4J73A

Crystal structure of beta'-cop/p25 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
295
Chain Sequence
b'KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHNYIASGFDNGFTVLSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 82
structure length 295
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j73A01
4FA4D 5EARA 5C2WB 3ZWLB 2AGYA 3IJ0A 4J87A 2YMUA 4J0WA 5CXBA 2B5MA 5AFU3 1K8KC 3I7NA 3MKQA 3CFVA 4EWRA 3BG1A 4J82A 2IUQA 3DXMC 1QNIA 3OKTA 4JD2C 4ZOVA 4QQEA 5FLXg 1U2VC 3CIKB 3KRXB 4FAVD 4CY2A 1XIPA 5CXBB 3BWSA 3JB9L 4N14A 4LGNA 4K3JB 1FWXA 4PSWB 4JSNC 1U4CA 3JAMg 4K3ID 2PM7B 2IURA 3FRXA 1P22A 3AH8B 3UVLA 4X60B 3C9CA 4BH6A 2BCJB 2OJYA 1TBGA 2YBAA 3UR4A 5FQDA 5FA5B 3F3FA 5C9ZB 3PVWB 2AGZA 4CY5A 3EI1A 5JWZA 4J8BA 4E5ZA 5I5IA 4U7AA 4GQBB 4G56B 3C99A 3ODTA 3AL9A 4PNKB 2H14A 3RN1D 4GGDA 2H9MA 3V7DB 4CZVA 3ORVD 3RRMC 3KRWB 3B7FA 5GSAA 3L4MD 4O9DA 3EI1B 3DWLC 2H68A 4OWRA 1GXRA 2PM6B 3UVKA 5B4WA 4FAND 5TF2A 2H9LA 3SVWD 1PGUA 5IJ8E 4ERZA 1XHMA 3SWSD 4LG8A 2O9KA 3IJCA 2GNQA 4H5IA 5FKTA 5EM2B 3IJ1A 3AFCA 2OIZA 4FHLA 3GREA 4ES0A 2YNNA 5FKRA 3IKOA 2H9PA 5H17A 3PSLA 1N6EA 3DXKC 4OZUA 3JZNA 4J77A 5CYKA 1K32A 3A0FA 5IJ7E 2AH1A 2HYEA 4J86A 3V5WB 3BG0A 4A0BA 3N0DA 1MG2A 3JPXA 1JJUB 4CI1A 3I7LA 3CFSB 4J81A 3MMYA 4FA9D 4GMBA 5CYKB 3E0CA 5HYNB 2H13A 1YFQA 2GC7A 1OMWB 2AGLA 5EMKB 2OVRB 4L9OA 3SBQA 5FXYA 1A0RB 4ZN4A 3F3PA 3U4YA 2H6KA 5AMSA 3C75H 4GZ8A 4A0BB 3I8CA 4D0KA 5IC7A 5FKQA 4A0AB 1S4UX 5HE1B 4ESGA 1RI6A 3EI3B 3JRPA 4LG9A 5K19A 4U1EI 1NR0A 3RLMD 2I0TA 1N6DA 4J73A 2BBKH 2CE9A 2TRCB 5EALA 3J80g 4CY3A 2IWFA 1PEVA 3OTTA 4ZOYA 3PSCB 3NVNA 2IUPA 2H3XA 5IGOA 2EBSA 3HFQA 3PXSD 5EMMB 3EWEA 2P9SC 2Z2OA 2CO0A 2I0RA 3L4OD 3SBRA 4J0XA 3SMRA 3GFCA 2P9PC 3AL8A 3MXXA 1ERJA 2H47A 2P9LC 2PBIB 4L3HD 4GGCA 4TZ4A 4CZXA 2QXVA 3EU7A 1TYQC 2PM9A 3FGBA 3I7KA 2H6QA 5H1MA 3FM0A 2UZYB 4GGAA 2P9NC 5EMLB 5HE3B 5A2Qg 3AL8B 3PVUB 4O3UB 3VGZA 4ZOXA 4ZOZA 2Z2NA 4CC9A 5SXMA 4ERQA 4R7AB 4GM3A 5IT9g 3EMHA 4JXMA 3MZKA 1NEXB 4E5ZB 5HQGA 4A7JA 5TDHB 4Y7RA 3RMZD 4XEIC 3PXTD 3DSMA 3N0EA 3SBPA 2HKMA 4X61B 4YVDA 4QL1A 4X63B 3I7OA 3IIWA 2XL2A 5CXCA 4A2MA 5HE2B 4FB1D 1XKSA 1MDAH 5FKSA 3I7HA 2I0SA 2B5NA 4I79A 1SQ9A 5H14A 1L0QA 4CZYA 1OLZA 3NVQA 2OVPB 3UKRC 3RSEC 3I7PA 3P4FA 3EG6A 4L1QD 2CO0C 5CXCB 3EI4A 4IMMA 2HESX 2AH0A 1SHYB 3DM0A 2HJ4A 2B4EA 5I5JA 2J57G 4X3EA 3MKSB 4KFMB 4PBZA 3RN0D 3UKUC 3I2NA 5THAA 3SN6B 1GP2B 4JSXC 2HJBA 5TEFA 4D6VA 3EI4B 4JSPC 2Q7QA 4AEZA 3SFZA 4XYHA 3RFGA 4PC0A 4XYIA 2G9AA 1PI6A 5IGQA 3I8EA 3OL2A 2J55H 4JSVC 3ULEC 1MG3A 2I3SA 2B5LA 4UI9R 3SXTD 4GM8A 2P9KC 5GMKn 4FA1D 3NVXA 4IA9A 5GXIA 4GM9A 3F3GA 2P9UC 3EI2A 1JOFA 4L3GD 3K26A 3JZGA 5EAPA 4QRJA 3SHFA 3OL2B 4J84A 4AOWA 4FWWA 1VYHC 2Z2PA 4JT5C 4FA5D 4JT6C 5AJAA 3V9FA 4PSXB 1PBYB 2IUVA 4PBYA 1SQJA 4MK0B 2XU7A 3JROA 3C5MA 2QC5A 1N6FA 5I5MA 4GQ2P 3UVNA 3J81g 3SJLD 1B9XA 2AGWA 1JMZB 2CNXA 2IAAA 2AGXA 4NSXA 3OKYA 4CI8A 3EI2B 4O45A 2PM9B 2YB8B 3K27A 5C2VB 4GQ1A 3OKWA 3RFHA 2CN2A 3UVMA 3MZLA 5GXHA 5HE0B 2UZXB 4O1QD 5EM2A 5EMJB 4ERYA 5EAMA 4BL0A 2OK4A 2I3TA 4HDJA 3PE7A 4A2LA 3OKYB 2CN3A 2OVQB 3IIYA 2XYIA 4J78A 5K1CC 4A09A 3VA6A 2HKRA 1B9YA 4A08A 2YNPA 3SCYA 2MTAH 4H5JA 3VH0A 4O3TB 4CI2A 2J56H 2GC4A 2W18A 2AQ5A 1R5MA 1GG2B 4A11A 4E54A 5KDOB 4A09B 4CY1A 2G99A 3JZHA 1JMXB 4A08B 2IWKA 2H6NA 3I89A 4J8GA 2OK6A 3OW8A 4BUJC 4A0AA 2YNOA 2XL3A 1GOTB 4PXWA 3SLED 3EI3A 4CI3A 3UVOA 4Z8LA 3W15A 4A11B 4E54B 4J79A 2HXCA 1Q47A 4QT8A 3PXWD 2P9IC 2CE8A 5TEEA 4Y5RD 2H9NA
