYA 1VQPA 2HBPA 3OW2A 2EJFA 1KD1U 1KQ2A 5GAMg 1VQLT 2GF7A 4KUDK 2V8IA 5GANh 1M1GA 3OYKA 4C8QA 1UGPB 2LCLA 2MI6A 2IVWA 5CKBA 1JJ2A 2EIFA 3ME9A 5GAOq 3LGLA 2QTXA 1UGRB 1WQWA 3HP9A 4PJOF 2A3LA 3L2RA 2CZ6B 2RJFA 3MP1A 4M77B 3FC3A 4BACA 4BE0A 4M7AG 4ZGJB 2QQ9A 1WJSA 2DK3A 3V7SA 4J6YA 4RCCA 4HA8A 1VQOA 1KQ1A 4M78F 2RHYA 2EFIA 4XTZA 3J81E 3OYEA 1U1TA 3KXTA 2DXUA 5HK0A 1KHIA 5GAN7 2CZ1B 1N9SA 3E9FA 2MWPA 2E5QA 3JB9I 2D0QB 2E6NA 2RHIA 2B8AA 3OYNA 1NZ9A 1Q82U 4P5NA 4C5HA 3SD4A 3CMEA 2FVUA 3G4SA 3V7RA 2MMPA 4M7AB 3PIOA 4BI8B 4C0DC 1Q7YU 2DXCA 1LJOA 4BY6C 5LJ5h 2KMTA 5DY9A 4GY5A 3QJ6A 2HAXA 3HPWA 4A4KA 3QHSA 1M1KU 4ZN1A 1B34B 5FU6B 2EQUA 5I21A 5D6WA 4C5IA 4C92D 3JB9J 2H3JA 4M77F 2EKOA 5I2SA 3CBMA 1R8OB 2LT4A 4QQGA 4EPCA 3CCUA 3CMAA 3CCVA 3QIIA 2DIGA 3C4SA 4E7HA 1HK9A 2K4YA 2WACA 1DJ7B 4JRIA 3CC7T 1NJIC 3JCMb 2DIQA 1P92A 2RK2A 2WSCE 3LYIA 3S3OA 1VQ9A 1VQLA 4M7DB 3CCMA 1K9MC 2JN0A 3RMSA 1WNLA 3AHUA 4C0ZA 2OTJA 3JSCA 3O8VA 2CYZB 4FSXA 1B34A 3PT9A 3FLGA 2YHTA 5GAOp 2RO0A 3HFOA 4KBMB 2DVEA 2RI5A 5GAMe 4M7AF 3URGA 1WPYA 2CGHA 2JVVA 5GAMj 4DQ2A 4R56A 1XOVA 4Z02A 3QXEB 2I2LA 4EMGA 2F69A 2YLBA 3KUFA 2HNIA 1BI3A 3M5AA 4L5GA 4BUGA 4ZGDB 5M9OA 3MO8A 2PVDB 2QA4T 3CCET 5EG2A 3BDLA 5KCOA 1K73U 2F5KA 1VQPT 1QVFS 2WSFE 2EAYA 3GP8A 3HL8A 1Y96B 4B9XA 4E7LA 1M90C 2LC4A 4M7DF 1WJQA 3NTHA 2LNVA 4QVDA 3CCQT 3CC2T 3BDUA 1RL2A 3EFSA 3CCLT 2ZPEB 4F7UG 1M1FA 4C0DB 2JTMA 3C12A 4KUIA 3UPUA 5FRNA 3BY7A 4BY6B 4CRIA 2L8DA 2VV5A 4M75C 3G6EA 1BIBA 2O01E 4C92A 2EQKA 4J7IA 4FIBA 1FXXA 5I2MA 3RIRA 3VKIA 3VUZA 4X9CA 2MWOA 2XK0A 5CCAA 2OTLT 3NFCA 1JBMA 3E1SA 5CO7A 4C5EA 3CC7A 1FX7A 3OW2S 1Y96A 2EQJA 1Q81U 1XNIA 3OMGA 4RG8A 4II1A 2ZGWA 4RG2A 4DOWA 3A8HB 3TREA 5DLOA 4E7IA 4QQDA 1XQHA 2GQVA 1X01A 2JOYA 2VYTA 3RKYA 4F7UB 4MMKA 3RMQA 3Q1JA 2LDMA 1JJ2S 3CC4A 2D6FA 2DZCA 1QVFA 3M55A 5CKDA 4BE2A 4HCCA 4M77D 3CCSA 3CMET 2K5LA 2EJ9A 3G4ST 1UGQB 1PSEA 1TH7A 2E10A 2X4YA 4XU2A 3X28B 1K8AU 4B9WA 5A0DA 2X4WA 3A8OB 4NOYA 3SFMA 1VQ4T 2DXBA 4BDZA 1N27A 2YLCA 3GLXA 3M59A 5GMKl 4C5GA 3JCMd 3JCMJ 1I4K1 1OI1A 2P0KA 1LNXA 1Y71A 3OYCA 3CCUT 1YI2A 4LD9K 2VXFA 4E7KA 1M4ZA 3CEYA 1BYMA 1BI2A 3CCEA 2ZPBB 2A7YA 1X75C 3HFNA 3UDCA 2GFAA 4CI0C 3OYGA 2DKGA 4M7AD 1H641 2Y4YA 3QPHA 1VQ9T 3CPWA 4EMKC 2L5QA 5GAN5 3HKSA 5CQYA 3CCMT 3CCQA 3META 3CC2A 1U8RA 3CCLA 2KK4A 4ELZC 4F7UF 4M78A 2OTJT 3QZ9B 2DD4A 3M4YA 5C0MA 1Q86C 1VQ6T 2JZ2A 4MMLA 1YHQA 4HCBA 4J5YA 1O9SA 3PTAA 3V8JA 2IG0A 1EIFA 5GANd 3CCJT 2PU9B 3M58A 4PKCC 4XTYA 1OZ2A 2R58A 2V8JA 5GAMf 4M75B 1VQ5T 3N5BB 2OTLA 4GLKA 4EDUA 2KY9A 4QQ6A 3OSSC 4M7DD 5FROA 4XQ3A 5IT9E 4IKFA 1BI1A 1W4SA 2RI2A 3KBGA 4PLIA 2O4XB 3SB2A 3CXCA 3GNGA 3SWNC 2KQWA 4F7UE 3J80E 3DB4A 1AHJB 1VIFA 3OBWA 3JB9G 3GF5A 4L6V5 4PLLA 1SSFA 2VGNA 2YRVA 1N6AA 2ZZDA 3QO3A 4M77A 4C0FA 1ZHIA 4D6WA 5GAOl 1KC8C 4M7DG 4FU6A 1N8RU 2QQAA 2G3RA 2X4JA 3A8MB 4QVZA 3MHXA 3OYIA 1VQ4A 2LVMA 2DD5A 1QVGA 5J26A 3PMIA 3G6ET 4XAXB 3OMCA 1W2BA 2CZ7B 2LT1A 2RH2A 5CKFA 3VV0A 1YCYA 5LJ5d 3RKXA 5L8RE 4M75F 5FRMA 2L3RA 1VQMT 1G3SA 3ZBDA 4ZGEB 2VXEA 4L59A 1NE8A 3L2QA 2QXFA 2ZPIB 3OA6A 3E9GA 2DO3A 4WF2A 3PNWC 5GANg 2DXTA 4IUQA 4BB7A 4LDXA 1KQSA 2RI3A 4M7AA 4JLIA 4OB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D F;  4PJO B;  1BIA A;  2DEQ A;  4Y91 A;  4M7A C;  4EMK B;  4QVD A;  4C8Q E;  2FYK A;  2RB6 A;  3BDU A;  4JRK A;  3EFS A;  2DTO A;  3JCM g;  1N9R A;  4F7U G;  1D3B A;  3JCM h;  3BY7 A;  3JCM Q;  3JCM P;  5LJ3 e;  4M75 A;  4M78 B;  4XTU A;  2DTI A;  2E1H A;  4N0A A;  4C8Q F;  5GAN 6;  1M8V A;  4M75 C;  1BIB A;  4M75 E;  4XU1 A;  4C92 A;  4RCB A;  4PNO A;  2FB7 A;  3QUI A;  3RIR A;  3INZ A;  4M77 G;  4X9C A;  1U1S A;  4JUV A;  4X9D A;  4C92 C;  4C92 E;  4NL3 A;  4HT8 A;  1JBM A;  2DZ9 A;  3JCM f;  4M7D A;  4A54 A;  4M7D C;  1Y96 A;  4XTV A;  4PJO A;  4M7D E;  2E65 A;  2ZGW A;  2EJF A;  4EMK A;  1KQ2 A;  5GAM g;  3SWN B;  4F7U B;  1X01 A;  3RKY A;  5GAO r;  4MMK A;  5GAN h;  4PJO E;  4C8Q A;  3JB9 F;  5GMK e;  2DZC A;  4A53 A;  3FB9 A;  2EWN A;  4C8Q C;  4M77 D;  5GAO q;  2QTX A;  1WQW A;  2EJ9 A;  1M5Q 1;  4PJO F;  4M78 E;  1TH7 A;  2E10 A;  4XU2 A;  4M77 B;  2RD1 A;  3BW1 A;  4M7A G;  5LJ3 d;  3V7S A;  4NOY A;  5GAN f;  4J6Y A;  4RCC A;  4HA8 A;  1KQ1 A;  4M78 F;  4N0A C;  4XTZ A;  2YLC A;  5LJ3 j;  5GMK l;  3JCM e;  1U1T A;  3JCM d;  4NL2 A;  3JCM J;  2DXU A;  3L2Z A;  2RM4 