4J6YA

Hfq from pseudomonas aeruginosa crystallized in gtp presence
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
molecule keywords Protein hfq
molecule tags Rna binding protein
source organism Pseudomonas aeruginosa
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j6yA00
3QUIA 3L2ZA 3V8JA 2RM4A 4M75G 4M77D 3SWNA 4XTVA 4M75E 3JCMX 3JB9F 2YHTA 2Y90A 3RESA 3BY7A 2I2LA 1JRIA 3EFSA 1HXDA 3VU3C 4C8QB 4C92F 4F7UF 4M7DC 4M7DB 1BIAA 1N9RA 2RA2A 4PNOA 2FYKA 3BDUA 2EWNA 4XU1A 3V7RA 5GAOm 5GAOr 1Y96A 4M7DE 4XU3A 2DTHA 3JCMh 1M5Q1 2DKGA 3JCMg 4M77G 5GAMe 5LJ5e 3JCMc 5GAN5 5GAOn 4M77E 3JCMJ 1WQWA 3HFOA 2DEQA 3SWNB 1BIBA 2CGHA 4C8QC 3BFMA 1WPYA 2E10A 3RKWA 5GMKl 4OP0A 3JCMd 4M75F 4M7AF 1I4K1 4M7AD 4JUVA 4DQ2A 5LJ5j 5GAMj 1Y96B 5GANh 5GANg 5I21A 1I5LA 3SWNC 4X9CA 4M7DF 4M7DD 5GANd 4MMLA 3RKXA 4XTWA 4C8QD 3JB9I 3JB9J 4NOYA 3FIFA 4J6WA 4M7AG 4M7AE 3M4GA 2DTIA 2RB6A 4JRKA 3RERA 4NL2A 3INZA 4C8QG 4M7DG 3V8LA 1N9SA 3EFRA 4WF2A 2EJ9A 4C8QE 5GAN3 4RCBA 5LJ3h 5LJ3g 4X9DA 4HT9A 2DXUA 4PJOA 4QVDA 4XTUA 5LJ3d 3QHSA 4A54A 5GAOq 5GMKe 3JCMV 3SB2A 4J6XA 5GAOp 1B34A 3V8KA 2DZ9A 4N0AA 3JCMf 2RD1A 3FJPA 1LNXA 5LJ3f 1YCYA 4C8QF 5GAOl 4C92A 4HT8A 4PJOB 4A53A 5GMKj 4XQ3A 5GAN8 4HA8A 2DXTA 2HNIA 3QO3A 1KQ2A 4XU2A 5DY9A 3HSBA 1LJOA 1H641 3RIRA 5GANf 3V7SA 5CAIA 2VXEA 5GAMh 4RCCA 4M78A 5LJ5h 5LJ5g 2EAYA 5GAMg 3JB9H 2VC8A 3QSUA 4M75A 4PJOC 1TH7A 5GANj 5GAMd 5LJ5d 2VXFA 1HK9A 4M78D 4Y91A 5GAN7 1MGQA 2EJGA 1D3BA 2DVEA 2E64A 4JRIA 4N0AC 4EMHA 1WQ7A 5GAN4 2YLBA 5LJ5f 4M78B 5GMKi 2YLCA 3L1AA 4JLIA 4M77A 2K57A 4C92C 4EMKA 4PJOD 4MMKA 5GMKm 2DZCA 3JCMQ 4XTYA 3HFNA 1JBMA 4M78E 4XTZA 4V2SA 3RKYA 3BW1A 1M8VA 4F7UA 2E1HA 1I81A 1D3BB 2JN0A 4J6YA 5GAN6 3JB9D 4M78C 3JCMW 4PJOG 4M75C 3JCMP 4M77B 4C92D 4EMKB 3GIBA 4PJOE 1B34B 1I8FA 2QTXA 2E65A 4M7AA 3AHUA 2FB7A 4F7UB 2E41A 1LOJA 4M78F 4C92B 3JB9G 3JCMe 4XTXA 4EMGA 5LJ3e 4M78G 4F7UG 3JCMb 4NL3A 3PGGA 1KQ1A 4M77C 4C92G 4EMKC 3V7CA 4M75D 4C92E 4F7UE 1X01A 5GMKh 5GAN2 4C8QA 2DJZA 4M7DA 4M7AC 2DTOA 5GAMf 2EJFA 4PJOF 1U1TA 4M7AB 3RUXA 5LJ3j 4M75B 5GANe 4J5YA 2ZGWA 3FB9A 1U1SA 4M77F 1WNLA 4QVCA 4XU0A
chains in the Genus database with same CATH superfamily
3QUIA 2BKDN 2CP0A 2EWNA 2DKGA 2QXFA 3SWNB 4C5GA 1GXIE 1RAGB 2CH4A 2GCXA 3RKWA 1NEGA 5CQXA 4RTYA 1BI1A 2DL7A 3GNFB 3PFSA 4DQ2A 4QQ6A 2YWWA 2J06A 1OX8A 3GP8A 4ELYC 3UWNA 3DB3A 3JB9I 5KE2A 3QKJA 1KC8U 3VS4A 3CCQT 4F14A 3ZEHA 1Y7XA 5KCHA 3JRZA 4QW2A 2E3HA 3S6WA 1IXDA 3OYAA 1WIEA 2JW4A 2DL3A 2O4XB 1JJ2S 4GY5A 1WYXA 2PTKA 4N0AA 5HY6A 3OYKA 1T3SA 4RG2A 3UDCA 2RI2A 2MPXC 3G6EA 5FWBA 2X35A 5GMKj 2CZ1B 1UFFA 4DEXA 2CP5A 2BUDA 2LT1A 5CKHA 4AG1C 3JB9H 2EYZA 2IG0A 2QK0A 1OV3A 2NUPB 3CCEQ 1RUWA 2COWA 2E64A 2LZ6B 3H0IA 1M1KU 4M77A 3PTAA 2H8HA 2W10A 2COZA 1VQNA 3CCST 2EQKA 2JXBA 2CDTA 1BBZA 3M55A 2XI9A 4XK8E 1Z9QA 3AHUA 3PNWC 3E2UA 4F7UE 1KG1A 1G3TA 1WHMA 4E47A 1N8RC 2MAMA 1U1TA 4DBFA 4J5YA 2JTFA 4FYWB 3SWNA 1JO8A 3BY7A 5IH2A 3CCUT 4C0GA 3SEMA 2X4YA 1GBQA 1D1AA 1BIBA 1K8AU 2OAWA 4BB7A 3SD4A 2IIMA 2P4RA 2DERA 2FRYA 2CYZB 2JMCA 1VQKA 2K6DA 5GANd 3OYLA 2RHUA 4XTWA 1LCKA 2LVMA 2O4XA 4ZGEB 3M58A 1JJ2A 3L2RA 1W2BA 5FU7B 1XJWB 2LQWA 4IUUA 3MP6A 1R0CB 2KXDA 4N4IA 4HCKA 1U3OA 2YXYA 1Q81C 1MNDA 4OB1B 5GMKe 2FVUA 1B34A 1SEMA 2RD1A 4C5HA 1LNXA 1UHCA 3TEEA 4IIOA 2JT4A 2JOYA 4N4GA 2NUPA 1QVFS 4R0KA 1H641 1G3YA 1UECA 1WHLA 2E3IA 2K7AA 2RJCA 3A98A 3QZ9B 1ZA2B 3C4SA 1KC8C 2F5TX 3EG0A 4HVWA 1H3ZA 4D6WA 2RHZA 4CC3A 1V29B 4AFZC 1ZUUA 3CD6T 1YJNT 1CKBA 3P8DA 1QKWA 1QP2A 2LMJA 3GIBA 3G4SA 4A4HA 5KYXB 1R8OB 4IUQA 2FB7A 2DBKA 5C6SA 1QVFP 3CCVT 4PFOA 1KSWA 1T0JA 4PFPA 3TVTA 4C92E 4AFQC 2OTLA 3CC2T 4PJOF 3CPFA 2PZ1A 4IUVA 3RUXA 2EBPA 1VQ5Q 2ZGWA 5FU6C 2KDSA 4M75E 2RN8A 3VS1A 2YUPA 2G6FX 1PKSA 4C8QB 4XU1A 2NUZA 2FO0A 3KBGA 2AIRB 3OYGA 1NLOC 3MP1A 1VQOQ 3JCMd 2DVJA 3O5ZA 3P8HA 1YIJA 1VQ9A 1ZBXA 1MMGA 3M53A 1KHCA 2X4WA 4RUGA 1B3QA 1N6AA 2E70A 3OSSC 1D1BA 5IHKA 2HKQB 3INZA 1Z9ZA 3RBBB 3FRNA 2VUBA 2RHYA 5J3BA 3GOXA 5LJ3h 1D1CA 1PSEA 4O6JA 2LCSA 2CP6A 2XKOC 1Q86U 3CC7A 1I07A 1X2QA 3HL8A 3ER0A 4RTXA 5EG2A 1QVGA 4HT8A 1IB8A 2F69A 2FPEA 2KRSA 1K8AC 2MMPA 3VRYA 1OPKA 2K79A 2OTJQ 2GFAA 1VQ4T 4J83A 1MGQA 3I55A 1X27A 3M0RA 5L8RE 1XOVA 1GCQC 3M4YA 1M1KR 2JUFA 1WA7A 2YUOA 3OS1A 2HAXA 4MMKA 1GRIA 3TSZA 3CC4Q 4WCIA 4XTYA 2D0QB 5KYXA 2XDDA 1YI2T 4B9WA 5A2QE 1YP5A 3CCMA 2Y4YA 3Q1JA 2E6ZA 2QTXA 3EH2A 2CUDA 2HCKA 4LDVA 2ZPHB 1NJIC 1YBYA 2DO3A 2QASA 3LX7A 1MV3A 2FRWA 3OS2A 2DE0X 1Y0MA 2KY9A 4C8QA 4ZTFA 5KYUB 5I22A 1QCFA 1QMCA 1VQ8A 2VVKA 1TS9A 2DYIA 3HP9A 1UE9A 1JXOA 3V7RA 2BIVA 2XU8A 2NLUA 4DOWA 5GMKl 2QEXT 4JRPA 4JUVA 1UB4A 5CKBA 3CC7T 1FX7A 1VQLQ 4M7DF 5I11A 3S3NA 5CVIA 1XNIA 3G7ZA 1P92A 4M7AG 3RMSA 1X69A 1AEYA 2ZCFB 3M9QA 5AYFA 3RERA 3VS6A 1AWJA 3EFRA 2EJ9A 5GAN3 2LTOA 4E6RA 3I56A 3E19A 5LJ3g 2JS2A 2M16A 1TWBA 1G2BA 2A37A 4KUDK 3CMAQ 2R5AA 2QQBA 2CREA 3SB2A 1TUGB 2V8JA 4R55A 3QWYA 3L42A 1YCYA 3A8OB 1Y07A 1ZQ1A 1QW1A 1SRLA 1BCMA 3S3MA 2LX9A 1YJWQ 2HNIA 2CZ0B 2EPDA 1MNEA 4KH1B 2OI3A 5GANf 1N5ZA 3MEWA 5LJ5h 3OYEA 1KQSA 4J9HA 2IPOB 1TUDA 1TXQA 3OYIA 1IREB 2NWMA 2ROLA 4GBQA 4ZGDB 1V76A 4J6YA 3OYNA 3M0PA 2V8KA 2CSQA 2VKNA 4PJOG 4C92D 1Q86C 3URGA 5KYUA 3OY9A 2QGFB 3HRTA 1NZ9A 3LWIA 1ZSGA 4M75D 1QCOA 3TQ7P 3F70A 1NLPC 1QVPA 1WHHA 2ROTA 3LLRA 3CMEA 4QQDA 3FB9A 4RCCA 1D0XA 3V8JA 3C94A 2RM4A 2HL3A 4KRTA 3M57A 1YJ9Q 1SG5A 2O2OA 4M7DB 1X75C 1BIAA 4M7AC 2F5KA 4XU3A 2DTHA 2HD0A 2QDYB 3OBWA 3HFOA 4FIBA 3BFMA 1WJQA 4JS4A 1Y96B 5A0LA 1I5LA 4X9CA 5CO7A 3H6ZA 3FDRA 3JB9J 1YHQQ 1M3CA 2DTIA 3CBPA 2HL5C 4J9IA 4LD6A 1K0XA 4GLMA 4J7FA 2J6OA 5CKDA 4J9DA 4EPCA 3FEOA 4JJBA 1T3LA 3JAME 2X3WD 2DK3A 5FROA 2ED0A 3QHSA 3CCRA 3JCMV 1Q86R 3QBYA 2ZPFB 3ZL7C 3V8KA 3JCMf 4OMPA 1M30A 5FW9A 4FU6A 3NHNA 3X25B 5CKEA 5GAN8 3GF5A 4Y28E 1NPPA 3CPWA 5LJ5g 4PJOC 2X3XD 2RQRA 1KD1U 1O9SA 1ZSZC 2EJGA 2HBWA 1R77A 3L2QA 1IGQA 4FT2A 2ENMA 2E1HA 1E7OA 2HSPA 2HKNA 4X1VA 3JB9D 1ABOA 2L8DA 1NYGA 3G6EQ 3CCQA 4EMKB 2DAQA 3EG3A 4HCCA 4E2FB 2PNIA 4XTXA 2VASA 1VOMA 4BDYA 3V7CA 1MMDA 1SHFA 4M7DA 2GF7A 4OMMA 2E6NA 3OYCA 3OYDA 1OOTA 1OI1A 4XU0A 1QCNA 3OYJA 3OB9A 2K2VA 3LH0A 4KUIA 1N9RA 2CKKA 4PNOA 3BDUA 1Y96A 2LP5A 1VA7A 3AT1B 1VQNQ 1WQWA 1PG5B 1I4K1 2M51A 1AVZC 5D6WA 2DJQA 5EC7A 1PRMC 2J05A 3FIFA 1NG2A 4OMQA 1PM3A 2WSEE 4JRKA 3M59A 3CCSA 2J6FA 1GFDA 2QQSA 2NYSA 1BI0A 2YUNA 1B7TA 3OYHA 2AKKA 3SHWA 2JTEA 3MKDA 3ZFJA 4PLLA 5GAOq 4QT7A 4KH0B 3CXCA 4LDXA 1D0ZA 2DILA 4E7LA 5LJ3f 2DIGA 4LNPA 4HA8A 2P4TA 1WHKA 3CBMA 4OGCA 4AMCA 3TREA 2KEAA 3CCUA 5GAMh 2VC8A 1X2KA 4FT4A 2BTTA 1PRLC 1VYTA 3PVQA 1ZHIA 1H8KA 4HXJA 1VQPT 3CCLT 4EMKA 4FM4B 2H3EB 2O9VA 2E5KA 2DF6A 3HFNA 2K5LA 1UJ0A 3RKYA 5CK9A 2GTJA 1I81A 