chains in the Genus database with same CATH superfamily
4FA4D 4AN1A 5EARA 5C2WB 3ZWLB 2AGYA 3IJ0A 4J87A 2YMUA 4J0WA 5CXBA 2B5MA 5AFU3 1K8KC 3I7NA 3MKQA 3CFVA 4DNVA 4EWRA 3BG1A 2HU7A 2VDOA 5M5SA 4J82A 4NC4A 2IUQA 3DXMC 4WK2A 1QNIA 3OKTA 4JD2C 1JTDB 4ZOVA 4NENA 4BP9A 4QQEA 5FLXg 1U2VC 3CIKB 3KRXB 4FAVD 4CY2A 1XIPA 5CXBB 3BWSA 3JB9L 4N14A 4LGNA 4K3JB 1FWXA 4PSWB 4WK0A 3IJEA 4JSNC 1U4CA 3JAMg 4K3ID 2PM7B 2IURA 3FRXA 3V4PA 1P22A 3AH8B 3UVLA 4X60B 3C9CA 4BH6A 2BCJB 2OJYA 1TBGA 2YBAA 1VZ2A 3UR4A 5FQDA 5FA5B 3F3FA 5C9ZB 3PVWB 2AGZA 4CY5A 3EI1A 3IURA 5JWZA 4J8BA 4E5ZA 5I5IA 4DNUA 4U7AA 2VZ1A 2VC2A 4GQBB 4G56B 1GOFA 4D9SA 3C99A 3MUOA 3ODTA 3AL9A 1C9IA 4PNKB 2H14A 3RN1D 4GGDA 3T3PA 2H9MA 3V7DB 4CZVA 3ORVD 3RRMC 3KRWB 1GOGA 3B7FA 4O2WA 5GSAA 3L4MD 4O9DA 3EI1B 3DWLC 2H68A 4OWRA 1GXRA 2PM6B 3UVKA 5B4WA 4FAND 5TF2A 2H9LA 3SVWD 5E6SA 2JKXA 1PGUA 5IJ8E 4ERZA 1XHMA 3SWSD 4LG8A 4Z7NA 2O9KA 3IJCA 3IUJA 2GNQA 3QI0A 4H5IA 4WK4A 5FKTA 5EM2B 3IJ1A 3AFCA 2OIZA 4FHLA 3GREA 4ES0A 2YNNA 3FCUA 5FKRA 3IKOA 2H9PA 5H17A 3PSLA 1N6EA 3DXKC 4OZUA 3JZNA 4J77A 5CYKA 1K32A 3A0FA 4WJKA 3IVMA 5IJ7E 4JHPC 2AH1A 1E8NA 2HYEA 4J86A 3V5WB 3BG0A 5E6UA 4A0BA 3N0DA 1MG2A 1H2YA 3JPXA 1JJUB 4NBMA 4CI1A 3I7LA 3CFSB 4J81A 3MMYA 4FA9D 4GMBA 1QFMA 5CYKB 5M5VA 3E0CA 5HYNB 2H13A 2VDMA 4AN0A 1YFQA 2GC7A 1OMWB 2AGLA 5EMKB 2OVRB 4L9OA 3SBQA 5FXYA 1A0RB 4ZN4A 3F3PA 3U4YA 2H6KA 5AMSA 3C75H 4GZ8A 4A0BB 3I8CA 4D0KA 5IC7A 5FKQA 3T3MA 1H2XA 4A0AB 1S4UX 1K3IA 3EQ9A 5HE1B 4ESGA 1RI6A 4MMXA 3EI3B 3JRPA 4LG9A 4G1EA 5K19A 3IULA 1NR0A 4U1EI 3RLMD 2I0TA 5M5UA 4RE5A 1N6DA 3QHYB 4J73A 2BBKH 2CE9A 2TRCB 4DNWA 1UOPA 5EALA 3J80g 4CY3A 2IWFA 1PEVA 3OTTA 4ZOYA 3PSCB 3NVNA 2IUPA 2H3XA 5IGOA 2XDWA 2EBSA 3HFQA 3K71A 3PXSD 2VDNA 5EMMB 3EWEA 1H2WA 2P9SC 2Z2OA 2CO0A 2I0RA 3L4OD 3SBRA 4AX4A 4J0XA 3SMRA 3GFCA 4BP8A 2P9PC 3AL8A 3O4IA 3MXXA 1I2MB 1UOOA 1ERJA 2H47A 2P9LC 2PBIB 3NIGA 3O4HA 4GGCA 4L3HD 4TZ4A 4CZXA 5C86A 2QXVA 3EU7A 1TYQC 2PM9A 3FGBA 3I7KA 1JV2A 1O6FA 4UM8A 2H6QA 4UM9A 5H1MA 3FM0A 1H2ZA 2UZYB 4GGAA 2P9NC 4O02A 5EMLB 5HE3B 5A2Qg 1A12A 3AL8B 3PVUB 4O3UB 3VGZA 2VDLA 4ZOXA 4ZOZA 5M5TA 2WQ8A 2Z2NA 4CC9A 3OF7A 3GD1I 5SXMA 4ERQA 4R7AB 2EIEA 4GM3A 1VZ3A 5IT9g 3EMHA 4JXMA 3MZKA 1NEXB 4E5ZB 5HQGA 4A7JA 5TDHB 4Y7RA 3RMZD 4XEIC 3PXTD 3DSMA 1L5GA 3N0EA 3SBPA 2HKMA 1GOHA 4X61B 4YVDA 3V4VA 4QL1A 4X63B 3I7OA 3IIWA 5M61A 4G55A 2XL2A 5CXCA 2XZGA 4A2MA 5HE2B 4FB1D 2HU5A 1XKSA 1MDAH 5FKSA 3I7HA 2I0SA 2B5NA 4I79A 1SQ9A 5H14A 1L0QA 4CZYA 1OLZA 3FCSA 3NVQA 2OVPB 3UKRC 3RSEC 3I7PA 3P4FA 3EG6A 5HDBA 3MVDK 3O4JA 4L1QD 3ZE1A 3VI4A 2CO0C 5CXCB 4MMZA 4L1MA 3EI4A 4IMMA 2HESX 2AH0A 2VZ3A 1SHYB 3DM0A 2EIBA 2HJ4A 2B4EA 3ZDXA 1YR2A 4AMZA 5I5JA 4QAMA 2J57G 4Z7QA 1T2XA 4X3EA 3MKSB 4KFMB 1O6GA 4PBZA 2QR5A 3RN0D 3UKUC 3I2NA 1BPOA 5THAA 5E6RA 3SN6B 3IUQA 1M1XA 1GP2B 4JSXC 2HJBA 5TEFA 4D6VA 5C92A 3IUNA 3EI4B 4JSPC 2Q7QA 4AEZA 4RE6A 3SFZA 4XYHA 3RFGA 4PC0A 4XYIA 2G9AA 1PI6A 5IGQA 3K6SA 1UTCA 4AMYA 3I8EA 3OL2A 2J55H 4JSVC 3ULEC 2BKLA 1MG3A 2I3SA 4JHNA 2B5LA 4UI9R 1E8MA 3IUMA 3SXTD 4Z7OA 2EICA 4GM8A 2P9KC 5M5RA 1VE7A 4FA1D 5GMKn 3NVXA 1U8CA 4IA9A 3ZE0A 5GXIA 4GM9A 3F3GA 2P9UC 3EI2A 1JOFA 4L3GD 3K26A 3JZGA 5EAPA 3VI3A 4QRJA 3SHFA 5FFGA 