A;  1I4K 1;  1MGQ A;  3QSU A;  1LNX A;  5GAN 7;  1N9S A;  5GMK i;  2VXF A;  1WQ7 A;  2RA2 A;  3JB9 I;  1I5L A;  3L1A A;  3HFN A;  3JCM W;  2EJG A;  4XTW A;  2DKG A;  4C92 G;  3JB9 H;  4M7A D;  4XU0 A;  3V7C A;  1H64 1;  4PJO C;  5GAM h;  1JRI A;  5GAN 2;  4EMK C;  3EFR A;  5GAN 5;  3PGG A;  3V7R A;  4F7U F;  4M7A B;  4M78 A;  5LJ5 g;  1LJO A;  1LOJ A;  5GMK m;  5LJ5 h;  5GMK j;  5DY9 A;  4M77 E;  4J6X A;  4M78 C;  4MML A;  5GAO n;  4M75 D;  4J5Y A;  5GAN e;  3V8J A;  3QHS A;  4XTX A;  1D3B B;  5GAN d;  1B34 B;  2Y90 A;  3JCM V;  4C8Q G;  3FIF A;  4XTY A;  4EMH A;  5I21 A;  4J6W A;  3V8K A;  4C92 D;  4M75 B;  3RUX A;  5GAM f;  5GAN j;  4M77 F;  3JB9 J;  5GAN 4;  3RKW A;  4C92 B;  4M7D D;  3JCM c;  5LJ5 f;  4XQ3 A;  1HK9 A;  3SWN A;  4F7U A;  3JCM X;  2E41 A;  4M75 G;  3SB2 A;  4QVC A;  4JRI A;  5CAI A;  4PJO D;  3JCM b;  4M7D B;  3SWN C;  3M4G A;  4F7U E;  2K57 A;  1I81 A;  5LJ3 g;  4V2S A;  5LJ3 h;  4C8Q D;  2JN0 A;  1WNL A;  1HXD A;  3AHU A;  4M7A E;  3GIB A;  3JB9 G;  4M78 D;  2VC8 A;  3QO3 A;  3RER A;  4M7D G;  4M77 A;  1B34 A;  4C8Q B;  5GAO l;  2YHT A;  2DJZ A;  5GAO p;  3HFO A;  4M77 C;  2DVE A;  4PJO G;  5GAN 8;  5GAM e;  4M7A F;  5GAM d;  3VU3 C;  2E64 A;  1WPY A;  2CGH A;  5LJ3 f;  5GAM j;  3BFM A;  4DQ2 A;  5LJ5 e;  4M78 G;  1YCY A;  5LJ5 d;  2I2L A;  4EMG A;  2YLB A;  3RKX A;  3JB9 D;  4M75 F;  2HNI A;  3FJP A;  4XU3 A;  5GMK h;  5LJ5 j;  3V8L A;  2DTH A;  2VXE A;  5GAO m;  4C92 F;  4WF2 A;  4HT9 A;  5GAN g;  2DXT A;  4OP0 A;  5GAN 3;  3HSB A;  4M7A A;  2EAY A;  3RES A;  4JLI A;  1I8F A;  1Y96 B; 
#chains in the Genus database with same CATH topology
 2VUB A;  2GTJ A;  4HKE A;  2H8H A;  3JCM Q;  4YTL A;  2RJE A;  2ZCF B;  2LQN A;  4R55 A;  4RCB A;  2XDP A;  1QCO A;  4OMN A;  4X9D A;  3VS1 A;  3ULR B;  2ED0 A;  2ZPF B;  1VQN T;  4OVA A;  5DM7 R;  1WI7 A;  1UHF A;  1KD1 C;  1VQO Q;  1M9S A;  3JB9 F;  3QWX X;  2KT8 A;  4KGV B;  3OYD A;  2AZV A;  5GJV B;  1YJ9 T;  2DL4 A;  2ED1 A;  4BD3 A;  3AT1 B;  1SKU B;  5IAY A;  3OS2 A;  2D1X A;  2CKK A;  3OYH A;  3PMT A;  4MZM A;  1PKS A;  2D9T A;  4N4I A;  2C0T A;  2L2P A;  2NWM A;  4RUG A;  3CME Q;  1UGS B;  3L2Z A;  4PJM A;  8ATC B;  1YIT A;  5CQX A;  1K0S A;  1IO6 A;  3HHT B;  3V7C A;  3DLM A;  3MEV A;  3OQ5 A;  6AT1 B;  5KYN A;  4RMO A;  1IRX A;  4KGZ B;  4M75 D;  3THK A;  3R6N A;  3DKM A;  1VQ9 Q;  4A4F A;  4DA4 A;  3RUX A;  5GAN 4;  4C0G A;  1VQ6 Q;  3J7A F;  3P8H A;  3CXC S;  5CK9 A;  4F7U A;  2A36 A;  3LGF A;  4FT4 A;  4IIO A;  1K9M U;  2KXD A;  4LD6 A;  2K57 A;  1H3Z A;  3S3M A;  2DYI A;  1QWF A;  2E5K A;  2L3S A;  1ZBX A;  4OMF B;  2BZY A;  2E64 A;  5LJ3 f;  3OYM A;  1Q95 G;  3EG0 A;  1YIJ T;  1G5V A;  4OF1 A;  2QQS A;  1I5O B;  3UAT A;  1LCK A;  4EIK A;  1NPP A;  1KQS S;  2J06 A;  1G8X A;  3VYG A;  4ZTJ A;  1I07 A;  1QVG P;  1K73 C;  2RHZ A;  4FW2 A;  3EGD A;  3JCM g;  1QWE A;  2K3X A;  2PZ1 A;  2DL7 A;  1WHG A;  1YWO A;  2W0Z A;  5GAN 6;  2PVO B;  5HY6 A;  3CC4 Q;  1NEG A;  2BIV A;  3I5R A;  2QQB A;  3INZ A;  2BKD N;  2O4X A;  3CQT A;  3VS0 A;  4A4E A;  2M51 A;  5KH6 A;  1SPK A;  1LPL A;  3X24 B;  1OQK A;  5CKE A;  2HEQ A;  2QAZ A;  1WJR A;  4N4H A;  1YI2 Q;  3NMZ C;  3RBB B;  3I55 T;  2E6Z A;  1ZUK A;  2CS7 A;  2GBQ A;  3CCE Q;  1QKW A;  2CP6 A;  5D7U A;  1K8A C;  2HQE A;  4B6M A;  3VJP A;  3CC2 Q;  5LJ3 j;  3CCL Q;  5KE3 A;  4NL2 A;  1NYF A;  2R5A A;  1YHQ Q;  2R5M A;  1K8A R;  1ZA1 B;  3EFR A;  2RQT A;  1KHC A;  2DM1 A;  2MF2 A;  2YWW A;  3M0R A;  1NM7 A;  2DPP B;  1Q86 U;  1TUC A;  2YRD A;  2MOX A;  2K79 A;  4N4G A;  2XIC A;  1G3T A;  2EQM A;  4XTX A;  1VQ8 A;  2FRY A;  1YJN A;  2KYM A;  1WYX A;  3X26 B;  4FYY B;  1WA7 A;  4FW1 A;  5LJ5 f;  3TEE A;  4PJO D;  2RHU A;  2RJD A;  4E47 A;  2LTO A;  1I81 A;  5LJ3 h;  3FRN A;  3M54 A;  4ELY C;  4M78 D;  4DBR A;  1VQ7 A;  1AWO A;  3HRS A;  2IPO B;  2YT6 A;  3JAM E;  3JRZ A;  1UGV A;  4PFP A;  4XK8 E;  1VQO T;  2OI3 A;  2NLU A;  2CP5 A;  4JRP A;  3CBO A;  2A37 A;  2K3Y A;  3G7Z A;  3V8L A;  4ME7 A;  2RF0 A;  1YJW A;  1Q7Y R;  1S72 Q;  2HL5 C;  5GAO m;  3HSB A;  2DA9 A;  4KH0 B;  4M7A C;  4IUV A;  4IUU A;  1ZSZ A;  1C0M A;  1RAH B;  4J8O A;  3C95 A;  3LLR A;  2EW3 A;  2BE9 B;  3QUI A;  4M77 G;  4AFQ C;  1BB9 A;  2DZ9 A;  2QA4 A;  3RR6 A;  2EJF A;  1KQ2 A;  1ZLM A;  4KUD K;  2RN8 A;  