1S72T 2O31A 2KVQG 2RNAA 3EGXA 2QDLA 4IIMA 1NM7A 4JDSA 1B34B 3E1SA 2OJ2A 2LDMA 4N4HA 4MZPA 4IURA 1KQ1A 3JCMQ 2LQ8A 2LCCA 3PMTA 5C0MA 5FRMA 4LE9A 2DJZA 4Z88A 4QKUA 3S3OA 3C12A 3EHRA 2FEIA 5I2MA 1IGUA 4LUEA 4XTVA 1KD1C 2HZYA 1AWWA 5ECAA 3CCJT 2RH2A 4M77G 4BE0A 3JCMJ 4OMOA 3G4SQ 3PT9A 2AT1B 5I2SA 1B07A 1JEGA 2PVGB 4A4FA 3HRUA 2OTLQ 3ME9A 4J6WA 3A8GB 5D6XA 4M7AE 3R6NA 3CD6A 1YJNA 4C0DC 2GQIA 4A4KA 4NL2A 2CH4W 3NGPA 1HD3A 1E6HA 2XHCA 1PNJA 1YITT 3CCVA 4DEYA 2EQIA 2KROA 1YFNA 2RK2A 2K2MA 2L3PA 3G71Q 2BE9B 2CP3A 3CC2A 1XQHA 2RMOA 3FJPA 3HPWA 1VQ9Q 1YIJQ 4C8QF 2ABLA 4JLGA 2A28A 4A53A 1YCSB 3A8MB 5CR2A 4FSSA 1KQ2A 1PCXA 3V7SA 3RMQA 3RR6A 5GAMg 2DRMA 1C0MA 4Z8AA 2K9GA 3VRZA 4FSXA 1KD1R 2L3RA 3OA6A 4N0AC 4EMHA 1VQMQ 5LJ5f 4P5NA 2YLCA 3EGDB 2K57A 3OMGA 4KT0E 3MCAB 1VQ7Q 3RDVA 3OQ5A 1MMAA 4KBMB 2KSSA 4BY6C 1KFZA 2C0TA 5KYNA 1NPRA 4PJOE 2HQXA 2JTMA 1WHGA 1NBEB 4YTLA 2E41A 1LOJA 2RI3A 4M78F 4MDWA 3HTRA 1Y71A 2I0NA 4RMOA 1RAFB 1SSFA 3C0CA 4OVAA 4M77C 3DLLA 2V1QA 4KGZB 3I55Q 3DB4A 1S1NA 1TU0B 1YWOA 5GMKi 1K9MU 1ZUKA 4EDUA 3VU3C 3MJXA 3CCEA 4RTVA 4NS5A 3CCMQ 3BE3A 1AZGB 2KXCA 1G5VA 3MEVA 1WI7A 1VQ4A 3M5AA 4IKFA 1WPYA 2EKOA 4OMLA 3QDRB 4QQGA 4CRIA 2MK5A 3SWNC 5DLOA 2VYTA 2Y4XA 1WZOA 1YI2A 2JS0A 3M4GA 4R56A 1VQ8Q 1YN8A 2CUBA 1FXXA 3RNJA 1C1AA 1W4SA 3GLXA 1M1KC 2BZ8A 3MEUA 2KQWA 4X9DA 5GAOp 3A8LB 5FWCA 2P0QA 4A4GA 2YRDA 3ASKA 3MEAA 3M56A 4LDYA 1GBRA 1YNZA 4XU2A 3L2UA 4AT1B 3VYHB 3M0UA 2VXEA 2WSFE 1RL2A 3EGDA 1K73U 2VXFA 3HHTB 1BKBA 2D6FA 1OEBA 2ZAEA 1W6XA 2QEXA 1QVFA 1AHJB 1WQ7A 5GAN4 2ZZDA 3I56Q 1GFCA 4M78B 2HSEB 4ZN3A 1AOJA 5AT1B 4LD9K 2YUQA 1AZEA 2PQWA 3VS7A 3OS5A 2DLPA 2QQ9A 2V8IA 1D3BB 3JCMW 2KT8A 2D1XA 3CCET 2FG0A 1ACMB 2LJ0A 5KYYB 1VIEA 1X6OA 3L2VA 1TTHB 3WVEB 5GMKh 1FWZA 1BCOA 2QGGA 4F16A 1U06A 1K4US 1UJYA 2A3LA 4OF1A 2P0KA 1Q7YU 1HXDA 1UGQB 4CC4B 5GAOm 2QA4Q 4E7HA 2J6KA 1MV0B 2HQEA 3CQTA 3LGLA 4M7DE 4HCZA 1QQJA 2EQJA 1N27A 4M7AD 2LC4A 3QJYA 4PJLA 1X6BA 4DBQA 3J80E 2IVWA 1M1FA 2QTVA 1T0HA 3OYMA 3CMEQ 4E7JA 4DA4A 4B6MA 2MYSA 4C8QG 1M2VB 3VJPA 1ZBJA 4AG2C 5HK0A 2GFUA 4HT9A 1IRXA 1K9MC 4QVDA 1VQ6Q 1M90U 5FU7C 5LJ3d 4A54A 2YT6A 1IHVA 2MWOA 2KMTA 1OPLA 2M1HA 4RTTA 4HVUA 1UGRB 2DD5A 1WXBA 2D8HA 2J7IA 2DXTA 1SKUB 4RTZA 5IN1A 3L2WA 3UA6A 3RIRA 5CAIA 3TU4K 4ZTJA 1X6GA 3OW2P 4M78A 3HKSA 3NTKA 2MCNA 3CEYA 2CT3A 2Z0WA 2ZPBB 1D3BA 4ME7A 4PJJA 3EGUA 1F1BB 2OX7A 2DM1A 2K3XA 3U23A 4PJOD 2L89A 2KAFA 4XTZA 5KYYA 3CCRQ 2KNBB 3WVDB 4ESRA 1MHNA 3N5BB 2RPNA 4FYVB 1SHGA 1U8RA 2FPFA 1G3SA 2DBMA 2AHJB 2X4JA 2HQHA 4LDWA 2P84A 1RLQC 2CT4A 2ATCB 3PGGA 3SDZA 1WJRA 3REAB 1UUEA 1RAIB 1ARKA 1K9MR 5IHIA 2LCLA 5GANj 2D9TA 3WXMB 1KHIA 1HSQA 3JCMc 3CCQQ 4M77E 3A1PA 4C8QC 4XAXB 2MWPA 2E10A 1VQ5T 2AZSA 4ORZA 3PIPA 4Q5WA 2B8AA 1M2VA 3OYBA 1HYOA 2B86A 3NPFA 5IHNA 4Y92A 4FYXB 4FCYA 1Q82U 4VUBA 2GBQA 1VQOT 5GJVB 4M4ZA 2COYA 3GBQA 1PSFA 2VB6A 2HMAA 3UPUA 1KIKA 4BI8B 2DEUA 2E4HA 5CCAA 3KUFA 2EW3A 2M02A 4C92A 7AT1B 4A63B 1OX9A 1CKAA 3THKA 2EAYA 1QLYA 4M75A 3VUZA 1K73R 2DX1A 5LJ5d 4Y91A 3CCSQ 2LX7A 3HRSA 2A0FB 2DA9A 2RJEA 1TUCA 1WXTA 3NFCA 3LYIA 4V2SA 3BW1A 5HCKA 2JN0A 2OTJT 3DKMA 2GGRA 4MZTA 1RABB 2VV5A 4O5VA 2EIFA 3VS0A 2BZXA 2PVDB 3CCUQ 2XICA 2DL8A 3CC4T 1RI0A 2K4YA 4LUDA 4B9XA 3G1JA 1O75A 5GANe 4M7DD 3EG2A 3L2ZA 1Q7YR 1M2OA 2MOXA 2LT4A 2YHTA 2Y90A 2D0NA 2FL7A 1JRIA 1PC0A 2JM9A 1JB0E 1EIFA 3PIOA 2WSCE 4JPBW 3H41A 2K3BA 2FZKB 2XK0A 3C95A 2P0PA 3EGXB 1A0NB 1VQPA 3CCLA 2L2PA 1MMNA 2DL4A 1OZ3A 2M9UA 3R6OA 1S72A 1RAEB 1RI9A 1PD0A 1JQQA 3FC3A 3UF4A 4M7DG 3V8LA 1N9SA 4WF2A 3UATA 2G3RA 1OQKA 1SSHA 2DXUA 1VQLT 3ULRB 1MUZA 2DXCA 4XTUA 1M90R 2RQUA 2EYQA 1G8XA 2F2XA 2ZPEB 3OYYA 1ZUYA 2DZ9A 1I0CA 3QIIA 2CP7A 2KRNA 1UHFA 5LL6S 4LDUA 1HJDA 3QG1A 3QO3A 4J9CA 1SRMA 1M27C 1RAAB 3ZBDA 3CCJA 3CMAT 3CD6Q 1YJNQ 1TH7A 2LNHB 2GQVA 5DM7R 2A08A 2CSIA 4CC2A 2DIQA 4JRIA 1YHQA 2YLBA 4WTOB 4C5IA 1Q82C 3CCVQ 4JLIA 1YJWT 1OYXA 1AWOA 3VS2A 1Q81U 1AD5A 1FYNA 3M0SA 3CC2Q 1ZA1B 4CI0C 1VQKQ 5HKCA 2O01E 4AFUC 2L5QA 4RG8A 1M3AA 3M54A 3JCMe 9ATCB 1YITA 4ZN1A 2DRKA 3BDLA 2K5FA 2E5QA 4KGXB 5FU6B 5D6YA 4PJNA 2RHXA 3A8HB 5LJ3j 2EFIA 1WNLA 1OULA 4M77D 1NE8A 2I2LA 3EFSA 1LPLA 2XMFA 5GAOr 2K3YA 1IHWA 2DL5A 1H3HA 4M7DC 2A7YA 4Z02A 2KYMA 1W2BS 5GANh 5I21A 1EZZB 5IXBA 1YJ9T 1D09B 3QYGB 1OU8A 2FPDA 4J9EA 1UG1A 1TOVA 2RB6A 4JJNK 3META 4JZ4A 2KYBA 1Q82R 2AKLA 4C8QE 3PE0A 4FL6A 1YHQT 1VQ4Q 1OZ2A 5J39A 5FRNA 2EQMA 4RTWA 2KBTA 1RACB 2RQWA 1JJ2P 1W2BP 1QKXA 1LJOA 5L23A 1YI2Q 4BACA 4RTUA 1WX6A 3MHXA 4FW2A 5KE3A 2DYBA 4UC4A 4J9BA 5GAMd 4BE1A 3GPLA 2RJFA 3QDFA 1FMWA 2KI7A 3OSVA 1M4ZA 2QAZA 2E12A 4F17A 5GMKm 2DZCA 3P8BB 2DMOA 4M78E 4PFZA 1M9SA 2MI6A 3NMZC 2DFUA 3JCMP 4BUGA 1I8FA 1TG0A 3PMIA 2X4XA 2EYXA 1AWXA 4JJCA 5LJ3e 3QWXX 4EMKC 1GCPA 2D8JA 3X28B 3EH1A 2QEXQ 3G6ET 1U1SA 4L59A 4OGEA 1OU9A 3JCMX 3CC7Q 3RESA 2DD4A 4F7UF 2KK4A 3M0TA 2LQNA 2LJ3A 1PD1A 4EIKA 2AK5A 3JCMh 2EYWA 1BI3A 2MIOA 2ESWA 5CQYA 4AFSC 4PJMA 4PK4A 4ELZC 4M7AF 1V1CA 1X43A 3TSWA 4QVZA 1SPKA 2DXBA 5LJ5j 3J7AF 3IQLA 5GANg 4JZ3A 5GJWB 1NJIU 1WLPB 4MMLA 4PKCC 2CZ7B 1ZX6A 1EFNA 3QXEB 5IXFA 1VQNT 1N8RR 2JJ9A 2W0ZA 1QVGS 2NUTB 4RCBA 2RQTA 2YRCA 1ABQA 4ANJA 4LN2A 4FYYB 1UDLA 5CKFA 4BD3A 1R0BG 4BI4A 1GCQA 1JU5C 1FMVA 3JV3A 3I9QA 4XQ3A 3HSBA 3LW5E 2JM8A 2OAUA 1UGSB 1I5OB 3UT1A 4HKEA 2KT1A 2A36A 2F2WA 2DVEA 3REBB 2C06A 3L1AA 1QVGP 2K5IA 1VQKT 2DNUA 2FZCB 1M8VA 3T9NA 1Q81R 5GAN6 1VUBA 1U5SA 4J7IA 1UTIA 1NYFA 4MZMA 2QG9B 4F7UB 3G71A 1K0SA 3MO8A 4EMGA 2LJ1A 3VYGA 4NL3A 1PHTA 1X01A 1WDXA 5GAN2 2EJFA 2GTOA 4M7AB 3GNGA 3I5RA 2O88A 1GL5A 1G83A 1KC8R 5KYWB 4IUTA 3E9GA 4C92F 5HK3A 1VIFA 2RA2A 5IAYA 1VQMA 5LJ5e 1K76A 3JCMg 2KRMA 2XDBA 4D8DA 4M75F 1VQ7A 1WXUA 2QQRA 1DJ7B 4ZNXA 3J81E 3RKXA 4C8QD 2NUTA 3X20B 1IO6A 4OB3B 1BI2A 3G4ST 2VWFA 2QYZA 2LNVA 1QP3A 2FZGB 4OMNA 1K9AA 1BB9A 2F1LA 2GNCA 2C0OA 6AT1B 2OTLT 3VUBA 3MPUB 3JSCA 3EAEA 4J9FA 1M1GA 2VGNA 3O8VA 2KGTA 3OW2S 1KQSS 1JXMA 3SFMA 4PJOB 2PUOB 4FW1A 2R5MA 2EGAA 2L3QA 3KFVA 2RQVA 2CZ6B 2ZPGB 5DY9A 2V26A 4BE2A 1KJWA 1ZSZB 2KE9A 4MDXA 3H0HA 2JVVA 2HBPA 2XD0A 2SEMA 5KCOA 1K1ZA 4ZGJB 3G71T 3TCJA 4M78D 2L0AA 2YDLA 5A0GA 1VQ9T 1YIJT 4E7SA 1VQ5A 1C6VX 4J8OA 2CP2A 1FMKA 2PVOB 3VKIA 4E7KA 3NTHA 3QYHB 1RLPC 4F7UA 2BZYA 3FLGA 4KULA 8ATCB 2EVRA 2WACA 2DPPB 2JNGA 1VQOA 2PUKB 1LVKA 2FHDA 1KQSP 1VQMT 2HDAA 4M7AA 4BDZA 4C92B 3OBYA 4C0ZA 3QPHA 4F7UG 1K8AR 5KYWA 1VQ7T 4D8KA 2DTOA 5GAMf 1E6GA 4KGVB 1VYVA 2V1RA 2ED1A 4M75B 3EHQA 3H0FA 4QVCA 3EG1A 4HCBA 4M78G 1Y57A 3KXTA 3JB9F 2LQKA 4BI3A 1PKTA 2LRQA 2BE7D 2FYKA 1WHJA 2SRCA 1M5Q1 5GAN5 2AZVA 2DEQA 2EKHA 3I55T 2RJDA 4OP0A 4A4EA 5GAMj 2EYYA 1PWTA 2JMAA 2R57A 3H9NA 1NJIR 4NOYA 3CCMT 1K73C 1ZLMA 2OTJA 3LWHA 2X51A 