3OL2B 4J84A 4AOWA 4FWWA 1VYHC 2Z2PA 4IRZA 4JT5C 4FA5D 4JT6C 5AJAA 5FFOA 3V9FA 4PSXB 1PBYB 2VDKA 2IUVA 1VE6A 1SQJA 2XE4A 3EQ8A 4MK0B 2XU7A 4PBYA 3JROA 3O4GA 3C5MA 3EQ7A 2QC5A 1N6FA 5I5MA 4GQ2P 3UVNA 3J81g 3SJLD 1B9XA 1QFSA 2AGWA 1JMZB 1UOQA 2CNXA 2AGXA 2IAAA 3OKYA 4NSXA 4CI8A 4O45A 3EI2B 1E5TA 2PM9B 2YB8B 3K27A 3NIDA 5C2VB 4GQ1A 3OKWA 3RFHA 2CN2A 3UVMA 3MZLA 5GXHA 5HE0B 3GC3B 2UZXB 4O1QD 5EM2A 5EMJB 4ERYA 5EAMA 4BL0A 2OK4A 2I3TA 4HDJA 3PE7A 3ZDZA 4G1MA 4A2LA 3OKYB 4BCBA 2CN3A 4BCDA 2OVQB 3IIYA 2XYIA 3KCIA 4J78A 3DDUA 5K1CC 4MMYA 4A09A 3VA6A 2HKRA 1B9YA 4A08A 2YNPA 3SCYA 2MTAH 3MUNA 4H5JA 3VH0A 2VDRA 4O3TB 1TYEA 4NAAA 4CI2A 2J56H 2GC4A 2VDPA 2W18A 2AQ5A 1R5MA 1GG2B 4A11A 4E54A 3ZE2A 5KDOB 2HU8A 4A09B 4CY1A 2EIDA 2G99A 3JZHA 1JMXB 2QZPA 4A08B 2IWKA 2H6NA 3I89A 4J8GA 2OK6A 3OW8A 4BUJC 1C9LA 3NIFA 3ZDYA 4A0AA 2YNOA 2XL3A 1GOTB 4PXWA 3SLED 2VDQA 3EI3A 4CI3A 3UVOA 4Z8LA 3W15A 4A11B 4E54B 3K72A 4J79A 2HXCA 1Q47A 4BCCA 4QT8A 3PXWD 2P9IC 2CE8A 5TEEA 4Y5RD 2H9NA
chains in the Genus database with same CATH topology
4FA4D 5EARA 5C2WB 3ZWLB 2AGYA 3IJ0A 4J87A 2YMUA 4J0WA 5CXBA 2B5MA 5AFU3 1K8KC 3I7NA 3MKQA 3CFVA 4EWRA 3BG1A 4J82A 2IUQA 3DXMC 1QNIA 3OKTA 4JD2C 4ZOVA 4QQEA 5FLXg 1U2VC 3CIKB 3KRXB 4FAVD 4CY2A 1XIPA 5CXBB 3BWSA 3JB9L 4N14A 4LGNA 4K3JB 1FWXA 4PSWB 4JSNC 1U4CA 3JAMg 4K3ID 2PM7B 2IURA 3FRXA 1P22A 3AH8B 3UVLA 4X60B 3C9CA 4BH6A 2BCJB 2OJYA 1TBGA 2YBAA 3UR4A 5FQDA 5FA5B 3F3FA 5C9ZB 3PVWB 2AGZA 4CY5A 3EI1A 5JWZA 4J8BA 4E5ZA 5I5IA 4U7AA 4GQBB 4G56B 3C99A 3ODTA 3AL9A 4PNKB 2H14A 3RN1D 4GGDA 2H9MA 3V7DB 4CZVA 3ORVD 3RRMC 3KRWB 3B7FA 5GSAA 3L4MD 4O9DA 3EI1B 3DWLC 2H68A 4OWRA 1GXRA 2PM6B 3UVKA 5B4WA 4FAND 5TF2A 2H9LA 3SVWD 1PGUA 5IJ8E 4ERZA 1XHMA 3SWSD 4LG8A 2O9KA 3IJCA 2GNQA 4H5IA 5FKTA 5EM2B 3IJ1A 3AFCA 2OIZA 4FHLA 3GREA 4ES0A 2YNNA 5FKRA 3IKOA 2H9PA 5H17A 3PSLA 1N6EA 3DXKC 4OZUA 3JZNA 4J77A 5CYKA 1K32A 3A0FA 5IJ7E 2AH1A 2HYEA 4J86A 3V5WB 3BG0A 4A0BA 3N0DA 1MG2A 3JPXA 1JJUB 4CI1A 3I7LA 3CFSB 4J81A 3MMYA 4FA9D 4GMBA 5CYKB 3E0CA 5HYNB 2H13A 1YFQA 2GC7A 1OMWB 2AGLA 5EMKB 2OVRB 4L9OA 3SBQA 5FXYA 1A0RB 4ZN4A 3F3PA 3U4YA 2H6KA 5AMSA 3C75H 4GZ8A 4A0BB 3I8CA 4D0KA 5IC7A 5FKQA 4A0AB 1S4UX 5HE1B 4ESGA 1RI6A 3EI3B 3JRPA 4LG9A 5K19A 4U1EI 1NR0A 3RLMD 2I0TA 1N6DA 4J73A 2BBKH 2CE9A 2TRCB 5EALA 3J80g 4CY3A 2IWFA 1PEVA 3OTTA 4ZOYA 3PSCB 3NVNA 2IUPA 2H3XA 5IGOA 2EBSA 3HFQA 3PXSD 5EMMB 3EWEA 2P9SC 2Z2OA 2CO0A 2I0RA 3L4OD 3SBRA 4J0XA 3SMRA 3GFCA 2P9PC 3AL8A 3MXXA 1ERJA 2H47A 2P9LC 2PBIB 4L3HD 4GGCA 4TZ4A 4CZXA 2QXVA 3EU7A 1TYQC 2PM9A 3FGBA 3I7KA 2H6QA 5H1MA 3FM0A 2UZYB 4GGAA 2P9NC 5EMLB 5HE3B 5A2Qg 3AL8B 3PVUB 4O3UB 3VGZA 4ZOXA 4ZOZA 2Z2NA 4CC9A 5SXMA 4ERQA 4R7AB 4GM3A 5IT9g 3EMHA 4JXMA 3MZKA 1NEXB 4E5ZB 5HQGA 4A7JA 5TDHB 4Y7RA 3RMZD 4XEIC 3PXTD 3DSMA 3N0EA 3SBPA 2HKMA 4X61B 4YVDA 4QL1A 4X63B 3I7OA 3IIWA 2XL2A 5CXCA 4A2MA 5HE2B 4FB1D 1XKSA 1MDAH 5FKSA 3I7HA 2I0SA 2B5NA 4I79A 1SQ9A 5H14A 1L0QA 4CZYA 1OLZA 3NVQA 2OVPB 3UKRC 3RSEC 3I7PA 3P4FA 3EG6A 4L1QD 2CO0C 5CXCB 3EI4A 4IMMA 2HESX 2AH0A 1SHYB 3DM0A 2HJ4A 2B4EA 5I5JA 2J57G 4X3EA 3MKSB 4KFMB 4PBZA 3RN0D 3UKUC 3I2NA 5THAA 3SN6B 1GP2B 4JSXC 2HJBA 5TEFA 4D6VA 3EI4B 4JSPC 2Q7QA 4AEZA 3SFZA 4XYHA 3RFGA 4PC0A 4XYIA 2G9AA 1PI6A 5IGQA 3I8EA 3OL2A 2J55H 4JSVC 3ULEC 1MG3A 2I3SA 2B5LA 4UI9R 3SXTD 4GM8A 2P9KC 5GMKn 4FA1D 3NVXA 4IA9A 5GXIA 