4J73A

Crystal structure of beta'-cop/p25 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
295
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 82
structure length 295
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j73A01
4LG9A 3RFGA 4LG8A 1PGUA 3I7LA 2Z2PA 3PVUB 4IA9A 3DXMC 4G56B 2XL3A 5EMJB 4J87A 3U4YA 2HKRA 4FAVD 4FWWA 4QT8A 4GQ1A 3EMHA 3ODTA 4CI8A 1PI6A 4E54A 4J0WA 5HE0B 2G9AA 4EWRA 2I3TA 1JMZB 2J55H 3SWSD 2H47A 3IIYA 2PM9B 3AL9A 3I7NA 3L4OD 5TF2A 5HQGA 3C99A 5K19A 4A09A 2BCJB 3SBPA 4QL1A 5K1CC 3E0CA 5FKSA 4JSXC 4J78A 5KDOB 1GXRA 5HE3B 5GMKn 4CZVA 2XU7A 5AJAA 3I8CA 4GZ8A 5AMSA 1B9YA 4A0AB 2GC4A 3JPXA 1GP2B 1YFQA 5THAA 3SJLD 1JOFA 3C5MA 4A11A 3OL2A 3ORVD 4PBYA 4U7AA 2XL2A 2GC7A 3AFCA 2CO0A 3PXWD 3F3GA 3EI2B 3L4MD 4J73A 1MG3A 3PE7A 1SQ9A 4ZN4A 5EALA 3GREA 4MK0B 1P22A 1QNIA 2H6QA 5H17A 2IURA 1TYQC 2IWKA 5IGOA 3JB9L 3NVQA 4J84A 3EWEA 1XHMA 3PVWB 1JMXB 4D6VA 4BH6A 2Q7QA 3I89A 4JSPC 4L1QD 5CYKA 2HJ4A 2I3SA 4GM9A 4D0KA 4O3TB 4J8GA 3SLED 3PSCB 2I0RA 5TEEA 4A0BB 4FHLA 3SBQA 2YBAA 4GGAA 5IGQA 3MMYA 4ERQA 3V7DB 2AGXA 4AEZA 4GGCA 3UKUC 3C75H 2IAAA 3JAMg 2P9LC 2P9IC 4FA9D 2W18A 4TZ4A 3N0DA 4X60B 4JT5C 3OKYB 5SXMA 2OK6A 3C9CA 4CI3A 3CFVA 5I5IA 1S4UX 4A08B 4LGNA 1RI6A 3EU7A 3NVNA 3UVKA 4E5ZA 3AL8B 3GFCA 4KFMB 2YMUA 5CXCB 4CZYA 4J81A 4J82A 4ERYA 3RRMC 3OW8A 4JT6C 2PM7B 4J0XA 5C2VB 4Z8LA 4JSVC 2PM9A 3SN6B 4PXWA 5TEFA 1N6EA 4J79A 5FQDA 5GXIA 2P9UC 1GG2B 2OVQB 3RLMD 3JZHA 3KRWB 3RN0D 4J8BA 2H14A 1PEVA 4CC9A 3BG0A 3B7FA 2CE8A 4A09B 4PBZA 4L3GD 3EI4A 4BL0A 4GQ2P 5FA5B 2CO0C 3OKTA 2TRCB 5HE2B 3MXXA 3PXSD 2IUPA 4A0AA 2HKMA 3I8EA 5AFU3 2IUVA 3PXTD 5H14A 3RSEC 5JWZA 1JJUB 3EI3A 1U4CA 2PBIB 2EBSA 3EI1A 2OIZA 2CN2A 3RN1D 2OJYA 4ES0A 4FB1D 5CXBB 3IKOA 2YB8B 1ERJA 2AH1A 2I0TA 5EM2A 2P9PC 2AQ5A 4JSNC 3EI2A 4CY3A 2MTAH 2P9NC 5FKRA 4K3JB 2XYIA 1N6FA 1TBGA 2OVPB 4OZUA 5TDHB 4PNKB 2O9KA 4FA4D 3JROA 4CI2A 3DWLC 5IJ8E 3K26A 3I7HA 4O1QD 4A2LA 3N0EA 1MDAH 5IJ7E 4A2MA 2GNQA 2AGYA 2HESX 3UVMA 4O45A 4PSXB 2YNNA 3W15A 5EMMB 4CZXA 4GMBA 4QRJA 2AGLA 2UZYB 5CYKB 2B5LA 3FGBA 5I5JA 1XKSA 4J77A 2B5MA 2IUQA 4GM8A 3SXTD 2YNPA 3RMZD 2PM6B 4X63B 4CY5A 3IJ0A 5FXYA 2H3XA 3DXKC 5FKTA 3VH0A 4AOWA 3V5WB 1K32A 4YVDA 4Y7RA 3OKYA 4NSXA 3V9FA 5HE1B 3ZWLB 5GXHA 4A08A 2G99A 2CE9A 4PC0A 1FWXA 5GSAA 3CFSB 3AL8A 1OLZA 2B5NA 4L9OA 3SCYA 5C2WB 4UI9R 4ZOXA 1NEXB 4X61B 1NR0A 2HYEA 4O3UB 2P9KC 3RFHA 2BBKH 1MG2A 4CI1A 3J81g 4CY2A 4E5ZB 3SMRA 4R7AB 2H9LA 5EMLB 3F3PA 4HDJA 2AH0A 2HJBA 3UVOA 4X3EA 3P4FA 4E54B 4XYIA 5C9ZB 3SBRA 4CY1A 5A2Qg 3KRXB 4FA1D 4FAND 1GOTB 3JZGA 4IMMA 1U2VC 3SVWD 2H68A 1L0QA 4GM3A 1N6DA 3DM0A 2H6NA 5EAMA 3HFQA 5H1MA 5HYNB 5I5MA 4BUJC 3F3FA 3I2NA 3JZNA 3IJ1A 3I7OA 4ZOYA 3IIWA 4OWRA 4J86A 3SFZA 4L3HD 3JRPA 4ESGA 3EI4B 4QQEA 2Z2OA 3BWSA 4ZOZA 3UKRC 2H6KA 1Q47A 1VYHC 5CXBA 4XEIC 5EAPA 4H5JA 4XYHA 5EARA 3OTTA 2I0SA 3IJCA 1OMWB 4A11B 3SHFA 3OL2B 3VA6A 3EI3B 3EI1B 2B4EA 3A0FA 2HXCA 1A0RB 2QC5A 3VGZA 1SQJA 4N14A 5FKQA 3FM0A 3BG1A 5EM2B 1XIPA 4I79A 3FRXA 1K8KC 4ERZA 4JD2C 2H9PA 4PSWB 2AGWA 4GGDA 1SHYB 3K27A 3J80g 4Y5RD 2Z2NA 4U1EI 3MKSB 2J57G 2J56H 2QXVA 3UVNA 3ULEC 1R5MA 2AGZA 4ZOVA 1B9XA 4A0BA 2UZXB 2IWFA 5EMKB 3UR4A 2H9MA 5IC7A 3I7KA 4JXMA 4FA5D 5B4WA 3I7PA 4A7JA 2CN3A 3EG6A 3MKQA 2OVRB 1PBYB 3UVLA 2OK4A 3MZKA 3DSMA 2H9NA 5IT9g 3PSLA 2YNOA 3MZLA 4K3ID 4O9DA 3AH8B 2H13A 5FLXg 3NVXA 3OKWA 2P9SC 2CNXA 4GQBB 3CIKB 5CXCA 4H5IA