4DBHA 1QWEA 4E7IA 1EX4A 2VGMA 4OMFB 3M0QA 3OW2A 4JJDA 4IUPA 3A5ZB 3VV0A 2ZPIB 4PJOA 3CC4A 1TSFA 3EFOB 3I5SA 3CPWS 1ZSZA 2EGEA 4GLKA 1VQ8T 2QA4A 3VS5A 2M0YA 5A0DA 8AT1B 1VQPQ 3CCLQ 2HEQA 4L6V5 2QI2A 2XDPA 2PU9B 1S72Q 1YWPA 5IT9E 5D7UA 5GAN7 1Q7YC 2RK1A 1VYUA 4X34A 3NTIA 3D7SB 1CSKA 3FJ5A 3H8ZA 4RKUE 4C0FA 4PL6A 5KH6A 3EG9B 3LGFA 4M78C 2MF2A 3CPWP 4ATOA 4L5GA 1BK2A 1UGVA 1AT1B 1VQ6A 3OS0A 1RADB 1XTDA 2E65A 3I56T 3VS3A 3CCJQ 2F2VA 1VQLA 4C92G 4JRQA 2O9SA 1Q95G 1KK7A 2EQUA 4PLIA 4M77F 3UA7A 1H92A 4JS5A 4M75G 2C0IA 2YRVA 1M90C 2M0OA 2JZ2A 4OB0B 3CMAA 3I35A 5GAMe 4HVVA 4DBRA 5GAOn 2XIDA 2CGHA 1W1FA 4K11A 1D0YA 1WFWA 4TVRA 4F04B 2QQAA 3MP8A 1UGPB 2XG8D 1YITQ 4LXCA 4C0DB 1RAHB 1YJWA 4E7ZA 1WGSA 4DOVA 2QA4T 2L3SA 3EFOA 1W70A 3CXCS 3X26B 1I1JA 3QJ6A 3OMCA 2CS7A 3CBOA 2YSQA 2RO0A 4J6XA 3CMET 1UEBA 5GAOl 2RHIA 1IZ6A 1G3WA 5DLQE 5J26A 1NEBA 3DLMA 1N8RU 2RF0A 4J9GA 1VQ6T 4CC7A 3OYFA 4OB2B 1HK9A 3EG9A 5M9OA 3CXCP 2RI5A 2H3JA 3QZ5B 4BY6B 1M3BA 4II1A 5CIUA 4C92C 1YJ9A 2KR3A 1SF9A 1JBMA 2ECZA 1QWFA 1BU1A 1M8MA 4Z89A 4C5EA 1J3TA 4M75C 4M77B 5FLXE 3PVLA 1BYMA 3JB9G 2DETA 2EGCA 3JCMb 1WJSA 3CCRT 2X9HA 3LH5A 3X24B 3QSUA 2R58A 3E9FA
chains in the Genus database with same CATH topology
3QUIA 3V8JA 3C94A 4OGEA 2RM4A 1Q7YU 3JCMX 3M57A 3RESA 2DD4A 4F7UF 4M7DB 1HXDA 2BKDN 1UGQB 1X75C 2KK4A 1BIAA 5GAOm 4E7HA 4M7AC 2EWNA 2F5KA 2HQEA 3LGLA 4M7DE 4XU3A 2DTHA 4HCZA 2HD0A 3JCMh 2DKGA 2EQJA 1N27A 1BI3A 2QDYB 2QXFA 3HFOA 3OBWA 3SWNB 5CQYA 4C5GA 4FIBA 4ELZC 3BFMA 2GCXA 4M7AF 3RKWA 1GXIE 4QVZA 5CQXA 1WJQA 4M7AD 4JS4A 1BI1A 3PFSA 3GNFB 4DQ2A 2DXBA 4QQ6A 5LJ5j 1Y96B 3J7AF 2LC4A 3QJYA 5A0LA 5GANg 1I5LA 3GP8A 4ELYC 4X9CA 5CO7A 3UWNA 3H6ZA 1NJIU 3DB3A 4PKCC 4MMLA 3FDRA 3JB9I 3JB9J 5KE2A 3J80E 2IVWA 1M1FA 2CZ7B 3OYMA 4E7JA 3QKJA 2DTIA 3CBPA 3QXEB 1KC8U 3CCQT 4LD6A 4DA4A 1VQNT 4J7FA 3ZEHA 1Y7XA 5CKDA 5KCHA 3JRZA 4QW2A 4EPCA 4C8QG 3FEOA 3VJPA 3S6WA 5HK0A 3OYAA 1QVGS 4RCBA 2GFUA 4HT9A 1K9MC 3JAME 2O4XB 2DK3A 4QVDA 5FROA 1M90U 5FU7C 5LJ3d 3QHSA 4A54A 3CCRA 3JCMV 1JJ2S 3QBYA 2ZPFB 5CKFA 2MWOA 4BD3A 4GY5A 2KMTA 4BI4A 3V8KA 3JCMf 4N0AA 2M1HA 5HY6A 3OYKA 4RG2A 3UDCA 1UGRB 2DD5A 2RI2A 3G6EA 4FU6A 2X35A 3X25B 5GMKj 5CKEA 4XQ3A 5GAN8 2DXTA 2CZ1B 3GF5A 5IN1A 3L2WA 3HSBA 3LW5E 2LT1A 2BUDA 4Y28E 3RIRA 5CAIA 5CKHA 1NPPA 3TU4K 4ZTJA 3CPWA 2OAUA 4M78A 3HKSA 5LJ5g 3JB9H 3NTKA 4PJOC 2IG0A 1UGSB 3UT1A 3CEYA 1KD1U 4HKEA 1O9SA 2EJGA 2ZPBB 1D3BA 2DVEA 2E64A 4ME7A 1M1KU 2C06A 3L1AA 4M77A 3PTAA 2K3XA 4PJOD 3L2QA 2K5IA 1VQKT 2L89A 2KAFA 4XTZA 4FT2A 1M8VA 2E1HA 3T9NA 3WVDB 1MHNA 3N5BB 5GAN6 3JB9D 1VUBA 1U8RA 2L8DA 3CCQA 4J7IA 1G3SA 3CCST 4EMKB 1VQNA 2EQKA 4MZMA 2AHJB 2DAQA 2X4JA 2XI9A 3M55A 4HCCA 4XK8E 3AHUA 4LDWA 4F7UB 3G71A 3PNWC 4XTXA 3MO8A 4EMGA 4NL3A 3VYGA 3PGGA 4F7UE 4BDYA 3V7CA 1KG1A 1X01A 1G3TA 5GAN2 3SDZA 4M7DA 1WJRA 2GF7A 2EJFA 4E47A 2E6NA 2MAMA 1U1TA 3OYCA 4M7AB 1N8RC 3GNGA 3OYDA 4J5YA 1OI1A 4XU0A 2JTFA 3OYJA 3OB9A 3SWNA 2K2VA 3LH0A 3BY7A 4KUIA 4IUTA 3E9GA 4C92F 5HK3A 2LCLA 1N9RA 1VIFA 2CKKA 2RA2A 3BDUA 4PNOA 4C0GA 5IAYA 3CCUT 5GANj 2D9TA 1Y96A 2X4YA 3WXMB 1VQMA 1KHIA 5LJ5e 3JCMg 3JCMc 4M77E 1WQWA 1BIBA 4C8QC 4XAXB 2XDBA 2MWPA 2E10A 1K8AU 4M75F 1VQ7A 1VQ5T 1I4K1 4BB7A 3SD4A 5D6WA 2QQRA 1DJ7B 3PIPA 4Q5WA 2CYZB 2B8AA 1VQKA 3J81E 5GANd 3RKXA 4C8QD 2RHUA 4XTWA 3OYBA 3OYLA 3FIFA 3X20B 4OB3B 2LVMA 2O4XA 2WSEE 4JRKA 4ZGEB 3M58A 1Q82U 1JJ2A 3M59A 3CCSA 1BI2A 4VUBA 3L2RA 3G4ST 1U1SA 5FU7B 1VQOT 1W2BA 2LNVA 1QP3A 2QQSA 1BI0A 4IUUA 3MP6A 3OYHA 4N4IA 1PSFA 1Q81C 3ZFJA 4PLLA 5GAOq 2OTLT 4OB1B 5GMKe 3CXCA 4LDXA 3VUBA 3UPUA 2FVUA 1B34A 4BI8B 4E7LA 2RD1A 3JSCA 1LNXA 3EAEA 5LJ3f 4C5HA 1M1GA 2VGNA 3KUFA 3O8VA 5CCAA 3TEEA 3OW2S 1KQSS 2DIGA 4C92A 2JOYA 4N4GA 3SFMA 2PUOB 4PJOB 2R5MA 4HA8A 1QVFS 2CZ6B 2ZPGB 2P4TA 5DY9A 3CBMA 4OGCA 4BE2A 3TREA 1H641 1G3YA 3CCUA 4MDXA 5GAMh 4RCCA 2RJCA 2EAYA 2JVVA 2VC8A 2HBPA 3QZ9B 4M75A 3VUZA 5KCOA 2XD0A 4FT4A 4ZGJB 3G71T 5LJ5d 3TCJA 4M78D 3HRSA 4Y91A 5A0GA 1ZHIA 3C4SA 1VQ9T 1YIJT 1KC8C 1VQ5A 2RJEA 4J8OA 1VQPT 3CCLT 3NFCA 4EMKA 4FM4B 2F5TX 3LYIA 2PVOB 3VKIA 4E7KA 1H3ZA 3NTHA 2RHZA 2K5LA 3HFNA 3QYHB 4D6WA 4V2SA 3RKYA 3BW1A 1V29B 4F7UA 5CK9A 3FLGA 4KULA 1I81A 1S72T 3CD6T 2JN0A 2OTJT 3DKMA 1YJNT 3P8DA 2WACA 2DPPB 2KVQG 1QP2A 3GIBA 4MZTA 2JNGA 4JDSA 2VV5A 4O5VA 4A4HA 1B34B 2EIFA 2PUKB 3E1SA 3G4SA 1VQOA 2FHDA 1VQMT 4M7AA 1R8OB 4IUQA 2FB7A 2LDMA 4BDZA 4C92B 2PVDB 5C6SA 3CCVT 4N4HA 3OBYA 2XICA 4C0ZA 3QPHA 4MZPA 4IURA 4F7UG 3CC4T 1KQ1A 3JCMQ 1VQ7T 4C92E 2LQ8A 2LCCA 3PMTA 5C0MA 5FRMA 2OTLA 2DJZA 2DTOA 1RI0A 5GAMf 3CC2T 2K4YA 4PJOF 3CPFA 4IUVA 3S3OA 4B9XA 3RUXA 4M75B 1O75A 5GANe 2ZGWA 3C12A 4QVCA 4M78G 4HCBA 4M7DD 1VQLA 3L2ZA 5I2MA 5FU6C 2KDSA 4M75E 4XTVA 2LQKA 3KXTA 2LT4A 4BI3A 2YHTA 2Y90A 1KD1C 3JB9F 2FL7A 1JRIA 4C8QB 1JB0E 2LRQA 4XU1A 2FYKA 3CCJT 1EIFA 3PIOA 2WSCE 2RH2A 3KBGA 1M5Q1 3OYGA 4M77G 4BE0A 3JCMJ 5GAN5 3MP1A 2DEQA 3I55T 2RJDA 3PT9A 3JCMd 4OP0A 3P8HA 1VQ9A 2XK0A 3C95A 5I2SA 1YIJA 2P0PA 4A4EA 5GAMj 1ZBXA 1VQPA 3CCLA 2PVGB 4A4FA 3HRUA 3M53A 2R57A 1OZ3A 2M9UA 1KHCA 3R6OA 4NOYA 3ME9A 2X4WA 4J6WA 3A8GB 3CCMT 1K73C 5D6XA 4M7AE 1S72A 3CD6A 2OTJA 1N6AA 3LWHA 1YJNA 2E70A 3OSSC 4C0DC 4A4KA 4E7IA 4NL2A 3INZA 3FC3A 2VGMA 4M7DG 3V8LA 3FRNA 1N9SA 2VUBA 4OMFB 4WF2A 2RHYA 5J3BA 3OW2A 2XHCA 3GOXA 2G3RA 3A5ZB 4IUPA 5LJ3h 3VV0A 1YITT 3CCVA 2DXUA 2ZPIB 1VQLT 4PJOA 1PSEA 3CC4A 4O6JA 2DXCA 4XTUA 2RK2A 2XKOC 1Q86U 2EYQA 3CC7A 3CPWS 2ZPEB 3OYYA 3CC2A 1XQHA 2DZ9A 3ER0A 3HL8A 3QIIA 3FJPA 3HPWA 4GLKA 5EG2A 5LL6S 4C8QF 2QA4A 1VQ8T 1QVGA 5A0DA 4LDUA 4JLGA 4HT8A 4A53A 3QG1A 3A8MB 5CR2A 3QO3A 2QI2A 2F69A 4L6V5 2XDPA 1K8AC 1KQ2A 2PU9B 3ZBDA 3V7SA 3RMQA 3CCJA 2MMPA 3CMAT 5GAMg 2GFAA 1TH7A 1VQ4T 2GQVA 4J83A 5DM7R 5IT9E 4FSXA 1MGQA 2L3RA 5GAN7 3I55A 3OA6A 1Q7YC 2DIQA 2RK1A 4JRIA 4N0AC 5L8RE 4EMHA 1YHQA 1XOVA 2YLBA 5LJ5f 4P5NA 3M4YA 4X34A 4C5IA 2JUFA 3NTIA 2YLCA 4JLIA 1Q82C 1YJWT 2K57A 1OYXA 3OS1A 2HAXA 3H8ZA 3OMGA 4KT0E 4MMKA 4RKUE 4XTYA 2D0QB 3MCAB 4C0FA 3OQ5A 4PL6A 5KH6A 2XDDA 1YI2T 4B9WA 1Q81U 4KBMB 2KSSA 5A2QE 4BY6C 3LGFA 3CCMA 2Y4YA 4M78C 2MF2A 4ATOA 3Q1JA 4CI0C 4L5GA 1NPRA 2E6ZA 5HKCA 2HQXA 2JTMA 2O01E 4PJOE 1VQ6A 2QTXA 3OS0A 2L5QA 4RG8A 1XTDA 4LDVA 2E65A 4YTLA 3I56T 2E41A 1LOJA 2RI3A 2ZPHB 4M78F 4MDWA 3M54A 3JCMe 1Y71A 4RMOA 4ZN1A 1YBYA 2DO3A 1YITA 1SSFA 3BDLA 2K5FA 2E5QA 3LX7A 4M77C 4OVAA 4C92G 3OS2A 5FU6B 5D6YA 3DLLA 4JRQA 2KY9A 4C8QA 2EQUA 4PLIA 4ZTFA 2RHXA 3A8HB 3DB4A 5LJ3j 2EFIA 4M77F 1WNLA 5GMKi 1VQ8A 1K9MU 4JS5A 4M75G 4M77D 1NE8A 3HP9A 2YRVA 4EDUA 2I2LA 3EFSA 3VU3C 3CCEA 5GAOr 1M90C 2M0OA 2JZ2A 3V7RA 2BIVA 2K3YA 2XU8A 4NS5A 4OB0B 3CMAA 2NLUA 5GAMe 5GAOn 1G5VA 2XIDA 3MEVA 1VQ4A 3M5AA 4IKFA 2CGHA 4DOWA 2A7YA 1WPYA 5GMKl 2QEXT 4Z02A 4M7DC 2EKOA 4TVRA 4JRPA 4JUVA 2QQAA 3MP8A 1W2BS 1UB4A 3QDRB 1UGPB 4QQGA 2XG8D 5CKBA 5GANh 5I21A 4CRIA 3CC7T 1FX7A 4C0DB 1YJ9T 3SWNC 1YJWA 4M7DF 5DLOA 2VYTA 1WGSA 3QYGB 3S3NA 2Y4XA 5CVIA 4DOVA 2QA4T 1XNIA 3G7ZA 1P92A 1YI2A 4M7AG 3RMSA 3M4GA 2ZCFB 2RB6A 4JJNK 3META 4R56A 3M9QA 5AYFA 3RERA 3CXCS 3X26B 1FXXA 1W4SA 3GLXA 1M1KC 3QJ6A 3OMCA 2CS7A 3EFRA 2EJ9A 4C8QE 3CBOA 3MEUA 5GAN3 2LTOA 3I56A 3E19A 5LJ3g 2KQWA 4X9DA 2M16A 4KUDK 4FL6A 2R5AA 2QQBA 2RO0A 1YHQT 3SB2A 4J6XA 2V8JA 5GAOp 4R55A 3A8LB 3CMET 1OZ2A 2P0QA 5J39A 1UEBA 4A4GA 3ASKA 3L42A 1YCYA 5GAOl 5FRNA 3A8OB 1Y07A 2EQMA 1ZQ1A 1QW1A 3MEAA 3S3MA 2RHIA 1IZ6A 2LX9A 3M56A 4LDYA 2HNIA 1G3WA 2CZ0B 4XU2A 5DLQE 3L2UA 5J26A 3VYHB 1LJOA 5GANf 3DLMA 1NJIC 2VXEA 1N8RU 4BACA 2WSFE 1RL2A 3MEWA 5LJ5h 1VQ6T 3MHXA 5KE3A 4UC4A 3OYFA 3OYEA 1K73U 5GAMd 4OB2B 2VXFA 1HK9A 3HHTB 3GPLA 4BE1A 1BKBA 1KQSA 2D6FA 2RJFA 2QEXA 5M9OA 1QVFA 2RI5A 3OSVA 1M4ZA 3OYIA 1AHJB 1WQ7A 2H3JA 1IREB 3QZ5B 2ZZDA 4BY6B 5GAN4 4II1A 2E12A 4M78B 5CIUA 4C92C 4ZGDB 4ZN3A 5GMKm 2DZCA 1YJ9A 1JBMA 3P8BB 4M78E 4LD9K 2PQWA 3OS5A 2QQ9A 2V8IA 1D3BB 4J6YA 3OYNA 3JCMW 1M9SA 2V8KA 2MI6A 4C5EA 4PJOG 4M75C 3JCMP 4M77B 4C92D 3CCET 4BUGA 1Q86C 5FLXE 1I8FA 3URGA 3PMIA 3OY9A 1VIEA 2X4XA 1X6OA 1BYMA 3HRTA 1NZ9A 3LWIA 3L2VA 3JB9G 3WVEB 5LJ3e 3JCMb 4EMKC 1WJSA 5GMKh 1FWZA 4M75D 3CCRT 3X28B 3F70A 1QVPA 2A3LA 3LLRA 3CMEA 4QQDA 3X24B 4OF1A 3QSUA 3G6ET 2P0KA 3FB9A 2R58A 4L59A 3E9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUI A;  3L2Z A;  3V8J A;  2RM4 A;  4M75 G;  4M77 D;  3SWN A;  4XTV A;  4M75 E;  3JCM X;  3JB9 F;  2YHT A;  2Y90 A;  3RES A;  3BY7 A;  2I2L A;  1JRI A;  3EFS A;  1HXD A;  3VU3 C;  4C8Q B;  4C92 F;  4F7U F;  4M7D C;  4M7D B;  1BIA A;  1N9R A;  2RA2 A;  4PNO A;  2FYK A;  3BDU A;  2EWN A;  4XU1 A;  3V7R A;  5GAO m;  5GAO r;  1Y96 A;  4M7D E;  4XU3 A;  2DTH A;  3JCM h;  1M5Q 1;  2DKG A;  3JCM g;  4M77 G;  5GAM e;  5LJ5 e;  3JCM c;  5GAN 5;  5GAO n;  4M77 E;  3JCM J;  1WQW A;  3HFO A;  2DEQ A;  3SWN B;  1BIB A;  2CGH A;  4C8Q C;  3BFM A;  1WPY A;  2E10 A;  3RKW A;  5GMK l;  4OP0 A;  3JCM d;  4M75 F;  4M7A F;  1I4K 1;  4M7A D;  4JUV A;  4DQ2 A;  5LJ5 j;  5GAM j;  1Y96 B;  5GAN h;  5GAN g;  5I21 A;  1I5L A;  3SWN C;  4X9C A;  4M7D F;  4M7D D;  5GAN d;  4MML A;  3RKX A;  4XTW A;  4C8Q D;  3JB9 I;  3JB9 J;  4NOY A;  3FIF A;  4J6W A;  4M7A G;  4M7A E;  3M4G A;  2DTI A;  2RB6 A;  4JRK A;  3RER A;  4NL2 A;  3INZ A;  4C8Q G;  4M7D G;  3V8L A;  1N9S A;  3EFR A;  4WF2 A;  2EJ9 A;  4C8Q E;  5GAN 3;  4RCB A;  5LJ3 h;  5LJ3 g;  4X9D A;  4HT9 A;  2DXU A;  4PJO A;  4QVD A;  4XTU A;  5LJ3 d;  3QHS A;  4A54 A;  5GAO q;  5GMK e;  3JCM V;  3SB2 A;  4J6X A;  5GAO p;  1B34 A;  3V8K A;  2DZ9 A;  4N0A A;  3JCM f;  2RD1 A;  3FJP A;  1LNX A;  5LJ3 f;  1YCY A;  4C8Q F;  5GAO l;  4C92 A;  4HT8 A;  4PJO B;  4A53 A;  5GMK j;  4XQ3 A;  5GAN 8;  4HA8 A;  2DXT A;  2HNI A;  3QO3 A;  1KQ2 A;  4XU2 A;  5DY9 A;  3HSB A;  1LJO A;  1H64 1;  3RIR A;  5GAN f;  3V7S A;  5CAI A;  2VXE A;  5GAM h;  4RCC A;  4M78 A;  5LJ5 h;  5LJ5 g;  2EAY A;  5GAM g;  3JB9 H;  2VC8 A;  3QSU A;  4M75 A;  4PJO C;  1TH7 A;  5GAN j;  5GAM d;  5LJ5 d;  2VXF A;  1HK9 A;  4M78 D;  4Y91 A;  5GAN 7;  1MGQ A;  2EJG A;  1D3B A;  2DVE A;  2E64 A;  4JRI A;  4N0A C;  4EMH A;  1WQ7 A;  5GAN 4;  2YLB A;  5LJ5 f;  4M78 B;  5GMK i;  2YLC A;  3L1A A;  4JLI A;  4M77 A;  2K57 A;  4C92 C;  4EMK A;  4PJO D;  4MMK A;  5GMK m;  2DZC A;  3JCM Q;  4XTY A;  3HFN A;  1JBM A;  4M78 E;  4XTZ A;  4V2S A;  3RKY A;  3BW1 A;  1M8V A;  4F7U A;  2E1H A;  1I81 A;  1D3B B;  2JN0 A;  4J6Y A;  5GAN 6;  3JB9 D;  4M78 C;  3JCM W;  4PJO G;  4M75 C;  3JCM P;  4M77 B;  4C92 D;  4EMK B;  3GIB A;  4PJO E;  1B34 B;  1I8F A;  2QTX A;  2E65 A;  4M7A A;  3AHU A;  2FB7 A;  4F7U B;  2E41 A;  1LOJ A;  4M78 F;  4C92 B;  3JB9 G;  3JCM e;  4XTX A;  4EMG A;  5LJ3 e;  4M78 G;  4F7U G;  3JCM b;  4NL3 A;  3PGG A;  1KQ1 A;  4M77 C;  4C92 G;  4EMK C;  3V7C A;  4M75 D;  4C92 E;  4F7U E;  1X01 A;  5GMK h;  5GAN 2;  4C8Q A;  2DJZ A;  4M7D A;  4M7A C;  2DTO A;  5GAM f;  2EJF A;  4PJO F;  1U1T A;  4M7A B;  3RUX A;  5LJ3 j;  4M75 B;  5GAN e;  4J5Y A;  2ZGW A;  3FB9 A;  1U1S A;  4M77 F;  1WNL A;  4QVC A;  4XU0 A; 
#chains in the Genus database with same CATH topology
 3QUI A;  2BKD N;  2CP0 A;  2EWN A;  2DKG A;  2QXF A;  3SWN B;  4C5G A;  1GXI E;  1RAG B;  2CH4 A;  2GCX A;  3RKW A;  1NEG A;  5CQX A;  4RTY A;  1BI1 A;  2DL7 A;  3GNF B;  3PFS A;  4DQ2 A;  4QQ6 A;  2YWW A;  2J06 A;  1OX8 A;  3GP8 A;  4ELY C;  3UWN A;  3DB3 A;  3JB9 I;  5KE2 A;  3QKJ A;  1KC8 U;  3VS4 A;  3CCQ T;  4F14 A;  3ZEH A;  1Y7X A;  5KCH A;  3JRZ A;  4QW2 A;  2E3H A;  3S6W A;  1IXD A;  3OYA A;  1WIE A;  2JW4 A;  2DL3 A;  2O4X B;  1JJ2 S;  4GY5 A;  1WYX A;  2PTK A;  4N0A A;  5HY6 A;  3OYK A;  1T3S A;  4RG2 A;  3UDC A;  2RI2 A;  2MPX C;  3G6E A;  5FWB A;  2X35 A;  5GMK j;  2CZ1 B;  1UFF A;  4DEX A;  2CP5 A;  2BUD A;  2LT1 A;  5CKH A;  4AG1 C;  3JB9 H;  2EYZ A;  2IG0 A;  2QK0 A;  1OV3 A;  2NUP B;  3CCE Q;  1RUW A;  2COW A;  2E64 A;  2LZ6 B;  3H0I A;  1M1K U;  4M77 A;  3PTA A;  2H8H A;  2W10 A;  2COZ A;  1VQN A;  3CCS T;  2EQK A;  2JXB A;  2CDT A;  1BBZ A;  3M55 A;  2XI9 A;  4XK8 E;  1Z9Q A;  3AHU A;  3PNW C;  3E2U A;  4F7U E;  1KG1 A;  1G3T A;  1WHM A;  4E47 A;  1N8R C;  2MAM A;  1U1T A;  4DBF A;  4J5Y A;  2JTF A;  4FYW B;  3SWN A;  1JO8 A;  3BY7 A;  5IH2 A;  3CCU T;  4C0G A;  3SEM A;  2X4Y A;  1GBQ A;  1D1A A;  1BIB A;  1K8A U;  2OAW A;  4BB7 A;  3SD4 A;  2IIM A;  2P4R A;  2DER A;  2FRY A;  2CYZ B;  2JMC A;  1VQK A;  2K6D A;  5GAN d;  3OYL A;  2RHU A;  4XTW A;  1LCK A;  2LVM A;  2O4X A;  4ZGE B;  3M58 A;  1JJ2 A;  3L2R A;  1W2B A;  5FU7 B;  1XJW B;  2LQW A;  4IUU A;  3MP6 A;  1R0C B;  2KXD A;  4N4I A;  4HCK A;  1U3O A;  2YXY A;  1Q81 C;  1MND A;  4OB1 B;  5GMK e;  2FVU A;  1B34 A;  1SEM A;  2RD1 A;  4C5H A;  1LNX A;  1UHC A;  3TEE A;  4IIO A;  2JT4 A;  2JOY A;  4N4G A;  2NUP A;  1QVF S;  4R0K A;  1H64 1;  1G3Y A;  1UEC A;  1WHL A;  2E3I A;  2K7A A;  2RJC A;  3A98 A;  3QZ9 B;  1ZA2 B;  3C4S A;  1KC8 C;  2F5T X;  3EG0 A;  4HVW A;  1H3Z A;  4D6W A;  2RHZ A;  4CC3 A;  1V29 B;  4AFZ C;  1ZUU A;  3CD6 T;  1YJN T;  1CKB A;  3P8D A;  1QKW A;  1QP2 A;  2LMJ A;  3GIB A;  3G4S A;  4A4H A;  5KYX B;  1R8O B;  4IUQ A;  2FB7 A;  2DBK A;  5C6S A;  1QVF P;  3CCV T;  4PFO A;  1KSW A;  1T0J A;  4PFP A;  3TVT A;  4C92 E;  4AFQ C;  2OTL A;  3CC2 T;  4PJO F;  3CPF A;  2PZ1 A;  4IUV A;  3RUX A;  2EBP A;  1VQ5 Q;  2ZGW A;  5FU6 C;  2KDS A;  4M75 E;  2RN8 A;  3VS1 A;  