4GM9A 3F3GA 2P9UC 3EI2A 1JOFA 4L3GD 3K26A 3JZGA 5EAPA 4QRJA 3SHFA 3OL2B 4J84A 4AOWA 4FWWA 1VYHC 2Z2PA 4JT5C 4FA5D 4JT6C 5AJAA 3V9FA 4PSXB 1PBYB 2IUVA 4PBYA 1SQJA 4MK0B 2XU7A 3JROA 3C5MA 2QC5A 1N6FA 5I5MA 4GQ2P 3UVNA 3J81g 3SJLD 1B9XA 2AGWA 1JMZB 2CNXA 2IAAA 2AGXA 4NSXA 3OKYA 4CI8A 3EI2B 4O45A 2PM9B 2YB8B 3K27A 5C2VB 4GQ1A 3OKWA 3RFHA 2CN2A 3UVMA 3MZLA 5GXHA 5HE0B 2UZXB 4O1QD 5EM2A 5EMJB 4ERYA 5EAMA 4BL0A 2OK4A 2I3TA 4HDJA 3PE7A 4A2LA 3OKYB 2CN3A 2OVQB 3IIYA 2XYIA 4J78A 5K1CC 4A09A 3VA6A 2HKRA 1B9YA 4A08A 2YNPA 3SCYA 2MTAH 4H5JA 3VH0A 4O3TB 4CI2A 2J56H 2GC4A 2W18A 2AQ5A 1R5MA 1GG2B 4A11A 4E54A 5KDOB 4A09B 4CY1A 2G99A 3JZHA 1JMXB 4A08B 2IWKA 2H6NA 3I89A 4J8GA 2OK6A 3OW8A 4BUJC 4A0AA 2YNOA 2XL3A 1GOTB 4PXWA 3SLED 3EI3A 4CI3A 3UVOA 4Z8LA 3W15A 4A11B 4E54B 4J79A 2HXCA 1Q47A 4QT8A 3PXWD 2P9IC 2CE8A 5TEEA 4Y5RD 2H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 D;  5EAR A;  5C2W B;  3ZWL B;  2AGY A;  3IJ0 A;  4J87 A;  2YMU A;  4J0W A;  5CXB A;  2B5M A;  5AFU 3;  1K8K C;  3I7N A;  3MKQ A;  3CFV A;  4EWR A;  3BG1 A;  4J82 A;  2IUQ A;  3DXM C;  1QNI A;  3OKT A;  4JD2 C;  4ZOV A;  4QQE A;  5FLX g;  1U2V C;  3CIK B;  3KRX B;  4FAV D;  4CY2 A;  1XIP A;  5CXB B;  3BWS A;  3JB9 L;  4N14 A;  4LGN A;  4K3J B;  1FWX A;  4PSW B;  4JSN C;  1U4C A;  3JAM g;  4K3I D;  2PM7 B;  2IUR A;  3FRX A;  1P22 A;  3AH8 B;  3UVL A;  4X60 B;  3C9C A;  4BH6 A;  2BCJ B;  2OJY A;  1TBG A;  2YBA A;  3UR4 A;  5FQD A;  5FA5 B;  3F3F A;  5C9Z B;  3PVW B;  2AGZ A;  4CY5 A;  3EI1 A;  5JWZ A;  4J8B A;  4E5Z A;  5I5I A;  4U7A A;  4GQB B;  4G56 B;  3C99 A;  3ODT A;  3AL9 A;  4PNK B;  2H14 A;  3RN1 D;  4GGD A;  2H9M A;  3V7D B;  4CZV A;  3ORV D;  3RRM C;  3KRW B;  3B7F A;  5GSA A;  3L4M D;  4O9D A;  3EI1 B;  3DWL C;  2H68 A;  4OWR A;  1GXR A;  2PM6 B;  3UVK A;  5B4W A;  4FAN D;  5TF2 A;  2H9L A;  3SVW D;  1PGU A;  5IJ8 E;  4ERZ A;  1XHM A;  3SWS D;  4LG8 A;  2O9K A;  3IJC A;  2GNQ A;  4H5I A;  5FKT A;  5EM2 B;  3IJ1 A;  3AFC A;  2OIZ A;  4FHL A;  3GRE A;  4ES0 A;  2YNN A;  5FKR A;  3IKO A;  2H9P A;  5H17 A;  3PSL A;  1N6E A;  3DXK C;  4OZU A;  3JZN A;  4J77 A;  5CYK A;  1K32 A;  3A0F A;  5IJ7 E;  2AH1 A;  2HYE A;  4J86 A;  3V5W B;  3BG0 A;  4A0B A;  3N0D A;  1MG2 A;  3JPX A;  1JJU B;  4CI1 A;  3I7L A;  3CFS B;  4J81 A;  3MMY A;  4FA9 D;  4GMB A;  5CYK B;  3E0C A;  5HYN B;  2H13 A;  1YFQ A;  2GC7 A;  1OMW B;  2AGL A;  5EMK B;  2OVR B;  4L9O A;  3SBQ A;  5FXY A;  1A0R B;  4ZN4 A;  3F3P A;  3U4Y A;  2H6K A;  5AMS A;  3C75 H;  4GZ8 A;  4A0B B;  3I8C A;  4D0K A;  5IC7 A;  5FKQ A;  4A0A B;  1S4U X;  5HE1 B;  4ESG A;  1RI6 A;  3EI3 B;  3JRP A;  4LG9 A;  5K19 A;  4U1E I;  1NR0 A;  3RLM D;  2I0T A;  1N6D A;  4J73 A;  2BBK H;  2CE9 A;  2TRC B;  5EAL A;  3J80 g;  4CY3 A;  2IWF A;  1PEV A;  3OTT A;  4ZOY A;  3PSC B;  3NVN A;  2IUP A;  2H3X A;  5IGO A;  2EBS A;  3HFQ A;  3PXS D;  5EMM B;  3EWE A;  2P9S C;  2Z2O A;  2CO0 A;  2I0R A;  3L4O D;  3SBR A;  4J0X A;  3SMR A;  3GFC A;  2P9P C;  3AL8 A;  3MXX A;  1ERJ A;  2H47 A;  2P9L C;  2PBI B;  4L3H D;  4GGC A;  4TZ4 A;  4CZX A;  2QXV A;  3EU7 A;  1TYQ C;  2PM9 A;  3FGB A;  3I7K A;  2H6Q A;  5H1M A;  3FM0 A;  2UZY B;  4GGA A;  2P9N C;  5EML B;  5HE3 B;  5A2Q g;  3AL8 B;  3PVU B;  4O3U B;  3VGZ A;  4ZOX A;  4ZOZ A;  2Z2N A;  4CC9 A;  5SXM A;  4ERQ A;  4R7A B;  