1M1G A;  4DBQ A;  4C8Q A;  3OYK A;  1NLO C;  2LCL A;  2L3Q A;  2MI6 A;  5CKB A;  1JJ2 A;  2QTX A;  4K11 A;  2FZG B;  1UGR B;  2DL3 A;  4IIM A;  1YIT Q;  3L2R A;  2CZ6 B;  4BAC A;  4ZGJ B;  1WJS A;  2DK3 A;  1QMC A;  1ARK A;  1KQ1 A;  2JT4 A;  1PG5 B;  1IHW A;  5HK0 A;  4Z89 A;  3QWY A;  5GAN 7;  2CZ1 B;  2HQH A;  2B86 A;  2E5Q A;  1UJ0 A;  1WZO A;  1AVZ C;  4WCI A;  3V7R A;  4M7A B;  2LZ6 B;  4C0D C;  1R77 A;  5LJ5 h;  1H8K A;  3PVQ A;  2DMO A;  5FW9 A;  1M1K U;  2EQU A;  1VYU A;  4C92 D;  2H3J A;  2PNI A;  1UE9 A;  1EX4 A;  1JEG A;  2K4Y A;  1V1C A;  4JRI A;  3JCM b;  2RK2 A;  2FG0 A;  1K9M C;  1X6B A;  2JN0 A;  3RMS A;  4C0Z A;  2NUP A;  1B7T A;  3JSC A;  2CYZ B;  4LE9 A;  2YHT A;  5GAO p;  2RO0 A;  1M2V A;  2DVE A;  4M7A F;  1ACM B;  2KR3 A;  2JVV A;  1GCQ C;  3VRZ A;  5GAM j;  4R56 A;  1XOV A;  1X43 A;  2I2L A;  4J9C A;  2F69 A;  3KUF A;  3M5A A;  2DF6 A;  5M9O A;  4HCK A;  1TOV A;  3CCE T;  2E4H A;  1VQP T;  2NUT A;  2LC4 A;  1WJQ A;  3CC2 T;  1RL2 A;  3CCL T;  2ZPE B;  4C0D B;  2JTM A;  3UPU A;  4KUI A;  3BY7 A;  2VKN A;  4J9G A;  4D8K A;  2VV5 A;  4M75 C;  1BIB A;  2O01 E;  5I11 A;  4FIB A;  1AEY A;  4E7Z A;  1JXM A;  4ZNX A;  3RIR A;  4X9C A;  5CCA A;  2LCS A;  1JBM A;  3OW2 S;  1Q81 U;  1Y96 A;  2KRO A;  4E7I A;  3A8H B;  1XQH A;  2GQV A;  1X01 A;  4MMK A;  1MUZ A;  2DZC A;  1RAE B;  3G4S T;  1TH7 A;  2X4Y A;  1VQL Q;  3G1J A;  2X4W A;  2DEU A;  2DXB A;  1N27 A;  3M59 A;  1OOT A;  3JCM d;  2P0K A;  1KFZ A;  3CEY A;  1BYM A;  1VQ8 Q;  1X75 C;  3HFN A;  4PJL A;  3UDC A;  3OYG A;  1C1A A;  3D7S B;  3QPH A;  4EMK C;  3CCM T;  3MET A;  1ZUY A;  4M78 A;  5FWB A;  3H0H A;  2OTJ T;  1Q86 C;  3M0U A;  4PKC C;  3M58 A;  4M75 B;  4GLK A;  2KY9 A;  4QQ6 A;  1ZA2 B;  1VQ7 Q;  1Q86 R;  3CXC A;  3GNG A;  1AHJ B;  1AT1 B;  3ZL7 C;  3JB9 G;  1AD5 A;  1E7O A;  2HSP A;  4PLL A;  1SSF A;  2YRV A;  4DBH A;  3RER A;  4M7D G;  1MV0 B;  4FU6 A;  1YJW Q;  5KYX B;  2G6F X;  3A8M B;  4QVZ A;  4X1V A;  3MHX A;  2LVM A;  2DD5 A;  3H0I A;  1SSH A;  3PMI A;  3G6E T;  3OMC A;  2LT1 A;  2RH2 A;  1YCY A;  4M75 F;  1KJW A;  3L2Q A;  2QXF A;  3OA6 A;  4BB7 A;  2GNC A;  2RI3 A;  1KQS A;  4OB0 B;  4OMP A;  2DEQ A;  3TSW A;  4EMK B;  4C8Q E;  1WFW A;  4FYX B;  4FYV B;  1VQ6 A;  1RAA B;  2QA4 Q;  3CCS T;  1SRL A;  5LJ3 e;  1D1A A;  2HSE B;  2DTI A;  3GNF B;  2K3B A;  1NJI R;  3QDR B;  1QP3 A;  4M75 E;  4LDV A;  5CKH A;  2GCX A;  3OBY A;  1WHM A;  5KYU A;  4M7D A;  2CSQ A;  1AZG B;  1IZ6 A;  2BE7 D;  4J7F A;  4FM4 B;  2XD0 A;  3F70 A;  2EWN A;  1MMG A;  2DBK A;  1KSW A;  2OJ2 A;  5IH2 A;  5HKC A;  2HD0 A;  2HQX A;  5J39 A;  2FPE A;  3BW1 A;  8AT1 B;  2BZX A;  2RJC A;  5LJ3 d;  1D0Z A;  2L89 A;  2M1H A;  4ZTF A;  3H8Z A;  1GL5 A;  3TU4 K;  3QSU A;  1G83 A;  1I5L A;  1VQ4 Q;  3L1A A;  2M16 A;  3CPW S;  4A4H A;  2EYQ A;  5GAN 2;  3GOX A;  3PGG A;  1UJY A;  2YUO A;  3HRT A;  2GFU A;  5EC7 A;  9ATC B;  2EBP A;  2QI2 A;  1D3B B;  1M1K C;  2XKO C;  1HJD A;  5GAN j;  3ER0 A;  3V8K A;  2DRK A;  4ORZ A;  1M27 C;  3MPU B;  2RQU A;  2EPD A;  3KFV A;  3CD6 A;  5CAI A;  2CDT A;  4BI3 A;  2M0O A;  1VQ5 Q;  1WXT A;  1QW1 A;  1TU0 B;  2EYZ A;  1Z9Z A;  1GCP A;  1UEB A;  4RTY A;  3A1P A;  2FO0 A;  2WSE E;  2DJZ A;  4KT0 E;  1RUW A;  1AZE A;  3OYA A;  3VU3 C;  1CKB A;  5LJ5 e;  1RLQ C;  1PRL C;  3LW5 E;  4FT2 A;  2M02 A;  4MDW A;  1AWJ A;  4A4G A;  4LDW A;  1CKA A;  4OP0 A;  5GAN 3;  2J05 A;  1M90 U;  1I8F A;  3FEO A;  2X4X A;  4Y91 A;  3I56 A;  1W2B P;  4JRK A;  2KAF A;  1D0Y A;  2QEX T;  1QKX A;  1VQK A;  2LX9 A;  3E19 A;  4OB3 B;  1M8V A;  3DLL A;  4J9B A;  1VQ8 T;  1IRE B;  3EHR A;  3MEA A;  3M0S A;  1YJN T;  3ASK A;  3CPF A;  4C92 C;  4ZN3 A;  2PVG B;  2QDL A;  3JCM f;  2KBT A;  2JTF A;  4XTV A;  1Q81 C;  1GFD A;  2AZS A;  2PQW A;  5GAO r;  4PJO E;  1V29 B;  1VQ7 T;  1WHH A;  1M5Q 1;  4M78 E;  3L2V A;  1PD1 A;  2P4T A;  2J7I A;  2RD1 A;  1S72 A;  2GQI A;  2CH4 A;  1V76 A;  3EG3 A;  2M0Y A;  5C6S A;  2LCC A;  1NYG A;  1WDX A;  2XDB A;  1YJW T;  1X2K A;  2DRM A;  1U3O A;  5D6Y A;  1MV3 A;  3JB9 H;  3X25 B;  5KYY B;  5D6X A;  1JRI A;  5HCK A;  3OYB A;  2JW4 A;  4TVR A;  4DOV A;  2LQ8 A;  2V8K A;  5GMK j;  2LQW A;  2EYW A;  5FLX E;  2Y90 A;  3JCM V;  4OMQ A;  1KD1 R;  1UDL A;  7AT1 B;  3OYL A;  3ZEH A;  1UFF A;  4C92 B;  1UG1 A;  2AHJ B;  3R6O A;  3SWN A;  3VUB A;  2E41 A;  2EYX A;  4BI4 A;  3G71 A;  4A63 B;  1M2O A;  1YP5 A;  4C8Q D;  4KUL A;  2XID A;  2QQR A;  2X35 A;  1KC8 U;  1WGS A;  2VC8 A;  4Q5W A;  1PNJ A;  3OYF A;  2YUQ A;  4MZT A;  4JJB A;  3P8B B;  3EGX A;  1W70 A;  2E12 A;  5GAM d;  2MYS A;  2JM8 A;  2X9H A;  2X51 A;  1LVK A;  4XU3 A;  4OML A;  5GMK h;  2HBW A;  4WTO B;  1ZX6 A;  5IN1 A;  4C92 F;  1PM3 A;  1ZQ1 A;  2CT4 A;  3REA B;  2JJ9 A;  3CCR A;  3GPL A;  4NL3 A;  3A8G B;  2DE0 X;  3JCM h;  2QDY B;  5CR2 A;  1GFC A;  1OPK A;  2CZ0 B;  5FU6 C;  2K5I A;  3LX7 A;  3FJ5 A;  4ATO A;  1QCF A;  5A0G A;  4C92 E;  3QZ5 B;  3OYY A;  3OW2 A;  5KYW A;  2EGA A;  2GF7 A;  2CSI A;  1EFN A;  2E3I A;  1AWX A;  2IVW A;  4QT7 A;  2HMA A;  2RQV A;  1HYO A;  2A3L A;  3MP1 A;  4M7A G;  4RCC A;  3OYE A;  3J81 E;  1SG5 A;  1K73 R;  1E6H A;  3KXT A;  2EGE A;  1KHI A;  2ATC B;  4M4Z A;  2D0Q B;  1OV3 A;  5IHN A;  1Q82 U;  1NEB A;  1RAB B;  1WXU A;  4BI8 B;  2P84 A;  1LJO A;  2KMT A;  3CD6 Q;  4GY5 A;  3QJ6 A;  2EYY A;  4A4K A;  1JO8 A;  1B34 B;  5FU6 B;  4F17 A;  2FZC B;  2Z0W A;  2EKO A;  5I2S A;  4QQG A;  4EPC A;  3CCU A;  2AKK A;  3CMA A;  3QII A;  2DIG A;  3C4S A;  3S3O A;  2ZAE A;  1P92 A;  2WSC E;  1VQL A;  2EGC A;  2GTO A;  1WNL A;  2RNA A;  2J6K A;  2KEA A;  1QCN A;  3HFO A;  5IXB A;  4KBM B;  2YXY A;  2CGH A;  1QQJ A;  2F2X A;  3I56 Q;  3SHW A;  3QXE B;  1VQK Q;  4BUG A;  4ZGD B;  1WIE A;  2LX7 A;  5EG2 A;  1I1J A;  1QVF S;  2WSF E;  1RI9 A;  2EAY A;  2H3E B;  4E7L A;  5ECA A;  1M90 C;  3BDU A;  3TVT A;  2P4R A;  1FMV A;  1FXX A;  1M90 R;  3VKI A;  2MWO A;  2X3W D;  1BBZ A;  4DEX A;  4FCY A;  4C5E A;  3CC7 A;  2FEI A;  1XNI A;  2OX7 A;  1G2B A;  1PCX A;  4PJJ A;  2JOY A;  2VYT A;  4F7U B;  3RMQ A;  2DLP A;  1OUL A;  2D6F A;  4BE2 A;  3CME T;  4RTV A;  4CC3 A;  1PSE A;  4KGX B;  4B9W A;  3A8O B;  3EG9 A;  4R0K A;  4C5G A;  5IHI A;  1JJ2 P;  3OYC A;  4LD9 K;  4JJD A;  1BI2 A;  4CI0 C;  2GFA A;  2DKG A;  1VQ9 T;  1M8M A;  3CPW A;  1U8R A;  1OU8 A;  4F7U F;  1X69 A;  1S1N A;  2LJ3 A;  1UHC A;  1JQQ A;  2KRS A;  1VQ6 T;  2LMJ A;  4J5Y A;  1O9S A;  3TQ7 P;  3V8J A;  3G71 Q;  1R0B G;  3E2U A;  5GAN d;  1OZ2 A;  2V8J A;  1HSQ A;  5GAM f;  1TUG B;  2OTL A;  1KIK A;  2KRN A;  4M7D D;  3KBG A;  4PLI A;  1MNE A;  1M3C A;  2O4X B;  2F2V A;  2KQW A;  2RMO A;  4F7U E;  3DB4 A;  1RAD B;  3OBW A;  2YUN A;  3GF5 A;  4L6V 5;  2I0N A;  3I9Q A;  3QO3 A;  4D6W A;  1N6A A;  1KC8 C;  4M77 A;  4C0F A;  5GAO l;  2NYS A;  2D8H A;  2NUZ A;  3OYI A;  1VQ4 A;  3CCR Q;  5J26 A;  4OMM A;  3GBQ A;  2COZ A;  2CZ7 B;  3VV0 A;  1UTI A;  1X6G A;  5FRM A;  4F04 B;  1G3S A;  1NE8 A;  4CC7 A;  4WF2 A;  3VS4 A;  2BZ8 A;  1EZZ B;  2V1Q A;  1AWW A;  4O6J A;  5KYX A;  4PL6 A;  1NBE B;  1RAC B;  3CC4 T;  2BUD A;  1VYV A;  1ZSZ C;  4RTT A;  4Y28 E;  1TWB A;  2CP7 A;  1SRM A;  4XTU A;  3CCJ A;  2CP3 A;  2ROT A;  1VQ5 A;  4FL6 A;  1PSF A;  1K9M R;  2EVR A;  2RK1 A;  1QVP A;  2MPX C;  4A54 A;  1YI2 T;  3NTI A;  4EMK A;  3CD6 T;  1GBR A;  4O5V A;  2K5F A;  5GMK e;  2PUK B;  4C8Q C;  4QW2 A;  2YRC A;  1YHQ T;  2EQI A;  3JCM e;  2A0F B;  2DX1 A;  3OSV A;  1VQM A;  3X20 B;  3PFS A;  1WQ7 A;  1JU5 C;  3JCM W;  2EJG A;  5CVI A;  1K1Z A;  5GAM h;  3CCU Q;  1Q82 C;  3CMA Q;  3I55 A;  3I56 T;  3MEU A;  1LOJ A;  2XDD A;  1VQK T;  2K2V A;  5GAO n;  1ZSZ B;  2DL5 A;  3VYH B;  1Y57 A;  1A0N B;  1TTH B;  1D09 B;  1UUE A;  3RKW A;  1OZ3 A;  5J3B A;  3JCM X;  3SDZ A;  4QVC A;  2XI9 A;  3OB9 A;  2ABL A;  1GRI A;  4IUT A;  1Y7X A;  4BE1 A;  5DLQ E;  4C8Q B;  3VS6 A;  1YBY A;  5HK3 A;  1QVG S;  3M0P A;  3CXC P;  3MP6 A;  1OPL A;  1S72 T;  3ZFJ A;  1IXD A;  3H9N A;  4JJC A;  1VA7 A;  4A53 A;  3EH2 A;  4ANJ A;  2RB6 A;  1N9R A;  3QKJ A;  3CC7 Q;  1D1C A;  4C8Q F;  4RTZ A;  2L0A A;  1KQS P;  1J3T A;  3OS1 A;  2JMC A;  2LRQ A;  1RAF B;  4LDY A;  3G71 T;  1YIT T;  3T9N A;  1MHN A;  3NGP A;  3QG1 A;  4VUB A;  3FB9 A;  3CBP A;  3A8L B;  2KXC A;  2NUP B;  2F1L A;  1M2V B;  5GAN f;  2AIR B;  4D8D A;  1KG1 A;  4N0A C;  1G3Y A;  1MGQ A;  5GMK i;  2JS2 A;  2KVQ G;  1M3A A;  3MEW A;  4C92 G;  4PJO C;  2XHC A;  2OTL Q;  3CCR T;  3PIP A;  2CUB A;  2DVJ A;  1R0C B;  5GMK m;  4M77 E;  4J6X A;  4M78 C;  2FZK B;  2K2M A;  3FIF A;  4J6W A;  1RI0 A;  1QP2 A;  1W6X A;  2RPN A;  2VGM A;  1Y07 A;  5KYY A;  