chains in the Genus database with same CATH superfamily
4LG9A 3RFGA 4LG8A 1PGUA 3I7LA 2Z2PA 3PVUB 4IA9A 3IURA 3DXMC 4G56B 4JHNA 2XL3A 5EMJB 4J87A 3U4YA 2HKRA 2HU5A 4FAVD 4FWWA 4QT8A 4GQ1A 5M5SA 3EMHA 3ODTA 4CI8A 1PI6A 4E54A 4J0WA 2VDMA 5HE0B 2G9AA 4EWRA 2I3TA 1JMZB 2J55H 3SWSD 1E8NA 2H47A 3IIYA 2PM9B 3AL9A 3I7NA 3L4OD 5TF2A 5HQGA 3C99A 5K19A 4A09A 2BCJB 3SBPA 1E8MA 4QL1A 5K1CC 3E0CA 5FKSA 1UTCA 4JSXC 4J78A 5KDOB 1GXRA 5HE3B 5GMKn 4CZVA 3EQ9A 2XU7A 5AJAA 3I8CA 4GZ8A 5AMSA 1B9YA 4A0AB 2GC4A 3JPXA 1C9IA 1C9LA 1UOQA 2EICA 1GP2B 1YFQA 5THAA 3SJLD 5FFOA 1JOFA 4L1MA 3C5MA 4A11A 3OL2A 1O6GA 3QI0A 4MMXA 3ORVD 4PBYA 2XZGA 4U7AA 2XL2A 2GC7A 3AFCA 2HU7A 3ZE0A 2CO0A 4WJKA 3PXWD 3F3GA 3K72A 3EI2B 3L4MD 4J73A 1MG3A 3PE7A 3T3MA 1SQ9A 4BP9A 4ZN4A 5EALA 3GREA 4MK0B 1P22A 1QNIA 2H6QA 5H17A 2IURA 3V4PA 1TYQC 2XE4A 2IWKA 3IUJA 5IGOA 3JB9L 4NC4A 4D9SA 4QAMA 3NVQA 3IULA 4J84A 5E6UA 3EWEA 1XHMA 3PVWB 1JMXB 2VDPA 4D6VA 4MMYA 4BH6A 2Q7QA 1M1XA 3I89A 4JSPC 4AN1A 4L1QD 5CYKA 2HJ4A 2I3SA 4GM9A 4D0KA 4O3TB 3KCIA 4J8GA 3SLED 3PSCB 2I0RA 5TEEA 4A0BB 4FHLA 5M61A 3SBQA 2YBAA 4GGAA 3K6SA 5IGQA 1A12A 3MMYA 4ERQA 2VC2A 3V7DB 2AGXA 4AEZA 1H2YA 4GGCA 3UKUC 3C75H 3IVMA 4UM8A 2IAAA 3JAMg 2P9LC 2P9IC 4WK2A 4FA9D 2W18A 4TZ4A 3N0DA 4X60B 4JT5C 3OKYB 5SXMA 4BP8A 2OK6A 3C9CA 3MUNA 4CI3A 3CFVA 5I5IA 1VZ2A 1S4UX 4A08B 4LGNA 1RI6A 3EU7A 3NVNA 3UVKA 4E5ZA 3AL8B 3GFCA 4IRZA 1GOGA 4G55A 4KFMB 2VDRA 2YMUA 5CXCB 4CZYA 2VDLA 4DNUA 4J81A 4J82A 3NIDA 4ERYA 3RRMC 3OW8A 4JT6C 2PM7B 4J0XA 5C2VB 4Z8LA 4JSVC 5C86A 2PM9A 3SN6B 1YR2A 2VDKA 1T2XA 4PXWA 5TEFA 1N6EA 4NAAA 1L5GA 4J79A 3NIFA 5FQDA 3GD1I 5GXIA 4BCDA 2P9UC 1GG2B 2OVQB 3RLMD 3JZHA 3KRWB 3RN0D 4J8BA 5E6SA 2H14A 1PEVA 2VDNA 4G1EA 4CC9A 3BG0A 3B7FA 2CE8A 4A09B 4PBZA 4L3GD 3EI4A 4BL0A 4AX4A 5M5UA 3IUQA 1K3IA 4GQ2P 2CO0C 3OKTA 5FA5B 2TRCB 5HE2B 3MXXA 3PXSD 2IUPA 2XDWA 4A0AA 3IJEA 2HKMA 3I8EA 5M5TA 3MUOA 5AFU3 2IUVA 5HDBA 3PXTD 4MMZA 5H14A 3RSEC 5JWZA 1JJUB 3EI3A 1U4CA 2PBIB 2EBSA 4Z7OA 3EI1A 1VZ3A 2OIZA 2CN2A 5FFGA 3RN1D 2VDOA 2OJYA 4ES0A 4FB1D 1H2WA 5CXBB 3IKOA 2YB8B 1ERJA 2AH1A 2I0TA 4RE6A 5EM2A 2P9PC 4RE5A 2AQ5A 4JSNC 3EI2A 2VZ3A 4CY3A 1VE6A 2MTAH 2P9NC 5FKRA 4K3JB 2XYIA 1BPOA 1N6FA 2VDQA 1TBGA 2OVPB 4OZUA 5TDHB 4PNKB 2O9KA 4Z7QA 4FA4D 2QZPA 3JROA 4AN0A 4CI2A 4DNWA 1GOFA 2QR5A 3DWLC 5IJ8E 3K26A 1U8CA 4DNVA 3EQ7A 3I7HA 4O1QD 4A2LA 3N0EA 1MDAH 3O4HA 4WK0A 5IJ7E 4A2MA 1GOHA 2GNQA 4BCCA 2AGYA 2HESX 3UVMA 4O45A 4PSXB 2YNNA 3W15A 1E5TA 5EMMB 4CZXA 4GMBA 4QRJA 2AGLA 2UZYB 5CYKB 2B5LA 3FGBA 5I5JA 1XKSA 4J77A 2B5MA 2IUQA 4GM8A 3SXTD 2YNPA 3RMZD 2JKXA 2PM6B 4X63B 4CY5A 3IJ0A 5FXYA 2H3XA 3DXKC 5FKTA 3ZDZA 4AOWA 3VH0A 4UM9A 3V5WB 1K32A 4YVDA 4Y7RA 3OKYA 3VI4A 4NSXA 3V9FA 3O4GA 5HE1B 3ZWLB 4NENA 5GXHA 4A08A 2G99A 2CE9A 4PC0A 5E6RA 1FWXA 5GSAA 3CFSB 5M5VA 3AL8A 1OLZA 3EQ8A 2B5NA 4L9OA 3SCYA 5C2WB 4UI9R 1JV2A 4ZOXA 3ZDXA 1NEXB 4X61B 1I2MB 1NR0A 3OF7A 2HYEA 4O3UB 3FCSA 2P9KC 3RFHA 4AMYA 5C92A 2BBKH 1MG2A 4CI1A 3J81g 4CY2A 4E5ZB 3SMRA 4R7AB 2H9LA 5EMLB 3F3PA 4HDJA 2AH0A 2HJBA 3UVOA 4X3EA 3P4FA 2BKLA 4E54B 4XYIA 5C9ZB 3O4JA 3SBRA 4CY1A 5A2Qg 2EIEA 3KRXB 4O2WA 4FA1D 4FAND 1GOTB 3ZE2A 3O4IA 3JZGA 4IMMA 1U2VC 3SVWD 2H68A 1L0QA 4GM3A 1N6DA 3DM0A 2H6NA 5EAMA 3HFQA 5H1MA 5HYNB 5I5MA 1VE7A 4BUJC 3F3FA 3IUMA 3I2NA 