4GM3 A;  5IT9 g;  3EMH A;  4JXM A;  3MZK A;  1NEX B;  4E5Z B;  5HQG A;  4A7J A;  5TDH B;  4Y7R A;  3RMZ D;  4XEI C;  3PXT D;  3DSM A;  3N0E A;  3SBP A;  2HKM A;  4X61 B;  4YVD A;  4QL1 A;  4X63 B;  3I7O A;  3IIW A;  2XL2 A;  5CXC A;  4A2M A;  5HE2 B;  4FB1 D;  1XKS A;  1MDA H;  5FKS A;  3I7H A;  2I0S A;  2B5N A;  4I79 A;  1SQ9 A;  5H14 A;  1L0Q A;  4CZY A;  1OLZ A;  3NVQ A;  2OVP B;  3UKR C;  3RSE C;  3I7P A;  3P4F A;  3EG6 A;  4L1Q D;  2CO0 C;  5CXC B;  3EI4 A;  4IMM A;  2HES X;  2AH0 A;  1SHY B;  3DM0 A;  2HJ4 A;  2B4E A;  5I5J A;  2J57 G;  4X3E A;  3MKS B;  4KFM B;  4PBZ A;  3RN0 D;  3UKU C;  3I2N A;  5THA A;  3SN6 B;  1GP2 B;  4JSX C;  2HJB A;  5TEF A;  4D6V A;  3EI4 B;  4JSP C;  2Q7Q A;  4AEZ A;  3SFZ A;  4XYH A;  3RFG A;  4PC0 A;  4XYI A;  2G9A A;  1PI6 A;  5IGQ A;  3I8E A;  3OL2 A;  2J55 H;  4JSV C;  3ULE C;  1MG3 A;  2I3S A;  2B5L A;  4UI9 R;  3SXT D;  4GM8 A;  2P9K C;  5GMK n;  4FA1 D;  3NVX A;  4IA9 A;  5GXI A;  4GM9 A;  3F3G A;  2P9U C;  3EI2 A;  1JOF A;  4L3G D;  3K26 A;  3JZG A;  5EAP A;  4QRJ A;  3SHF A;  3OL2 B;  4J84 A;  4AOW A;  4FWW A;  1VYH C;  2Z2P A;  4JT5 C;  4FA5 D;  4JT6 C;  5AJA A;  3V9F A;  4PSX B;  1PBY B;  2IUV A;  4PBY A;  1SQJ A;  4MK0 B;  2XU7 A;  3JRO A;  3C5M A;  2QC5 A;  1N6F A;  5I5M A;  4GQ2 P;  3UVN A;  3J81 g;  3SJL D;  1B9X A;  2AGW A;  1JMZ B;  2CNX A;  2IAA A;  2AGX A;  4NSX A;  3OKY A;  4CI8 A;  3EI2 B;  4O45 A;  2PM9 B;  2YB8 B;  3K27 A;  5C2V B;  4GQ1 A;  3OKW A;  3RFH A;  2CN2 A;  3UVM A;  3MZL A;  5GXH A;  5HE0 B;  2UZX B;  4O1Q D;  5EM2 A;  5EMJ B;  4ERY A;  5EAM A;  4BL0 A;  2OK4 A;  2I3T A;  4HDJ A;  3PE7 A;  4A2L A;  3OKY B;  2CN3 A;  2OVQ B;  3IIY A;  2XYI A;  4J78 A;  5K1C C;  4A09 A;  3VA6 A;  2HKR A;  1B9Y A;  4A08 A;  2YNP A;  3SCY A;  2MTA H;  4H5J A;  3VH0 A;  4O3T B;  4CI2 A;  2J56 H;  2GC4 A;  2W18 A;  2AQ5 A;  1R5M A;  1GG2 B;  4A11 A;  4E54 A;  5KDO B;  4A09 B;  4CY1 A;  2G99 A;  3JZH A;  1JMX B;  4A08 B;  2IWK A;  2H6N A;  3I89 A;  4J8G A;  2OK6 A;  3OW8 A;  4BUJ C;  4A0A A;  2YNO A;  2XL3 A;  1GOT B;  4PXW A;  3SLE D;  3EI3 A;  4CI3 A;  3UVO A;  4Z8L A;  3W15 A;  4A11 B;  4E54 B;  4J79 A;  2HXC A;  1Q47 A;  4QT8 A;  3PXW D;  2P9I C;  2CE8 A;  5TEE A;  4Y5R D;  2H9N A; 
#chains in the Genus database with same CATH topology
 4FA4 D;  4AN1 A;  5EAR A;  5C2W B;  3ZWL B;  2AGY A;  3IJ0 A;  4J87 A;  2YMU A;  4J0W A;  5CXB A;  2B5M A;  5AFU 3;  1K8K C;  3I7N A;  3MKQ A;  3CFV A;  4DNV A;  4EWR A;  3BG1 A;  2HU7 A;  2VDO A;  5M5S A;  4J82 A;  4NC4 A;  2IUQ A;  3DXM C;  4WK2 A;  1QNI A;  3OKT A;  4JD2 C;  1JTD B;  4ZOV A;  4NEN A;  4BP9 A;  4QQE A;  5FLX g;  1U2V C;  3CIK B;  3KRX B;  4FAV D;  4CY2 A;  1XIP A;  5CXB B;  3BWS A;  3JB9 L;  4N14 A;  4LGN A;  4K3J B;  1FWX A;  4PSW B;  4WK0 A;  3IJE A;  4JSN C;  1U4C A;  3JAM g;  4K3I D;  2PM7 B;  2IUR A;  3FRX A;  3V4P A;  1P22 A;  3AH8 B;  3UVL A;  4X60 B;  3C9C A;  4BH6 A;  2BCJ B;  2OJY A;  1TBG A;  2YBA A;  1VZ2 A;  3UR4 A;  5FQD A;  5FA5 B;  3F3F A;  5C9Z B;  3PVW B;  2AGZ A;  4CY5 A;  3EI1 A;  3IUR A;  5JWZ A;  4J8B A;  4E5Z A;  5I5I A;  4DNU A;  4U7A A;  2VZ1 A;  2VC2 A;  4GQB B;  4G56 B;  1GOF A;  4D9S A;  3C99 A;  3MUO A;  3ODT A;  3AL9 A;  1C9I A;  4PNK B;  2H14 A;  3RN1 D;  4GGD A;  3T3P A;  2H9M A;  3V7D B;  4CZV A;  3ORV D;  3RRM