4J73A

Crystal structure of beta'-cop/p25 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
295
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 82
structure length 295
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j73A01
4QRJA 2HYEA 4UI9R 2O9KA 3JAMg 4E54A 3RN0D 4H5JA 1OLZA 3PSCB 4JT5C 3KRXB 4E54B 3UVLA 4X3EA 3MZLA 1P22A 2J55H 4ERQA 5EARA 3PVWB 3DXKC 4CZVA 5I5MA 3OKWA 5FKSA 3FM0A 4PBYA 2XYIA 3EI3A 1Q47A 2J56H 2HKRA 3JZHA 3MZKA 1XKSA 2PM6B 2Q7QA 2YMUA 2CE9A 3EI3B 2I0RA 3I7OA 4CZYA 3RMZD 4FA9D 2CO0A 3EWEA 5FKRA 3SWSD 2YNPA 2Z2PA 3CIKB 5CYKA 1NEXB 3BG1A 3E0CA 4FA4D 5CYKB 5A2Qg 5H14A 5TF2A 2H47A 2P9UC 3ZWLB 2G9AA 3F3FA 3AH8B 3K27A 3SN6B 4CY1A 2QXVA 3J80g 4PSWB 4CI8A 1FWXA 5I5IA 3MMYA 1A0RB 2YNOA 2H13A 1SHYB 4O1QD 3JB9L 2YNNA 5AFU3 5FKQA 3AFCA 1JJUB 2XL3A 5SXMA 4QT8A 2OVQB 3A0FA 3B7FA 2H68A 3EU7A 5IT9g 4A09A 3I7NA 2HJ4A 3IJ1A 4E5ZA 4BH6A 5K1CC 3SHFA 2IUQA 3PXWD 4QQEA 5GSAA 4E5ZB 2B5MA 3PXSD 2CN3A 1PEVA 5FQDA 5HE3B 3UVNA 2B5NA 3I8EA 2P9SC 5EALA 3MXXA 4H5IA 2H3XA 4ES0A 1XIPA 3EI1A 4JSNC 2H9MA 3EI1B 3FRXA 5TDHB 4L9OA 5FA5B 2PM7B 5IGQA 5EMLB 2B4EA 3I7HA 4GQ1A 3BG0A 4CI1A 3SXTD 3V7DB 3UVKA 1N6DA 3NVXA 4Y5RD 2H6KA 3RLMD 2AGZA 5GMKn 3OTTA 3OKTA 4ESGA 2OVRB 1RI6A 2OVPB 3JPXA 3I2NA 3RN1D 1K8KC 2GC7A 2IWKA 3UR4A 4O45A 4CC9A 4CY3A 2BBKH 4CZXA 4KFMB 1GP2B 3V9FA 4R7AB 2I0TA 4FAVD 4ZOZA 4ERZA 4U7AA 4XYIA 4A7JA 3JZGA 3MKSB 2P9PC 4J84A 4BL0A 2H9NA 1SQ9A 2OK6A 4FAND 5EM2A 4J0XA 3SJLD 2GC4A 5C2VB 3IIYA 5EM2B 1JMXB 3GFCA 2H9LA 2AQ5A 4PXWA 3SBPA 5H17A 2AGYA 2H6NA 1GG2B 2UZYB 2H6QA 1ERJA 3L4OD 4ZOYA 3CFVA 4CY5A 4U1EI 3U4YA 3EG6A 2HJBA 1TBGA 4AOWA 2AH0A 2P9KC 4GMBA 4OWRA 4J86A 4Z8LA 5I5JA 3ODTA 5THAA 1JOFA 2B5LA 1SQJA 4Y7RA 2AGXA 2H14A 3EI4A 1U2VC 3EI4B 5HE0B 4EWRA 4MK0B 5CXCA 2I3SA 5EAMA 1NR0A 3N0DA 2QC5A 4XYHA 5CXCB 5FKTA 3DSMA 4J77A 5EAPA 4A09B 3AL9A 3SBRA 1N6FA 3PE7A 1K32A 4GGDA 4PSXB 5TEFA 5EMMB 3PVUB 2CE8A 5EMKB 4YVDA 3VGZA 3KRWB 3JZNA 3J81g 4J78A 3SBQA 4O9DA 4JSVC 2I3TA 1U4CA 4JT6C 3FGBA 1QNIA 4IMMA 5K19A 4A11A 3EMHA 4GM9A 3P4FA 3RFGA 4LG8A 4A11B 1GOTB 4FA1D 1MG2A 4D6VA 4J8GA 4A0BA 3F3GA 4X63B 3RFHA 5IJ8E 4A0BB 4JD2C 4TZ4A 3MKQA 3UKUC 4CI3A 3L4MD 5C2WB 4L3GD 2EBSA 4ZOXA 4ERYA 3JRPA 2UZXB 5EMJB 4LGNA 3ORVD 2OIZA 4GGCA 2MTAH 3SLED 1GXRA 2BCJB 3SCYA 4A2MA 3PXTD 5B4WA 1OMWB 2P9IC 4O3TB 4AEZA 4PBZA 3DM0A 4J0WA 4HDJA 4FB1D 2OJYA 4A08A 2J57G 2PM9A 4A08B 2PM9B 2IAAA 4PC0A 3IKOA 4A2LA 4J87A 2AH1A 5KDOB 4O3UB 2AGWA 1B9XA 5FLXg 2TRCB 2PBIB 3DXMC 2YBAA 4K3ID 2I0SA 5GXHA 2OK4A 4FA5D 2CN2A 2HXCA 1PGUA 5HE1B 2YB8B 4QL1A 2P9LC 2XU7A 3GREA 4JSXC 4GQ2P 2IUVA 3V5WB 4XEIC 3IJCA 2CO0C 2Z2NA 4ZN4A 4K3JB 3I7KA 1JMZB 5AJAA 4PNKB 3HFQA 4ZOVA 3VA6A 2G99A 5JWZA 4GQBB 3OKYA 1L0QA 3C99A 3OW8A 3UVOA 4A0AA 4IA9A 3VH0A 3OKYB 2H9PA 4OZUA 4A0AB 4BUJC 3C9CA 5AMSA 5HQGA 3IJ0A 5IC7A 4GM3A 4J73A 4GGAA 2HKMA 2P9NC 1R5MA 4L3HD 5CXBA 5IGOA 5TEEA 4J79A 3RSEC 4GM8A 4CI2A 3BWSA 1N6EA 5CXBB 3K26A 5IJ7E 3JROA 3UKRC 3C75H 2CNXA 3PSLA 1PI6A 1TYQC 3UVMA 4J82A 3SFZA 5HE2B 4N14A 3AL8A 3I89A 3NVNA 4LG9A 3DWLC 3IIWA 3AL8B 3N0EA 2AGLA 2Z2OA 1MG3A 4X60B 3ULEC 3SVWD 1YFQA 3CFSB 3I7PA 3RRMC 2GNQA 2XL2A 1VYHC 1XHMA 4FWWA 3I7LA 5GXIA 5FXYA 3SMRA 5HYNB 3EI2A 3F3PA 2IWFA 4JXMA 4NSXA 3EI2B 5C9ZB 2HESX 4I79A 4GZ8A 3W15A 4JSPC 3C5MA 1B9YA 4D0KA 4J81A 1S4UX 3OL2A 4FHLA 5H1MA 4CY2A 2IUPA 4X61B 3OL2B 3I8CA 3NVQA 2W18A 4L1QD 1MDAH 2IURA 4J8BA 1PBYB 4G56B