3JZNA 3IJ1A 3I7OA 4ZOYA 3IIWA 4OWRA 4J86A 3SFZA 4L3HD 3DDUA 3JRPA 4ESGA 3EI4B 4QQEA 2Z2OA 3BWSA 4ZOZA 4NBMA 5M5RA 3UKRC 4Z7NA 2H6KA 1Q47A 2EIDA 1VYHC 3GC3B 5CXBA 4XEIC 5EAPA 4H5JA 4XYHA 5EARA 3OTTA 2I0SA 3IJCA 3QHYB 1OMWB 4O02A 4A11B 3SHFA 3OL2B 1QFMA 3EI3B 3VA6A 3ZDYA 3EI1B 2B4EA 3A0FA 2HXCA 1A0RB 1O6FA 2QC5A 3VGZA 3VI3A 1UOPA 1SQJA 4N14A 5FKQA 3FM0A 3BG1A 5EM2B 1XIPA 4I79A 3FRXA 4WK4A 1K8KC 4ERZA 4JD2C 2H9PA 4PSWB 2AGWA 4GGDA 1SHYB 3K27A 3J80g 4Y5RD 2Z2NA 4BCBA 4U1EI 3MKSB 2J57G 2J56H 2QXVA 1JTDB 3UVNA 3ULEC 1R5MA 2AGZA 4ZOVA 1B9XA 4A0BA 2UZXB 4AMZA 2VZ1A 2IWFA 5EMKB 3FCUA 3UR4A 3NIGA 1TYEA 2H9MA 5IC7A 3IUNA 2EIBA 3I7KA 4JXMA 1H2XA 1UOOA 4FA5D 5B4WA 3I7PA 4A7JA 3ZE1A 2CN3A 3EG6A 3MKQA 2OVRB 3K71A 1PBYB 3UVLA 1H2ZA 2OK4A 3MZKA 3DSMA 3T3PA 2H9NA 5IT9g 3PSLA 2YNOA 3MZLA 4K3ID 2WQ8A 4O9DA 3AH8B 2H13A 4JHPC 5FLXg 3NVXA 3OKWA 2HU8A 2P9SC 3V4VA 4G1MA 2CNXA 4GQBB 3CIKB 5CXCA 4H5IA 1QFSA 3MVDK
chains in the Genus database with same CATH topology
4LG9A 3RFGA 4LG8A 1PGUA 3I7LA 2Z2PA 3PVUB 4IA9A 3DXMC 4G56B 2XL3A 5EMJB 4J87A 3U4YA 2HKRA 4FAVD 4FWWA 4QT8A 4GQ1A 3EMHA 3ODTA 4CI8A 1PI6A 4E54A 4J0WA 5HE0B 2G9AA 4EWRA 2I3TA 1JMZB 2J55H 3SWSD 2H47A 3IIYA 2PM9B 3AL9A 3I7NA 3L4OD 5TF2A 5HQGA 3C99A 5K19A 4A09A 2BCJB 3SBPA 4QL1A 5K1CC 3E0CA 5FKSA 4JSXC 4J78A 5KDOB 1GXRA 5HE3B 5GMKn 4CZVA 2XU7A 5AJAA 3I8CA 4GZ8A 5AMSA 1B9YA 4A0AB 2GC4A 3JPXA 1GP2B 1YFQA 5THAA 3SJLD 1JOFA 3C5MA 4A11A 3OL2A 3ORVD 4PBYA 4U7AA 2XL2A 2GC7A 3AFCA 2CO0A 3PXWD 3F3GA 3EI2B 3L4MD 4J73A 1MG3A 3PE7A 1SQ9A 4ZN4A 5EALA 3GREA 4MK0B 1P22A 1QNIA 2H6QA 5H17A 2IURA 1TYQC 2IWKA 5IGOA 3JB9L 3NVQA 4J84A 3EWEA 1XHMA 3PVWB 1JMXB 4D6VA 4BH6A 2Q7QA 3I89A 4JSPC 4L1QD 5CYKA 2HJ4A 2I3SA 4GM9A 4D0KA 4O3TB 4J8GA 3SLED 3PSCB 2I0RA 5TEEA 4A0BB 4FHLA 3SBQA 2YBAA 4GGAA 5IGQA 3MMYA 4ERQA 3V7DB 2AGXA 4AEZA 4GGCA 3UKUC 3C75H 2IAAA 3JAMg 2P9LC 2P9IC 4FA9D 2W18A 4TZ4A 3N0DA 4X60B 4JT5C 3OKYB 5SXMA 2OK6A 3C9CA 4CI3A 3CFVA 5I5IA 1S4UX 4A08B 4LGNA 1RI6A 3EU7A 3NVNA 3UVKA 4E5ZA 3AL8B 3GFCA 4KFMB 2YMUA 5CXCB 4CZYA 4J81A 4J82A 4ERYA 3RRMC 3OW8A 4JT6C 2PM7B 4J0XA 5C2VB 4Z8LA 4JSVC 2PM9A 3SN6B 4PXWA 5TEFA 1N6EA 4J79A 5FQDA 5GXIA 2P9UC 1GG2B 2OVQB 3RLMD 3JZHA 3KRWB 3RN0D 4J8BA 2H14A 1PEVA 4CC9A 3BG0A 3B7FA 2CE8A 4A09B 4PBZA 4L3GD 3EI4A 4BL0A 4GQ2P 5FA5B 2CO0C 3OKTA 2TRCB 5HE2B 3MXXA 3PXSD 2IUPA 4A0AA 2HKMA 3I8EA 5AFU3 2IUVA 3PXTD 5H14A 3RSEC 5JWZA 1JJUB 3EI3A 1U4CA 2PBIB 2EBSA 3EI1A 2OIZA 2CN2A 3RN1D 2OJYA 4ES0A 4FB1D 5CXBB 3IKOA 2YB8B 1ERJA 2AH1A 2I0TA 5EM2A 2P9PC 2AQ5A 4JSNC 3EI2A 4CY3A 2MTAH 2P9NC 5FKRA 4K3JB 2XYIA 1N6FA 1TBGA 2OVPB 4OZUA 5TDHB 4PNKB 2O9KA 4FA4D 3JROA 4CI2A 3DWLC 5IJ8E 3K26A 3I7HA 4O1QD 4A2LA 3N0EA 1MDAH 5IJ7E 4A2MA 2GNQA 2AGYA 2HESX 3UVMA 4O45A 4PSXB 2YNNA 3W15A 5EMMB 4CZXA 4GMBA 4QRJA 2AGLA 2UZYB 5CYKB 2B5LA 3FGBA 5I5JA 1XKSA 4J77A 2B5MA 2IUQA 4GM8A 3SXTD 2YNPA 3RMZD 2PM6B 4X63B 4CY5A 3IJ0A 5FXYA 2H3XA 3DXKC 5FKTA 3VH0A 4AOWA 3V5WB 1K32A 4YVDA 4Y7RA 3OKYA 4NSXA 3V9FA 5HE1B 3ZWLB 5GXHA 4A08A 2G99A 2CE9A 4PC0A 1FWXA 5GSAA 3CFSB 3AL8A 1OLZA 2B5NA 4L9OA 3SCYA 5C2WB 4UI9R 4ZOXA 1NEXB 4X61B 1NR0A 2HYEA 4O3UB 2P9KC 3RFHA 2BBKH 1MG2A 4CI1A 3J81g 4CY2A 4E5ZB 3SMRA 4R7AB 2H9LA 5EMLB 3F3PA 4HDJA 2AH0A 2HJBA 3UVOA 4X3EA 3P4FA 4E54B 4XYIA 5C9ZB 3SBRA 4CY1A 5A2Qg 3KRXB 4FA1D 4FAND 1GOTB 3JZGA 4IMMA 1U2VC 3SVWD 2H68A 