4X34 A;  2QK0 A;  2QAS A;  3M4G A;  4E7J A;  2C06 A;  1I0C A;  2DL8 A;  1OYX A;  3GIB A;  4HVV A;  1MMA A;  5KCH A;  2V26 A;  3IQL A;  3TCJ A;  2IIM A;  1NPR A;  3MCA B;  1VIE A;  1NLP C;  5A0L A;  3M56 A;  1B07 A;  3CCJ Q;  1PKT A;  4HT9 A;  1HD3 A;  2RHX A;  5LL6 S;  1YIJ Q;  2KI7 A;  3OY9 A;  1M1K R;  2P0Q A;  3QYG B;  4PJO B;  3M53 A;  2J6F A;  4NS5 A;  1BI0 A;  1WHK A;  1M30 A;  4M78 B;  2AKL A;  1WXB A;  3UA7 A;  3QJY A;  3HRU A;  3CMA T;  3EAE A;  2HKQ B;  4M7D C;  3DB3 A;  1VQP A;  2HBP A;  4HVW A;  1BK2 A;  4AMC A;  1VQL T;  1RAG B;  5GAN h;  1UGP B;  1VQM Q;  3LGL A;  1K0X A;  1K4U S;  1WQW A;  4PJO F;  3HP9 A;  3JV3 A;  2QG9 B;  3FC3 A;  4BE0 A;  2KT1 A;  4J6Y A;  4HA8 A;  3TSZ A;  4M78 F;  2RHY A;  2EFI A;  3I55 Q;  4E6R A;  4CC2 A;  2DXU A;  2MWP A;  3JB9 I;  2B8A A;  3OYN A;  1ABQ A;  2E3H A;  4P5N A;  2FVU A;  3G4S A;  1Q7Y U;  1PWT A;  2QYZ A;  2DER A;  1FMW A;  4BY6 C;  2HAX A;  4QKU A;  4ZN1 A;  1Q81 R;  3JB9 J;  3CBM A;  1IGQ A;  1R8O B;  2LT4 A;  3CCV A;  2JS0 A;  1T3S A;  4E7H A;  1HK9 A;  2WAC A;  1DJ7 B;  3CC7 T;  4M7D B;  2DIQ A;  3LYI A;  4AFU C;  3CCM A;  2FPF A;  3AHU A;  2OTJ A;  3O8V A;  1YCS B;  4FSX A;  1B34 A;  3PT9 A;  1RAI B;  3FLG A;  2K9G A;  2RI5 A;  3I35 A;  5GAM e;  3URG A;  3EG1 A;  2RQW A;  3EHQ A;  3VS5 A;  2RQR A;  4Z02 A;  3EFO B;  4EMG A;  2YLB A;  4AFS C;  4L5G A;  3M0T A;  2PVD B;  2QA4 T;  1PD0 A;  1T0J A;  1FMK A;  1TXQ A;  3GP8 A;  4M7D F;  2JM9 A;  4JZ3 A;  3EFS A;  2YSQ A;  4F7U G;  3C12 A;  4BY6 B;  1D1B A;  3UF4 A;  2L8D A;  2ECZ A;  3G6E A;  1JXO A;  1K76 A;  4JZ4 A;  2OTL T;  2X3X D;  3NFC A;  4J9F A;  2HCK A;  3U23 A;  1OX8 A;  3E1S A;  5CO7 A;  3RNJ A;  3OMG A;  4M7D E;  4II1 A;  2ZGW A;  4RG2 A;  3RKY A;  3Q1J A;  4RTW A;  4M77 D;  3CCS A;  2CP2 A;  2K5L A;  2E10 A;  3X28 B;  2BTT A;  4XU2 A;  3OW2 P;  1C6V X;  5A0D A;  3SFM A;  1VQ4 T;  4KH1 B;  1TG0 A;  4BDZ A;  1I4K 1;  1LNX A;  4E7K A;  4F16 A;  1M4Z A;  1ABO A;  2ZPB B;  2A7Y A;  2KRM A;  2VWF A;  2Y4Y A;  4Y92 A;  5GAN 5;  3CCQ A;  4ELZ C;  3QZ9 B;  2DD4 A;  3LH5 A;  1WLP B;  3M4Y A;  2JZ2 A;  4MML A;  4HCB A;  3PTA A;  2IG0 A;  1EIF A;  4LNP A;  3CCJ T;  2PU9 B;  4KRT A;  4XTY A;  2R58 A;  1MND A;  1VQ5 T;  3N5B B;  4EDU A;  4DEY A;  1GBQ A;  5FRO A;  4XQ3 A;  4IKF A;  1BI1 A;  1W4S A;  1Y0M A;  3SWN C;  3J80 E;  2QTV A;  1VIF A;  2HL3 A;  2ZZD A;  1ZSG A;  1N8R U;  2QQA A;  2G3R A;  1QVG A;  1SHG A;  4HXJ A;  1OU9 A;  2L3R A;  4AG1 C;  1VQM T;  3ZBD A;  4ZGE B;  2AT1 B;  2DXT A;  4IUQ A;  4LDX A;  1VYT A;  4M7A A;  4JLI A;  2KE9 A;  2LJ1 A;  1TSF A;  2XG8 D;  2R57 A;  1VQP Q;  1XTD A;  3I5S A;  4LUD A;  3RDV A;  1H92 A;  3C0C A;  3NTK A;  3S6W A;  4OGC A;  2P0P A;  4JUV A;  3S3N A;  4JPB W;  3OS0 A;  2ENM A;  3FDR A;  5L23 A;  2JNG A;  2E65 A;  3QBY A;  3SWN B;  2Y4X A;  2XU8 A;  3A5Z B;  2AK5 A;  1OX9 A;  2QEX A;  2ZPG B;  4RKU E;  3L2U A;  3VRY A;  3WVD B;  1PRM C;  1X6O A;  3EGX B;  2O2O A;  3G4S Q;  2RM4 A;  2W10 A;  1F1B B;  4GBQ A;  4IUP A;  2QGG A;  2KDS A;  1G3W A;  3CCV Q;  1Q7Y C;  5GAN e;  3OS5 A;  4EMH A;  3CCM Q;  4C8Q G;  1GXI E;  2JMA A;  2OTJ Q;  3CPW P;  2CUD A;  3JCM c;  4UC4 A;  1IHV A;  1VQN A;  2VAS A;  1NJI U;  4M75 G;  3LWH A;  3M57 A;  5FU7 C;  2F5T X;  2KYB A;  5LJ3 g;  4V2S A;  1BKB A;  3MP8 A;  2PTK A;  4AT1 B;  2DET A;  5KYW B;  1UB4 A;  1YJ9 A;  1YNZ A;  1ZUU A;  5GAN 8;  5CIU A;  3EGD B;  1E6G A;  1GCQ A;  2FPD A;  1MMN A;  1W2B S;  3BFM A;  3JB9 D;  1WX6 A;  3FJP A;  1MMD A;  5LJ5 j;  2COW A;  3L42 A;  2MAM A;  4JRQ A;  2MK5 A;  3P8D A;  3G6E Q;  3EG2 A;  4E2F B;  2O31 A;  1NG2 A;  1AOJ A;  4JDS A;  4M75 A;  5GJW B;  2E1H A;  4XU1 A;  3UT1 A;  4JJN K;  2ZPH B;  2FB7 A;  3WVE B;  1U1S A;  2MIO A;  3CCS Q;  1KC8 R;  4MDX A;  2DAQ A;  2E70 A;  2DYB A;  2C0O A;  2YUP A;  2OAW A;  5FU7 B;  1VOM A;  2VVK A;  2KSS A;  2JUF A;  4MZP A;  2A28 A;  3LWI A;  3VS3 A;  1PC0 A;  1ZBJ A;  5A2Q E;  1JB0 E;  1YIJ A;  3CCQ Q;  5IXF A;  3A98 A;  2VB6 A;  4LN2 A;  3L2W A;  4BDY A;  2RA2 A;  2DIL A;  4XTW A;  4XU0 A;  1YN8 A;  2LP5 A;  3OYJ A;  3H6Z A;  4PK4 A;  5LJ5 g;  3QDF A;  2CT3 A;  1RLP C;  1N5Z A;  4OB1 B;  3NPF A;  1FWZ A;  2L3P A;  3QYH B;  2QGF B;  3M9Q A;  2FL7 A;  4JS4 A;  1VUB A;  1WHL A;  2LQK A;  2SRC A;  2PUO B;  5KE2 A;  4OB2 B;  2DBM A;  1W1F