chains in the Genus database with same CATH superfamily
4QRJA 2HYEA 4UI9R 2O9KA 4NENA 4WJKA 4BCCA 3JAMg 5E6SA 4E54A 3RN0D 4H5JA 1OLZA 3PSCB 4JT5C 3KRXB 4E54B 3UVLA 4X3EA 3MZLA 1P22A 2J55H 4ERQA 5EARA 1H2WA 4MMYA 3K71A 4Z7QA 4AN1A 3PVWB 3DXKC 4CZVA 2XZGA 1K3IA 5I5MA 3OKWA 4BCBA 5FKSA 3FM0A 5M5TA 4PBYA 1UOPA 2XYIA 1Q47A 2J56H 2HKRA 3EI3A 3JZHA 3MZKA 1XKSA 2PM6B 2Q7QA 2YMUA 2CE9A 3EI3B 2I0RA 3I7OA 3IUJA 4CZYA 3RMZD 4FA9D 2CO0A 3EWEA 3K6SA 5FKRA 3SWSD 1C9IA 3ZDYA 2YNPA 5E6UA 2Z2PA 3CIKB 5CYKA 1NEXB 3BG1A 3E0CA 4G55A 4FA4D 5CYKB 5A2Qg 4DNVA 5H14A 5TF2A 2H47A 1A12A 2P9UC 1QFSA 3ZWLB 2QR5A 2G9AA 3F3FA 3AH8B 3K27A 3FCUA 3SN6B 2QXVA 4CY1A 3J80g 4PSWB 3ZDXA 3NIGA 3IVMA 4CI8A 1FWXA 5I5IA 3MMYA 4UM8A 1A0RB 2YNOA 2H13A 1SHYB 4O1QD 3JB9L 2YNNA 5AFU3 5FKQA 3AFCA 1E5TA 3O4GA 1JJUB 2XL3A 5SXMA 4QT8A 2OVQB 3A0FA 3B7FA 2H68A 3EU7A 5IT9g 1E8NA 4A09A 3I7NA 1VE6A 2HJ4A 3IJ1A 5E6RA 4E5ZA 4L1MA 4BH6A 4WK0A 5K1CC 3SHFA 2IUQA 3PXWD 4QQEA 4UM9A 5GSAA 4E5ZB 3FCSA 3EQ7A 2B5MA 3PXSD 2CN3A 1PEVA 5FQDA 3T3MA 5HE3B 1O6FA 3UVNA 2B5NA 2XE4A 3T3PA 3I8EA 2P9SC 5EALA 3MXXA 4H5IA 2H3XA 4ES0A 1XIPA 3EI1A 4JSNC 1UOOA 2H9MA 3MVDK 3EI1B 2VDMA 3FRXA 5TDHB 4L9OA 3IUMA 5FA5B 2PM7B 5IGQA 5EMLB 2B4EA 3I7HA 4GQ1A 1UOQA 3BG0A 4CI1A 3SXTD 3V7DB 3UVKA 1N6DA 4Z7NA 4AMZA 3NVXA 1GOFA 3V4PA 4Y5RD 2H6KA 3RLMD 2AGZA 5GMKn 3OTTA 3OKTA 5HDBA 3O4HA 4ESGA 2OVRB 1RI6A 2OVPB 3O4IA 3JPXA 3I2NA 3RN1D 5FFGA 1K8KC 2GC7A 2IWKA 2VDOA 3UR4A 4O45A 4CC9A 4AMYA 4CY3A 2BBKH 4WK2A 4CZXA 4KFMB 1GP2B 3V9FA 4R7AB 2I0TA 4FAVD 4ZOZA 4ERZA 4G1MA 4NBMA 4U7AA 1H2XA 4XYIA 4A7JA 4O2WA 3JZGA 3MKSB 3K72A 2P9PC 4J84A 4BL0A 3QI0A 4Z7OA 2H9NA 1SQ9A 2OK6A 2XDWA 2EICA 4FAND 5EM2A 1YR2A 4J0XA 3QHYB 3SJLD 2GC4A 5C2VB 3IIYA 5EM2B 1JMXB 3GFCA 2H9LA 2AQ5A 4PXWA 1H2YA 3SBPA 5H17A 4DNWA 2AGYA 2H6NA 2VDQA 1GG2B 2UZYB 2H6QA 1ERJA 3L4OD 3IJEA 4ZOYA 3CFVA 4CY5A 1O6GA 4U1EI 3U4YA 4G1EA 4IRZA 1E8MA 3ZE1A 3EG6A 2HJBA 4RE6A 1TBGA 4AOWA 2AH0A 2P9KC 4GMBA 4OWRA 4J86A 4O02A 4Z8LA 4DNUA 5I5JA 3ODTA 5THAA 1T2XA 1JOFA 3VI3A 2B5LA 3EQ8A 4JHPC 3ZE2A 1SQJA 4Y7RA 2AGXA 2H14A 3EI4A 1JV2A 1U2VC 3EI4B 5HE0B 3NIDA 4EWRA 4MK0B 3GD1I 5CXCA 3V4VA 2I3SA 5EAMA 1NR0A 3N0DA 2QC5A 4XYHA 5CXCB 5FKTA 3DSMA 4J77A 5EAPA 4MMXA 4A09B 3AL9A 3SBRA 1N6FA 3PE7A 1JTDB 1K32A 4GGDA 4PSXB 5TEFA 5EMMB 3PVUB 1H2ZA 2VDLA 3O4JA 2CE8A 5EMKB 2VZ1A 4YVDA 3VGZA 3KRWB 3JZNA 3J81g 4J78A 3SBQA 4O9DA 4JSVC 2I3TA 5C92A 3IULA 2HU7A 1U4CA 2EIDA 4JT6C 3FGBA 1QNIA 4IMMA 5K19A 4A11A 3EMHA 2VDPA 4GM9A 3P4FA 3RFGA 4LG8A 4A11B 1L5GA 1GOTB 3KCIA 4FA1D 2BKLA 1MG2A 2VDNA 3OF7A 4J8GA 4D6VA 5FFOA 4A0BA 3F3GA 2EIBA 1VZ3A 5M61A 4X63B 3RFHA 5IJ8E 4A0BB 4JD2C 4TZ4A 3MKQA 3UKUC 4CI3A 3L4MD 5C2WB 4L3GD 2EBSA 4ZOXA 2HU5A 4ERYA 3JRPA 2UZXB 5EMJB 4LGNA 5M5SA 3ORVD 2OIZA 4GGCA 2MTAH 1M1XA 3SLED 1GXRA 2BCJB 3SCYA 4A2MA 3PXTD 1VE7A 5B4WA 1OMWB 2P9IC 4O3TB 4AEZA 4QAMA 4PBZA 3DM0A 4J0WA 1I2MB 4HDJA 2QZPA 4FB1D 2OJYA 4A08A 2HU8A 2J57G 2PM9A 5M5RA 3DDUA 4A08B 3VI4A 2PM9B 2IAAA 4PC0A 3IKOA 4A2LA 4J87A 2JKXA 5C86A 2AH1A 5KDOB 4O3UB 2AGWA 1C9LA 1B9XA 2VC2A 5FLXg 2TRCB 5M5VA 2PBIB 3DXMC 4BP9A 2YBAA 4K3ID 2I0SA 2VDRA 2OK4A 5GXHA 4FA5D 2CN2A 2HXCA 1PGUA 5HE1B 1GOHA 2YB8B 4BCDA 4QL1A 2P9LC 2XU7A 3GREA 4JSXC 4JHNA 3IUQA 4GQ2P 2IUVA 3V5WB 4XEIC 3IJCA 2CO0C 2Z2NA 4ZN4A 4K3JB 