1L0QA 4GM3A 1N6DA 3DM0A 2H6NA 5EAMA 3HFQA 5H1MA 5HYNB 5I5MA 4BUJC 3F3FA 3I2NA 3JZNA 3IJ1A 3I7OA 4ZOYA 3IIWA 4OWRA 4J86A 3SFZA 4L3HD 3JRPA 4ESGA 3EI4B 4QQEA 2Z2OA 3BWSA 4ZOZA 3UKRC 2H6KA 1Q47A 1VYHC 5CXBA 4XEIC 5EAPA 4H5JA 4XYHA 5EARA 3OTTA 2I0SA 3IJCA 1OMWB 4A11B 3SHFA 3OL2B 3VA6A 3EI3B 3EI1B 2B4EA 3A0FA 2HXCA 1A0RB 2QC5A 3VGZA 1SQJA 4N14A 5FKQA 3FM0A 3BG1A 5EM2B 1XIPA 4I79A 3FRXA 1K8KC 4ERZA 4JD2C 2H9PA 4PSWB 2AGWA 4GGDA 1SHYB 3K27A 3J80g 4Y5RD 2Z2NA 4U1EI 3MKSB 2J57G 2J56H 2QXVA 3UVNA 3ULEC 1R5MA 2AGZA 4ZOVA 1B9XA 4A0BA 2UZXB 2IWFA 5EMKB 3UR4A 2H9MA 5IC7A 3I7KA 4JXMA 4FA5D 5B4WA 3I7PA 4A7JA 2CN3A 3EG6A 3MKQA 2OVRB 1PBYB 3UVLA 2OK4A 3MZKA 3DSMA 2H9NA 5IT9g 3PSLA 2YNOA 3MZLA 4K3ID 4O9DA 3AH8B 2H13A 5FLXg 3NVXA 3OKWA 2P9SC 2CNXA 4GQBB 3CIKB 5CXCA 4H5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG9 A;  3RFG A;  4LG8 A;  1PGU A;  3I7L A;  2Z2P A;  3PVU B;  4IA9 A;  3DXM C;  4G56 B;  2XL3 A;  5EMJ B;  4J87 A;  3U4Y A;  2HKR A;  4FAV D;  4FWW A;  4QT8 A;  4GQ1 A;  3EMH A;  3ODT A;  4CI8 A;  1PI6 A;  4E54 A;  4J0W A;  5HE0 B;  2G9A A;  4EWR A;  2I3T A;  1JMZ B;  2J55 H;  3SWS D;  2H47 A;  3IIY A;  2PM9 B;  3AL9 A;  3I7N A;  3L4O D;  5TF2 A;  5HQG A;  3C99 A;  5K19 A;  4A09 A;  2BCJ B;  3SBP A;  4QL1 A;  5K1C C;  3E0C A;  5FKS A;  4JSX C;  4J78 A;  5KDO B;  1GXR A;  5HE3 B;  5GMK n;  4CZV A;  2XU7 A;  5AJA A;  3I8C A;  4GZ8 A;  5AMS A;  1B9Y A;  4A0A B;  2GC4 A;  3JPX A;  1GP2 B;  1YFQ A;  5THA A;  3SJL D;  1JOF A;  3C5M A;  4A11 A;  3OL2 A;  3ORV D;  4PBY A;  4U7A A;  2XL2 A;  2GC7 A;  3AFC A;  2CO0 A;  3PXW D;  3F3G A;  3EI2 B;  3L4M D;  4J73 A;  1MG3 A;  3PE7 A;  1SQ9 A;  4ZN4 A;  5EAL A;  3GRE A;  4MK0 B;  1P22 A;  1QNI A;  2H6Q A;  5H17 A;  2IUR A;  1TYQ C;  2IWK A;  5IGO A;  3JB9 L;  3NVQ A;  4J84 A;  3EWE A;  1XHM A;  3PVW B;  1JMX B;  4D6V A;  4BH6 A;  2Q7Q A;  3I89 A;  4JSP C;  4L1Q D;  5CYK A;  2HJ4 A;  2I3S A;  4GM9 A;  4D0K A;  4O3T B;  4J8G A;  3SLE D;  3PSC B;  2I0R A;  5TEE A;  4A0B B;  4FHL A;  3SBQ A;  2YBA A;  4GGA A;  5IGQ A;  3MMY A;  4ERQ A;  3V7D B;  2AGX A;  4AEZ A;  4GGC A;  3UKU C;  3C75 H;  2IAA A;  3JAM g;  2P9L C;  2P9I C;  4FA9 D;  2W18 A;  4TZ4 A;  3N0D A;  4X60 B;  4JT5 C;  3OKY B;  5SXM A;  2OK6 A;  3C9C A;  4CI3 A;  3CFV A;  5I5I A;  1S4U X;  4A08 B;  4LGN A;  1RI6 A;  3EU7 A;  3NVN A;  3UVK A;  4E5Z A;  3AL8 B;  3GFC A;  4KFM B;  2YMU A;  5CXC B;  4CZY A;  4J81 A;  4J82 A;  4ERY A;  3RRM C;  3OW8 A;  4JT6 C;  2PM7 B;  4J0X A;  5C2V B;  4Z8L A;  4JSV C;  2PM9 A;  3SN6 B;  4PXW A;  5TEF A;  1N6E A;  4J79 A;  5FQD A;  5GXI A;  2P9U C;  1GG2 B;  2OVQ B;  3RLM D;  3JZH A;  3KRW B;  3RN0 D;  4J8B A;  2H14 A;  1PEV A;  4CC9 A;  3BG0 A;  3B7F A;  2CE8 A;  4A09 B;  4PBZ A;  4L3G D;  3EI4 A;  4BL0 A;  4GQ2 P;  5FA5 B;  2CO0 C;  3OKT A;  2TRC B;  5HE2 B;  3MXX A;  3PXS D;  2IUP A;  4A0A A;  2HKM A;  3I8E A;  5AFU 3;  2IUV A;  3PXT D;  5H14 A;  3RSE C;  5JWZ A;  1JJU B;  3EI3 A;  1U4C A;  2PBI B;  2EBS A;  3EI1 A;  2OIZ A;  2CN2 A;  3RN1 D;  2OJY A;  4ES0 A;  4FB1 D;  5CXB B;  3IKO A;  2YB8 B;  1ERJ A;  2AH1 A;  2I0T A;  5EM2 A;  2P9P C;  2AQ5 A;  4JSN C;  3EI2 A;  4CY3 A;  2MTA H;  2P9N C;  5FKR A;  4K3J B;  2XYI A;  1N6F A;  1TBG A;  2OVP B;  4OZU A;  5TDH B;  4PNK B;  2O9K A;  4FA4 D;  3JRO A;  4CI2 A;  3DWL