A;  1HXD A;  2O9S A;  1XJW B;  4M7A E;  1O75 A;  2HZY A;  1H3H A;  4OGE A;  1BU1 A;  4M77 C;  1KK7 A;  4PJO G;  1N8R C;  2ROL A;  2M9U A;  1WHJ A;  4JLG A;  4JS5 A;  4M78 G;  5FWC A;  3EG9 B;  1Q82 R;  2DTH A;  2OAU A;  4IUR A;  2FHD A;  2XMF A;  3UWN A;  1N8R R;  1TUD A;  1PHT A;  4LDU A;  1B3Q A;  3RES A;  1X27 A;  2O9V A;  1BIA A;  4HCZ A;  2FYK A;  1IGU A;  2DTO A;  1D3B A;  4J83 A;  2HKN A;  3JCM P;  4PJN A;  3C94 A;  3LH0 A;  4N0A A;  5AT1 B;  2QEX Q;  4PNO A;  1U06 A;  4HT8 A;  5AYF A;  3CCV T;  3WXM B;  4PJO A;  1YJN Q;  1KD1 U;  5GAM g;  1M3B A;  2V8I A;  2KGT A;  2FRW A;  2ESW A;  2EIF A;  3ME9 A;  3HTR A;  5GAO q;  3REB B;  3BE3 A;  3EGU A;  2RJF A;  4M77 B;  2QQ9 A;  1SEM A;  3V7S A;  1VQO A;  4XTZ A;  3MJX A;  1U1T A;  2SEM A;  1N9S A;  3EH1 A;  3E9F A;  3M0Q A;  2E6N A;  3PE0 A;  2RHI A;  2DNU A;  1NZ9 A;  4C5H A;  3SD4 A;  3CME A;  1T0H A;  2MMP A;  1D0X A;  3PIO A;  2MCN A;  2DXC A;  1VQN Q;  5DY9 A;  4LXC A;  3HPW A;  3QHS A;  5I21 A;  2C0I A;  5D6W A;  2JTE A;  2GGR A;  4C5I A;  4J9I A;  4M77 F;  2CRE A;  3SEM A;  1YJ9 Q;  1NJI C;  1VQ9 A;  4Z8A A;  2D8J A;  4PFZ A;  3VS2 A;  4RTX A;  2KNB B;  2NUT B;  4FYW B;  1WPY A;  2DJQ A;  4DQ2 A;  4F14 A;  1X2Q A;  1IB8 A;  1K9A A;  2HNI A;  3H41 A;  1BI3 A;  2K6D A;  1CSK A;  4E7S A;  3O5Z A;  3MO8 A;  3BDL A;  5KCO A;  1K73 U;  2F5K A;  1QLY A;  3HL8 A;  1Y96 B;  4B9X A;  3NTH A;  4QVD A;  2LNV A;  3CCQ T;  4RTU A;  2CP0 A;  1M1F A;  1T3L A;  5FRN A;  1SHF A;  4LUE A;  1OEB A;  3NHN A;  1TS9 A;  4CRI A;  4AFZ C;  3EFO A;  2EKH A;  4C92 A;  2EQK A;  2F2W A;  4J7I A;  5I2M A;  4J9H A;  3VUZ A;  1QVF P;  2XK0 A;  3MKD A;  1FX7 A;  1YWP A;  2EQJ A;  4J9E A;  4RG8 A;  4DOW A;  3TRE A;  5DLO A;  4QQD A;  2HDA A;  4DBF A;  1Z9Q A;  2LDM A;  1JJ2 S;  3CC4 A;  3H0F A;  1QVF A;  3M55 A;  5CKD A;  5IHK A;  4HCC A;  4FSS A;  2K7A A;  2EJ9 A;  1UGQ B;  1K8A U;  4NOY A;  4PFO A;  2YLC A;  2LNH B;  3GLX A;  5GMK l;  3JCM J;  1OI1 A;  1YI2 A;  1Y71 A;  3CCU T;  4ESR A;  2VXF A;  2J6O A;  4CC4 B;  3CCE A;  2JXB A;  1BCM A;  1UEC A;  4M7A D;  1H64 1;  4J9D A;  2L5Q A;  3UA6 A;  3HKS A;  5CQY A;  3CC2 A;  3CCL A;  2KK4 A;  2O88 A;  1YFN A;  2DFU A;  5C0M A;  1YHQ A;  4AG2 C;  2COY A;  2YDL A;  2CH4 W;  2D0N A;  3OSS C;  2V1R A;  1SF9 A;  5IT9 E;  2RI2 A;  3SB2 A;  1U5S A;  4OMO A;  1BCO A;  4Z88 A;  2VGN A;  1ZHI A;  1FYN A;  5I22 A;  2X4J A;  2A08 A;  4HVU A;  4XAX B;  1W2B A;  5CKF A;  4GLM A;  5LJ5 d;  3RKX A;  5L8R E;  3VS7 A;  2VXE A;  4L59 A;  2ZPI B;  3E9G A;  2DO3 A;  3PVL A;  3PNW C;  5GAN g;  5KYU B;  2LJ0 A; 
#chains in the Genus database with same CATH homology
 4O6J A;  2VUB A;  2DEQ A;  4EMK B;  4C8Q E;  4PL6 A;  3CC4 T;  4HKE A;  1VQ6 A;  2BUD A;  2XG8 D;  4Y28 E;  3JCM Q;  3CCS T;  2R57 A;  5LJ3 e;  1XTD A;  4XTU A;  4YTL A;  2DTI A;  3CCJ A;  3GNF B;  3QDR B;  2RJE A;  2ZCF B;  1QP3 A;  1VQ5 A;  4M75 E;  4LDV A;  4FL6 A;  4R55 A;  3NTK A;  1PSF A;  4RCB A;  2XDP A;  3S6W A;  4OGC A;  5CKH A;  2GCX A;  2P0P A;  4JUV A;  4X9D A;  2RK1 A;  3S3N A;  3OBY A;  4M7D A;  1QVP A;  4A54 A;  3OS0 A;  3FDR A;  1YI2 T;  2ZPF B;  1VQN T;  2JNG A;  4OVA A;  3NTI A;  2E65 A;  4EMK A;  5DM7 R;  3CD6 T;  1IZ6 A;  3QBY A;  3SWN B;  4O5V A;  2Y4X A;  1KD1 C;  4J7F A;  2XU8 A;  3A5Z B;  4FM4 B;  1M9S A;  3JB9 F;  2K5F A;  5GMK e;  2XD0 A;  2QEX A;  3OYD A;  3F70 A;  2PUK B;  2EWN A;  4C8Q C;  2ZPG B;  4QW2 A;  4RKU E;  3L2U A;  1YJ9 T;  4BD3 A;  5HKC A;  3WVD B;  2HD0 A;  5IAY A;  3OS2 A;  2HQX A;  5J39 A;  3BW1 A;  1X6O A;  2CKK A;  2RJC A;  3PMT A;  3OYH A;  1YHQ T;  4MZM A;  5LJ3 d;  2D9T A;  4N4I A;  2L89 A;  2M1H A;  3JCM e;  4ZTF A;  3H8Z A;  3TU4 K;  1UGS B;  3QSU A;  3L2Z A;  2RM4 A;  3OSV A;  1VQM A;  3X20 B;  3PFS A;  1WQ7 A;  4IUP A;  1YIT A;  1I5L A;  3L1A A;  5CQX A;  3HHT B;  2EJG A;  2M16 A;  3CPW S;  3JCM W;  4A4H A;  5CVI A;  3V7C A;  2KDS A;  3DLM A;  2EYQ A;  3MEV A;  3OQ5 A;  5GAM h;  5GAN 2;  1G3W A;  4RMO A;  1Q82 C;  3GOX A;  3PGG A;  3I55 A;  3I56 T;  3MEU A;  3HRT A;  1Q7Y C;  1LOJ A;  2XDD A;  2GFU A;  1VQK T;  2K2V A;  2QI2 A;  4M75 D;  5GAN e;  5GAO n;  3DKM A;  3VYH B;  1D3B B;  3OS5 A;  4EMH A;  4C8Q G;  2XKO C;  1M1K C;  4A4F A;  3ER0 A;  3V8K A;  4DA4 A;  3RUX A;  5GAN j;  3CD6 A;  1GXI E;  5GAN 4;  4C0G A;  3RKW