3I7KA 1JMZB 5AJAA 4PNKB 4AN0A 5M5UA 4NC4A 2VZ3A 3IURA 3HFQA 1VZ2A 4ZOVA 2G99A 3VA6A 5JWZA 1TYEA 3MUOA 4GQBB 1BPOA 3OKYA 1L0QA 3C99A 3OW8A 3UVOA 4A0AA 4IA9A 3VH0A 2VDKA 3OKYB 2H9PA 4OZUA 4A0AB 3ZDZA 4BUJC 3C9CA 3IUNA 5AMSA 4D9SA 5HQGA 3IJ0A 5IC7A 4GM3A 4J73A 4GGAA 2HKMA 1GOGA 2P9NC 1R5MA 4L3HD 5CXBA 5IGOA 5TEEA 4J79A 3RSEC 4GM8A 3MUNA 4CI2A 3BWSA 1N6EA 5CXBB 3K26A 5IJ7E 3ZE0A 3JROA 1QFMA 3UKRC 3C75H 2CNXA 3PSLA 1PI6A 1TYQC 3UVMA 1U8CA 4J82A 3SFZA 5HE2B 4N14A 3AL8A 3I89A 3NVNA 4LG9A 4BP8A 3DWLC 3IIWA 3AL8B 3N0EA 2AGLA 2Z2OA 1MG3A 4X60B 3ULEC 3SVWD 1YFQA 3CFSB 3I7PA 3RRMC 2GNQA 3EQ9A 2XL2A 1VYHC 4WK4A 1XHMA 4FWWA 2EIEA 3I7LA 5GXIA 5FXYA 3SMRA 5HYNB 3EI2A 3F3PA 3GC3B 2IWFA 4JXMA 4NSXA 4RE5A 3EI2B 5C9ZB 2HESX 4I79A 4GZ8A 3W15A 4AX4A 4JSPC 3C5MA 1B9YA 4MMZA 4D0KA 4J81A 1S4UX 3NIFA 3OL2A 4FHLA 2WQ8A 5H1MA 4NAAA 4CY2A 2IUPA 4X61B 3OL2B 3I8CA 3NVQA 2W18A 4L1QD 1MDAH 2IURA 4J8BA 1PBYB 1UTCA 4G56B
chains in the Genus database with same CATH topology
4QRJA 2HYEA 4UI9R 2O9KA 3JAMg 4E54A 3RN0D 4H5JA 1OLZA 3PSCB 4JT5C 3KRXB 4E54B 3UVLA 4X3EA 3MZLA 1P22A 2J55H 4ERQA 5EARA 3PVWB 3DXKC 4CZVA 5I5MA 3OKWA 5FKSA 3FM0A 4PBYA 2XYIA 3EI3A 1Q47A 2J56H 2HKRA 3JZHA 3MZKA 1XKSA 2PM6B 2Q7QA 2YMUA 2CE9A 3EI3B 2I0RA 3I7OA 4CZYA 3RMZD 4FA9D 2CO0A 3EWEA 5FKRA 3SWSD 2YNPA 2Z2PA 3CIKB 5CYKA 1NEXB 3BG1A 3E0CA 4FA4D 5CYKB 5A2Qg 5H14A 5TF2A 2H47A 2P9UC 3ZWLB 2G9AA 3F3FA 3AH8B 3K27A 3SN6B 4CY1A 2QXVA 3J80g 4PSWB 4CI8A 1FWXA 5I5IA 3MMYA 1A0RB 2YNOA 2H13A 1SHYB 4O1QD 3JB9L 2YNNA 5AFU3 5FKQA 3AFCA 1JJUB 2XL3A 5SXMA 4QT8A 2OVQB 3A0FA 3B7FA 2H68A 3EU7A 5IT9g 4A09A 3I7NA 2HJ4A 3IJ1A 4E5ZA 4BH6A 5K1CC 3SHFA 2IUQA 3PXWD 4QQEA 5GSAA 4E5ZB 2B5MA 3PXSD 2CN3A 1PEVA 5FQDA 5HE3B 3UVNA 2B5NA 3I8EA 2P9SC 5EALA 3MXXA 4H5IA 2H3XA 4ES0A 1XIPA 3EI1A 4JSNC 2H9MA 3EI1B 3FRXA 5TDHB 4L9OA 5FA5B 2PM7B 5IGQA 5EMLB 2B4EA 3I7HA 4GQ1A 3BG0A 4CI1A 3SXTD 3V7DB 3UVKA 1N6DA 3NVXA 4Y5RD 2H6KA 3RLMD 2AGZA 5GMKn 3OTTA 3OKTA 4ESGA 2OVRB 1RI6A 2OVPB 3JPXA 3I2NA 3RN1D 1K8KC 2GC7A 2IWKA 3UR4A 4O45A 4CC9A 4CY3A 2BBKH 4CZXA 4KFMB 1GP2B 3V9FA 4R7AB 2I0TA 4FAVD 4ZOZA 4ERZA 4U7AA 4XYIA 4A7JA 3JZGA 3MKSB 2P9PC 4J84A 4BL0A 2H9NA 1SQ9A 2OK6A 4FAND 5EM2A 4J0XA 3SJLD 2GC4A 5C2VB 3IIYA 5EM2B 1JMXB 3GFCA 2H9LA 2AQ5A 4PXWA 3SBPA 5H17A 2AGYA 2H6NA 1GG2B 2UZYB 2H6QA 1ERJA 3L4OD 4ZOYA 3CFVA 4CY5A 4U1EI 3U4YA 3EG6A 2HJBA 1TBGA 4AOWA 2AH0A 2P9KC 4GMBA 4OWRA 4J86A 4Z8LA 5I5JA 3ODTA 5THAA 1JOFA 2B5LA 1SQJA 4Y7RA 2AGXA 2H14A 3EI4A 1U2VC 3EI4B 5HE0B 4EWRA 4MK0B 5CXCA 2I3SA 5EAMA 1NR0A 3N0DA 2QC5A 4XYHA 5CXCB 5FKTA 3DSMA 4J77A 5EAPA 4A09B 3AL9A 3SBRA 1N6FA 3PE7A 1K32A 4GGDA 4PSXB 5TEFA 5EMMB 3PVUB 2CE8A 5EMKB 4YVDA 3VGZA 3KRWB 3JZNA 3J81g 4J78A 3SBQA 4O9DA 4JSVC 2I3TA 1U4CA 4JT6C 3FGBA 1QNIA 4IMMA 5K19A 4A11A 3EMHA 4GM9A 3P4FA 3RFGA 4LG8A 4A11B 1GOTB 4FA1D 1MG2A 4D6VA 4J8GA 4A0BA 3F3GA 4X63B 3RFHA 5IJ8E 4A0BB 4JD2C 4TZ4A 3MKQA 3UKUC 4CI3A 3L4MD 5C2WB 4L3GD 2EBSA 4ZOXA 4ERYA 3JRPA 2UZXB 5EMJB 4LGNA 3ORVD 2OIZA 4GGCA 2MTAH 3SLED 1GXRA 2BCJB 3SCYA 4A2MA 3PXTD 5B4WA 1OMWB 2P9IC 4O3TB 4AEZA 4PBZA 3DM0A 4J0WA 4HDJA 4FB1D 2OJYA 4A08A 2J57G 2PM9A 4A08B 2PM9B 2IAAA 4PC0A 3IKOA 4A2LA 4J87A 2AH1A 5KDOB 4O3UB 2AGWA 1B9XA 5FLXg 2TRCB 2PBIB 3DXMC 2YBAA 4K3ID 2I0SA 5GXHA 2OK4A 4FA5D 2CN2A 2HXCA 1PGUA 5HE1B 2YB8B 4QL1A 2P9LC 2XU7A 3GREA 4JSXC 4GQ2P 2IUVA 