4J73A

Crystal structure of beta'-cop/p25 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
295
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
total genus 82
structure length 295
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j73A01
4A11B 3VH0A 4QT8A 4H5IA 5CYKB 5GXIA 3PSCB 4CI2A 2W18A 4PXWA 5THAA 1L0QA 4O1QD 2AH1A 3UVMA 4A11A 4N14A 4ZOYA 4O9DA 4E5ZB 4QL1A 5FLXg 3AL9A 4K3ID 4A0AB 3L4OD 3MKSB 1U4CA 4X3EA 2H3XA 5CXCB 3EG6A 1MG2A 3EI4B 2AGZA 4FAND 1JOFA 2PM9A 5HE1B 4JD2C 1U2VC 2PM7B 1XHMA 5FKQA 5IJ8E 4J87A 1PEVA 4U1EI 4EWRA 4JSVC 2P9NC 4MK0B 4FA4D 2I0SA 3NVNA 1OLZA 5HE2B 2BBKH 2P9PC 3HFQA 3FRXA 3C99A 4GQBB 2H6KA 4Y5RD 3PXSD 2I3SA 5H17A 4GQ1A 3MZLA 3F3FA 4ERQA 3JZHA 4AEZA 1PI6A 4A0BA 5IJ7E 5K1CC 4A08A 2H9MA 2IAAA 1JMZB 4J0XA 2H13A 3JZNA 4PSXB 1K8KC 2Q7QA 2OK4A 2OIZA 3UKRC 3I7OA 3PVUB 2IWKA 5EAPA 3C75H 3EI4A 2CE8A 2PM6B 4Y7RA 3OTTA 2AQ5A 4ERYA 3OL2A 1GXRA 4FWWA 1N6FA 1ERJA 4KFMB 1NEXB 3SHFA 2G99A 3RN0D 2B4EA 2OJYA 4X61B 2GNQA 5AJAA 3NVQA 4JT5C 1TBGA 3JZGA 3SFZA 4OWRA 3DWLC 4O3TB 1RI6A 3AH8B 4GM3A 5I5IA 3MKQA 3FM0A 3OKYA 4GQ2P 2PM9B 4LGNA 2G9AA 5TF2A 2Z2NA 2XL2A 3UVNA 3SBRA 4JT6C 5GSAA 4E5ZA 1SHYB 5TEEA 2CN3A 4L3GD 3K26A 4OZUA 3SLED 1XIPA 5CXBB 3SMRA 3JAMg 3I7NA 4PNKB 3A0FA 3PVWB 4ERZA 2AGYA 4I79A 4JSNC 2HYEA 2P9IC 2H9LA 1N6DA 5FQDA 4J81A 3UR4A 4GGCA 5TDHB 3V9FA 4J79A 3OKTA 1B9YA 2H6NA 3AL8A 3MMYA 3JPXA 3ULEC 3MZKA 4CZXA 4J8BA 3C9CA 2AGLA 3BG0A 3CFSB 4G56B 5IGOA 2H68A 5IGQA 5GXHA 3OKWA 3I7PA 3I2NA 2I3TA 4X60B 2H9PA 5FKRA 3RFHA 4JSXC 3IKOA 4GGDA 1N6EA 2OVRB 4BH6A 2P9SC 3CIKB 5C9ZB 2B5MA 3I7KA 3EWEA 4X63B 5HYNB 4O45A 3RFGA 4LG8A 3DXMC 4HDJA 4NSXA 4CC9A 5TEFA 2PBIB 2HXCA 5EMMB 1K32A 5IT9g 2H47A 3ORVD 4L3HD 4D6VA 4IA9A 5SXMA 3VGZA 3PXTD 3MXXA 2GC7A 4GZ8A 4ZOVA 2AH0A 1R5MA 5B4WA 2H14A 2UZXB 3VA6A 4D0KA 2OK6A 4FAVD 4CY2A 3J80g 2IURA 3KRXB 2B5LA 2YB8B 2HJ4A 4L1QD 4A0AA 4J82A 3J81g 5I5MA 4UI9R 4FA1D 5AFU3 4U7AA 3JROA 1TYQC 2HESX 3BWSA 3RRMC 4BL0A 4XYHA 1PBYB 2HJBA 2P9LC 5HE0B 2J56H 2OVPB 4A08B 3OKYB 2IUQA 2I0RA 2TRCB 1B9XA 3SWSD 3SXTD 2XL3A 2J57G 3PSLA 4PBZA 3SVWD 3PE7A 3EMHA 5EM2B 3RN1D 3I89A 3NVXA 5CXCA 4CZYA 2H9NA 3EI3A 3RMZD 4J86A 3RLMD 2AGXA 2HKRA 5FA5B 5K19A 3OL2B 2CO0A 2P9KC 4J8GA 5FXYA 3EI2B 4AOWA 4K3JB 5AMSA 2Z2PA 4GM8A 4J77A 2XU7A 4GMBA 5JWZA 3I7LA 1GP2B 5H1MA 2Z2OA 1FWXA 4JSPC 3IIWA 3IJ0A 2HKMA 3EI2A 3GFCA 1JMXB 5H14A 4CY3A 3DSMA 5EAMA 4J0WA 1GG2B 5FKSA 3UVOA 2UZYB 3SBQA 4O3UB 3GREA 3I8EA 3U4YA 3V7DB 4PC0A 4ZOZA 2QXVA 4XEIC 3UVLA 3SN6B 4E54B 2I0TA 3DXKC 1Q47A 3UKUC 5C2VB 3P4FA 1VYHC 4Z8LA 5C2WB 4JXMA 3F3GA 2J55H 3EI3B 3PXWD 3JRPA 3ZWLB 4L9OA 3FGBA 3EU7A 4A09A 4QRJA 3V5WB 2O9KA 3F3PA 4IMMA 3RSEC 4R7AB 2CN2A 5CXBA 2OVQB 2H6QA 3C5MA 5EMKB 4FHLA 1P22A 4CI3A 5KDOB 3UVKA 4PSWB 4ES0A 2MTAH 4FB1D 5GMKn 2IUVA 3N0DA 2XYIA 5IC7A 1SQ9A 3JB9L 2YNNA 5HQGA 2YMUA 4CZVA 5EMJB 3AL8B 5EARA 3EI1A 4GM9A 4E54A 1GOTB 4A2MA 2YBAA 1QNIA 2P9UC 3E0CA 1XKSA 3OW8A 3I7HA 2BCJB 2YNOA 3AFCA 2EBSA 2CE9A 1SQJA 4ZN4A 5CYKA 1OMWB 3IIYA 4PBYA 4A0BB 1PGUA 4A09B 1YFQA 4FA9D 2B5NA 3K27A 3BG1A 2GC4A 4TZ4A 4FA5D 3IJ1A 3KRWB 3DM0A 4CY5A 3IJCA 4BUJC 4A7JA 4LG9A 3ODTA 5A2Qg 4H5JA 4YVDA 4GGAA 3SCYA 1NR0A 4A2LA 4ZOXA 3CFVA 4QQEA 5EM2A 3B7FA 3L4MD 1MDAH 5I5JA 3EI1B 4XYIA 2CNXA 5FKTA 5HE3B 4J73A 2CO0C 3SJLD 2YNPA 4ESGA 1MG3A 3N0EA 2IUPA 4CI1A 4J84A 1A0RB 5EALA 2AGWA 4CI8A 1S4UX 3SBPA 4J78A 3W15A 2IWFA 5EMLB 4CY1A 1JJUB 3I8CA 2QC5A