C;  5IJ8 E;  3K26 A;  3I7H A;  4O1Q D;  4A2L A;  3N0E A;  1MDA H;  5IJ7 E;  4A2M A;  2GNQ A;  2AGY A;  2HES X;  3UVM A;  4O45 A;  4PSX B;  2YNN A;  3W15 A;  5EMM B;  4CZX A;  4GMB A;  4QRJ A;  2AGL A;  2UZY B;  5CYK B;  2B5L A;  3FGB A;  5I5J A;  1XKS A;  4J77 A;  2B5M A;  2IUQ A;  4GM8 A;  3SXT D;  2YNP A;  3RMZ D;  2PM6 B;  4X63 B;  4CY5 A;  3IJ0 A;  5FXY A;  2H3X A;  3DXK C;  5FKT A;  3VH0 A;  4AOW A;  3V5W B;  1K32 A;  4YVD A;  4Y7R A;  3OKY A;  4NSX A;  3V9F A;  5HE1 B;  3ZWL B;  5GXH A;  4A08 A;  2G99 A;  2CE9 A;  4PC0 A;  1FWX A;  5GSA A;  3CFS B;  3AL8 A;  1OLZ A;  2B5N A;  4L9O A;  3SCY A;  5C2W B;  4UI9 R;  4ZOX A;  1NEX B;  4X61 B;  1NR0 A;  2HYE A;  4O3U B;  2P9K C;  3RFH A;  2BBK H;  1MG2 A;  4CI1 A;  3J81 g;  4CY2 A;  4E5Z B;  3SMR A;  4R7A B;  2H9L A;  5EML B;  3F3P A;  4HDJ A;  2AH0 A;  2HJB A;  3UVO A;  4X3E A;  3P4F A;  4E54 B;  4XYI A;  5C9Z B;  3SBR A;  4CY1 A;  5A2Q g;  3KRX B;  4FA1 D;  4FAN D;  1GOT B;  3JZG A;  4IMM A;  1U2V C;  3SVW D;  2H68 A;  1L0Q A;  4GM3 A;  1N6D A;  3DM0 A;  2H6N A;  5EAM A;  3HFQ A;  5H1M A;  5HYN B;  5I5M A;  4BUJ C;  3F3F A;  3I2N A;  3JZN A;  3IJ1 A;  3I7O A;  4ZOY A;  3IIW A;  4OWR A;  4J86 A;  3SFZ A;  4L3H D;  3JRP A;  4ESG A;  3EI4 B;  4QQE A;  2Z2O A;  3BWS A;  4ZOZ A;  3UKR C;  2H6K A;  1Q47 A;  1VYH C;  5CXB A;  4XEI C;  5EAP A;  4H5J A;  4XYH A;  5EAR A;  3OTT A;  2I0S A;  3IJC A;  1OMW B;  4A11 B;  3SHF A;  3OL2 B;  3VA6 A;  3EI3 B;  3EI1 B;  2B4E A;  3A0F A;  2HXC A;  1A0R B;  2QC5 A;  3VGZ A;  1SQJ A;  4N14 A;  5FKQ A;  3FM0 A;  3BG1 A;  5EM2 B;  1XIP A;  4I79 A;  3FRX A;  1K8K C;  4ERZ A;  4JD2 C;  2H9P A;  4PSW B;  2AGW A;  4GGD A;  1SHY B;  3K27 A;  3J80 g;  4Y5R D;  2Z2N A;  4U1E I;  3MKS B;  2J57 G;  2J56 H;  2QXV A;  3UVN A;  3ULE C;  1R5M A;  2AGZ A;  4ZOV A;  1B9X A;  4A0B A;  2UZX B;  2IWF A;  5EMK B;  3UR4 A;  2H9M A;  5IC7 A;  3I7K A;  4JXM A;  4FA5 D;  5B4W A;  3I7P A;  4A7J A;  2CN3 A;  3EG6 A;  3MKQ A;  2OVR B;  1PBY B;  3UVL A;  2OK4 A;  3MZK A;  3DSM A;  2H9N A;  5IT9 g;  3PSL A;  2YNO A;  3MZL A;  4K3I D;  4O9D A;  3AH8 B;  2H13 A;  5FLX g;  3NVX A;  3OKW A;  2P9S C;  2CNX A;  4GQB B;  3CIK B;  5CXC A;  4H5I A; 
#chains in the Genus database with same CATH topology
 4LG9 A;  3RFG A;  4LG8 A;  1PGU A;  3I7L A;  2Z2P A;  3PVU B;  4IA9 A;  3IUR A;  3DXM C;  4G56 B;  4JHN A;  2XL3 A;  5EMJ B;  4J87 A;  3U4Y A;  2HKR A;  2HU5 A;  4FAV D;  4FWW A;  4QT8 A;  4GQ1 A;  5M5S A;  3EMH A;  3ODT A;  4CI8 A;  1PI6 A;  4E54 A;  4J0W A;  2VDM A;  5HE0 B;  2G9A A;  4EWR A;  2I3T A;  1JMZ B;  2J55 H;  3SWS D;  1E8N A;  2H47 A;  3IIY A;  2PM9 B;  3AL9 A;  3I7N A;  3L4O D;  5TF2 A;  5HQG A;  3C99 A;  5K19 A;  4A09 A;  2BCJ B;  3SBP A;  1E8M A;  4QL1 A;  5K1C C;  3E0C A;  5FKS A;  1UTC A;  4JSX C;  4J78 A;  5KDO B;  1GXR A;  5HE3 B;  5GMK n;  4CZV A;  3EQ9 A;  2XU7 A;  5AJA A;  3I8C A;  4GZ8 A;  5AMS A;  1B9Y A;  4A0A B;  2GC4 A;  3JPX A;  1C9I A;  1C9L A;  1UOQ A;  2EIC A;  1GP2 B;  1YFQ A;  5THA A;  3SJL D;  5FFO A;  1JOF A;  4L1M A;  3C5M A;  4A11 A;  3OL2 A;  1O6G A;  3QI0 A;  4MMX A;  3ORV D;  4PBY A;  2XZG A;  4U7A A;  2XL2 A;  2GC7 A;  3AFC A;  2HU7 A;  3ZE0 A;  2CO0 A;  4WJK A;  3PXW D;  3F3G A;  3K72 A;  3EI2 B;  3L4M D;  4J73 A;  1MG3 A;  3PE7 A;  3T3M A;  1SQ9 A;  4BP9 