3V5WB 4XEIC 3IJCA 2CO0C 2Z2NA 4ZN4A 4K3JB 3I7KA 1JMZB 5AJAA 4PNKB 3HFQA 4ZOVA 3VA6A 2G99A 5JWZA 4GQBB 3OKYA 1L0QA 3C99A 3OW8A 3UVOA 4A0AA 4IA9A 3VH0A 3OKYB 2H9PA 4OZUA 4A0AB 4BUJC 3C9CA 5AMSA 5HQGA 3IJ0A 5IC7A 4GM3A 4J73A 4GGAA 2HKMA 2P9NC 1R5MA 4L3HD 5CXBA 5IGOA 5TEEA 4J79A 3RSEC 4GM8A 4CI2A 3BWSA 1N6EA 5CXBB 3K26A 5IJ7E 3JROA 3UKRC 3C75H 2CNXA 3PSLA 1PI6A 1TYQC 3UVMA 4J82A 3SFZA 5HE2B 4N14A 3AL8A 3I89A 3NVNA 4LG9A 3DWLC 3IIWA 3AL8B 3N0EA 2AGLA 2Z2OA 1MG3A 4X60B 3ULEC 3SVWD 1YFQA 3CFSB 3I7PA 3RRMC 2GNQA 2XL2A 1VYHC 1XHMA 4FWWA 3I7LA 5GXIA 5FXYA 3SMRA 5HYNB 3EI2A 3F3PA 2IWFA 4JXMA 4NSXA 3EI2B 5C9ZB 2HESX 4I79A 4GZ8A 3W15A 4JSPC 3C5MA 1B9YA 4D0KA 4J81A 1S4UX 3OL2A 4FHLA 5H1MA 4CY2A 2IUPA 4X61B 3OL2B 3I8CA 3NVQA 2W18A 4L1QD 1MDAH 2IURA 4J8BA 1PBYB 4G56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRJ A;  2HYE A;  4UI9 R;  2O9K A;  3JAM g;  4E54 A;  3RN0 D;  4H5J A;  1OLZ A;  3PSC B;  4JT5 C;  3KRX B;  4E54 B;  3UVL A;  4X3E A;  3MZL A;  1P22 A;  2J55 H;  4ERQ A;  5EAR A;  3PVW B;  3DXK C;  4CZV A;  5I5M A;  3OKW A;  5FKS A;  3FM0 A;  4PBY A;  2XYI A;  3EI3 A;  1Q47 A;  2J56 H;  2HKR A;  3JZH A;  3MZK A;  1XKS A;  2PM6 B;  2Q7Q A;  2YMU A;  2CE9 A;  3EI3 B;  2I0R A;  3I7O A;  4CZY A;  3RMZ D;  4FA9 D;  2CO0 A;  3EWE A;  5FKR A;  3SWS D;  2YNP A;  2Z2P A;  3CIK B;  5CYK A;  1NEX B;  3BG1 A;  3E0C A;  4FA4 D;  5CYK B;  5A2Q g;  5H14 A;  5TF2 A;  2H47 A;  2P9U C;  3ZWL B;  2G9A A;  3F3F A;  3AH8 B;  3K27 A;  3SN6 B;  4CY1 A;  2QXV A;  3J80 g;  4PSW B;  4CI8 A;  1FWX A;  5I5I A;  3MMY A;  1A0R B;  2YNO A;  2H13 A;  1SHY B;  4O1Q D;  3JB9 L;  2YNN A;  5AFU 3;  5FKQ A;  3AFC A;  1JJU B;  2XL3 A;  5SXM A;  4QT8 A;  2OVQ B;  3A0F A;  3B7F A;  2H68 A;  3EU7 A;  5IT9 g;  4A09 A;  3I7N A;  2HJ4 A;  3IJ1 A;  4E5Z A;  4BH6 A;  5K1C C;  3SHF A;  2IUQ A;  3PXW D;  4QQE A;  5GSA A;  4E5Z B;  2B5M A;  3PXS D;  2CN3 A;  1PEV A;  5FQD A;  5HE3 B;  3UVN A;  2B5N A;  3I8E A;  2P9S C;  5EAL A;  3MXX A;  4H5I A;  2H3X A;  4ES0 A;  1XIP A;  3EI1 A;  4JSN C;  2H9M A;  3EI1 B;  3FRX A;  5TDH B;  4L9O A;  5FA5 B;  2PM7 B;  5IGQ A;  5EML B;  2B4E A;  3I7H A;  4GQ1 A;  3BG0 A;  4CI1 A;  3SXT D;  3V7D B;  3UVK A;  1N6D A;  3NVX A;  4Y5R D;  2H6K A;  3RLM D;  2AGZ A;  5GMK n;  3OTT A;  3OKT A;  4ESG A;  2OVR B;  1RI6 A;  2OVP B;  3JPX A;  3I2N A;  3RN1 D;  1K8K C;  2GC7 A;  2IWK A;  3UR4 A;  4O45 A;  4CC9 A;  4CY3 A;  2BBK H;  4CZX A;  4KFM B;  1GP2 B;  3V9F A;  4R7A B;  2I0T A;  4FAV D;  4ZOZ A;  4ERZ A;  4U7A A;  4XYI A;  4A7J A;  3JZG A;  3MKS B;  2P9P C;  4J84 A;  4BL0 A;  2H9N A;  1SQ9 A;  2OK6 A;  4FAN D;  5EM2 A;  4J0X A;  3SJL D;  2GC4 A;  5C2V B;  3IIY A;  5EM2 B;  1JMX B;  3GFC A;  2H9L A;  2AQ5 A;  4PXW A;  3SBP A;  5H17 A;  2AGY A;  2H6N A;  1GG2 B;  2UZY B;  2H6Q A;  1ERJ A;  3L4O D;  4ZOY A;  3CFV A;  4CY5 A;  4U1E I;  3U4Y A;  3EG6 A;  2HJB A;  1TBG A;  4AOW A;  2AH0 A;  2P9K C;  4GMB A;  4OWR A;  4J86 A;  4Z8L A;  5I5J A;  3ODT A;  5THA A;  1JOF A;  2B5L A;  1SQJ A;  4Y7R A;  2AGX A;  2H14 A;  3EI4 A;  1U2V C;  3EI4 B;  5HE0 B;  4EWR A;  4MK0 B;  5CXC A;  2I3S A;  5EAM A;  1NR0 A;  3N0D A;  2QC5 A;  4XYH A;  5CXC B;  5FKT A;  3DSM A;  4J77 A;  5EAP A;  4A09 B;  3AL9 A;  3SBR A;  1N6F A;  3PE7 A;  1K32 A;  4GGD A;  4PSX B;  5TEF A;  5EMM B;  3PVU