A;  3J7A F;  3P8H A;  1OZ3 A;  5J3B A;  4UC4 A;  3JCM c;  3CXC S;  5CK9 A;  1VQN A;  4F7U A;  3JCM X;  1NJI U;  4M75 G;  3SDZ A;  4QVC A;  3LGF A;  4FT4 A;  5CAI A;  3LWH A;  4BI3 A;  2XI9 A;  2M0O A;  3M57 A;  3OB9 A;  1K9M U;  1QW1 A;  5FU7 C;  2F5T X;  4IUT A;  2K57 A;  4LD6 A;  5LJ3 g;  4V2S A;  1BKB A;  3MP8 A;  1H3Z A;  1UEB A;  1Y7X A;  3S3M A;  2WSE E;  4BE1 A;  1UB4 A;  5DLQ E;  4C8Q B;  1YJ9 A;  2DJZ A;  4KT0 E;  1YBY A;  5CIU A;  5GAN 8;  5HK3 A;  3OYA A;  1QVG S;  1ZBX A;  3MP6 A;  4OMF B;  3VU3 C;  2E64 A;  1S72 T;  5LJ3 f;  3OYM A;  1W2B S;  3BFM A;  3ZFJ A;  5LJ5 e;  1YIJ T;  3LW5 E;  1G5V A;  4FT2 A;  3JB9 D;  4OF1 A;  2QQS A;  3FJP A;  5LJ5 j;  3L42 A;  2MAM A;  4JRQ A;  4MDW A;  1NPP A;  3P8D A;  4A4G A;  1KQS S;  4LDW A;  4OP0 A;  5GAN 3;  3VYG A;  4ZTJ A;  1M90 U;  1K73 C;  1I8F A;  3FEO A;  4A53 A;  2X4X A;  4Y91 A;  2RHZ A;  3I56 A;  2RB6 A;  4JRK A;  2KAF A;  2QEX T;  3JCM g;  1N9R A;  2K3X A;  1VQK A;  3QKJ A;  2LX9 A;  3E19 A;  4JDS A;  4M75 A;  4OB3 B;  1M8V A;  2E1H A;  4C8Q F;  5GAN 6;  3DLL A;  2PVO B;  1VQ8 T;  1IRE B;  3MEA A;  4XU1 A;  5HY6 A;  3UT1 A;  4JJN K;  2ZPH B;  1YJN T;  2BIV A;  2FB7 A;  3ASK A;  3CPF A;  2QQB A;  3INZ A;  3WVE B;  1U1S A;  2BKD N;  4C92 C;  2O4X A;  4ZN3 A;  2PVG B;  2LRQ A;  3OS1 A;  3JCM f;  4A4E A;  4MDX A;  2DAQ A;  5KH6 A;  2JTF A;  2E70 A;  4XTV A;  1Q81 C;  4LDY A;  3G71 T;  1YIT T;  3X24 B;  2PQW A;  1MHN A;  3T9N A;  5FU7 B;  5CKE A;  5GAO r;  4PJO E;  2KSS A;  3QG1 A;  2JUF A;  1V29 B;  3FB9 A;  4VUB A;  4MZP A;  1WJR A;  3CBP A;  3A8L B;  4N4H A;  3LWI A;  1VQ7 T;  3I55 T;  1M5Q 1;  2E6Z A;  4M78 E;  2CS7 A;  3L2V A;  2P4T A;  2RD1 A;  1S72 A;  1K8A C;  2HQE A;  5A2Q E;  1JB0 E;  5GAN f;  3VJP A;  1YIJ A;  5LJ3 j;  1KG1 A;  4N0A C;  5KE3 A;  4NL2 A;  1G3Y A;  5C6S A;  1MGQ A;  2LCC A;  2R5A A;  5GMK i;  2KVQ G;  3L2W A;  4BDY A;  2RA2 A;  2XDB A;  1YJW T;  3MEW A;  2R5M A;  5D6Y A;  4C92 G;  4XTW A;  3JB9 H;  3X25 B;  4XU0 A;  4PJO C;  2XHC A;  5D6X A;  1JRI A;  3EFR A;  3CCR T;  3RER A;  3PIP A;  3OYB A;  1KHC A;  4TVR A;  2MF2 A;  4DOV A;  3OYJ A;  2LQ8 A;  2V8K A;  3H6Z A;  2DPP B;  5LJ5 g;  1Q86 U;  5GMK m;  5GMK j;  4M77 E;  4J6X A;  4M78 C;  5FLX E;  4N4G A;  2XIC A;  1G3T A;  2EQM A;  4XTX A;  1VQ8 A;  2Y90 A;  3JCM V;  3FIF A;  4OB1 B;  1FWZ A;  4J6W A;  1YJN A;  3X26 B;  1RI0 A;  3QYH B;  1QP2 A;  3OYL A;  3M9Q A;  3ZEH A;  2FL7 A;  4C92 B;  1VUB A;  4JS4 A;  5LJ5 f;  2LQK A;  2AHJ B;  2VGM A;  3TEE A;  2PUO B;  1Y07 A;  3R6O A;  3SWN A;  3VUB A;  2E41 A;  4X34 A;  2RHU A;  4PJO D;  5KE2 A;  2RJD A;  4BI4 A;  4OB2 B;  3G71 A;  4E47 A;  3M4G A;  2LTO A;  4E7J A;  2C06 A;  4M7A E;  1I81 A;  5LJ3 h;  4C8Q D;  4KUL A;  1HXD A;  2XID A;  1OYX A;  3FRN A;  2QQR A;  2X35 A;  3M54 A;  4ELY C;  4M78 D;  1O75 A;  1WGS A;  2VC8 A;  1KC8 U;  4OGE A;  4Q5W A;  3OYF A;  1VQ7 A;  3HRS A;  5KCH A;  4MZT A;  4M77 C;  3P8B B;  4PJO G;  1N8R C;  3JAM E;  3JRZ A;  2E12 A;  5GAM d;  3TCJ A;  4M7D E;  2M9U A;  1NPR A;  4XK8 E;  3MCA B;  4JLG A;  1VQO T;  1VIE A;  4JS5 A;  4M78 G;  5A0L A;  2NLU A;  3M56 A;  4XU3 A;  4JRP A;  3CBO A;  5GMK h;  2K3Y A;  3G7Z A;  3V8L A;  2DTH A;  4ME7 A;  2OAU A;  1YJW A;  4IUR A;  2FHD A;  5IN1 A;  3UWN A;  5GAO m;  4C92 F;  1ZQ1 A;  5LL6 S;  2RHX A;  4HT9 A;  4LDU A;  3HSB A;  3CCR A;  3RES A;  3OY9 A;  4NL3 A;  3GPL A;  2P0Q A;  3A8G B;  1BIA A;  3QYG B;  4HCZ A;  3M53 A;  4IUV A;  4IUU A;  4M7A C;  4PJO B;  2FYK A;  2DTO A;  4NS5 A;  1BI0 A;  1D3B A;  2QDY B;  3JCM h;  5CR2 A;  4J83 A;  3JCM P;  3C94 A;  2CZ0 B;  4M78 B;  5FU6 C;  2K5I A;  3LH0 A;  4J8O A;  4N0A A;  3LX7 A;  3C95 A;  3LLR A;  3GIB A;  3QJY A;  4PNO A;  3QUI A;  4ATO A;  4M77 G;  5A0G A;  4C92 E;  3HRU A;  4HT8 A;  2DZ9 A;  3CMA T;  5AYF A;  3QZ5 B;  3CCV T;  3EAE A;  2QA4 A;  4M7D C;  3DB3 A;  3WXM B;  4PJO A;  3OYY A;  1VQP A;  2HBP A;  3OW2 A;  2EJF A;  1KD1 U;  1KQ2 A;  5GAM g;  1VQL T;  2GF7 A;  4KUD K;  2V8I A;  5GAN h;  1M1G A;  3OYK A;  4C8Q A;  1UGP B;  2LCL A;  2MI6 A;  2IVW A;  5CKB A;  1JJ2 A;  2EIF A;  3ME9 A;  5GAO q;  3LGL A;  2QTX A;  1UGR B;  1WQW A;  3HP9 A;  4PJO F;  2A3L A;  3L2R A;  2CZ6 B;  2RJF A;  3MP1 A;  4M77 B;  3FC3 A;  4BAC A;  4BE0 A;  4M7A G;  4ZGJ B;  2QQ9 A;  1WJS A;  2DK3 A;  3V7S A;  4J6Y A;  