C;  3KRW B;  1GOG A;  3B7F A;  4O2W A;  5GSA A;  3L4M D;  4O9D A;  3EI1 B;  3DWL C;  2H68 A;  4OWR A;  1GXR A;  2PM6 B;  3UVK A;  5B4W A;  4FAN D;  5TF2 A;  2H9L A;  3SVW D;  5E6S A;  2JKX A;  1PGU A;  5IJ8 E;  4ERZ A;  1XHM A;  3SWS D;  4LG8 A;  4Z7N A;  2O9K A;  3IJC A;  3IUJ A;  2GNQ A;  3QI0 A;  4H5I A;  4WK4 A;  5FKT A;  5EM2 B;  3IJ1 A;  3AFC A;  2OIZ A;  4FHL A;  3GRE A;  4ES0 A;  2YNN A;  3FCU A;  5FKR A;  3IKO A;  2H9P A;  5H17 A;  3PSL A;  1N6E A;  3DXK C;  4OZU A;  3JZN A;  4J77 A;  5CYK A;  1K32 A;  3A0F A;  4WJK A;  3IVM A;  5IJ7 E;  4JHP C;  2AH1 A;  1E8N A;  2HYE A;  4J86 A;  3V5W B;  3BG0 A;  5E6U A;  4A0B A;  3N0D A;  1MG2 A;  1H2Y A;  3JPX A;  1JJU B;  4NBM A;  4CI1 A;  3I7L A;  3CFS B;  4J81 A;  3MMY A;  4FA9 D;  4GMB A;  1QFM A;  5CYK B;  5M5V A;  3E0C A;  5HYN B;  2H13 A;  2VDM A;  4AN0 A;  1YFQ A;  2GC7 A;  1OMW B;  2AGL A;  5EMK B;  2OVR B;  4L9O A;  3SBQ A;  5FXY A;  1A0R B;  4ZN4 A;  3F3P A;  3U4Y A;  2H6K A;  5AMS A;  3C75 H;  4GZ8 A;  4A0B B;  3I8C A;  4D0K A;  5IC7 A;  5FKQ A;  3T3M A;  1H2X A;  4A0A B;  1S4U X;  1K3I A;  3EQ9 A;  5HE1 B;  4ESG A;  1RI6 A;  4MMX A;  3EI3 B;  3JRP A;  4LG9 A;  4G1E A;  5K19 A;  3IUL A;  1NR0 A;  4U1E I;  3RLM D;  2I0T A;  5M5U A;  4RE5 A;  1N6D A;  3QHY B;  4J73 A;  2BBK H;  2CE9 A;  2TRC B;  4DNW A;  1UOP A;  5EAL A;  3J80 g;  4CY3 A;  2IWF A;  1PEV A;  3OTT A;  4ZOY A;  3PSC B;  3NVN A;  2IUP A;  2H3X A;  5IGO A;  2XDW A;  2EBS A;  3HFQ A;  3K71 A;  3PXS D;  2VDN A;  5EMM B;  3EWE A;  1H2W A;  2P9S C;  2Z2O A;  2CO0 A;  2I0R A;  3L4O D;  3SBR A;  4AX4 A;  4J0X A;  3SMR A;  3GFC A;  4BP8 A;  2P9P C;  3AL8 A;  3O4I A;  3MXX A;  1I2M B;  1UOO A;  1ERJ A;  2H47 A;  2P9L C;  2PBI B;  3NIG A;  3O4H A;  4GGC A;  4L3H D;  4TZ4 A;  4CZX A;  5C86 A;  2QXV A;  3EU7 A;  1TYQ C;  2PM9 A;  3FGB A;  3I7K A;  1JV2 A;  1O6F A;  4UM8 A;  2H6Q A;  4UM9 A;  5H1M A;  3FM0 A;  1H2Z A;  2UZY B;  4GGA A;  2P9N C;  4O02 A;  5EML B;  5HE3 B;  5A2Q g;  1A12 A;  3AL8 B;  3PVU B;  4O3U B;  3VGZ A;  2VDL A;  4ZOX A;  4ZOZ A;  5M5T A;  2WQ8 A;  2Z2N A;  4CC9 A;  3OF7 A;  3GD1 I;  5SXM A;  4ERQ A;  4R7A B;  2EIE A;  4GM3 A;  1VZ3 A;  5IT9 g;  3EMH A;  4JXM A;  3MZK A;  1NEX B;  4E5Z B;  5HQG A;  4A7J A;  5TDH B;  4Y7R A;  3RMZ D;  4XEI C;  3PXT D;  3DSM A;  1L5G A;  3N0E A;  3SBP A;  2HKM A;  1GOH A;  4X61 B;  4YVD A;  3V4V A;  4QL1 A;  4X63 B;  3I7O A;  3IIW A;  5M61 A;  4G55 A;  2XL2 A;  5CXC A;  2XZG A;  4A2M A;  5HE2 B;  4FB1 D;  2HU5 A;  1XKS A;  1MDA H;  5FKS A;  3I7H A;  2I0S A;  2B5N A;  4I79 A;  1SQ9 A;  5H14 A;  1L0Q A;  4CZY A;  1OLZ A;  3FCS A;  3NVQ A;  2OVP B;  3UKR C;  3RSE C;  3I7P A;  3P4F A;  3EG6 A;  5HDB A;  3MVD K;  3O4J A;  4L1Q D;  3ZE1 A;  3VI4 A;  2CO0 C;  5CXC B;  4MMZ A;  4L1M A;  3EI4 A;  4IMM A;  2HES X;  2AH0 A;  2VZ3 A;  1SHY B;  3DM0 A;  2EIB A;  2HJ4 A;  2B4E A;  3ZDX A;  1YR2 A;  4AMZ A;  5I5J A;  4QAM A;  2J57 G;  4Z7Q A;  1T2X A;  4X3E A;  3MKS B;  4KFM B;  1O6G A;  4PBZ A;  2QR5 A;  3RN0 D;  3UKU C;  3I2N A;  1BPO A;  5THA A;  5E6R A;  3SN6 B;  3IUQ A;  1M1X A;  1GP2 B;  4JSX C;  2HJB A;  5TEF A;  4D6V A;  5C92 A;  3IUN A;  3EI4 B;  4JSP C;  2Q7Q A;  4AEZ A;  4RE6 A;  3SFZ A;  4XYH A;  3RFG A;  4PC0 A;  4XYI A;  2G9A A;  1PI6 A;  5IGQ A;  3K6S A;  1UTC A;  4AMY A;  3I8E A;  3OL2 