B;  2CE8 A;  5EMK B;  4YVD A;  3VGZ A;  3KRW B;  3JZN A;  3J81 g;  4J78 A;  3SBQ A;  4O9D A;  4JSV C;  2I3T A;  1U4C A;  4JT6 C;  3FGB A;  1QNI A;  4IMM A;  5K19 A;  4A11 A;  3EMH A;  4GM9 A;  3P4F A;  3RFG A;  4LG8 A;  4A11 B;  1GOT B;  4FA1 D;  1MG2 A;  4D6V A;  4J8G A;  4A0B A;  3F3G A;  4X63 B;  3RFH A;  5IJ8 E;  4A0B B;  4JD2 C;  4TZ4 A;  3MKQ A;  3UKU C;  4CI3 A;  3L4M D;  5C2W B;  4L3G D;  2EBS A;  4ZOX A;  4ERY A;  3JRP A;  2UZX B;  5EMJ B;  4LGN A;  3ORV D;  2OIZ A;  4GGC A;  2MTA H;  3SLE D;  1GXR A;  2BCJ B;  3SCY A;  4A2M A;  3PXT D;  5B4W A;  1OMW B;  2P9I C;  4O3T B;  4AEZ A;  4PBZ A;  3DM0 A;  4J0W A;  4HDJ A;  4FB1 D;  2OJY A;  4A08 A;  2J57 G;  2PM9 A;  4A08 B;  2PM9 B;  2IAA A;  4PC0 A;  3IKO A;  4A2L A;  4J87 A;  2AH1 A;  5KDO B;  4O3U B;  2AGW A;  1B9X A;  5FLX g;  2TRC B;  2PBI B;  3DXM C;  2YBA A;  4K3I D;  2I0S A;  5GXH A;  2OK4 A;  4FA5 D;  2CN2 A;  2HXC A;  1PGU A;  5HE1 B;  2YB8 B;  4QL1 A;  2P9L C;  2XU7 A;  3GRE A;  4JSX C;  4GQ2 P;  2IUV A;  3V5W B;  4XEI C;  3IJC A;  2CO0 C;  2Z2N A;  4ZN4 A;  4K3J B;  3I7K A;  1JMZ B;  5AJA A;  4PNK B;  3HFQ A;  4ZOV A;  3VA6 A;  2G99 A;  5JWZ A;  4GQB B;  3OKY A;  1L0Q A;  3C99 A;  3OW8 A;  3UVO A;  4A0A A;  4IA9 A;  3VH0 A;  3OKY B;  2H9P A;  4OZU A;  4A0A B;  4BUJ C;  3C9C A;  5AMS A;  5HQG A;  3IJ0 A;  5IC7 A;  4GM3 A;  4J73 A;  4GGA A;  2HKM A;  2P9N C;  1R5M A;  4L3H D;  5CXB A;  5IGO A;  5TEE A;  4J79 A;  3RSE C;  4GM8 A;  4CI2 A;  3BWS A;  1N6E A;  5CXB B;  3K26 A;  5IJ7 E;  3JRO A;  3UKR C;  3C75 H;  2CNX A;  3PSL A;  1PI6 A;  1TYQ C;  3UVM A;  4J82 A;  3SFZ A;  5HE2 B;  4N14 A;  3AL8 A;  3I89 A;  3NVN A;  4LG9 A;  3DWL C;  3IIW A;  3AL8 B;  3N0E A;  2AGL A;  2Z2O A;  1MG3 A;  4X60 B;  3ULE C;  3SVW D;  1YFQ A;  3CFS B;  3I7P A;  3RRM C;  2GNQ A;  2XL2 A;  1VYH C;  1XHM A;  4FWW A;  3I7L A;  5GXI A;  5FXY A;  3SMR A;  5HYN B;  3EI2 A;  3F3P A;  2IWF A;  4JXM A;  4NSX A;  3EI2 B;  5C9Z B;  2HES X;  4I79 A;  4GZ8 A;  3W15 A;  4JSP C;  3C5M A;  1B9Y A;  4D0K A;  4J81 A;  1S4U X;  3OL2 A;  4FHL A;  5H1M A;  4CY2 A;  2IUP A;  4X61 B;  3OL2 B;  3I8C A;  3NVQ A;  2W18 A;  4L1Q D;  1MDA H;  2IUR A;  4J8B A;  1PBY B;  4G56 B; 
#chains in the Genus database with same CATH topology
 4QRJ A;  2HYE A;  4UI9 R;  2O9K A;  4NEN A;  4WJK A;  4BCC A;  3JAM g;  5E6S A;  4E54 A;  3RN0 D;  4H5J A;  1OLZ A;  3PSC B;  4JT5 C;  3KRX B;  4E54 B;  3UVL A;  4X3E A;  3MZL A;  1P22 A;  2J55 H;  4ERQ A;  5EAR A;  1H2W A;  4MMY A;  3K71 A;  4Z7Q A;  4AN1 A;  3PVW B;  3DXK C;  4CZV A;  2XZG A;  1K3I A;  5I5M A;  3OKW A;  4BCB A;  5FKS A;  3FM0 A;  5M5T A;  4PBY A;  1UOP A;  2XYI A;  1Q47 A;  2J56 H;  2HKR A;  3EI3 A;  3JZH A;  3MZK A;  1XKS A;  2PM6 B;  2Q7Q A;  2YMU A;  2CE9 A;  3EI3 B;  2I0R A;  3I7O A;  3IUJ A;  4CZY A;  3RMZ D;  4FA9 D;  2CO0 A;  3EWE A;  3K6S A;  5FKR A;  3SWS D;  1C9I A;  3ZDY A;  2YNP A;  5E6U A;  2Z2P A;  3CIK B;  5CYK A;  1NEX B;  3BG1 A;  3E0C A;  4G55 A;  4FA4 D;  5CYK B;  5A2Q g;  4DNV A;  5H14 A;  5TF2 A;  2H47 A;  1A12 A;  2P9U C;  1QFS A;  3ZWL B;  2QR5 A;  2G9A A;  3F3F A;  3AH8 B;  3K27 A;  3FCU A;  3SN6 B;  2QXV A;  4CY1 A;  3J80 g;  4PSW B;  3ZDX A;  3NIG A;  3IVM A;  4CI8 A;  1FWX A;  5I5I A;  3MMY A;  4UM8 A;  1A0R B;  2YNO A;  2H13 A;  1SHY B;  4O1Q D;  3JB9 