chains in the Genus database with same CATH superfamily
4A11B 3VH0A 4QT8A 4H5IA 3IVMA 5CYKB 5GXIA 3FCUA 3PSCB 4CI2A 2W18A 4PXWA 5THAA 1L0QA 4O1QD 2AH1A 3UVMA 4A11A 4Z7QA 1VE6A 4N14A 4O9DA 1K3IA 4ZOYA 3V4PA 4E5ZB 4QL1A 2HU8A 4NAAA 5FLXg 3AL9A 4K3ID 4A0AB 3L4OD 3MKSB 1H2WA 1A12A 1U4CA 4UM8A 4X3EA 2H3XA 5CXCB 3EG6A 1MG2A 3EI4B 2AGZA 4FAND 1JOFA 1O6GA 2PM9A 5HE1B 4BP8A 4JD2C 1U2VC 2PM7B 2VDOA 1XHMA 4BCBA 3T3PA 5FKQA 5IJ8E 4J87A 1PEVA 2XZGA 4U1EI 5HDBA 4EWRA 1I2MB 3O4HA 1VZ3A 4JSVC 2P9NC 4MK0B 4FA4D 2I0SA 3NVNA 1OLZA 4NENA 2BBKH 5HE2B 4DNWA 2P9PC 3QHYB 3HFQA 2VZ1A 5M5VA 3FRXA 2VDLA 3C99A 2H6KA 4GQBB 4Y5RD 2EICA 5E6UA 3PXSD 2I3SA 5H17A 4GQ1A 3MZLA 3F3FA 4ERQA 3JZHA 4AEZA 1PI6A 4WK4A 4A0BA 5IJ7E 5K1CC 4A08A 4NBMA 4O02A 4MMXA 2H9MA 1T2XA 2IAAA 1JMZB 4J0XA 2H13A 3JZNA 4PSXB 1K8KC 2Q7QA 2OK4A 2OIZA 2XDWA 3UKRC 3PVUB 3I7OA 2IWKA 5EAPA 3C75H 3EI4A 2CE8A 2PM6B 4Y7RA 3OTTA 4RE6A 2AQ5A 4ERYA 3OL2A 1GXRA 4FWWA 1N6FA 5C86A 1ERJA 4KFMB 1UOOA 1NEXB 3SHFA 2G99A 1YR2A 3RN0D 2B4EA 2OJYA 4X61B 2GNQA 3IUJA 4G1MA 5AJAA 3NVQA 4JT5C 1TBGA 3JZGA 3MUOA 3SFZA 4OWRA 3DWLC 4O3TB 1RI6A 4BP9A 3AH8B 4MMYA 4GM3A 5I5IA 3MKQA 1TYEA 3FM0A 3OKYA 4GQ2P 3K6SA 2PM9B 4LGNA 2G9AA 5TF2A 2Z2NA 2XL2A 3UVNA 3SBRA 3ZE1A 4JT6C 4JHPC 5GSAA 4E5ZA 1SHYB 5TEEA 3EQ8A 2CN3A 4JHNA 4L3GD 3K26A 4OZUA 5M5UA 3O4IA 1XIPA 5CXBB 3SMRA 3NIGA 5FFGA 3QI0A 3SLED 3JAMg 2HU7A 3I7NA 4PNKB 3A0FA 4AMYA 3PVWB 4NC4A 4ERZA 2AGYA 4I79A 4JSNC 2HYEA 2P9IC 2H9LA 1N6DA 1GOHA 5FQDA 3ZDZA 4J81A 3UR4A 1E8MA 4GGCA 5TDHB 3V9FA 4J79A 3OKTA 1B9YA 2H6NA 3AL8A 3MMYA 3JPXA 3IJEA 3ULEC 3MZKA 4CZXA 4J8BA 3C9CA 5M5RA 2AGLA 3BG0A 3CFSB 4G56B 5IGOA 2H68A 5IGQA 5GXHA 1E5TA 3OKWA 2XE4A 3I7PA 3I2NA 2I3TA 1UOQA 3IUMA 4X60B 2H9PA 5FKRA 3RFHA 4JSXC 3IKOA 4GGDA 1N6EA 2OVRB 4BH6A 2P9SC 3CIKB 3NIFA 5C9ZB 2B5MA 3I7KA 3EWEA 4X63B 5HYNB 4O45A 3RFGA 4LG8A 3DXMC 4HDJA 4NSXA 4CC9A 5TEFA 2PBIB 2HXCA 5EMMB 1K32A 4RE5A 5IT9g 2H47A 2VC2A 1H2YA 3ORVD 2VDKA 3OF7A 4L3HD 4D6VA 4IA9A 4MMZA 5SXMA 3VGZA 3PXTD 3MXXA 5FFOA 4AX4A 2GC7A 4GZ8A 4ZOVA 2AH0A 1R5MA 5B4WA 2H14A 2UZXB 3VA6A 4D0KA 2OK6A 3NIDA 4FAVD 1VE7A 3K72A 4CY2A 3J80g 2IURA 3KRXB 2B5LA 2YB8B 2HJ4A 4L1QD 4A0AA 4J82A 3J81g 5I5MA 3ZE2A 4UI9R 4AN0A 4FA1D 3KCIA 1H2ZA 1L5GA 5AFU3 4U7AA 3JROA 1TYQC 2HESX 3BWSA 4O2WA 3RRMC 4BL0A 4XYHA 1PBYB 2HJBA 2P9LC 5HE0B 2EIBA 2J56H 2OVPB 3OKYB 4A08B 2IUQA 2I0RA 2TRCB 1B9XA 3SWSD 3SXTD 2XL3A 1C9IA 2J57G 3PSLA 4BCCA 4PBZA 3SVWD 3PE7A 3EMHA 3IULA 5EM2B 3O4GA 3RN1D 1UTCA 3FCSA 3I89A 1GOFA 3ZDXA 3NVXA 5CXCA 4CZYA 2H9NA 4G55A 1BPOA 3EI3A 3DDUA 3GD1I 4J86A 3RLMD 3RMZD 2AGXA 