2YUP A;  2G6F X;  1PKS A;  4C8Q B;  4XU1 A;  2NUZ A;  2FO0 A;  3KBG A;  2AIR B;  3OYG A;  1NLO C;  3MP1 A;  1VQO Q;  3JCM d;  2DVJ A;  3O5Z A;  3P8H A;  1YIJ A;  1VQ9 A;  1ZBX A;  1MMG A;  3M53 A;  1KHC A;  2X4W A;  4RUG A;  1B3Q A;  1N6A A;  2E70 A;  3OSS C;  1D1B A;  5IHK A;  2HKQ B;  3INZ A;  1Z9Z A;  3RBB B;  3FRN A;  2VUB A;  2RHY A;  5J3B A;  3GOX A;  5LJ3 h;  1D1C A;  1PSE A;  4O6J A;  2LCS A;  2CP6 A;  2XKO C;  1Q86 U;  3CC7 A;  1I07 A;  1X2Q A;  3HL8 A;  3ER0 A;  4RTX A;  5EG2 A;  1QVG A;  4HT8 A;  1IB8 A;  2F69 A;  2FPE A;  2KRS A;  1K8A C;  2MMP A;  3VRY A;  1OPK A;  2K79 A;  2OTJ Q;  2GFA A;  1VQ4 T;  4J83 A;  1MGQ A;  3I55 A;  1X27 A;  3M0R A;  5L8R E;  1XOV A;  1GCQ C;  3M4Y A;  1M1K R;  2JUF A;  1WA7 A;  2YUO A;  3OS1 A;  2HAX A;  4MMK A;  1GRI A;  3TSZ A;  3CC4 Q;  4WCI A;  4XTY A;  2D0Q B;  5KYX A;  2XDD A;  1YI2 T;  4B9W A;  5A2Q E;  1YP5 A;  3CCM A;  2Y4Y A;  3Q1J A;  2E6Z A;  2QTX A;  3EH2 A;  2CUD A;  2HCK A;  4LDV A;  2ZPH B;  1NJI C;  1YBY A;  2DO3 A;  2QAS A;  3LX7 A;  1MV3 A;  2FRW A;  3OS2 A;  2DE0 X;  1Y0M A;  2KY9 A;  4C8Q A;  4ZTF A;  5KYU B;  5I22 A;  1QCF A;  1QMC A;  1VQ8 A;  2VVK A;  1TS9 A;  2DYI A;  3HP9 A;  1UE9 A;  1JXO A;  3V7R A;  2BIV A;  2XU8 A;  2NLU A;  4DOW A;  5GMK l;  2QEX T;  4JRP A;  4JUV A;  1UB4 A;  5CKB A;  3CC7 T;  1FX7 A;  1VQL Q;  4M7D F;  5I11 A;  3S3N A;  5CVI A;  1XNI A;  3G7Z A;  1P92 A;  4M7A G;  3RMS A;  1X69 A;  1AEY A;  2ZCF B;  3M9Q A;  5AYF A;  3RER A;  3VS6 A;  1AWJ A;  3EFR A;  2EJ9 A;  5GAN 3;  2LTO A;  4E6R A;  3I56 A;  3E19 A;  5LJ3 g;  2JS2 A;  2M16 A;  1TWB A;  1G2B A;  2A37 A;  4KUD K;  3CMA Q;  2R5A A;  2QQB A;  2CRE A;  3SB2 A;  1TUG B;  2V8J A;  4R55 A;  3QWY A;  3L42 A;  1YCY A;  3A8O B;  1Y07 A;  1ZQ1 A;  1QW1 A;  1SRL A;  1BCM A;  3S3M A;  2LX9 A;  1YJW Q;  2HNI A;  2CZ0 B;  2EPD A;  1MNE A;  4KH1 B;  2OI3 A;  5GAN f;  1N5Z A;  3MEW A;  5LJ5 h;  3OYE A;  1KQS A;  4J9H A;  2IPO B;  1TUD A;  1TXQ A;  3OYI A;  1IRE B;  2NWM A;  2ROL A;  4GBQ A;  4ZGD B;  1V76 A;  4J6Y A;  3OYN A;  3M0P A;  2V8K A;  2CSQ A;  2VKN A;  4PJO G;  4C92 D;  1Q86 C;  3URG A;  5KYU A;  3OY9 A;  2QGF B;  3HRT A;  1NZ9 A;  3LWI A;  1ZSG A;  4M75 D;  1QCO A;  3TQ7 P;  3F70 A;  1NLP C;  1QVP A;  1WHH A;  2ROT A;  3LLR A;  3CME A;  4QQD A;  3FB9 A;  4RCC A;  1D0X A;  3V8J A;  3C94 A;  2RM4 A;  2HL3 A;  4KRT A;  3M57 A;  1YJ9 Q;  1SG5 A;  2O2O A;  4M7D B;  1X75 C;  1BIA A;  4M7A C;  2F5K A;  4XU3 A;  2DTH A;  2HD0 A;  2QDY B;  3OBW A;  3HFO A;  4FIB A;  3BFM A;  1WJQ A;  4JS4 A;  1Y96 B;  5A0L A;  1I5L A;  4X9C A;  5CO7 A;  3H6Z A;  3FDR A;  3JB9 J;  1YHQ Q;  1M3C A;  2DTI A;  3CBP A;  2HL5 C;  4J9I A;  4LD6 A;  1K0X A;  4GLM A;  4J7F A;  2J6O A;  5CKD A;  4J9D A;  4EPC A;  3FEO A;  4JJB A;  1T3L A;  3JAM E;  2X3W D;  2DK3 A;  5FRO A;  2ED0 A;  3QHS A;  3CCR A;  3JCM V;  1Q86 R;  3QBY A;  2ZPF B;  3ZL7 C;  3V8K A;  3JCM f;  4OMP A;  1M30 A;  5FW9 A;  4FU6 A;  3NHN A;  3X25 B;  5CKE A;  5GAN 8;  3GF5 A;  4Y28 E;  1NPP A;  3CPW A;  5LJ5 g;  4PJO C;  2X3X D;  2RQR A;  1KD1 U;  1O9S A;  1ZSZ C;  2EJG A;  2HBW A;  1R77 A;  3L2Q A;  1IGQ A;  4FT2 A;  2ENM A;  2E1H A;  1E7O A;  2HSP A;  2HKN A;  4X1V A;  3JB9 D;  1ABO A;  2L8D A;  1NYG A;  3G6E Q;  3CCQ A;  4EMK B;  2DAQ A;  3EG3 A;  4HCC A;  4E2F B;  2PNI A;  4XTX A;  2VAS A;  1VOM A;  4BDY A;  3V7C A;  1MMD A;  1SHF A;  4M7D A;  2GF7 A;  4OMM A;  2E6N A;  3OYC A;  3OYD A;  1OOT A;  1OI1 A;  4XU0 A;  1QCN A;  3OYJ A;  3OB9 A;  2K2V A;  3LH0 A;  4KUI A;  1N9R A;  2CKK A;  4PNO A;  3BDU A;  1Y96 A;  2LP5 A;  1VA7 A;  3AT1 B;  1VQN Q;  1WQW A;  1PG5 B;  1I4K 1;  2M51 A;  1AVZ C;  5D6W A;  2DJQ A;  5EC7 A;  1PRM C;  2J05 A;  3FIF A;  1NG2 A;  4OMQ A;  1PM3 A;  2WSE E;  4JRK A;  3M59 A;  3CCS A;  2J6F A;  1GFD A;  2QQS A;  2NYS A;  1BI0 A;  2YUN A;  1B7T A;  3OYH A;  2AKK A;  3SHW A;  2JTE A;  3MKD A;  3ZFJ A;  4PLL A;  5GAO q;  4QT7 A;  4KH0 B;  3CXC A;  4LDX A;  1D0Z A;  2DIL A;  4E7L A;  5LJ3 f;  2DIG A;  4LNP A;  4HA8 A;  2P4T A;  1WHK A;  3CBM A;  4OGC A;  4AMC A;  3TRE A;  2KEA A;  3CCU A;  5GAM h;  2VC8 A;  1X2K A;  4FT4 A;  2BTT A;  1PRL C;  1VYT A;  3PVQ A;  1ZHI A;  1H8K A;  4HXJ A;  1VQP T;  3CCL T;  4EMK A;  4FM4 B;  2H3E B;  2O9V A;  2E5K A;  2DF6 A;  3HFN A;  2K5L A;  1UJ0 A;  3RKY A;  5CK9 A;  2GTJ A;  1I81 A;  1S72 T;  2O31 A;  2KVQ G;  2RNA A;  3EGX A;  2QDL A;  4IIM A;  1NM7 A;  4JDS A;  1B34 B;  3E1S A;  2OJ2 A;  2LDM A;  4N4H A;  4MZP A;  4IUR A;  1KQ1 A;  3JCM Q;  2LQ8 A;  2LCC A;  3PMT A;  5C0M A;  5FRM A;  4LE9 A;  2DJZ A;  4Z88 A;  4QKU A;  3S3O A;  3C12 A;  3EHR A;  2FEI A;  5I2M A;  1IGU A;  4LUE A;  4XTV A;  1KD1 C;  2HZY A;  1AWW A;  5ECA A;  3CCJ T;  2RH2 A;  4M77 G;  4BE0 A;  3JCM J;  4OMO A;  3G4S Q;  3PT9 A;  2AT1 B;  5I2S A;  1B07 A;  1JEG A;  2PVG B;  4A4F A;  3HRU A;  2OTL Q;  3ME9 A;  4J6W A;  3A8G B;  5D6X A;  4M7A E;  3R6N A;  3CD6 A;  1YJN A;  4C0D C;  2GQI A;  4A4K A;  4NL2 A;  2CH4 W;  3NGP A;  1HD3 A;  1E6H A;  2XHC A;  1PNJ A;  1YIT T;  3CCV A;  4DEY A;  2EQI A;  2KRO A;  1YFN A;  2RK2 A;  2K2M A;  2L3P A;  3G71 Q;  2BE9 B;  2CP3 A;  3CC2 A;  1XQH A;  2RMO A;  3FJP A;  3HPW A;  1VQ9 Q;  1YIJ Q;  4C8Q F;  2ABL A;  4JLG A;  2A28 A;  4A53 A;  1YCS B;  3A8M B;  5CR2 A;  4FSS A;  1KQ2 A;  1PCX A;  3V7S A;  3RMQ A;  3RR6 A;  5GAM g;  2DRM A;  1C0M A;  4Z8A A;  2K9G A;  3VRZ A;  4FSX A;  1KD1 R;  2L3R A;  3OA6 A;  4N0A C;  4EMH A;  1VQM Q;  5LJ5 f;  4P5N A;  2YLC A;  3EGD B;  2K57 A;  3OMG A;  4KT0 E;  3MCA B;  1VQ7 Q;  3RDV A;  3OQ5 A;  1MMA A;  4KBM B;  2KSS A;  4BY6 C;  1KFZ A;  2C0T A;  5KYN A;  1NPR A;  4PJO E;  2HQX A;  2JTM A;  1WHG A;  1NBE B;  4YTL A;  2E41 A;  1LOJ A;  2RI3 A;  4M78 F;  4MDW A;  3HTR A;  1Y71 A;  2I0N A;  4RMO A;  1RAF B;  1SSF A;  3C0C A;  4OVA A;  4M77 C;  3DLL A;  2V1Q A;  4KGZ B;  3I55 Q;  3DB4 A;  1S1N A;  1TU0 B;  1YWO A;  5GMK i;  1K9M U;  1ZUK A;  4EDU A;  3VU3 C;  3MJX A;  3CCE A;  4RTV A;  4NS5 A;  3CCM Q;  3BE3 A;  1AZG B;  2KXC A;  1G5V A;  3MEV A;  1WI7 A;  1VQ4 A;  3M5A A;  4IKF A;  1WPY A;  2EKO A;  4OML A;  3QDR B;  4QQG A;  4CRI A;  2MK5 A;  3SWN C;  5DLO A;  2VYT A;  2Y4X A;  1WZO A;  1YI2 A;  2JS0 A;  3M4G A;  4R56 A;  1VQ8 Q;  1YN8 A;  2CUB A;  1FXX A;  3RNJ A;  1C1A A;  1W4S A;  3GLX A;  1M1K C;  2BZ8 A;  3MEU A;  2KQW A;  4X9D A;  5GAO p;  3A8L B;  5FWC A;  2P0Q A;  4A4G A;  2YRD A;  3ASK A;  3MEA A;  3M56 A;  4LDY A;  1GBR A;  1YNZ A;  4XU2 A;  3L2U A;  4AT1 B;  3VYH B;  3M0U A;  2VXE A;  2WSF E;  1RL2 A;  3EGD A;  1K73 U;  2VXF A;  3HHT B;  1BKB A;  2D6F