A;  4ZN4 A;  5EAL A;  3GRE A;  4MK0 B;  1P22 A;  1QNI A;  2H6Q A;  5H17 A;  2IUR A;  3V4P A;  1TYQ C;  2XE4 A;  2IWK A;  3IUJ A;  5IGO A;  3JB9 L;  4NC4 A;  4D9S A;  4QAM A;  3NVQ A;  3IUL A;  4J84 A;  5E6U A;  3EWE A;  1XHM A;  3PVW B;  1JMX B;  2VDP A;  4D6V A;  4MMY A;  4BH6 A;  2Q7Q A;  1M1X A;  3I89 A;  4JSP C;  4AN1 A;  4L1Q D;  5CYK A;  2HJ4 A;  2I3S A;  4GM9 A;  4D0K A;  4O3T B;  3KCI A;  4J8G A;  3SLE D;  3PSC B;  2I0R A;  5TEE A;  4A0B B;  4FHL A;  5M61 A;  3SBQ A;  2YBA A;  4GGA A;  3K6S A;  5IGQ A;  1A12 A;  3MMY A;  4ERQ A;  2VC2 A;  3V7D B;  2AGX A;  4AEZ A;  1H2Y A;  4GGC A;  3UKU C;  3C75 H;  3IVM A;  4UM8 A;  2IAA A;  3JAM g;  2P9L C;  2P9I C;  4WK2 A;  4FA9 D;  2W18 A;  4TZ4 A;  3N0D A;  4X60 B;  4JT5 C;  3OKY B;  5SXM A;  4BP8 A;  2OK6 A;  3C9C A;  3MUN A;  4CI3 A;  3CFV A;  5I5I A;  1VZ2 A;  1S4U X;  4A08 B;  4LGN A;  1RI6 A;  3EU7 A;  3NVN A;  3UVK A;  4E5Z A;  3AL8 B;  3GFC A;  4IRZ A;  1GOG A;  4G55 A;  4KFM B;  2VDR A;  2YMU A;  5CXC B;  4CZY A;  2VDL A;  4DNU A;  4J81 A;  4J82 A;  3NID A;  4ERY A;  3RRM C;  3OW8 A;  4JT6 C;  2PM7 B;  4J0X A;  5C2V B;  4Z8L A;  4JSV C;  5C86 A;  2PM9 A;  3SN6 B;  1YR2 A;  2VDK A;  1T2X A;  4PXW A;  5TEF A;  1N6E A;  4NAA A;  1L5G A;  4J79 A;  3NIF A;  5FQD A;  3GD1 I;  5GXI A;  4BCD A;  2P9U C;  1GG2 B;  2OVQ B;  3RLM D;  3JZH A;  3KRW B;  3RN0 D;  4J8B A;  5E6S A;  2H14 A;  1PEV A;  2VDN A;  4G1E A;  4CC9 A;  3BG0 A;  3B7F A;  2CE8 A;  4A09 B;  4PBZ A;  4L3G D;  3EI4 A;  4BL0 A;  4AX4 A;  5M5U A;  3IUQ A;  1K3I A;  4GQ2 P;  2CO0 C;  3OKT A;  5FA5 B;  2TRC B;  5HE2 B;  3MXX A;  3PXS D;  2IUP A;  2XDW A;  4A0A A;  3IJE A;  2HKM A;  3I8E A;  5M5T A;  3MUO A;  5AFU 3;  2IUV A;  5HDB A;  3PXT D;  4MMZ A;  5H14 A;  3RSE C;  5JWZ A;  1JJU B;  3EI3 A;  1U4C A;  2PBI B;  2EBS A;  4Z7O A;  3EI1 A;  1VZ3 A;  2OIZ A;  2CN2 A;  5FFG A;  3RN1 D;  2VDO A;  2OJY A;  4ES0 A;  4FB1 D;  1H2W A;  5CXB B;  3IKO A;  2YB8 B;  1ERJ A;  2AH1 A;  2I0T A;  4RE6 A;  5EM2 A;  2P9P C;  4RE5 A;  2AQ5 A;  4JSN C;  3EI2 A;  2VZ3 A;  4CY3 A;  1VE6 A;  2MTA H;  2P9N C;  5FKR A;  4K3J B;  2XYI A;  1BPO A;  1N6F A;  2VDQ A;  1TBG A;  2OVP B;  4OZU A;  5TDH B;  4PNK B;  2O9K A;  4Z7Q A;  4FA4 D;  2QZP A;  3JRO A;  4AN0 A;  4CI2 A;  4DNW A;  1GOF A;  2QR5 A;  3DWL C;  5IJ8 E;  3K26 A;  1U8C A;  4DNV A;  3EQ7 A;  3I7H A;  4O1Q D;  4A2L A;  3N0E A;  1MDA H;  3O4H A;  4WK0 A;  5IJ7 E;  4A2M A;  1GOH A;  2GNQ A;  4BCC A;  2AGY A;  2HES X;  3UVM A;  4O45 A;  4PSX B;  2YNN A;  3W15 A;  1E5T A;  5EMM B;  4CZX A;  4GMB A;  4QRJ A;  2AGL A;  2UZY B;  5CYK B;  2B5L A;  3FGB A;  5I5J A;  1XKS A;  4J77 A;  2B5M A;  2IUQ A;  4GM8 A;  3SXT D;  2YNP A;  3RMZ D;  2JKX A;  2PM6 B;  4X63 B;  4CY5 A;  3IJ0 A;  5FXY A;  2H3X A;  3DXK C;  5FKT A;  3ZDZ A;  4AOW A;  3VH0 A;  4UM9 A;  3V5W B;  1K32 A;  4YVD A;  4Y7R A;  3OKY A;  3VI4 A;  4NSX A;  3V9F A;  3O4G A;  5HE1 B;  3ZWL B;  4NEN A;  5GXH A;  4A08 A;  2G99 A;  2CE9 A;  4PC0 A;  5E6R A;  1FWX A;  5GSA A;  3CFS B;  5M5V A;  3AL8 A;  1OLZ A;  3EQ8 A;  2B5N A;  4L9O A;  3SCY A;  5C2W B;  4UI9 R;  1JV2 A;  4ZOX A;  3ZDX A;  1NEX B;  4X61 B;  1I2M B;  1NR0 A;  3OF7 A;  2HYE A;  4O3U B;  3FCS A;  2P9K C;  3RFH A;  4AMY A;  5C92 A;  2BBK H;  1MG2 A;  4CI1 A;  3J81 g;  4CY2 A;  4E5Z B;  