2HKRA 1JV2A 5FA5B 5K19A 3OL2B 2CO0A 2EIEA 2P9KC 4J8GA 5FXYA 4G1EA 3IURA 3EI2B 4AOWA 2QR5A 4WK0A 4K3JB 5AMSA 2Z2PA 4GM8A 4J77A 2XU7A 4GMBA 4AMZA 3V4VA 5JWZA 4Z7OA 3I7LA 1M1XA 1GP2B 5H1MA 1UOPA 2Z2OA 1FWXA 4JSPC 3IIWA 3ZDYA 5M61A 3IJ0A 2HKMA 3EI2A 4DNVA 3GFCA 1JMXB 5E6SA 5H14A 4CY3A 1GOGA 3DSMA 5EAMA 4J0WA 1GG2B 5FKSA 3UVOA 2QZPA 2UZYB 3MVDK 3SBQA 4O3UB 3GREA 3I8EA 4L1MA 4Z7NA 3U4YA 3VI3A 3V7DB 4PC0A 4ZOZA 2QXVA 4XEIC 3UVLA 3SN6B 4E54B 2I0TA 3DXKC 3IUQA 3GC3B 1Q47A 3UKUC 5C2VB 3P4FA 1VYHC 4Z8LA 5C2WB 3VI4A 3EQ7A 4JXMA 3F3GA 2J55H 2BKLA 3EI3B 2VDRA 3PXWD 3JRPA 3ZWLB 4L9OA 3FGBA 3EU7A 2JKXA 4A09A 4QRJA 3V5WB 3K71A 2O9KA 4UM9A 3F3PA 4IMMA 4QAMA 3RSEC 5M5TA 1JTDB 4R7AB 2CN2A 3O4JA 5CXBA 2OVQB 2H6QA 1C9LA 3C5MA 5EMKB 1E8NA 4FHLA 1P22A 4CI3A 5KDOB 1O6FA 4BCDA 3UVKA 4PSWB 4ES0A 2MTAH 5C92A 2VZ3A 4FB1D 5GMKn 2IUVA 3N0DA 2XYIA 2VDPA 2EIDA 5IC7A 1SQ9A 3JB9L 2YNNA 5HQGA 2YMUA 4CZVA 2WQ8A 3AL8B 5EARA 5EMJB 3EI1A 4GM9A 4WK2A 4E54A 1GOTB 4A2MA 4AN1A 2YBAA 1QNIA 2P9UC 3E0CA 4DNUA 1XKSA 3OW8A 3I7HA 2BCJB 2YNOA 3AFCA 2VDQA 2EBSA 3MUNA 2CE9A 1SQJA 4ZN4A 5CYKA 1OMWB 3IIYA 4PBYA 4A0BB 1PGUA 4A09B 1YFQA 4D9SA 4FA9D 2B5NA 3K27A 3BG1A 2GC4A 4TZ4A 4FA5D 3IJ1A 3KRWB 4WJKA 3DM0A 4CY5A 2HU5A 3IJCA 4BUJC 4A7JA 4LG9A 1QFSA 3ODTA 5A2Qg 4H5JA 4YVDA 3ZE0A 4GGAA 3SCYA 1NR0A 4A2LA 3IUNA 4ZOXA 3CFVA 4QQEA 5EM2A 3T3MA 3B7FA 3L4MD 1QFMA 1U8CA 1MDAH 5I5JA 3EI1B 4XYIA 2CNXA 5FKTA 5HE3B 4J73A 2VDMA 2CO0C 3SJLD 2YNPA 4ESGA 1MG3A 3N0EA 2IUPA 2VDNA 5E6RA 3EQ9A 4CI1A 4J84A 1A0RB 1H2XA 2AGWA 5EALA 4CI8A 1S4UX 3SBPA 4J78A 3W15A 1VZ2A 5M5SA 2IWFA 5EMLB 4CY1A 1JJUB 3I8CA 4IRZA 2QC5A
chains in the Genus database with same CATH topology
4A11B 3VH0A 4QT8A 4H5IA 5CYKB 5GXIA 3PSCB 4CI2A 2W18A 4PXWA 5THAA 1L0QA 4O1QD 2AH1A 3UVMA 4A11A 4N14A 4ZOYA 4O9DA 4E5ZB 4QL1A 5FLXg 3AL9A 4K3ID 4A0AB 3L4OD 3MKSB 1U4CA 4X3EA 2H3XA 5CXCB 3EG6A 1MG2A 3EI4B 2AGZA 4FAND 1JOFA 2PM9A 5HE1B 4JD2C 1U2VC 2PM7B 1XHMA 5FKQA 5IJ8E 4J87A 1PEVA 4U1EI 4EWRA 4JSVC 2P9NC 4MK0B 4FA4D 2I0SA 3NVNA 1OLZA 5HE2B 2BBKH 2P9PC 3HFQA 3FRXA 3C99A 4GQBB 2H6KA 4Y5RD 3PXSD 2I3SA 5H17A 4GQ1A 3MZLA 3F3FA 4ERQA 3JZHA 4AEZA 1PI6A 4A0BA 5IJ7E 5K1CC 4A08A 2H9MA 2IAAA 1JMZB 4J0XA 2H13A 3JZNA 4PSXB 1K8KC 2Q7QA 2OK4A 2OIZA 3UKRC 3I7OA 3PVUB 2IWKA 5EAPA 3C75H 3EI4A 2CE8A 2PM6B 4Y7RA 3OTTA 2AQ5A 4ERYA 3OL2A 1GXRA 4FWWA 1N6FA 1ERJA 4KFMB 1NEXB 3SHFA 2G99A 3RN0D 2B4EA 2OJYA 4X61B 2GNQA 5AJAA 3NVQA 4JT5C 1TBGA 3JZGA 3SFZA 4OWRA 3DWLC 4O3TB 1RI6A 3AH8B 4GM3A 5I5IA 3MKQA 3FM0A 3OKYA 4GQ2P 2PM9B 4LGNA 2G9AA 5TF2A 2Z2NA 2XL2A 3UVNA 3SBRA 4JT6C 5GSAA 4E5ZA 1SHYB 5TEEA 2CN3A 4L3GD 3K26A 4OZUA 3SLED 1XIPA 5CXBB 3SMRA 3JAMg 3I7NA 4PNKB 3A0FA 3PVWB 4ERZA 2AGYA 4I79A 4JSNC 2HYEA 2P9IC 2H9LA 1N6DA 5FQDA 4J81A 3UR4A 4GGCA 5TDHB 3V9FA 4J79A 3OKTA 1B9YA 2H6NA 3AL8A 3MMYA 3JPXA 3ULEC 3MZKA 4CZXA 4J8BA 3C9CA 2AGLA 3BG0A 3CFSB 4G56B 5IGOA 2H68A 5IGQA 5GXHA 3OKWA 3I7PA 3I2NA 2I3TA 4X60B 2H9PA 5FKRA 3RFHA 4JSXC 3IKOA 4GGDA 1N6EA 2OVRB 4BH6A 2P9SC 