A;  1OEB A;  2ZAE A;  1W6X A;  2QEX A;  1QVF A;  1AHJ B;  1WQ7 A;  5GAN 4;  2ZZD A;  3I56 Q;  1GFC A;  4M78 B;  2HSE B;  4ZN3 A;  1AOJ A;  5AT1 B;  4LD9 K;  2YUQ A;  1AZE A;  2PQW A;  3VS7 A;  3OS5 A;  2DLP A;  2QQ9 A;  2V8I A;  1D3B B;  3JCM W;  2KT8 A;  2D1X A;  3CCE T;  2FG0 A;  1ACM B;  2LJ0 A;  5KYY B;  1VIE A;  1X6O A;  3L2V A;  1TTH B;  3WVE B;  5GMK h;  1FWZ A;  1BCO A;  2QGG A;  4F16 A;  1U06 A;  1K4U S;  1UJY A;  2A3L A;  4OF1 A;  2P0K A;  1Q7Y U;  1HXD A;  1UGQ B;  4CC4 B;  5GAO m;  2QA4 Q;  4E7H A;  2J6K A;  1MV0 B;  2HQE A;  3CQT A;  3LGL A;  4M7D E;  4HCZ A;  1QQJ A;  2EQJ A;  1N27 A;  4M7A D;  2LC4 A;  3QJY A;  4PJL A;  1X6B A;  4DBQ A;  3J80 E;  2IVW A;  1M1F A;  2QTV A;  1T0H A;  3OYM A;  3CME Q;  4E7J A;  4DA4 A;  4B6M A;  2MYS A;  4C8Q G;  1M2V B;  3VJP A;  1ZBJ A;  4AG2 C;  5HK0 A;  2GFU A;  4HT9 A;  1IRX A;  1K9M C;  4QVD A;  1VQ6 Q;  1M90 U;  5FU7 C;  5LJ3 d;  4A54 A;  2YT6 A;  1IHV A;  2MWO A;  2KMT A;  1OPL A;  2M1H A;  4RTT A;  4HVU A;  1UGR B;  2DD5 A;  1WXB A;  2D8H A;  2J7I A;  2DXT A;  1SKU B;  4RTZ A;  5IN1 A;  3L2W A;  3UA6 A;  3RIR A;  5CAI A;  3TU4 K;  4ZTJ A;  1X6G A;  3OW2 P;  4M78 A;  3HKS A;  3NTK A;  2MCN A;  3CEY A;  2CT3 A;  2Z0W A;  2ZPB B;  1D3B A;  4ME7 A;  4PJJ A;  3EGU A;  1F1B B;  2OX7 A;  2DM1 A;  2K3X A;  3U23 A;  4PJO D;  2L89 A;  2KAF A;  4XTZ A;  5KYY A;  3CCR Q;  2KNB B;  3WVD B;  4ESR A;  1MHN A;  3N5B B;  2RPN A;  4FYV B;  1SHG A;  1U8R A;  2FPF A;  1G3S A;  2DBM A;  2AHJ B;  2X4J A;  2HQH A;  4LDW A;  2P84 A;  1RLQ C;  2CT4 A;  2ATC B;  3PGG A;  3SDZ A;  1WJR A;  3REA B;  1UUE A;  1RAI B;  1ARK A;  1K9M R;  5IHI A;  2LCL A;  5GAN j;  2D9T A;  3WXM B;  1KHI A;  1HSQ A;  3JCM c;  3CCQ Q;  4M77 E;  3A1P A;  4C8Q C;  4XAX B;  2MWP A;  2E10 A;  1VQ5 T;  2AZS A;  4ORZ A;  3PIP A;  4Q5W A;  2B8A A;  1M2V A;  3OYB A;  1HYO A;  2B86 A;  3NPF A;  5IHN A;  4Y92 A;  4FYX B;  4FCY A;  1Q82 U;  4VUB A;  2GBQ A;  1VQO T;  5GJV B;  4M4Z A;  2COY A;  3GBQ A;  1PSF A;  2VB6 A;  2HMA A;  3UPU A;  1KIK A;  4BI8 B;  2DEU A;  2E4H A;  5CCA A;  3KUF A;  2EW3 A;  2M02 A;  4C92 A;  7AT1 B;  4A63 B;  1OX9 A;  1CKA A;  3THK A;  2EAY A;  1QLY A;  4M75 A;  3VUZ A;  1K73 R;  2DX1 A;  5LJ5 d;  4Y91 A;  3CCS Q;  2LX7 A;  3HRS A;  2A0F B;  2DA9 A;  2RJE A;  1TUC A;  1WXT A;  3NFC A;  3LYI A;  4V2S A;  3BW1 A;  5HCK A;  2JN0 A;  2OTJ T;  3DKM A;  2GGR A;  4MZT A;  1RAB B;  2VV5 A;  4O5V A;  2EIF A;  3VS0 A;  2BZX A;  2PVD B;  3CCU Q;  2XIC A;  2DL8 A;  3CC4 T;  1RI0 A;  2K4Y A;  4LUD A;  4B9X A;  3G1J A;  1O75 A;  5GAN e;  4M7D D;  3EG2 A;  3L2Z A;  1Q7Y R;  1M2O A;  2MOX A;  2LT4 A;  2YHT A;  2Y90 A;  2D0N A;  2FL7 A;  1JRI A;  1PC0 A;  2JM9 A;  1JB0 E;  1EIF A;  3PIO A;  2WSC E;  4JPB W;  3H41 A;  2K3B A;  2FZK B;  2XK0 A;  3C95 A;  2P0P A;  3EGX B;  1A0N B;  1VQP A;  3CCL A;  2L2P A;  1MMN A;  2DL4 A;  1OZ3 A;  2M9U A;  3R6O A;  1S72 A;  1RAE B;  1RI9 A;  1PD0 A;  1JQQ A;  3FC3 A;  3UF4 A;  4M7D G;  3V8L A;  1N9S A;  4WF2 A;  3UAT A;  2G3R A;  1OQK A;  1SSH A;  2DXU A;  1VQL T;  3ULR B;  1MUZ A;  2DXC A;  4XTU A;  1M90 R;  2RQU A;  2EYQ A;  1G8X A;  2F2X A;  2ZPE B;  3OYY A;  1ZUY A;  2DZ9 A;  1I0C A;  3QII A;  2CP7 A;  2KRN A;  1UHF A;  5LL6 S;  4LDU A;  1HJD A;  3QG1 A;  3QO3 A;  4J9C A;  1SRM A;  1M27 C;  1RAA B;  3ZBD A;  3CCJ A;  3CMA T;  3CD6 Q;  1YJN Q;  1TH7 A;  2LNH B;  2GQV A;  5DM7 R;  2A08 A;  2CSI A;  4CC2 A;  2DIQ A;  4JRI A;  1YHQ A;  2YLB A;  4WTO B;  4C5I A;  1Q82 C;  3CCV Q;  4JLI A;  1YJW T;  1OYX A;  1AWO A;  3VS2 A;  1Q81 U;  1AD5 A;  1FYN A;  3M0S A;  3CC2 Q;  1ZA1 B;  4CI0 C;  1VQK Q;  5HKC A;  2O01 E;  4AFU C;  2L5Q A;  4RG8 A;  1M3A A;  3M54 A;  3JCM e;  9ATC B;  1YIT A;  4ZN1 A;  2DRK A;  3BDL A;  2K5F A;  2E5Q A;  4KGX B;  5FU6 B;  5D6Y A;  4PJN A;  2RHX A;  3A8H B;  5LJ3 j;  2EFI A;  1WNL A;  1OUL A;  4M77 D;  1NE8 A;  2I2L A;  3EFS A;  1LPL A;  2XMF A;  5GAO r;  2K3Y A;  1IHW A;  2DL5 A;  1H3H A;  4M7D C;  2A7Y A;  4Z02 A;  2KYM A;  1W2B S;  5GAN h;  5I21 A;  1EZZ B;  5IXB A;  1YJ9 T;  1D09 B;  3QYG B;  1OU8 A;  2FPD A;  4J9E A;  1UG1 A;  1TOV A;  2RB6 A;  4JJN K;  3MET A;  4JZ4 A;  2KYB A;  1Q82 R;  2AKL A;  4C8Q E;  3PE0 A;  4FL6 A;  1YHQ T;  1VQ4 Q;  1OZ2 A;  5J39 A;  5FRN A;  2EQM A;  4RTW A;  2KBT A;  1RAC B;  2RQW A;  1JJ2 P;  1W2B P;  1QKX A;  1LJO A;  5L23 A;  1YI2 Q;  4BAC A;  4RTU A;  1WX6 A;  3MHX A;  4FW2 A;  5KE3 A;  2DYB A;  4UC4 A;  4J9B A;  5GAM d;  4BE1 A;  3GPL A;  2RJF A;  3QDF A;  1FMW A;  2KI7 A;  3OSV A;  1M4Z A;  2QAZ A;  2E12 A;  4F17 A;  5GMK m;  2DZC A;  3P8B B;  2DMO A;  4M78 E;  4PFZ A;  1M9S A;  2MI6 A;  3NMZ C;  2DFU A;  3JCM P;  4BUG A;  1I8F A;  1TG0 A;  3PMI A;  2X4X A;  2EYX A;  1AWX A;  4JJC A;  5LJ3 e;  3QWX X;  4EMK C;  1GCP A;  2D8J A;  3X28 B;  3EH1 A;  2QEX Q;  3G6E T;  1U1S A;  4L59 A;  4OGE A;  1OU9 A;  3JCM X;  3CC7 Q;  3RES A;  2DD4 A;  4F7U F;  2KK4 A;  3M0T A;  2LQN A;  2LJ3 A;  1PD1 A;  4EIK A;  2AK5 A;  3JCM h;  2EYW A;  1BI3 A;  2MIO A;  2ESW A;  5CQY A;  4AFS C;  4PJM A;  4PK4 A;  4ELZ C;  4M7A F;  1V1C A;  1X43 A;  3TSW A;  4QVZ A;  1SPK A;  2DXB A;  5LJ5 j;  3J7A F;  3IQL A;  5GAN g;  4JZ3 A;  5GJW B;  1NJI U;  1WLP B;  4MML A;  4PKC C;  2CZ7 B;  1ZX6 A;  1EFN A;  3QXE B;  5IXF A;  1VQN T;  1N8R R;  2JJ9 A;  2W0Z A;  1QVG S;  2NUT B;  4RCB A;  2RQT A;  2YRC A;  1ABQ A;  4ANJ A;  4LN2 A;  4FYY B;  1UDL A;  5CKF A;  4BD3 A;  1R0B G;  4BI4 A;  1GCQ A;  1JU5 C;  1FMV A;  3JV3 A;  3I9Q A;  4XQ3 A;  3HSB A;  3LW5 E;  2JM8 A;  2OAU A;  1UGS B;  1I5O B;  3UT1 A;  4HKE A;  2KT1 A;  2A36 A;  2F2W A;  2DVE A;  3REB B;  2C06 A;  3L1A A;  1QVG P;  2K5I A;  1VQK T;  2DNU A;  2FZC B;  1M8V A;  3T9N A;  1Q81 R;  5GAN 6;  1VUB A;  1U5S A;  4J7I A;  1UTI A;  1NYF A;  4MZM A;  2QG9 B;  4F7U B;  3G71 A;  1K0S A;  3MO8 A;  4EMG A;  2LJ1 A;  3VYG A;  4NL3 A;  1PHT A;  1X01 A;  1WDX A;  5GAN 2;  2EJF A;  2GTO A;  4M7A B;  3GNG A;  3I5R A;  2O88 A;  1GL5 A;  1G83 A;  1KC8 R;  5KYW B;  4IUT A;  3E9G A;  4C92 F;  5HK3 A;  1VIF A;  2RA2 A;  5IAY A;  1VQM A;  5LJ5 e;  1K76 A;  3JCM g;  2KRM A;  2XDB A;  4D8D A;  4M75 F;  1VQ7 A;  1WXU A;  2QQR A;  1DJ7 B;  4ZNX A;  3J81 E;  3RKX A;  4C8Q D;  2NUT A;  3X20 B;  1IO6 A;  4OB3 B;  1BI2 A;  3G4S T;  2VWF A;  2QYZ A;  2LNV A;  1QP3 A;  2FZG B;  4OMN A;  1K9A A;  1BB9 A;  2F1L A;  2GNC A;  2C0O A;  6AT1 B;  2OTL T;  3VUB A;  3MPU B;  3JSC A;  3EAE A;  4J9F A;  1M1G A;  2VGN A;  3O8V A;  2KGT A;  3OW2 S;  1KQS S;  1JXM A;  3SFM A;  4PJO B;  2PUO B;  4FW1 A;  2R5M A;  2EGA A;  2L3Q A;  3KFV A;  2RQV A;  