L;  2YNN A;  5AFU 3;  5FKQ A;  3AFC A;  1E5T A;  3O4G A;  1JJU B;  2XL3 A;  5SXM A;  4QT8 A;  2OVQ B;  3A0F A;  3B7F A;  2H68 A;  3EU7 A;  5IT9 g;  1E8N A;  4A09 A;  3I7N A;  1VE6 A;  2HJ4 A;  3IJ1 A;  5E6R A;  4E5Z A;  4L1M A;  4BH6 A;  4WK0 A;  5K1C C;  3SHF A;  2IUQ A;  3PXW D;  4QQE A;  4UM9 A;  5GSA A;  4E5Z B;  3FCS A;  3EQ7 A;  2B5M A;  3PXS D;  2CN3 A;  1PEV A;  5FQD A;  3T3M A;  5HE3 B;  1O6F A;  3UVN A;  2B5N A;  2XE4 A;  3T3P A;  3I8E A;  2P9S C;  5EAL A;  3MXX A;  4H5I A;  2H3X A;  4ES0 A;  1XIP A;  3EI1 A;  4JSN C;  1UOO A;  2H9M A;  3MVD K;  3EI1 B;  2VDM A;  3FRX A;  5TDH B;  4L9O A;  3IUM A;  5FA5 B;  2PM7 B;  5IGQ A;  5EML B;  2B4E A;  3I7H A;  4GQ1 A;  1UOQ A;  3BG0 A;  4CI1 A;  3SXT D;  3V7D B;  3UVK A;  1N6D A;  4Z7N A;  4AMZ A;  3NVX A;  1GOF A;  3V4P A;  4Y5R D;  2H6K A;  3RLM D;  2AGZ A;  5GMK n;  3OTT A;  3OKT A;  5HDB A;  3O4H A;  4ESG A;  2OVR B;  1RI6 A;  2OVP B;  3O4I A;  3JPX A;  3I2N A;  3RN1 D;  5FFG A;  1K8K C;  2GC7 A;  2IWK A;  2VDO A;  3UR4 A;  4O45 A;  4CC9 A;  4AMY A;  4CY3 A;  2BBK H;  4WK2 A;  4CZX A;  4KFM B;  1GP2 B;  3V9F A;  4R7A B;  2I0T A;  4FAV D;  4ZOZ A;  4ERZ A;  4G1M A;  4NBM A;  4U7A A;  1H2X A;  4XYI A;  4A7J A;  4O2W A;  3JZG A;  3MKS B;  3K72 A;  2P9P C;  4J84 A;  4BL0 A;  3QI0 A;  4Z7O A;  2H9N A;  1SQ9 A;  2OK6 A;  2XDW A;  2EIC A;  4FAN D;  5EM2 A;  1YR2 A;  4J0X A;  3QHY B;  3SJL D;  2GC4 A;  5C2V B;  3IIY A;  5EM2 B;  1JMX B;  3GFC A;  2H9L A;  2AQ5 A;  4PXW A;  1H2Y A;  3SBP A;  5H17 A;  4DNW A;  2AGY A;  2H6N A;  2VDQ A;  1GG2 B;  2UZY B;  2H6Q A;  1ERJ A;  3L4O D;  3IJE A;  4ZOY A;  3CFV A;  4CY5 A;  1O6G A;  4U1E I;  3U4Y A;  4G1E A;  4IRZ A;  1E8M A;  3ZE1 A;  3EG6 A;  2HJB A;  4RE6 A;  1TBG A;  4AOW A;  2AH0 A;  2P9K C;  4GMB A;  4OWR A;  4J86 A;  4O02 A;  4Z8L A;  4DNU A;  5I5J A;  3ODT A;  5THA A;  1T2X A;  1JOF A;  3VI3 A;  2B5L A;  3EQ8 A;  4JHP C;  3ZE2 A;  1SQJ A;  4Y7R A;  2AGX A;  2H14 A;  3EI4 A;  1JV2 A;  1U2V C;  3EI4 B;  5HE0 B;  3NID A;  4EWR A;  4MK0 B;  3GD1 I;  5CXC A;  3V4V A;  2I3S A;  5EAM A;  1NR0 A;  3N0D A;  2QC5 A;  4XYH A;  5CXC B;  5FKT A;  3DSM A;  4J77 A;  5EAP A;  4MMX A;  4A09 B;  3AL9 A;  3SBR A;  1N6F A;  3PE7 A;  1JTD B;  1K32 A;  4GGD A;  4PSX B;  5TEF A;  5EMM B;  3PVU B;  1H2Z A;  2VDL A;  3O4J A;  2CE8 A;  5EMK B;  2VZ1 A;  4YVD A;  3VGZ A;  3KRW B;  3JZN A;  3J81 g;  4J78 A;  3SBQ A;  4O9D A;  4JSV C;  2I3T A;  5C92 A;  3IUL A;  2HU7 A;  1U4C A;  2EID A;  4JT6 C;  3FGB A;  1QNI A;  4IMM A;  5K19 A;  4A11 A;  3EMH A;  2VDP A;  4GM9 A;  3P4F A;  3RFG A;  4LG8 A;  4A11 B;  1L5G A;  1GOT B;  3KCI A;  4FA1 D;  2BKL A;  1MG2 A;  2VDN A;  3OF7 A;  4J8G A;  4D6V A;  5FFO A;  4A0B A;  3F3G A;  2EIB A;  1VZ3 A;  5M61 A;  4X63 B;  3RFH A;  5IJ8 E;  4A0B B;  4JD2 C;  4TZ4 A;  3MKQ A;  3UKU C;  4CI3 A;  3L4M D;  5C2W B;  4L3G D;  2EBS A;  4ZOX A;  2HU5 A;  4ERY A;  3JRP A;  2UZX B;  5EMJ B;  4LGN A;  5M5S A;  3ORV D;  2OIZ A;  4GGC A;  2MTA H;  1M1X A;  3SLE D;  1GXR A;  2BCJ B;  3SCY A;  4A2M A;  3PXT D;  1VE7 A;  5B4W A;  1OMW B;  2P9I C;  4O3T B;  4AEZ A;  4QAM A;  4PBZ A;  3DM0 A;  4J0W A;  1I2M B;  4HDJ A;  2QZP A;  4FB1 D;  2OJY A;  4A08 A;  2HU8 A;  2J57 G;  2PM9 A;  5M5R A;  3DDU A;  4A08 B;  3VI4 A;  2PM9 B;  2IAA A;  4PC0 A;  3IKO A;  