3CIKB 5C9ZB 2B5MA 3I7KA 3EWEA 4X63B 5HYNB 4O45A 3RFGA 4LG8A 3DXMC 4HDJA 4NSXA 4CC9A 5TEFA 2PBIB 2HXCA 5EMMB 1K32A 5IT9g 2H47A 3ORVD 4L3HD 4D6VA 4IA9A 5SXMA 3VGZA 3PXTD 3MXXA 2GC7A 4GZ8A 4ZOVA 2AH0A 1R5MA 5B4WA 2H14A 2UZXB 3VA6A 4D0KA 2OK6A 4FAVD 4CY2A 3J80g 2IURA 3KRXB 2B5LA 2YB8B 2HJ4A 4L1QD 4A0AA 4J82A 3J81g 5I5MA 4UI9R 4FA1D 5AFU3 4U7AA 3JROA 1TYQC 2HESX 3BWSA 3RRMC 4BL0A 4XYHA 1PBYB 2HJBA 2P9LC 5HE0B 2J56H 2OVPB 4A08B 3OKYB 2IUQA 2I0RA 2TRCB 1B9XA 3SWSD 3SXTD 2XL3A 2J57G 3PSLA 4PBZA 3SVWD 3PE7A 3EMHA 5EM2B 3RN1D 3I89A 3NVXA 5CXCA 4CZYA 2H9NA 3EI3A 3RMZD 4J86A 3RLMD 2AGXA 2HKRA 5FA5B 5K19A 3OL2B 2CO0A 2P9KC 4J8GA 5FXYA 3EI2B 4AOWA 4K3JB 5AMSA 2Z2PA 4GM8A 4J77A 2XU7A 4GMBA 5JWZA 3I7LA 1GP2B 5H1MA 2Z2OA 1FWXA 4JSPC 3IIWA 3IJ0A 2HKMA 3EI2A 3GFCA 1JMXB 5H14A 4CY3A 3DSMA 5EAMA 4J0WA 1GG2B 5FKSA 3UVOA 2UZYB 3SBQA 4O3UB 3GREA 3I8EA 3U4YA 3V7DB 4PC0A 4ZOZA 2QXVA 4XEIC 3UVLA 3SN6B 4E54B 2I0TA 3DXKC 1Q47A 3UKUC 5C2VB 3P4FA 1VYHC 4Z8LA 5C2WB 4JXMA 3F3GA 2J55H 3EI3B 3PXWD 3JRPA 3ZWLB 4L9OA 3FGBA 3EU7A 4A09A 4QRJA 3V5WB 2O9KA 3F3PA 4IMMA 3RSEC 4R7AB 2CN2A 5CXBA 2OVQB 2H6QA 3C5MA 5EMKB 4FHLA 1P22A 4CI3A 5KDOB 3UVKA 4PSWB 4ES0A 2MTAH 4FB1D 5GMKn 2IUVA 3N0DA 2XYIA 5IC7A 1SQ9A 3JB9L 2YNNA 5HQGA 2YMUA 4CZVA 5EMJB 3AL8B 5EARA 3EI1A 4GM9A 4E54A 1GOTB 4A2MA 2YBAA 1QNIA 2P9UC 3E0CA 1XKSA 3OW8A 3I7HA 2BCJB 2YNOA 3AFCA 2EBSA 2CE9A 1SQJA 4ZN4A 5CYKA 1OMWB 3IIYA 4PBYA 4A0BB 1PGUA 4A09B 1YFQA 4FA9D 2B5NA 3K27A 3BG1A 2GC4A 4TZ4A 4FA5D 3IJ1A 3KRWB 3DM0A 4CY5A 3IJCA 4BUJC 4A7JA 4LG9A 3ODTA 5A2Qg 4H5JA 4YVDA 4GGAA 3SCYA 1NR0A 4A2LA 4ZOXA 3CFVA 4QQEA 5EM2A 3B7FA 3L4MD 1MDAH 5I5JA 3EI1B 4XYIA 2CNXA 5FKTA 5HE3B 4J73A 2CO0C 3SJLD 2YNPA 4ESGA 1MG3A 3N0EA 2IUPA 4CI1A 4J84A 1A0RB 5EALA 2AGWA 4CI8A 1S4UX 3SBPA 4J78A 3W15A 2IWFA 5EMLB 4CY1A 1JJUB 3I8CA 2QC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A11 B;  3VH0 A;  4QT8 A;  4H5I A;  5CYK B;  5GXI A;  3PSC B;  4CI2 A;  2W18 A;  4PXW A;  5THA A;  1L0Q A;  4O1Q D;  2AH1 A;  3UVM A;  4A11 A;  4N14 A;  4ZOY A;  4O9D A;  4E5Z B;  4QL1 A;  5FLX g;  3AL9 A;  4K3I D;  4A0A B;  3L4O D;  3MKS B;  1U4C A;  4X3E A;  2H3X A;  5CXC B;  3EG6 A;  1MG2 A;  3EI4 B;  2AGZ A;  4FAN D;  1JOF A;  2PM9 A;  5HE1 B;  4JD2 C;  1U2V C;  2PM7 B;  1XHM A;  5FKQ A;  5IJ8 E;  4J87 A;  1PEV A;  4U1E I;  4EWR A;  4JSV C;  2P9N C;  4MK0 B;  4FA4 D;  2I0S A;  3NVN A;  1OLZ A;  5HE2 B;  2BBK H;  2P9P C;  3HFQ A;  3FRX A;  3C99 A;  4GQB B;  2H6K A;  4Y5R D;  3PXS D;  2I3S A;  5H17 A;  4GQ1 A;  3MZL A;  3F3F A;  4ERQ A;  3JZH A;  4AEZ A;  1PI6 A;  4A0B A;  5IJ7 E;  5K1C C;  4A08 A;  2H9M A;  2IAA A;  1JMZ B;  4J0X A;  2H13 A;  3JZN A;  4PSX B;  1K8K C;  2Q7Q A;  2OK4 A;  2OIZ A;  3UKR C;  3I7O A;  3PVU B;  2IWK A;  5EAP A;  3C75 H;  3EI4 A;  2CE8 A;  2PM6 B;  4Y7R A;  3OTT A;  2AQ5 A;  4ERY A;  3OL2 A;  1GXR A;  4FWW A;  1N6F A;  1ERJ A;  4KFM B;  1NEX B;  3SHF A;  2G99 A;  3RN0 D;  2B4E A;  2OJY A;  4X61 B;  2GNQ A;  5AJA A;  3NVQ A;  