A;  2J55 H;  4JSV C;  3ULE C;  2BKL A;  1MG3 A;  2I3S A;  4JHN A;  2B5L A;  4UI9 R;  1E8M A;  3IUM A;  3SXT D;  4Z7O A;  2EIC A;  4GM8 A;  2P9K C;  5M5R A;  1VE7 A;  4FA1 D;  5GMK n;  3NVX A;  1U8C A;  4IA9 A;  3ZE0 A;  5GXI A;  4GM9 A;  3F3G A;  2P9U C;  3EI2 A;  1JOF A;  4L3G D;  3K26 A;  3JZG A;  5EAP A;  3VI3 A;  4QRJ A;  3SHF A;  5FFG A;  3OL2 B;  4J84 A;  4AOW A;  4FWW A;  1VYH C;  2Z2P A;  4IRZ A;  4JT5 C;  4FA5 D;  4JT6 C;  5AJA A;  5FFO A;  3V9F A;  4PSX B;  1PBY B;  2VDK A;  2IUV A;  1VE6 A;  1SQJ A;  2XE4 A;  3EQ8 A;  4MK0 B;  2XU7 A;  4PBY A;  3JRO A;  3O4G A;  3C5M A;  3EQ7 A;  2QC5 A;  1N6F A;  5I5M A;  4GQ2 P;  3UVN A;  3J81 g;  3SJL D;  1B9X A;  1QFS A;  2AGW A;  1JMZ B;  1UOQ A;  2CNX A;  2AGX A;  2IAA A;  3OKY A;  4NSX A;  4CI8 A;  4O45 A;  3EI2 B;  1E5T A;  2PM9 B;  2YB8 B;  3K27 A;  3NID A;  5C2V B;  4GQ1 A;  3OKW A;  3RFH A;  2CN2 A;  3UVM A;  3MZL A;  5GXH A;  5HE0 B;  3GC3 B;  2UZX B;  4O1Q D;  5EM2 A;  5EMJ B;  4ERY A;  5EAM A;  4BL0 A;  2OK4 A;  2I3T A;  4HDJ A;  3PE7 A;  3ZDZ A;  4G1M A;  4A2L A;  3OKY B;  4BCB A;  2CN3 A;  4BCD A;  2OVQ B;  3IIY A;  2XYI A;  3KCI A;  4J78 A;  3DDU A;  5K1C C;  4MMY A;  4A09 A;  3VA6 A;  2HKR A;  1B9Y A;  4A08 A;  2YNP A;  3SCY A;  2MTA H;  3MUN A;  4H5J A;  3VH0 A;  2VDR A;  4O3T B;  1TYE A;  4NAA A;  4CI2 A;  2J56 H;  2GC4 A;  2VDP A;  2W18 A;  2AQ5 A;  1R5M A;  1GG2 B;  4A11 A;  4E54 A;  3ZE2 A;  5KDO B;  2HU8 A;  4A09 B;  4CY1 A;  2EID A;  2G99 A;  3JZH A;  1JMX B;  2QZP A;  4A08 B;  2IWK A;  2H6N A;  3I89 A;  4J8G A;  2OK6 A;  3OW8 A;  4BUJ C;  1C9L A;  3NIF A;  3ZDY A;  4A0A A;  2YNO A;  2XL3 A;  1GOT B;  4PXW A;  3SLE D;  2VDQ A;  3EI3 A;  4CI3 A;  3UVO A;  4Z8L A;  3W15 A;  4A11 B;  4E54 B;  3K72 A;  4J79 A;  2HXC A;  1Q47 A;  4BCC A;  4QT8 A;  3PXW D;  2P9I C;  2CE8 A;  5TEE A;  4Y5R D;  2H9N A; 
#chains in the Genus database with same CATH homology
 4FA4 D;  5EAR A;  5C2W B;  3ZWL B;  2AGY A;  3IJ0 A;  4J87 A;  2YMU A;  4J0W A;  5CXB A;  2B5M A;  5AFU 3;  1K8K C;  3I7N A;  3MKQ A;  3CFV A;  4EWR A;  3BG1 A;  4J82 A;  2IUQ A;  3DXM C;  1QNI A;  3OKT A;  4JD2 C;  4ZOV A;  4QQE A;  5FLX g;  1U2V C;  3CIK B;  3KRX B;  4FAV D;  4CY2 A;  1XIP A;  5CXB B;  3BWS A;  3JB9 L;  4N14 A;  4LGN A;  4K3J B;  1FWX A;  4PSW B;  4JSN C;  1U4C A;  3JAM g;  4K3I D;  2PM7 B;  2IUR A;  3FRX A;  1P22 A;  3AH8 B;  3UVL A;  4X60 B;  3C9C A;  4BH6 A;  2BCJ B;  2OJY A;  1TBG A;  2YBA A;  3UR4 A;  5FQD A;  5FA5 B;  3F3F A;  5C9Z B;  3PVW B;  2AGZ A;  4CY5 A;  3EI1 A;  5JWZ A;  4J8B A;  4E5Z A;  5I5I A;  4U7A A;  4GQB B;  4G56 B;  3C99 A;  3ODT A;  3AL9 A;  4PNK B;  2H14 A;  3RN1 D;  4GGD A;  2H9M A;  3V7D B;  4CZV A;  3ORV D;  3RRM C;  3KRW B;  3B7F A;  5GSA A;  3L4M D;  4O9D A;  3EI1 B;  3DWL C;  2H68 A;  4OWR A;  1GXR A;  2PM6 B;  3UVK A;  5B4W A;  4FAN D;  5TF2 A;  2H9L A;  3SVW D;  1PGU A;  5IJ8 E;  4ERZ A;  1XHM A;  3SWS D;  4LG8 A;  2O9K A;  3IJC A;  2GNQ A;  4H5I A;  5FKT A;  5EM2 B;  3IJ1 A;  3AFC A;  2OIZ A;  4FHL A;  3GRE A;  4ES0 A;  2YNN A;  5FKR A;  3IKO A;  2H9P A;  5H17 A;  3PSL A;  1N6E A;  3DXK C;  4OZU A;  3JZN A;  4J77 A;  5CYK A;  1K32 A;  3A0F A;  5IJ7 E;  2AH1 A;  2HYE A;  4J86 A;  3V5W B;  3BG0 A;  4A0B A;  3N0D A;  1MG2 A;  3JPX A;  1JJU B;  4CI1 A;  3I7L A;  3CFS B;  4J81 A;  3MMY