4A2L A;  4J87 A;  2JKX A;  5C86 A;  2AH1 A;  5KDO B;  4O3U B;  2AGW A;  1C9L A;  1B9X A;  2VC2 A;  5FLX g;  2TRC B;  5M5V A;  2PBI B;  3DXM C;  4BP9 A;  2YBA A;  4K3I D;  2I0S A;  2VDR A;  2OK4 A;  5GXH A;  4FA5 D;  2CN2 A;  2HXC A;  1PGU A;  5HE1 B;  1GOH A;  2YB8 B;  4BCD A;  4QL1 A;  2P9L C;  2XU7 A;  3GRE A;  4JSX C;  4JHN A;  3IUQ A;  4GQ2 P;  2IUV A;  3V5W B;  4XEI C;  3IJC A;  2CO0 C;  2Z2N A;  4ZN4 A;  4K3J B;  3I7K A;  1JMZ B;  5AJA A;  4PNK B;  4AN0 A;  5M5U A;  4NC4 A;  2VZ3 A;  3IUR A;  3HFQ A;  1VZ2 A;  4ZOV A;  2G99 A;  3VA6 A;  5JWZ A;  1TYE A;  3MUO A;  4GQB B;  1BPO A;  3OKY A;  1L0Q A;  3C99 A;  3OW8 A;  3UVO A;  4A0A A;  4IA9 A;  3VH0 A;  2VDK A;  3OKY B;  2H9P A;  4OZU A;  4A0A B;  3ZDZ A;  4BUJ C;  3C9C A;  3IUN A;  5AMS A;  4D9S A;  5HQG A;  3IJ0 A;  5IC7 A;  4GM3 A;  4J73 A;  4GGA A;  2HKM A;  1GOG A;  2P9N C;  1R5M A;  4L3H D;  5CXB A;  5IGO A;  5TEE A;  4J79 A;  3RSE C;  4GM8 A;  3MUN A;  4CI2 A;  3BWS A;  1N6E A;  5CXB B;  3K26 A;  5IJ7 E;  3ZE0 A;  3JRO A;  1QFM A;  3UKR C;  3C75 H;  2CNX A;  3PSL A;  1PI6 A;  1TYQ C;  3UVM A;  1U8C A;  4J82 A;  3SFZ A;  5HE2 B;  4N14 A;  3AL8 A;  3I89 A;  3NVN A;  4LG9 A;  4BP8 A;  3DWL C;  3IIW A;  3AL8 B;  3N0E A;  2AGL A;  2Z2O A;  1MG3 A;  4X60 B;  3ULE C;  3SVW D;  1YFQ A;  3CFS B;  3I7P A;  3RRM C;  2GNQ A;  3EQ9 A;  2XL2 A;  1VYH C;  4WK4 A;  1XHM A;  4FWW A;  2EIE A;  3I7L A;  5GXI A;  5FXY A;  3SMR A;  5HYN B;  3EI2 A;  3F3P A;  3GC3 B;  2IWF A;  4JXM A;  4NSX A;  4RE5 A;  3EI2 B;  5C9Z B;  2HES X;  4I79 A;  4GZ8 A;  3W15 A;  4AX4 A;  4JSP C;  3C5M A;  1B9Y A;  4MMZ A;  4D0K A;  4J81 A;  1S4U X;  3NIF A;  3OL2 A;  4FHL A;  2WQ8 A;  5H1M A;  4NAA A;  4CY2 A;  2IUP A;  4X61 B;  3OL2 B;  3I8C A;  3NVQ A;  2W18 A;  4L1Q D;  1MDA H;  2IUR A;  4J8B A;  1PBY B;  1UTC A;  4G56 B; 
#chains in the Genus database with same CATH homology
 4QRJ A;  2HYE A;  4UI9 R;  2O9K A;  3JAM g;  4E54 A;  3RN0 D;  4H5J A;  1OLZ A;  3PSC B;  4JT5 C;  3KRX B;  4E54 B;  3UVL A;  4X3E A;  3MZL A;  1P22 A;  2J55 H;  4ERQ A;  5EAR A;  3PVW B;  3DXK C;  4CZV A;  5I5M A;  3OKW A;  5FKS A;  3FM0 A;  4PBY A;  2XYI A;  3EI3 A;  1Q47 A;  2J56 H;  2HKR A;  3JZH A;  3MZK A;  1XKS A;  2PM6 B;  2Q7Q A;  2YMU A;  2CE9 A;  3EI3 B;  2I0R A;  3I7O A;  4CZY A;  3RMZ D;  4FA9 D;  2CO0 A;  3EWE A;  5FKR A;  3SWS D;  2YNP A;  2Z2P A;  3CIK B;  5CYK A;  1NEX B;  3BG1 A;  3E0C A;  4FA4 D;  5CYK B;  5A2Q g;  5H14 A;  5TF2 A;  2H47 A;  2P9U C;  3ZWL B;  2G9A A;  3F3F A;  3AH8 B;  3K27 A;  3SN6 B;  4CY1 A;  2QXV A;  3J80 g;  4PSW B;  4CI8 A;  1FWX A;  5I5I A;  3MMY A;  1A0R B;  2YNO A;  2H13 A;  1SHY B;  4O1Q D;  3JB9 L;  2YNN A;  5AFU 3;  5FKQ A;  3AFC A;  1JJU B;  2XL3 A;  5SXM A;  4QT8 A;  2OVQ B;  3A0F A;  3B7F A;  2H68 A;  3EU7 A;  5IT9 g;  4A09 A;  3I7N A;  2HJ4 A;  3IJ1 A;  4E5Z A;  4BH6 A;  5K1C C;  3SHF A;  2IUQ A;  3PXW D;  4QQE A;  5GSA A;  4E5Z B;  2B5M A;  3PXS D;  2CN3 A;  1PEV A;  5FQD A;  5HE3 B;  3UVN A;  2B5N A;  3I8E A;  2P9S C;  5EAL A;  3MXX A;  4H5I A;  2H3X A;  4ES0 A;  1XIP A;  3EI1 A;  4JSN C;  2H9M A;  3EI1 B;  3FRX A;  5TDH B;  4L9O A;  5FA5 B;  2PM7 B;  5IGQ A;  5EML B;  2B4E A;  3I7H A;  4GQ1 A;  3BG0 A;  4CI1 A;  3SXT D;  3V7D B;  3UVK A;  1N6D A;  3NVX A;  4Y5R D;  2H6K A;  3RLM D;  2AGZ A;  