4JT5 C;  1TBG A;  3JZG A;  3SFZ A;  4OWR A;  3DWL C;  4O3T B;  1RI6 A;  3AH8 B;  4GM3 A;  5I5I A;  3MKQ A;  3FM0 A;  3OKY A;  4GQ2 P;  2PM9 B;  4LGN A;  2G9A A;  5TF2 A;  2Z2N A;  2XL2 A;  3UVN A;  3SBR A;  4JT6 C;  5GSA A;  4E5Z A;  1SHY B;  5TEE A;  2CN3 A;  4L3G D;  3K26 A;  4OZU A;  3SLE D;  1XIP A;  5CXB B;  3SMR A;  3JAM g;  3I7N A;  4PNK B;  3A0F A;  3PVW B;  4ERZ A;  2AGY A;  4I79 A;  4JSN C;  2HYE A;  2P9I C;  2H9L A;  1N6D A;  5FQD A;  4J81 A;  3UR4 A;  4GGC A;  5TDH B;  3V9F A;  4J79 A;  3OKT A;  1B9Y A;  2H6N A;  3AL8 A;  3MMY A;  3JPX A;  3ULE C;  3MZK A;  4CZX A;  4J8B A;  3C9C A;  2AGL A;  3BG0 A;  3CFS B;  4G56 B;  5IGO A;  2H68 A;  5IGQ A;  5GXH A;  3OKW A;  3I7P A;  3I2N A;  2I3T A;  4X60 B;  2H9P A;  5FKR A;  3RFH A;  4JSX C;  3IKO A;  4GGD A;  1N6E A;  2OVR B;  4BH6 A;  2P9S C;  3CIK B;  5C9Z B;  2B5M A;  3I7K A;  3EWE A;  4X63 B;  5HYN B;  4O45 A;  3RFG A;  4LG8 A;  3DXM C;  4HDJ A;  4NSX A;  4CC9 A;  5TEF A;  2PBI B;  2HXC A;  5EMM B;  1K32 A;  5IT9 g;  2H47 A;  3ORV D;  4L3H D;  4D6V A;  4IA9 A;  5SXM A;  3VGZ A;  3PXT D;  3MXX A;  2GC7 A;  4GZ8 A;  4ZOV A;  2AH0 A;  1R5M A;  5B4W A;  2H14 A;  2UZX B;  3VA6 A;  4D0K A;  2OK6 A;  4FAV D;  4CY2 A;  3J80 g;  2IUR A;  3KRX B;  2B5L A;  2YB8 B;  2HJ4 A;  4L1Q D;  4A0A A;  4J82 A;  3J81 g;  5I5M A;  4UI9 R;  4FA1 D;  5AFU 3;  4U7A A;  3JRO A;  1TYQ C;  2HES X;  3BWS A;  3RRM C;  4BL0 A;  4XYH A;  1PBY B;  2HJB A;  2P9L C;  5HE0 B;  2J56 H;  2OVP B;  4A08 B;  3OKY B;  2IUQ A;  2I0R A;  2TRC B;  1B9X A;  3SWS D;  3SXT D;  2XL3 A;  2J57 G;  3PSL A;  4PBZ A;  3SVW D;  3PE7 A;  3EMH A;  5EM2 B;  3RN1 D;  3I89 A;  3NVX A;  5CXC A;  4CZY A;  2H9N A;  3EI3 A;  3RMZ D;  4J86 A;  3RLM D;  2AGX A;  2HKR A;  5FA5 B;  5K19 A;  3OL2 B;  2CO0 A;  2P9K C;  4J8G A;  5FXY A;  3EI2 B;  4AOW A;  4K3J B;  5AMS A;  2Z2P A;  4GM8 A;  4J77 A;  2XU7 A;  4GMB A;  5JWZ A;  3I7L A;  1GP2 B;  5H1M A;  2Z2O A;  1FWX A;  4JSP C;  3IIW A;  3IJ0 A;  2HKM A;  3EI2 A;  3GFC A;  1JMX B;  5H14 A;  4CY3 A;  3DSM A;  5EAM A;  4J0W A;  1GG2 B;  5FKS A;  3UVO A;  2UZY B;  3SBQ A;  4O3U B;  3GRE A;  3I8E A;  3U4Y A;  3V7D B;  4PC0 A;  4ZOZ A;  2QXV A;  4XEI C;  3UVL A;  3SN6 B;  4E54 B;  2I0T A;  3DXK C;  1Q47 A;  3UKU C;  5C2V B;  3P4F A;  1VYH C;  4Z8L A;  5C2W B;  4JXM A;  3F3G A;  2J55 H;  3EI3 B;  3PXW D;  3JRP A;  3ZWL B;  4L9O A;  3FGB A;  3EU7 A;  4A09 A;  4QRJ A;  3V5W B;  2O9K A;  3F3P A;  4IMM A;  3RSE C;  4R7A B;  2CN2 A;  5CXB A;  2OVQ B;  2H6Q A;  3C5M A;  5EMK B;  4FHL A;  1P22 A;  4CI3 A;  5KDO B;  3UVK A;  4PSW B;  4ES0 A;  2MTA H;  4FB1 D;  5GMK n;  2IUV A;  3N0D A;  2XYI A;  5IC7 A;  1SQ9 A;  3JB9 L;  2YNN A;  5HQG A;  2YMU A;  4CZV A;  5EMJ B;  3AL8 B;  5EAR A;  3EI1 A;  4GM9 A;  4E54 A;  1GOT B;  4A2M A;  2YBA A;  1QNI A;  2P9U C;  3E0C A;  1XKS A;  3OW8 A;  3I7H A;  2BCJ B;  2YNO A;  3AFC A;  2EBS A;  2CE9 A;  1SQJ A;  4ZN4 A;  5CYK A;  1OMW B;  3IIY A;  4PBY A;  4A0B