4RCC A;  4HA8 A;  1VQO A;  1KQ1 A;  4M78 F;  2RHY A;  2EFI A;  4XTZ A;  3J81 E;  3OYE A;  1U1T A;  3KXT A;  2DXU A;  5HK0 A;  1KHI A;  5GAN 7;  2CZ1 B;  1N9S A;  3E9F A;  2MWP A;  2E5Q A;  3JB9 I;  2D0Q B;  2E6N A;  2RHI A;  2B8A A;  3OYN A;  1NZ9 A;  1Q82 U;  4P5N A;  4C5H A;  3SD4 A;  3CME A;  2FVU A;  3G4S A;  3V7R A;  2MMP A;  4M7A B;  3PIO A;  4BI8 B;  4C0D C;  1Q7Y U;  2DXC A;  1LJO A;  4BY6 C;  5LJ5 h;  2KMT A;  5DY9 A;  4GY5 A;  3QJ6 A;  2HAX A;  3HPW A;  4A4K A;  3QHS A;  1M1K U;  4ZN1 A;  1B34 B;  5FU6 B;  2EQU A;  5I21 A;  5D6W A;  4C5I A;  4C92 D;  3JB9 J;  2H3J A;  4M77 F;  2EKO A;  5I2S A;  3CBM A;  1R8O B;  2LT4 A;  4QQG A;  4EPC A;  3CCU A;  3CMA A;  3CCV A;  3QII A;  2DIG A;  3C4S A;  4E7H A;  1HK9 A;  2K4Y A;  2WAC A;  1DJ7 B;  4JRI A;  3CC7 T;  1NJI C;  3JCM b;  2DIQ A;  1P92 A;  2RK2 A;  2WSC E;  3LYI A;  3S3O A;  1VQ9 A;  1VQL A;  4M7D B;  3CCM A;  1K9M C;  2JN0 A;  3RMS A;  1WNL A;  3AHU A;  4C0Z A;  2OTJ A;  3JSC A;  3O8V A;  2CYZ B;  4FSX A;  1B34 A;  3PT9 A;  3FLG A;  2YHT A;  5GAO p;  2RO0 A;  3HFO A;  4KBM B;  2DVE A;  2RI5 A;  5GAM e;  4M7A F;  3URG A;  1WPY A;  2CGH A;  2JVV A;  5GAM j;  4DQ2 A;  4R56 A;  1XOV A;  4Z02 A;  3QXE B;  2I2L A;  4EMG A;  2F69 A;  2YLB A;  3KUF A;  2HNI A;  1BI3 A;  3M5A A;  4L5G A;  4BUG A;  4ZGD B;  5M9O A;  3MO8 A;  2PVD B;  2QA4 T;  3CCE T;  5EG2 A;  3BDL A;  5KCO A;  1K73 U;  2F5K A;  1VQP T;  1QVF S;  2WSF E;  2EAY A;  3GP8 A;  3HL8 A;  1Y96 B;  4B9X A;  4E7L A;  1M90 C;  2LC4 A;  4M7D F;  1WJQ A;  3NTH A;  2LNV A;  4QVD A;  3CCQ T;  3CC2 T;  3BDU A;  1RL2 A;  3EFS A;  3CCL T;  2ZPE B;  4F7U G;  1M1F A;  4C0D B;  2JTM A;  3C12 A;  4KUI A;  3UPU A;  5FRN A;  3BY7 A;  4BY6 B;  4CRI A;  2L8D A;  2VV5 A;  4M75 C;  3G6E A;  1BIB A;  2O01 E;  4C92 A;  2EQK A;  4J7I A;  4FIB A;  1FXX A;  5I2M A;  3RIR A;  3VKI A;  3VUZ A;  4X9C A;  2MWO A;  2XK0 A;  5CCA A;  2OTL T;  3NFC A;  1JBM A;  3E1S A;  5CO7 A;  4C5E A;  3CC7 A;  1FX7 A;  3OW2 S;  1Y96 A;  2EQJ A;  1Q81 U;  1XNI A;  3OMG A;  4RG8 A;  4II1 A;  2ZGW A;  4RG2 A;  4DOW A;  3A8H B;  3TRE A;  5DLO A;  4E7I A;  4QQD A;  1XQH A;  2GQV A;  1X01 A;  2JOY A;  2VYT A;  3RKY A;  4F7U B;  4MMK A;  3RMQ A;  3Q1J A;  2LDM A;  1JJ2 S;  3CC4 A;  2D6F A;  2DZC A;  1QVF A;  3M55 A;  5CKD A;  4BE2 A;  4HCC A;  4M77 D;  3CCS A;  3CME T;  2K5L A;  2EJ9 A;  3G4S T;  1UGQ B;  1PSE A;  1TH7 A;  2E10 A;  2X4Y A;  4XU2 A;  3X28 B;  1K8A U;  4B9W A;  5A0D A;  2X4W A;  3A8O B;  4NOY A;  3SFM A;  1VQ4 T;  2DXB A;  4BDZ A;  1N27 A;  2YLC A;  3GLX A;  3M59 A;  5GMK l;  4C5G A;  3JCM d;  3JCM J;  1I4K 1;  1OI1 A;  2P0K A;  1LNX A;  1Y71 A;  3OYC A;  3CCU T;  1YI2 A;  4LD9 K;  2VXF A;  4E7K A;  1M4Z A;  3CEY A;  1BYM A;  1BI2 A;  3CCE A;  2ZPB B;  2A7Y A;  1X75 C;  3HFN A;  3UDC A;  2GFA A;  4CI0 C;  3OYG A;  2DKG A;  4M7A D;  1H64 1;  2Y4Y A;  3QPH A;  1VQ9 T;  3CPW A;  4EMK C;  2L5Q A;  5GAN 5;  3HKS A;  5CQY A;  3CCM T;  3CCQ A;  3MET A;  3CC2 A;  1U8R A;  3CCL A;  2KK4 A;  4ELZ C;  4F7U F;  4M78 A;  2OTJ T;  3QZ9 B;  2DD4 A;  3M4Y A;  5C0M A;  1Q86 C;  1VQ6 T;  2JZ2 A;  4MML A;  1YHQ A;  4HCB A;  4J5Y A;  1O9S A;  3PTA A;  3V8J A;  2IG0 A;  1EIF A;  5GAN d;  3CCJ T;  2PU9 B;  3M58 A;  4PKC C;  4XTY A;  1OZ2 A;  2R58 A;  2V8J A;  5GAM f;  4M75 B;  1VQ5 T;  3N5B B;  2OTL A;  4GLK A;  4EDU A;  2KY9 A;  4QQ6 A;  3OSS C;  4M7D D;  5FRO A;  4XQ3 A;  5IT9 E;  4IKF A;  1BI1 A;  1W4S A;  2RI2 A;  3KBG A;  4PLI A;  2O4X B;  3SB2 A;  3CXC A;  3GNG A;  3SWN C;  2KQW A;  4F7U E;  3J80 E;  3DB4 A;  1AHJ B;  1VIF A;  3OBW A;  3JB9 G;  3GF5 A;  4L6V 5;  4PLL A;  1SSF A;  2VGN A;  2YRV A;  1N6A A;  2ZZD A;  3QO3 A;  4M77 A;  4C0F A;  1ZHI A;  4D6W A;  5GAO l;  1KC8 C;  4M7D G;  4FU6 A;  1N8R U;  2QQA A;  2G3R A;  2X4J A;  3A8M B;  4QVZ A;  3MHX A;  3OYI A;  1VQ4 A;  2LVM A;  2DD5 A;  1QVG A;  5J26 A;  3PMI A;  3G6E T;  4XAX B;  3OMC A;  1W2B A;  2CZ7 B;  2LT1 A;  2RH2 A;  5CKF A;  3VV0 A;  1YCY A;  5LJ5 d;  3RKX A;  5L8R E;  4M75 F;  5FRM A;  2L3R A;  1VQM T;  1G3S A;  3ZBD A;  4ZGE B;  2VXE A;  4L59 A;  1NE8 A;  3L2Q A;  2QXF A;  2ZPI B;  3OA6 A;  3E9G A;  2DO3 A;  4WF2 A;  3PNW C;  5GAN g;  2DXT A;  4IUQ A;  4BB7 A;  4LDX A;  1KQS A;  2RI3 A;  4M7A A;  4JLI A;  4OB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...