2CZ6 B;  2ZPG B;  5DY9 A;  2V26 A;  4BE2 A;  1KJW A;  1ZSZ B;  2KE9 A;  4MDX A;  3H0H A;  2JVV A;  2HBP A;  2XD0 A;  2SEM A;  5KCO A;  1K1Z A;  4ZGJ B;  3G71 T;  3TCJ A;  4M78 D;  2L0A A;  2YDL A;  5A0G A;  1VQ9 T;  1YIJ T;  4E7S A;  1VQ5 A;  1C6V X;  4J8O A;  2CP2 A;  1FMK A;  2PVO B;  3VKI A;  4E7K A;  3NTH A;  3QYH B;  1RLP C;  4F7U A;  2BZY A;  3FLG A;  4KUL A;  8ATC B;  2EVR A;  2WAC A;  2DPP B;  2JNG A;  1VQO A;  2PUK B;  1LVK A;  2FHD A;  1KQS P;  1VQM T;  2HDA A;  4M7A A;  4BDZ A;  4C92 B;  3OBY A;  4C0Z A;  3QPH A;  4F7U G;  1K8A R;  5KYW A;  1VQ7 T;  4D8K A;  2DTO A;  5GAM f;  1E6G A;  4KGV B;  1VYV A;  2V1R A;  2ED1 A;  4M75 B;  3EHQ A;  3H0F A;  4QVC A;  3EG1 A;  4HCB A;  4M78 G;  1Y57 A;  3KXT A;  3JB9 F;  2LQK A;  4BI3 A;  1PKT A;  2LRQ A;  2BE7 D;  2FYK A;  1WHJ A;  2SRC A;  1M5Q 1;  5GAN 5;  2AZV A;  2DEQ A;  2EKH A;  3I55 T;  2RJD A;  4OP0 A;  4A4E A;  5GAM j;  2EYY A;  1PWT A;  2JMA A;  2R57 A;  3H9N A;  1NJI R;  4NOY A;  3CCM T;  1K73 C;  1ZLM A;  2OTJ A;  3LWH A;  2X51 A;  4DBH A;  1QWE A;  4E7I A;  1EX4 A;  2VGM A;  4OMF B;  3M0Q A;  3OW2 A;  4JJD A;  4IUP A;  3A5Z B;  3VV0 A;  2ZPI B;  4PJO A;  3CC4 A;  1TSF A;  3EFO B;  3I5S A;  3CPW S;  1ZSZ A;  2EGE A;  4GLK A;  1VQ8 T;  2QA4 A;  3VS5 A;  2M0Y A;  5A0D A;  8AT1 B;  1VQP Q;  3CCL Q;  2HEQ A;  4L6V 5;  2QI2 A;  2XDP A;  2PU9 B;  1S72 Q;  1YWP A;  5IT9 E;  5D7U A;  5GAN 7;  1Q7Y C;  2RK1 A;  1VYU A;  4X34 A;  3NTI A;  3D7S B;  1CSK A;  3FJ5 A;  3H8Z A;  4RKU E;  4C0F A;  4PL6 A;  5KH6 A;  3EG9 B;  3LGF A;  4M78 C;  2MF2 A;  3CPW P;  4ATO A;  4L5G A;  1BK2 A;  1UGV A;  1AT1 B;  1VQ6 A;  3OS0 A;  1RAD B;  1XTD A;  2E65 A;  3I56 T;  3VS3 A;  3CCJ Q;  2F2V A;  1VQL A;  4C92 G;  4JRQ A;  2O9S A;  1Q95 G;  1KK7 A;  2EQU A;  4PLI A;  4M77 F;  3UA7 A;  1H92 A;  4JS5 A;  4M75 G;  2C0I A;  2YRV A;  1M90 C;  2M0O A;  2JZ2 A;  4OB0 B;  3CMA A;  3I35 A;  5GAM e;  4HVV A;  4DBR A;  5GAO n;  2XID A;  2CGH A;  1W1F A;  4K11 A;  1D0Y A;  1WFW A;  4TVR A;  4F04 B;  2QQA A;  3MP8 A;  1UGP B;  2XG8 D;  1YIT Q;  4LXC A;  4C0D B;  1RAH B;  1YJW A;  4E7Z A;  1WGS A;  4DOV A;  2QA4 T;  2L3S A;  3EFO A;  1W70 A;  3CXC S;  3X26 B;  1I1J A;  3QJ6 A;  3OMC A;  2CS7 A;  3CBO A;  2YSQ A;  2RO0 A;  4J6X A;  3CME T;  1UEB A;  5GAO l;  2RHI A;  1IZ6 A;  1G3W A;  5DLQ E;  5J26 A;  1NEB A;  3DLM A;  1N8R U;  2RF0 A;  4J9G A;  1VQ6 T;  4CC7 A;  3OYF A;  4OB2 B;  1HK9 A;  3EG9 A;  5M9O A;  3CXC P;  2RI5 A;  2H3J A;  3QZ5 B;  4BY6 B;  1M3B A;  4II1 A;  5CIU A;  4C92 C;  1YJ9 A;  2KR3 A;  1SF9 A;  1JBM A;  2ECZ A;  1QWF A;  1BU1 A;  1M8M A;  4Z89 A;  4C5E A;  1J3T A;  4M75 C;  4M77 B;  5FLX E;  3PVL A;  1BYM A;  3JB9 G;  2DET A;  2EGC A;  3JCM b;  1WJS A;  3CCR T;  2X9H A;  3LH5 A;  3X24 B;  3QSU A;  2R58 A;  3E9F A; 
#chains in the Genus database with same CATH homology
 3QUI A;  3V8J A;  3C94 A;  4OGE A;  2RM4 A;  1Q7Y U;  3JCM X;  3M57 A;  3RES A;  2DD4 A;  4F7U F;  4M7D B;  1HXD A;  2BKD N;  1UGQ B;  1X75 C;  2KK4 A;  1BIA A;  5GAO m;  4E7H A;  4M7A C;  2EWN A;  2F5K A;  2HQE A;  3LGL A;  4M7D E;  4XU3 A;  2DTH A;  4HCZ A;  2HD0 A;  3JCM h;  2DKG A;  2EQJ A;  1N27 A;  1BI3 A;  2QDY B;  2QXF A;  3HFO A;  3OBW A;  3SWN B;  5CQY A;  4C5G A;  4FIB A;  4ELZ C;  3BFM A;  2GCX A;  4M7A F;  3RKW A;  1GXI E;  4QVZ A;  5CQX A;  1WJQ A;  4M7A D;  4JS4 A;  1BI1 A;  3PFS A;  3GNF B;  4DQ2 A;  2DXB A;  4QQ6 A;  5LJ5 j;  1Y96 B;  3J7A F;  2LC4 A;  3QJY A;  5A0L A;  5GAN g;  1I5L A;  3GP8 A;  4ELY C;  4X9C A;  5CO7 A;  3UWN A;  3H6Z A;  1NJI U;  3DB3 A;  4PKC C;  4MML A;  3FDR A;  3JB9 I;  3JB9 J;  5KE2 A;  3J80 E;  2IVW A;  1M1F A;  2CZ7 B;  3OYM A;  4E7J A;  3QKJ A;  2DTI A;  3CBP A;  3QXE B;  1KC8 U;  3CCQ T;  4LD6 A;  4DA4 A;  1VQN T;  4J7F A;  3ZEH A;  1Y7X A;  5CKD A;  5KCH A;  3JRZ A;  4QW2 A;  4EPC A;  4C8Q G;  3FEO A;  3VJP A;  3S6W A;  5HK0 A;  3OYA A;  1QVG S;  4RCB A;  2GFU A;  4HT9 A;  1K9M C;  3JAM E;  2O4X B;  2DK3 A;  4QVD A;  5FRO A;  1M90 U;  5FU7 C;  5LJ3 d;  3QHS A;  4A54 A;  3CCR A;  3JCM V;  1JJ2 S;  3QBY A;  2ZPF B;  5CKF A;  2MWO A;  4BD3 A;  4GY5 A;  2KMT A;  4BI4 A;  3V8K A;  3JCM f;  4N0A A;  2M1H A;  5HY6 A;  3OYK A;  4RG2 A;  3UDC A;  1UGR B;  2DD5 A;  2RI2 A;  3G6E A;  4FU6 A;  2X35 A;  3X25 B;  5GMK j;  5CKE A;  4XQ3 A;  5GAN 8;  2DXT A;  2CZ1 B;  3GF5 A;  5IN1 A;  3L2W A;  3HSB A;  3LW5 E;  2LT1 A;  2BUD A;  4Y28 E;  3RIR A;  5CAI A;  5CKH A;  1NPP A;  3TU4 K;  4ZTJ A;  3CPW A;  2OAU A;  4M78 A;  3HKS A;  5LJ5 g;  3JB9 H;  3NTK A;  4PJO C;  2IG0 A;  1UGS B;  3UT1 A;  3CEY A;  1KD1 U;  4HKE A;  1O9S A;  2EJG A;  2ZPB B;  1D3B A;  2DVE A;  2E64 A;  4ME7 A;  1M1K U;  2C06 A;  3L1A A;  4M77 A;  3PTA A;  2K3X A;  4PJO D;  3L2Q A;  2K5I A;  1VQK T;  2L89 A;  2KAF A;  4XTZ A;  4FT2 A;  1M8V A;  2E1H A;  3T9N A;  3WVD B;  1MHN A;  3N5B B;  5GAN 6;  3JB9 D;  1VUB A;  1U8R A;  2L8D A;  3CCQ A;  4J7I A;  1G3S A;  3CCS T;  4EMK B;  1VQN A;  2EQK A;  4MZM A;  2AHJ B;  2DAQ A;  2X4J A;  2XI9 A;  3M55 A;  4HCC A;  4XK8 E;  3AHU A;  4LDW A;  4F7U B;  3G71 A;  3PNW C;  4XTX A;  3MO8 A;  4EMG A;  4NL3 A;  3VYG A;  3PGG A;  4F7U E;  4BDY A;  3V7C A;  1KG1 A;  1X01 A;  1G3T A;  5GAN 2;  3SDZ A;  4M7D A;  1WJR A;  2GF7 A;  2EJF A;  4E47 A;  2E6N A;  2MAM A;  1U1T A;  3OYC A;  4M7A B;  1N8R C;  3GNG A;  3OYD A;  4J5Y A;  1OI1 A;  4XU0 A;  2JTF A;  3OYJ A;  3OB9 A;  3SWN A;  2K2V A;  3LH0 A;  3BY7 A;  4KUI A;  4IUT A;  3E9G A;  4C92 F;  5HK3 A;  2LCL A;  1N9R A;  1VIF A;  2CKK A;  2RA2 A;  3BDU A;  4PNO A;  4C0G A;  5IAY A;  3CCU T;  5GAN j;  2D9T A;  1Y96 A;  2X4Y A;  3WXM B;  1VQM A;  1KHI A;  5LJ5 e;  3JCM g;  3JCM c;  4M77 E;  1WQW A;  1BIB A;  4C8Q C;  4XAX B;  2XDB A;  2MWP A;  2E10 A;  1K8A U;  4M75 F;  1VQ7 A;  1VQ5 T;  1I4K 1;  4BB7 A;  3SD4 A;  5D6W A;  2QQR A;  1DJ7 B;  3PIP A;  4Q5W A;  2CYZ B;  2B8A A;  1VQK A;  3J81 E;  5GAN d;  3RKX A;  4C8Q D;  2RHU A;  4XTW A;  3OYB A;  3OYL A;  3FIF A;  3X20 B;  4OB3 B;  2LVM A;  2O4X A;  2WSE E;  4JRK A;  4ZGE B;  3M58 A;  1Q82 U;  1JJ2 A;  3M59 A;  3CCS A;  1BI2 A;  4VUB A;  3L2R A;  3G4S T;  1U1S A;  5FU7 B;  1VQO T;  1W2B A;  2LNV A;  1QP3 A;  2QQS A;  1BI0 A;  4IUU A;  3MP6 A;  3OYH A;  4N4I A;  1PSF A;  1Q81 C;  3ZFJ A;  4PLL A;  5GAO q;  2OTL T;  4OB1 B;  5GMK e;  3CXC A;  4LDX A;  3VUB A;  3UPU A;  2FVU A;  1B34 A;  4BI8 B;  4E7L A;  2RD1 A;  3JSC A;  1LNX A;  3EAE A;  5LJ3 f;  4C5H A;  1M1G A;  2VGN A;  3KUF A;  3O8V A;  5CCA A;  3TEE A;  3OW2 S;  1KQS S;  2DIG A;  4C92 A;  2JOY A;  4N4G A;  3SFM A;  2PUO B;  4PJO B;  2R5M A;  