B;  1PGU A;  4A09 B;  1YFQ A;  4FA9 D;  2B5N A;  3K27 A;  3BG1 A;  2GC4 A;  4TZ4 A;  4FA5 D;  3IJ1 A;  3KRW B;  3DM0 A;  4CY5 A;  3IJC A;  4BUJ C;  4A7J A;  4LG9 A;  3ODT A;  5A2Q g;  4H5J A;  4YVD A;  4GGA A;  3SCY A;  1NR0 A;  4A2L A;  4ZOX A;  3CFV A;  4QQE A;  5EM2 A;  3B7F A;  3L4M D;  1MDA H;  5I5J A;  3EI1 B;  4XYI A;  2CNX A;  5FKT A;  5HE3 B;  4J73 A;  2CO0 C;  3SJL D;  2YNP A;  4ESG A;  1MG3 A;  3N0E A;  2IUP A;  4CI1 A;  4J84 A;  1A0R B;  5EAL A;  2AGW A;  4CI8 A;  1S4U X;  3SBP A;  4J78 A;  3W15 A;  2IWF A;  5EML B;  4CY1 A;  1JJU B;  3I8C A;  2QC5 A; 
#chains in the Genus database with same CATH topology
 4A11 B;  3VH0 A;  4QT8 A;  4H5I A;  3IVM A;  5CYK B;  5GXI A;  3FCU A;  3PSC B;  4CI2 A;  2W18 A;  4PXW A;  5THA A;  1L0Q A;  4O1Q D;  2AH1 A;  3UVM A;  4A11 A;  4Z7Q A;  1VE6 A;  4N14 A;  4O9D A;  1K3I A;  4ZOY A;  3V4P A;  4E5Z B;  4QL1 A;  2HU8 A;  4NAA A;  5FLX g;  3AL9 A;  4K3I D;  4A0A B;  3L4O D;  3MKS B;  1H2W A;  1A12 A;  1U4C A;  4UM8 A;  4X3E A;  2H3X A;  5CXC B;  3EG6 A;  1MG2 A;  3EI4 B;  2AGZ A;  4FAN D;  1JOF A;  1O6G A;  2PM9 A;  5HE1 B;  4BP8 A;  4JD2 C;  1U2V C;  2PM7 B;  2VDO A;  1XHM A;  4BCB A;  3T3P A;  5FKQ A;  5IJ8 E;  4J87 A;  1PEV A;  2XZG A;  4U1E I;  5HDB A;  4EWR A;  1I2M B;  3O4H A;  1VZ3 A;  4JSV C;  2P9N C;  4MK0 B;  4FA4 D;  2I0S A;  3NVN A;  1OLZ A;  4NEN A;  2BBK H;  5HE2 B;  4DNW A;  2P9P C;  3QHY B;  3HFQ A;  2VZ1 A;  5M5V A;  3FRX A;  2VDL A;  3C99 A;  2H6K A;  4GQB B;  4Y5R D;  2EIC A;  5E6U A;  3PXS D;  2I3S A;  5H17 A;  4GQ1 A;  3MZL A;  3F3F A;  4ERQ A;  3JZH A;  4AEZ A;  1PI6 A;  4WK4 A;  4A0B A;  5IJ7 E;  5K1C C;  4A08 A;  4NBM A;  4O02 A;  4MMX A;  2H9M A;  1T2X A;  2IAA A;  1JMZ B;  4J0X A;  2H13 A;  3JZN A;  4PSX B;  1K8K C;  2Q7Q A;  2OK4 A;  2OIZ A;  2XDW A;  3UKR C;  3PVU B;  3I7O A;  2IWK A;  5EAP A;  3C75 H;  3EI4 A;  2CE8 A;  2PM6 B;  4Y7R A;  3OTT A;  4RE6 A;  2AQ5 A;  4ERY A;  3OL2 A;  1GXR A;  4FWW A;  1N6F A;  5C86 A;  1ERJ A;  4KFM B;  1UOO A;  1NEX B;  3SHF A;  2G99 A;  1YR2 A;  3RN0 D;  2B4E A;  2OJY A;  4X61 B;  2GNQ A;  3IUJ A;  4G1M A;  5AJA A;  3NVQ A;  4JT5 C;  1TBG A;  3JZG A;  3MUO A;  3SFZ A;  4OWR A;  3DWL C;  4O3T B;  1RI6 A;  4BP9 A;  3AH8 B;  4MMY A;  4GM3 A;  5I5I A;  3MKQ A;  1TYE A;  3FM0 A;  3OKY A;  4GQ2 P;  3K6S A;  2PM9 B;  4LGN A;  2G9A A;  5TF2 A;  2Z2N A;  2XL2 A;  3UVN A;  3SBR A;  3ZE1 A;  4JT6 C;  4JHP C;  5GSA A;  4E5Z A;  1SHY B;  5TEE A;  3EQ8 A;  2CN3 A;  4JHN A;  4L3G D;  3K26 A;  4OZU A;  5M5U A;  3O4I A;  1XIP A;  5CXB B;  3SMR A;  3NIG A;  5FFG A;  3QI0 A;  3SLE D;  3JAM g;  2HU7 A;  3I7N A;  4PNK B;  3A0F A;  4AMY A;  3PVW B;  4NC4 A;  4ERZ A;  2AGY A;  4I79 A;  4JSN C;  2HYE A;  2P9I C;  2H9L A;  1N6D A;  1GOH A;  5FQD A;  3ZDZ A;  4J81 A;  3UR4 A;  1E8M A;  4GGC A;  5TDH B;  3V9F A;  4J79 A;  3OKT A;  1B9Y A;  2H6N A;  3AL8 A;  3MMY A;  3JPX A;  3IJE A;  3ULE C;  3MZK A;  4CZX A;  4J8B A;  3C9C A;  5M5R A;  2AGL