A;  4FA9 D;  4GMB A;  5CYK B;  3E0C A;  5HYN B;  2H13 A;  1YFQ A;  2GC7 A;  1OMW B;  2AGL A;  5EMK B;  2OVR B;  4L9O A;  3SBQ A;  5FXY A;  1A0R B;  4ZN4 A;  3F3P A;  3U4Y A;  2H6K A;  5AMS A;  3C75 H;  4GZ8 A;  4A0B B;  3I8C A;  4D0K A;  5IC7 A;  5FKQ A;  4A0A B;  1S4U X;  5HE1 B;  4ESG A;  1RI6 A;  3EI3 B;  3JRP A;  4LG9 A;  5K19 A;  4U1E I;  1NR0 A;  3RLM D;  2I0T A;  1N6D A;  4J73 A;  2BBK H;  2CE9 A;  2TRC B;  5EAL A;  3J80 g;  4CY3 A;  2IWF A;  1PEV A;  3OTT A;  4ZOY A;  3PSC B;  3NVN A;  2IUP A;  2H3X A;  5IGO A;  2EBS A;  3HFQ A;  3PXS D;  5EMM B;  3EWE A;  2P9S C;  2Z2O A;  2CO0 A;  2I0R A;  3L4O D;  3SBR A;  4J0X A;  3SMR A;  3GFC A;  2P9P C;  3AL8 A;  3MXX A;  1ERJ A;  2H47 A;  2P9L C;  2PBI B;  4L3H D;  4GGC A;  4TZ4 A;  4CZX A;  2QXV A;  3EU7 A;  1TYQ C;  2PM9 A;  3FGB A;  3I7K A;  2H6Q A;  5H1M A;  3FM0 A;  2UZY B;  4GGA A;  2P9N C;  5EML B;  5HE3 B;  5A2Q g;  3AL8 B;  3PVU B;  4O3U B;  3VGZ A;  4ZOX A;  4ZOZ A;  2Z2N A;  4CC9 A;  5SXM A;  4ERQ A;  4R7A B;  4GM3 A;  5IT9 g;  3EMH A;  4JXM A;  3MZK A;  1NEX B;  4E5Z B;  5HQG A;  4A7J A;  5TDH B;  4Y7R A;  3RMZ D;  4XEI C;  3PXT D;  3DSM A;  3N0E A;  3SBP A;  2HKM A;  4X61 B;  4YVD A;  4QL1 A;  4X63 B;  3I7O A;  3IIW A;  2XL2 A;  5CXC A;  4A2M A;  5HE2 B;  4FB1 D;  1XKS A;  1MDA H;  5FKS A;  3I7H A;  2I0S A;  2B5N A;  4I79 A;  1SQ9 A;  5H14 A;  1L0Q A;  4CZY A;  1OLZ A;  3NVQ A;  2OVP B;  3UKR C;  3RSE C;  3I7P A;  3P4F A;  3EG6 A;  4L1Q D;  2CO0 C;  5CXC B;  3EI4 A;  4IMM A;  2HES X;  2AH0 A;  1SHY B;  3DM0 A;  2HJ4 A;  2B4E A;  5I5J A;  2J57 G;  4X3E A;  3MKS B;  4KFM B;  4PBZ A;  3RN0 D;  3UKU C;  3I2N A;  5THA A;  3SN6 B;  1GP2 B;  4JSX C;  2HJB A;  5TEF A;  4D6V A;  3EI4 B;  4JSP C;  2Q7Q A;  4AEZ A;  3SFZ A;  4XYH A;  3RFG A;  4PC0 A;  4XYI A;  2G9A A;  1PI6 A;  5IGQ A;  3I8E A;  3OL2 A;  2J55 H;  4JSV C;  3ULE C;  1MG3 A;  2I3S A;  2B5L A;  4UI9 R;  3SXT D;  4GM8 A;  2P9K C;  5GMK n;  4FA1 D;  3NVX A;  4IA9 A;  5GXI A;  4GM9 A;  3F3G A;  2P9U C;  3EI2 A;  1JOF A;  4L3G D;  3K26 A;  3JZG A;  5EAP A;  4QRJ A;  3SHF A;  3OL2 B;  4J84 A;  4AOW A;  4FWW A;  1VYH C;  2Z2P A;  4JT5 C;  4FA5 D;  4JT6 C;  5AJA A;  3V9F A;  4PSX B;  1PBY B;  2IUV A;  4PBY A;  1SQJ A;  4MK0 B;  2XU7 A;  3JRO A;  3C5M A;  2QC5 A;  1N6F A;  5I5M A;  4GQ2 P;  3UVN A;  3J81 g;  3SJL D;  1B9X A;  2AGW A;  1JMZ B;  2CNX A;  2IAA A;  2AGX A;  4NSX A;  3OKY A;  4CI8 A;  3EI2 B;  4O45 A;  2PM9 B;  2YB8 B;  3K27 A;  5C2V B;  4GQ1 A;  3OKW A;  3RFH A;  2CN2 A;  3UVM A;  3MZL A;  5GXH A;  5HE0 B;  2UZX B;  4O1Q D;  5EM2 A;  5EMJ B;  4ERY A;  5EAM A;  4BL0 A;  2OK4 A;  2I3T A;  4HDJ A;  3PE7 A;  4A2L A;  3OKY B;  2CN3 A;  2OVQ B;  3IIY A;  2XYI A;  4J78 A;  5K1C C;  4A09 A;  3VA6 A;  2HKR A;  1B9Y A;  4A08 A;  2YNP A;  3SCY A;  2MTA H;  4H5J A;  3VH0 A;  4O3T B;  4CI2 A;  2J56 H;  2GC4 A;  2W18 A;  2AQ5 A;  1R5M A;  1GG2 B;  4A11 A;  4E54 A;  5KDO B;  4A09 B;  4CY1 A;  2G99 A;  3JZH A;  1JMX B;  4A08 B;  2IWK A;  2H6N A;  3I89 A;  4J8G A;  2OK6 A;  3OW8 A;  4BUJ C;  4A0A A;  2YNO A;  2XL3 A;  1GOT B;  4PXW A;  3SLE D;  3EI3 A;  4CI3 A;  3UVO A;  4Z8L A;  3W15 A;  4A11 B;  4E54 B;  4J79 A;  2HXC A;  1Q47 A;  4QT8 A;  3PXW D;  2P9I C;  2CE8 A;  5TEE A;  4Y5R D;  2H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...