3SMR A;  4R7A B;  2H9L A;  5EML B;  3F3P A;  4HDJ A;  2AH0 A;  2HJB A;  3UVO A;  4X3E A;  3P4F A;  2BKL A;  4E54 B;  4XYI A;  5C9Z B;  3O4J A;  3SBR A;  4CY1 A;  5A2Q g;  2EIE A;  3KRX B;  4O2W A;  4FA1 D;  4FAN D;  1GOT B;  3ZE2 A;  3O4I A;  3JZG A;  4IMM A;  1U2V C;  3SVW D;  2H68 A;  1L0Q A;  4GM3 A;  1N6D A;  3DM0 A;  2H6N A;  5EAM A;  3HFQ A;  5H1M A;  5HYN B;  5I5M A;  1VE7 A;  4BUJ C;  3F3F A;  3IUM A;  3I2N A;  3JZN A;  3IJ1 A;  3I7O A;  4ZOY A;  3IIW A;  4OWR A;  4J86 A;  3SFZ A;  4L3H D;  3DDU A;  3JRP A;  4ESG A;  3EI4 B;  4QQE A;  2Z2O A;  3BWS A;  4ZOZ A;  4NBM A;  5M5R A;  3UKR C;  4Z7N A;  2H6K A;  1Q47 A;  2EID A;  1VYH C;  3GC3 B;  5CXB A;  4XEI C;  5EAP A;  4H5J A;  4XYH A;  5EAR A;  3OTT A;  2I0S A;  3IJC A;  3QHY B;  1OMW B;  4O02 A;  4A11 B;  3SHF A;  3OL2 B;  1QFM A;  3EI3 B;  3VA6 A;  3ZDY A;  3EI1 B;  2B4E A;  3A0F A;  2HXC A;  1A0R B;  1O6F A;  2QC5 A;  3VGZ A;  3VI3 A;  1UOP A;  1SQJ A;  4N14 A;  5FKQ A;  3FM0 A;  3BG1 A;  5EM2 B;  1XIP A;  4I79 A;  3FRX A;  4WK4 A;  1K8K C;  4ERZ A;  4JD2 C;  2H9P A;  4PSW B;  2AGW A;  4GGD A;  1SHY B;  3K27 A;  3J80 g;  4Y5R D;  2Z2N A;  4BCB A;  4U1E I;  3MKS B;  2J57 G;  2J56 H;  2QXV A;  1JTD B;  3UVN A;  3ULE C;  1R5M A;  2AGZ A;  4ZOV A;  1B9X A;  4A0B A;  2UZX B;  4AMZ A;  2VZ1 A;  2IWF A;  5EMK B;  3FCU A;  3UR4 A;  3NIG A;  1TYE A;  2H9M A;  5IC7 A;  3IUN A;  2EIB A;  3I7K A;  4JXM A;  1H2X A;  1UOO A;  4FA5 D;  5B4W A;  3I7P A;  4A7J A;  3ZE1 A;  2CN3 A;  3EG6 A;  3MKQ A;  2OVR B;  3K71 A;  1PBY B;  3UVL A;  1H2Z A;  2OK4 A;  3MZK A;  3DSM A;  3T3P A;  2H9N A;  5IT9 g;  3PSL A;  2YNO A;  3MZL A;  4K3I D;  2WQ8 A;  4O9D A;  3AH8 B;  2H13 A;  4JHP C;  5FLX g;  3NVX A;  3OKW A;  2HU8 A;  2P9S C;  3V4V A;  4G1M A;  2CNX A;  4GQB B;  3CIK B;  5CXC A;  4H5I A;  1QFS A;  3MVD K; 
#chains in the Genus database with same CATH homology
 4LG9 A;  3RFG A;  4LG8 A;  1PGU A;  3I7L A;  2Z2P A;  3PVU B;  4IA9 A;  3DXM C;  4G56 B;  2XL3 A;  5EMJ B;  4J87 A;  3U4Y A;  2HKR A;  4FAV D;  4FWW A;  4QT8 A;  4GQ1 A;  3EMH A;  3ODT A;  4CI8 A;  1PI6 A;  4E54 A;  4J0W A;  5HE0 B;  2G9A A;  4EWR A;  2I3T A;  1JMZ B;  2J55 H;  3SWS D;  2H47 A;  3IIY A;  2PM9 B;  3AL9 A;  3I7N A;  3L4O D;  5TF2 A;  5HQG A;  3C99 A;  5K19 A;  4A09 A;  2BCJ B;  3SBP A;  4QL1 A;  5K1C C;  3E0C A;  5FKS A;  4JSX C;  4J78 A;  5KDO B;  1GXR A;  5HE3 B;  5GMK n;  4CZV A;  2XU7 A;  5AJA A;  3I8C A;  4GZ8 A;  5AMS A;  1B9Y A;  4A0A B;  2GC4 A;  3JPX A;  1GP2 B;  1YFQ A;  5THA A;  3SJL D;  1JOF A;  3C5M A;  4A11 A;  3OL2 A;  3ORV D;  4PBY A;  4U7A A;  2XL2 A;  2GC7 A;  3AFC A;  2CO0 A;  3PXW D;  3F3G A;  3EI2 B;  3L4M D;  4J73 A;  1MG3 A;  3PE7 A;  1SQ9 A;  4ZN4 A;  5EAL A;  3GRE A;  4MK0 B;  1P22 A;  1QNI A;  2H6Q A;  5H17 A;  2IUR A;  1TYQ C;  2IWK A;  5IGO A;  3JB9 L;  3NVQ A;  4J84 A;  3EWE A;  1XHM A;  3PVW B;  1JMX B;  4D6V A;  4BH6 A;  2Q7Q A;  3I89 A;  4JSP C;  4L1Q D;  5CYK A;  2HJ4 A;  2I3S A;  4GM9 A;  4D0K A;  4O3T B;  4J8G A;  3SLE D;  3PSC B;  2I0R A;  5TEE A;  4A0B B;  4FHL A;  3SBQ A;  2YBA A;  4GGA A;  5IGQ A;  3MMY A;  4ERQ A;  3V7D B;  2AGX A;  4AEZ A;  4GGC A;  3UKU C;  3C75 H;  2IAA A;  3JAM g;  2P9L C;  2P9I C;  4FA9 D;  2W18 A;  4TZ4 A;  3N0D A;  4X60 B;  4JT5 C;  3OKY B;  5SXM A;  2OK6 A;  3C9C