A;  3BG0 A;  3CFS B;  4G56 B;  5IGO A;  2H68 A;  5IGQ A;  5GXH A;  1E5T A;  3OKW A;  2XE4 A;  3I7P A;  3I2N A;  2I3T A;  1UOQ A;  3IUM A;  4X60 B;  2H9P A;  5FKR A;  3RFH A;  4JSX C;  3IKO A;  4GGD A;  1N6E A;  2OVR B;  4BH6 A;  2P9S C;  3CIK B;  3NIF A;  5C9Z B;  2B5M A;  3I7K A;  3EWE A;  4X63 B;  5HYN B;  4O45 A;  3RFG A;  4LG8 A;  3DXM C;  4HDJ A;  4NSX A;  4CC9 A;  5TEF A;  2PBI B;  2HXC A;  5EMM B;  1K32 A;  4RE5 A;  5IT9 g;  2H47 A;  2VC2 A;  1H2Y A;  3ORV D;  2VDK A;  3OF7 A;  4L3H D;  4D6V A;  4IA9 A;  4MMZ A;  5SXM A;  3VGZ A;  3PXT D;  3MXX A;  5FFO A;  4AX4 A;  2GC7 A;  4GZ8 A;  4ZOV A;  2AH0 A;  1R5M A;  5B4W A;  2H14 A;  2UZX B;  3VA6 A;  4D0K A;  2OK6 A;  3NID A;  4FAV D;  1VE7 A;  3K72 A;  4CY2 A;  3J80 g;  2IUR A;  3KRX B;  2B5L A;  2YB8 B;  2HJ4 A;  4L1Q D;  4A0A A;  4J82 A;  3J81 g;  5I5M A;  3ZE2 A;  4UI9 R;  4AN0 A;  4FA1 D;  3KCI A;  1H2Z A;  1L5G A;  5AFU 3;  4U7A A;  3JRO A;  1TYQ C;  2HES X;  3BWS A;  4O2W A;  3RRM C;  4BL0 A;  4XYH A;  1PBY B;  2HJB A;  2P9L C;  5HE0 B;  2EIB A;  2J56 H;  2OVP B;  3OKY B;  4A08 B;  2IUQ A;  2I0R A;  2TRC B;  1B9X A;  3SWS D;  3SXT D;  2XL3 A;  1C9I A;  2J57 G;  3PSL A;  4BCC A;  4PBZ A;  3SVW D;  3PE7 A;  3EMH A;  3IUL A;  5EM2 B;  3O4G A;  3RN1 D;  1UTC A;  3FCS A;  3I89 A;  1GOF A;  3ZDX A;  3NVX A;  5CXC A;  4CZY A;  2H9N A;  4G55 A;  1BPO A;  3EI3 A;  3DDU A;  3GD1 I;  4J86 A;  3RLM D;  3RMZ D;  2AGX A;  2HKR A;  1JV2 A;  5FA5 B;  5K19 A;  3OL2 B;  2CO0 A;  2EIE A;  2P9K C;  4J8G A;  5FXY A;  4G1E A;  3IUR A;  3EI2 B;  4AOW A;  2QR5 A;  4WK0 A;  4K3J B;  5AMS A;  2Z2P A;  4GM8 A;  4J77 A;  2XU7 A;  4GMB A;  4AMZ A;  3V4V A;  5JWZ A;  4Z7O A;  3I7L A;  1M1X A;  1GP2 B;  5H1M A;  1UOP A;  2Z2O A;  1FWX A;  4JSP C;  3IIW A;  3ZDY A;  5M61 A;  3IJ0 A;  2HKM A;  3EI2 A;  4DNV A;  3GFC A;  1JMX B;  5E6S A;  5H14 A;  4CY3 A;  1GOG A;  3DSM A;  5EAM A;  4J0W A;  1GG2 B;  5FKS A;  3UVO A;  2QZP A;  2UZY B;  3MVD K;  3SBQ A;  4O3U B;  3GRE A;  3I8E A;  4L1M A;  4Z7N A;  3U4Y A;  3VI3 A;  3V7D B;  4PC0 A;  4ZOZ A;  2QXV A;  4XEI C;  3UVL A;  3SN6 B;  4E54 B;  2I0T A;  3DXK C;  3IUQ A;  3GC3 B;  1Q47 A;  3UKU C;  5C2V B;  3P4F A;  1VYH C;  4Z8L A;  5C2W B;  3VI4 A;  3EQ7 A;  4JXM A;  3F3G A;  2J55 H;  2BKL A;  3EI3 B;  2VDR A;  3PXW D;  3JRP A;  3ZWL B;  4L9O A;  3FGB A;  3EU7 A;  2JKX A;  4A09 A;  4QRJ A;  3V5W B;  3K71 A;  2O9K A;  4UM9 A;  3F3P A;  4IMM A;  4QAM A;  3RSE C;  5M5T A;  1JTD B;  4R7A B;  2CN2 A;  3O4J A;  5CXB A;  2OVQ B;  2H6Q A;  1C9L A;  3C5M A;  5EMK B;  1E8N A;  4FHL A;  1P22 A;  4CI3 A;  5KDO B;  1O6F A;  4BCD A;  3UVK A;  4PSW B;  4ES0 A;  2MTA H;  5C92 A;  2VZ3 A;  4FB1 D;  5GMK n;  2IUV A;  3N0D A;  2XYI A;  2VDP A;  2EID A;  5IC7 A;  1SQ9 A;  3JB9 L;  2YNN A;  5HQG A;  2YMU A;  4CZV A;  2WQ8 A;  3AL8 B;  5EAR A;  5EMJ B;  3EI1 A;  4GM9 A;  4WK2 A;  4E54 A;  1GOT B;  4A2M A;  4AN1 A;  2YBA A;  1QNI A;  2P9U C;  3E0C A;  4DNU A;  1XKS A;  