5GMK n;  3OTT A;  3OKT A;  4ESG A;  2OVR B;  1RI6 A;  2OVP B;  3JPX A;  3I2N A;  3RN1 D;  1K8K C;  2GC7 A;  2IWK A;  3UR4 A;  4O45 A;  4CC9 A;  4CY3 A;  2BBK H;  4CZX A;  4KFM B;  1GP2 B;  3V9F A;  4R7A B;  2I0T A;  4FAV D;  4ZOZ A;  4ERZ A;  4U7A A;  4XYI A;  4A7J A;  3JZG A;  3MKS B;  2P9P C;  4J84 A;  4BL0 A;  2H9N A;  1SQ9 A;  2OK6 A;  4FAN D;  5EM2 A;  4J0X A;  3SJL D;  2GC4 A;  5C2V B;  3IIY A;  5EM2 B;  1JMX B;  3GFC A;  2H9L A;  2AQ5 A;  4PXW A;  3SBP A;  5H17 A;  2AGY A;  2H6N A;  1GG2 B;  2UZY B;  2H6Q A;  1ERJ A;  3L4O D;  4ZOY A;  3CFV A;  4CY5 A;  4U1E I;  3U4Y A;  3EG6 A;  2HJB A;  1TBG A;  4AOW A;  2AH0 A;  2P9K C;  4GMB A;  4OWR A;  4J86 A;  4Z8L A;  5I5J A;  3ODT A;  5THA A;  1JOF A;  2B5L A;  1SQJ A;  4Y7R A;  2AGX A;  2H14 A;  3EI4 A;  1U2V C;  3EI4 B;  5HE0 B;  4EWR A;  4MK0 B;  5CXC A;  2I3S A;  5EAM A;  1NR0 A;  3N0D A;  2QC5 A;  4XYH A;  5CXC B;  5FKT A;  3DSM A;  4J77 A;  5EAP A;  4A09 B;  3AL9 A;  3SBR A;  1N6F A;  3PE7 A;  1K32 A;  4GGD A;  4PSX B;  5TEF A;  5EMM B;  3PVU B;  2CE8 A;  5EMK B;  4YVD A;  3VGZ A;  3KRW B;  3JZN A;  3J81 g;  4J78 A;  3SBQ A;  4O9D A;  4JSV C;  2I3T A;  1U4C A;  4JT6 C;  3FGB A;  1QNI A;  4IMM A;  5K19 A;  4A11 A;  3EMH A;  4GM9 A;  3P4F A;  3RFG A;  4LG8 A;  4A11 B;  1GOT B;  4FA1 D;  1MG2 A;  4D6V A;  4J8G A;  4A0B A;  3F3G A;  4X63 B;  3RFH A;  5IJ8 E;  4A0B B;  4JD2 C;  4TZ4 A;  3MKQ A;  3UKU C;  4CI3 A;  3L4M D;  5C2W B;  4L3G D;  2EBS A;  4ZOX A;  4ERY A;  3JRP A;  2UZX B;  5EMJ B;  4LGN A;  3ORV D;  2OIZ A;  4GGC A;  2MTA H;  3SLE D;  1GXR A;  2BCJ B;  3SCY A;  4A2M A;  3PXT D;  5B4W A;  1OMW B;  2P9I C;  4O3T B;  4AEZ A;  4PBZ A;  3DM0 A;  4J0W A;  4HDJ A;  4FB1 D;  2OJY A;  4A08 A;  2J57 G;  2PM9 A;  4A08 B;  2PM9 B;  2IAA A;  4PC0 A;  3IKO A;  4A2L A;  4J87 A;  2AH1 A;  5KDO B;  4O3U B;  2AGW A;  1B9X A;  5FLX g;  2TRC B;  2PBI B;  3DXM C;  2YBA A;  4K3I D;  2I0S A;  5GXH A;  2OK4 A;  4FA5 D;  2CN2 A;  2HXC A;  1PGU A;  5HE1 B;  2YB8 B;  4QL1 A;  2P9L C;  2XU7 A;  3GRE A;  4JSX C;  4GQ2 P;  2IUV A;  3V5W B;  4XEI C;  3IJC A;  2CO0 C;  2Z2N A;  4ZN4 A;  4K3J B;  3I7K A;  1JMZ B;  5AJA A;  4PNK B;  3HFQ A;  4ZOV A;  3VA6 A;  2G99 A;  5JWZ A;  4GQB B;  3OKY A;  1L0Q A;  3C99 A;  3OW8 A;  3UVO A;  4A0A A;  4IA9 A;  3VH0 A;  3OKY B;  2H9P A;  4OZU A;  4A0A B;  4BUJ C;  3C9C A;  5AMS A;  5HQG A;  3IJ0 A;  5IC7 A;  4GM3 A;  4J73 A;  4GGA A;  2HKM A;  2P9N C;  1R5M A;  4L3H D;  5CXB A;  5IGO A;  5TEE A;  4J79 A;  3RSE C;  4GM8 A;  4CI2 A;  3BWS A;  1N6E A;  5CXB B;  3K26 A;  5IJ7 E;  3JRO A;  3UKR C;  3C75 H;  2CNX A;  3PSL A;  1PI6 A;  1TYQ C;  3UVM A;  4J82 A;  3SFZ A;  5HE2 B;  4N14 A;  3AL8 A;  3I89 A;  3NVN A;  4LG9 A;  3DWL C;  3IIW A;  3AL8 B;  3N0E A;  2AGL A;  2Z2O A;  1MG3 A;  4X60 B;  3ULE C;  3SVW D;  1YFQ A;  3CFS B;  3I7P A;  3RRM C;  2GNQ A;  2XL2 A;  1VYH C;  1XHM A;  4FWW A;  3I7L A;  5GXI A;  5FXY A;  3SMR A;  5HYN B;  3EI2 A;  3F3P A;  2IWF A;  4JXM A;  4NSX A;  3EI2 B;  5C9Z B;  2HES X;  4I79 A;  4GZ8 A;  3W15 A;  4JSP C;  3C5M A;  1B9Y A;  4D0K A;  4J81 A;  1S4U X;  3OL2 A;  4FHL A;  5H1M A;  4CY2 A;  2IUP A;  4X61 B;  3OL2 B;  3I8C A;  3NVQ A;  2W18 A;  4L1Q D;  1MDA H;  2IUR A;  4J8B A;  1PBY B;  4G56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...