A;  4CI3 A;  3CFV A;  5I5I A;  1S4U X;  4A08 B;  4LGN A;  1RI6 A;  3EU7 A;  3NVN A;  3UVK A;  4E5Z A;  3AL8 B;  3GFC A;  4KFM B;  2YMU A;  5CXC B;  4CZY A;  4J81 A;  4J82 A;  4ERY A;  3RRM C;  3OW8 A;  4JT6 C;  2PM7 B;  4J0X A;  5C2V B;  4Z8L A;  4JSV C;  2PM9 A;  3SN6 B;  4PXW A;  5TEF A;  1N6E A;  4J79 A;  5FQD A;  5GXI A;  2P9U C;  1GG2 B;  2OVQ B;  3RLM D;  3JZH A;  3KRW B;  3RN0 D;  4J8B A;  2H14 A;  1PEV A;  4CC9 A;  3BG0 A;  3B7F A;  2CE8 A;  4A09 B;  4PBZ A;  4L3G D;  3EI4 A;  4BL0 A;  4GQ2 P;  5FA5 B;  2CO0 C;  3OKT A;  2TRC B;  5HE2 B;  3MXX A;  3PXS D;  2IUP A;  4A0A A;  2HKM A;  3I8E A;  5AFU 3;  2IUV A;  3PXT D;  5H14 A;  3RSE C;  5JWZ A;  1JJU B;  3EI3 A;  1U4C A;  2PBI B;  2EBS A;  3EI1 A;  2OIZ A;  2CN2 A;  3RN1 D;  2OJY A;  4ES0 A;  4FB1 D;  5CXB B;  3IKO A;  2YB8 B;  1ERJ A;  2AH1 A;  2I0T A;  5EM2 A;  2P9P C;  2AQ5 A;  4JSN C;  3EI2 A;  4CY3 A;  2MTA H;  2P9N C;  5FKR A;  4K3J B;  2XYI A;  1N6F A;  1TBG A;  2OVP B;  4OZU A;  5TDH B;  4PNK B;  2O9K A;  4FA4 D;  3JRO A;  4CI2 A;  3DWL C;  5IJ8 E;  3K26 A;  3I7H A;  4O1Q D;  4A2L A;  3N0E A;  1MDA H;  5IJ7 E;  4A2M A;  2GNQ A;  2AGY A;  2HES X;  3UVM A;  4O45 A;  4PSX B;  2YNN A;  3W15 A;  5EMM B;  4CZX A;  4GMB A;  4QRJ A;  2AGL A;  2UZY B;  5CYK B;  2B5L A;  3FGB A;  5I5J A;  1XKS A;  4J77 A;  2B5M A;  2IUQ A;  4GM8 A;  3SXT D;  2YNP A;  3RMZ D;  2PM6 B;  4X63 B;  4CY5 A;  3IJ0 A;  5FXY A;  2H3X A;  3DXK C;  5FKT A;  3VH0 A;  4AOW A;  3V5W B;  1K32 A;  4YVD A;  4Y7R A;  3OKY A;  4NSX A;  3V9F A;  5HE1 B;  3ZWL B;  5GXH A;  4A08 A;  2G99 A;  2CE9 A;  4PC0 A;  1FWX A;  5GSA A;  3CFS B;  3AL8 A;  1OLZ A;  2B5N A;  4L9O A;  3SCY A;  5C2W B;  4UI9 R;  4ZOX A;  1NEX B;  4X61 B;  1NR0 A;  2HYE A;  4O3U B;  2P9K C;  3RFH A;  2BBK H;  1MG2 A;  4CI1 A;  3J81 g;  4CY2 A;  4E5Z B;  3SMR A;  4R7A B;  2H9L A;  5EML B;  3F3P A;  4HDJ A;  2AH0 A;  2HJB A;  3UVO A;  4X3E A;  3P4F A;  4E54 B;  4XYI A;  5C9Z B;  3SBR A;  4CY1 A;  5A2Q g;  3KRX B;  4FA1 D;  4FAN D;  1GOT B;  3JZG A;  4IMM A;  1U2V C;  3SVW D;  2H68 A;  1L0Q A;  4GM3 A;  1N6D A;  3DM0 A;  2H6N A;  5EAM A;  3HFQ A;  5H1M A;  5HYN B;  5I5M A;  4BUJ C;  3F3F A;  3I2N A;  3JZN A;  3IJ1 A;  3I7O A;  4ZOY A;  3IIW A;  4OWR A;  4J86 A;  3SFZ A;  4L3H D;  3JRP A;  4ESG A;  3EI4 B;  4QQE A;  2Z2O A;  3BWS A;  4ZOZ A;  3UKR C;  2H6K A;  1Q47 A;  1VYH C;  5CXB A;  4XEI C;  5EAP A;  4H5J A;  4XYH A;  5EAR A;  3OTT A;  2I0S A;  3IJC A;  1OMW B;  4A11 B;  3SHF A;  3OL2 B;  3VA6 A;  3EI3 B;  3EI1 B;  2B4E A;  3A0F A;  2HXC A;  1A0R B;  2QC5 A;  3VGZ A;  1SQJ A;  4N14 A;  5FKQ A;  3FM0 A;  3BG1 A;  5EM2 B;  1XIP A;  4I79 A;  3FRX A;  1K8K C;  4ERZ A;  4JD2 C;  2H9P A;  4PSW B;  2AGW A;  4GGD A;  1SHY B;  3K27 A;  3J80 g;  4Y5R D;  2Z2N A;  4U1E I;  3MKS B;  2J57 G;  2J56 H;  2QXV A;  3UVN A;  3ULE C;  1R5M A;  2AGZ A;  4ZOV A;  1B9X A;  4A0B A;  2UZX B;  2IWF A;  5EMK B;  3UR4 A;  2H9M A;  5IC7 A;  3I7K A;  4JXM A;  4FA5 D;  5B4W A;  3I7P A;  4A7J A;  2CN3 A;  3EG6 A;  3MKQ A;  2OVR B;  1PBY B;  3UVL A;  2OK4 A;  3MZK A;  3DSM A;  2H9N A;  5IT9 g;  3PSL A;  2YNO A;  3MZL A;  4K3I D;  4O9D A;  3AH8 B;  2H13 A;  5FLX g;  3NVX A;  3OKW A;  2P9S C;  2CNX A;  4GQB B;  3CIK B;  5CXC A;  4H5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...