4HA8 A;  1QVF S;  2CZ6 B;  2ZPG B;  2P4T A;  5DY9 A;  3CBM A;  4OGC A;  4BE2 A;  3TRE A;  1H64 1;  1G3Y A;  3CCU A;  4MDX A;  5GAM h;  4RCC A;  2RJC A;  2EAY A;  2JVV A;  2VC8 A;  2HBP A;  3QZ9 B;  4M75 A;  3VUZ A;  5KCO A;  2XD0 A;  4FT4 A;  4ZGJ B;  3G71 T;  5LJ5 d;  3TCJ A;  4M78 D;  3HRS A;  4Y91 A;  5A0G A;  1ZHI A;  3C4S A;  1VQ9 T;  1YIJ T;  1KC8 C;  1VQ5 A;  2RJE A;  4J8O A;  1VQP T;  3CCL T;  3NFC A;  4EMK A;  4FM4 B;  2F5T X;  3LYI A;  2PVO B;  3VKI A;  4E7K A;  1H3Z A;  3NTH A;  2RHZ A;  2K5L A;  3HFN A;  3QYH B;  4D6W A;  4V2S A;  3RKY A;  3BW1 A;  1V29 B;  4F7U A;  5CK9 A;  3FLG A;  4KUL A;  1I81 A;  1S72 T;  3CD6 T;  2JN0 A;  2OTJ T;  3DKM A;  1YJN T;  3P8D A;  2WAC A;  2DPP B;  2KVQ G;  1QP2 A;  3GIB A;  4MZT A;  2JNG A;  4JDS A;  2VV5 A;  4O5V A;  4A4H A;  1B34 B;  2EIF A;  2PUK B;  3E1S A;  3G4S A;  1VQO A;  2FHD A;  1VQM T;  4M7A A;  1R8O B;  4IUQ A;  2FB7 A;  2LDM A;  4BDZ A;  4C92 B;  2PVD B;  5C6S A;  3CCV T;  4N4H A;  3OBY A;  2XIC A;  4C0Z A;  3QPH A;  4MZP A;  4IUR A;  4F7U G;  3CC4 T;  1KQ1 A;  3JCM Q;  1VQ7 T;  4C92 E;  2LQ8 A;  2LCC A;  3PMT A;  5C0M A;  5FRM A;  2OTL A;  2DJZ A;  2DTO A;  1RI0 A;  5GAM f;  3CC2 T;  2K4Y A;  4PJO F;  3CPF A;  4IUV A;  3S3O A;  4B9X A;  3RUX A;  4M75 B;  1O75 A;  5GAN e;  2ZGW A;  3C12 A;  4QVC A;  4M78 G;  4HCB A;  4M7D D;  1VQL A;  3L2Z A;  5I2M A;  5FU6 C;  2KDS A;  4M75 E;  4XTV A;  2LQK A;  3KXT A;  2LT4 A;  4BI3 A;  2YHT A;  2Y90 A;  1KD1 C;  3JB9 F;  2FL7 A;  1JRI A;  4C8Q B;  1JB0 E;  2LRQ A;  4XU1 A;  2FYK A;  3CCJ T;  1EIF A;  3PIO A;  2WSC E;  2RH2 A;  3KBG A;  1M5Q 1;  3OYG A;  4M77 G;  4BE0 A;  3JCM J;  5GAN 5;  3MP1 A;  2DEQ A;  3I55 T;  2RJD A;  3PT9 A;  3JCM d;  4OP0 A;  3P8H A;  1VQ9 A;  2XK0 A;  3C95 A;  5I2S A;  1YIJ A;  2P0P A;  4A4E A;  5GAM j;  1ZBX A;  1VQP A;  3CCL A;  2PVG B;  4A4F A;  3HRU A;  3M53 A;  2R57 A;  1OZ3 A;  2M9U A;  1KHC A;  3R6O A;  4NOY A;  3ME9 A;  2X4W A;  4J6W A;  3A8G B;  3CCM T;  1K73 C;  5D6X A;  4M7A E;  1S72 A;  3CD6 A;  2OTJ A;  1N6A A;  3LWH A;  1YJN A;  2E70 A;  3OSS C;  4C0D C;  4A4K A;  4E7I A;  4NL2 A;  3INZ A;  3FC3 A;  2VGM A;  4M7D G;  3V8L A;  3FRN A;  1N9S A;  2VUB A;  4OMF B;  4WF2 A;  2RHY A;  5J3B A;  3OW2 A;  2XHC A;  3GOX A;  2G3R A;  3A5Z B;  4IUP A;  5LJ3 h;  3VV0 A;  1YIT T;  3CCV A;  2DXU A;  2ZPI B;  1VQL T;  4PJO A;  1PSE A;  3CC4 A;  4O6J A;  2DXC A;  4XTU A;  2RK2 A;  2XKO C;  1Q86 U;  2EYQ A;  3CC7 A;  3CPW S;  2ZPE B;  3OYY A;  3CC2 A;  1XQH A;  2DZ9 A;  3ER0 A;  3HL8 A;  3QII A;  3FJP A;  3HPW A;  4GLK A;  5EG2 A;  5LL6 S;  4C8Q F;  2QA4 A;  1VQ8 T;  1QVG A;  5A0D A;  4LDU A;  4JLG A;  4HT8 A;  4A53 A;  3QG1 A;  3A8M B;  5CR2 A;  3QO3 A;  2QI2 A;  2F69 A;  4L6V 5;  2XDP A;  1K8A C;  1KQ2 A;  2PU9 B;  3ZBD A;  3V7S A;  3RMQ A;  3CCJ A;  2MMP A;  3CMA T;  5GAM g;  2GFA A;  1TH7 A;  1VQ4 T;  2GQV A;  4J83 A;  5DM7 R;  5IT9 E;  4FSX A;  1MGQ A;  2L3R A;  5GAN 7;  3I55 A;  3OA6 A;  1Q7Y C;  2DIQ A;  2RK1 A;  4JRI A;  4N0A C;  5L8R E;  4EMH A;  1YHQ A;  1XOV A;  2YLB A;  5LJ5 f;  4P5N A;  3M4Y A;  4X34 A;  4C5I A;  2JUF A;  3NTI A;  2YLC A;  4JLI A;  1Q82 C;  1YJW T;  2K57 A;  1OYX A;  3OS1 A;  2HAX A;  3H8Z A;  3OMG A;  4KT0 E;  4MMK A;  4RKU E;  4XTY A;  2D0Q B;  3MCA B;  4C0F A;  3OQ5 A;  4PL6 A;  5KH6 A;  2XDD A;  1YI2 T;  4B9W A;  1Q81 U;  4KBM B;  2KSS A;  5A2Q E;  4BY6 C;  3LGF A;  3CCM A;  2Y4Y A;  4M78 C;  2MF2 A;  4ATO A;  3Q1J A;  4CI0 C;  4L5G A;  1NPR A;  2E6Z A;  5HKC A;  2HQX A;  2JTM A;  2O01 E;  4PJO E;  1VQ6 A;  2QTX A;  3OS0 A;  2L5Q A;  4RG8 A;  1XTD A;  4LDV A;  2E65 A;  4YTL A;  3I56 T;  2E41 A;  1LOJ A;  2RI3 A;  2ZPH B;  4M78 F;  4MDW A;  3M54 A;  3JCM e;  1Y71 A;  4RMO A;  4ZN1 A;  1YBY A;  2DO3 A;  1YIT A;  1SSF A;  3BDL A;  2K5F A;  2E5Q A;  3LX7 A;  4M77 C;  4OVA A;  4C92 G;  3OS2 A;  5FU6 B;  5D6Y A;  3DLL A;  4JRQ A;  2KY9 A;  4C8Q A;  2EQU A;  4PLI A;  4ZTF A;  2RHX A;  3A8H B;  3DB4 A;  5LJ3 j;  2EFI A;  4M77 F;  1WNL A;  5GMK i;  1VQ8 A;  1K9M U;  4JS5 A;  4M75 G;  4M77 D;  1NE8 A;  3HP9 A;  2YRV A;  4EDU A;  2I2L A;  3EFS A;  3VU3 C;  3CCE A;  5GAO r;  1M90 C;  2M0O A;  2JZ2 A;  3V7R A;  2BIV A;  2K3Y A;  2XU8 A;  4NS5 A;  4OB0 B;  3CMA A;  2NLU A;  5GAM e;  5GAO n;  1G5V A;  2XID A;  3MEV A;  1VQ4 A;  3M5A A;  4IKF A;  2CGH A;  4DOW A;  2A7Y A;  1WPY A;  5GMK l;  2QEX T;  4Z02 A;  4M7D C;  2EKO A;  4TVR A;  4JRP A;  4JUV A;  2QQA A;  3MP8 A;  1W2B S;  1UB4 A;  3QDR B;  1UGP B;  4QQG A;  2XG8 D;  5CKB A;  5GAN h;  5I21 A;  4CRI A;  3CC7 T;  1FX7 A;  4C0D B;  1YJ9 T;  3SWN C;  1YJW A;  4M7D F;  5DLO A;  2VYT A;  1WGS A;  3QYG B;  3S3N A;  2Y4X A;  5CVI A;  4DOV A;  2QA4 T;  1XNI A;  3G7Z A;  1P92 A;  1YI2 A;  4M7A G;  3RMS A;  3M4G A;  2ZCF B;  2RB6 A;  4JJN K;  3MET A;  4R56 A;  3M9Q A;  5AYF A;  3RER A;  3CXC S;  3X26 B;  1FXX A;  1W4S A;  3GLX A;  1M1K C;  3QJ6 A;  3OMC A;  2CS7 A;  3EFR A;  2EJ9 A;  4C8Q E;  3CBO A;  3MEU A;  5GAN 3;  2LTO A;  3I56 A;  3E19 A;  5LJ3 g;  2KQW A;  4X9D A;  2M16 A;  4KUD K;  4FL6 A;  2R5A A;  2QQB A;  2RO0 A;  1YHQ T;  3SB2 A;  4J6X A;  2V8J A;  5GAO p;  4R55 A;  3A8L B;  3CME T;  1OZ2 A;  2P0Q A;  5J39 A;  1UEB A;  4A4G A;  3ASK A;  3L42 A;  1YCY A;  5GAO l;  5FRN A;  3A8O B;  1Y07 A;  2EQM A;  1ZQ1 A;  1QW1 A;  3MEA A;  3S3M A;  2RHI A;  1IZ6 A;  2LX9 A;  3M56 A;  4LDY A;  2HNI A;  1G3W A;  2CZ0 B;  4XU2 A;  5DLQ E;  3L2U A;  5J26 A;  3VYH B;  1LJO A;  5GAN f;  3DLM A;  1NJI C;  2VXE A;  1N8R U;  4BAC A;  2WSF E;  1RL2 A;  3MEW A;  5LJ5 h;  1VQ6 T;  3MHX A;  5KE3 A;  4UC4 A;  3OYF A;  3OYE A;  1K73 U;  5GAM d;  4OB2 B;  2VXF A;  1HK9 A;  3HHT B;  3GPL A;  4BE1 A;  1BKB A;  1KQS A;  2D6F A;  2RJF A;  2QEX A;  5M9O A;  1QVF A;  2RI5 A;  3OSV A;  1M4Z A;  3OYI A;  1AHJ B;  1WQ7 A;  2H3J A;  1IRE B;  3QZ5 B;  2ZZD A;  4BY6 B;  5GAN 4;  4II1 A;  2E12 A;  4M78 B;  5CIU A;  4C92 C;  4ZGD B;  4ZN3 A;  5GMK m;  2DZC A;  1YJ9 A;  1JBM A;  3P8B B;  4M78 E;  4LD9 K;  2PQW A;  3OS5 A;  2QQ9 A;  2V8I A;  1D3B B;  4J6Y A;  3OYN A;  3JCM W;  1M9S A;  2V8K A;  2MI6 A;  4C5E A;  4PJO G;  4M75 C;  3JCM P;  4M77 B;  4C92 D;  3CCE T;  4BUG A;  1Q86 C;  5FLX E;  1I8F A;  3URG A;  3PMI A;  3OY9 A;  1VIE A;  2X4X A;  1X6O A;  1BYM A;  3HRT A;  1NZ9 A;  3LWI A;  3L2V A;  3JB9 G;  3WVE B;  5LJ3 e;  3JCM b;  4EMK C;  1WJS A;  5GMK h;  1FWZ A;  4M75 D;  3CCR T;  3X28 B;  3F70 A;  1QVP A;  2A3L A;  3LLR A;  3CME A;  4QQD A;  3X24 B;  4OF1 A;  3QSU A;  3G6E T;  2P0K A;  3FB9 A;  2R58 A;  4L59 A;  3E9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...