3OW8 A;  3I7H A;  2BCJ B;  2YNO A;  3AFC A;  2VDQ A;  2EBS A;  3MUN A;  2CE9 A;  1SQJ A;  4ZN4 A;  5CYK A;  1OMW B;  3IIY A;  4PBY A;  4A0B B;  1PGU A;  4A09 B;  1YFQ A;  4D9S A;  4FA9 D;  2B5N A;  3K27 A;  3BG1 A;  2GC4 A;  4TZ4 A;  4FA5 D;  3IJ1 A;  3KRW B;  4WJK A;  3DM0 A;  4CY5 A;  2HU5 A;  3IJC A;  4BUJ C;  4A7J A;  4LG9 A;  1QFS A;  3ODT A;  5A2Q g;  4H5J A;  4YVD A;  3ZE0 A;  4GGA A;  3SCY A;  1NR0 A;  4A2L A;  3IUN A;  4ZOX A;  3CFV A;  4QQE A;  5EM2 A;  3T3M A;  3B7F A;  3L4M D;  1QFM A;  1U8C A;  1MDA H;  5I5J A;  3EI1 B;  4XYI A;  2CNX A;  5FKT A;  5HE3 B;  4J73 A;  2VDM A;  2CO0 C;  3SJL D;  2YNP A;  4ESG A;  1MG3 A;  3N0E A;  2IUP A;  2VDN A;  5E6R A;  3EQ9 A;  4CI1 A;  4J84 A;  1A0R B;  1H2X A;  2AGW A;  5EAL A;  4CI8 A;  1S4U X;  3SBP A;  4J78 A;  3W15 A;  1VZ2 A;  5M5S A;  2IWF A;  5EML B;  4CY1 A;  1JJU B;  3I8C A;  4IRZ A;  2QC5 A; 
#chains in the Genus database with same CATH homology
 4A11 B;  3VH0 A;  4QT8 A;  4H5I A;  5CYK B;  5GXI A;  3PSC B;  4CI2 A;  2W18 A;  4PXW A;  5THA A;  1L0Q A;  4O1Q D;  2AH1 A;  3UVM A;  4A11 A;  4N14 A;  4ZOY A;  4O9D A;  4E5Z B;  4QL1 A;  5FLX g;  3AL9 A;  4K3I D;  4A0A B;  3L4O D;  3MKS B;  1U4C A;  4X3E A;  2H3X A;  5CXC B;  3EG6 A;  1MG2 A;  3EI4 B;  2AGZ A;  4FAN D;  1JOF A;  2PM9 A;  5HE1 B;  4JD2 C;  1U2V C;  2PM7 B;  1XHM A;  5FKQ A;  5IJ8 E;  4J87 A;  1PEV A;  4U1E I;  4EWR A;  4JSV C;  2P9N C;  4MK0 B;  4FA4 D;  2I0S A;  3NVN A;  1OLZ A;  5HE2 B;  2BBK H;  2P9P C;  3HFQ A;  3FRX A;  3C99 A;  4GQB B;  2H6K A;  4Y5R D;  3PXS D;  2I3S A;  5H17 A;  4GQ1 A;  3MZL A;  3F3F A;  4ERQ A;  3JZH A;  4AEZ A;  1PI6 A;  4A0B A;  5IJ7 E;  5K1C C;  4A08 A;  2H9M A;  2IAA A;  1JMZ B;  4J0X A;  2H13 A;  3JZN A;  4PSX B;  1K8K C;  2Q7Q A;  2OK4 A;  2OIZ A;  3UKR C;  3I7O A;  3PVU B;  2IWK A;  5EAP A;  3C75 H;  3EI4 A;  2CE8 A;  2PM6 B;  4Y7R A;  3OTT A;  2AQ5 A;  4ERY A;  3OL2 A;  1GXR A;  4FWW A;  1N6F A;  1ERJ A;  4KFM B;  1NEX B;  3SHF A;  2G99 A;  3RN0 D;  2B4E A;  2OJY A;  4X61 B;  2GNQ A;  5AJA A;  3NVQ A;  4JT5 C;  1TBG A;  3JZG A;  3SFZ A;  4OWR A;  3DWL C;  4O3T B;  1RI6 A;  3AH8 B;  4GM3 A;  5I5I A;  3MKQ A;  3FM0 A;  3OKY A;  4GQ2 P;  2PM9 B;  4LGN A;  2G9A A;  5TF2 A;  2Z2N A;  2XL2 A;  3UVN A;  3SBR A;  4JT6 C;  5GSA A;  4E5Z A;  1SHY B;  5TEE A;  2CN3 A;  4L3G D;  3K26 A;  4OZU A;  3SLE D;  1XIP A;  5CXB B;  3SMR A;  3JAM g;  3I7N A;  4PNK B;  3A0F A;  3PVW B;  4ERZ A;  2AGY A;  4I79 A;  4JSN C;  2HYE A;  2P9I C;  2H9L A;  1N6D A;  5FQD A;  4J81 A;  3UR4 A;  4GGC A;  5TDH B;  3V9F A;  4J79 A;  3OKT A;  1B9Y A;  2H6N A;  3AL8 A;  3MMY A;  3JPX A;  3ULE C;  3MZK A;  4CZX A;  4J8B A;  3C9C A;  2AGL A;  3BG0 A;  3CFS B;  4G56 B;  5IGO A;  2H68 A;  5IGQ A;  5GXH A;  3OKW A;  3I7P A;  3I2N A;  2I3T A;  4X60 B;  2H9P A;  5FKR A;  3RFH A;  4JSX C;  3IKO A;  4GGD A;  1N6E A;  2OVR B;  4BH6 A;  2P9S C;  3CIK B;  5C9Z B;  2B5M A;  3I7K A;  3EWE A;  4X63 B;  5HYN B;  4O45 A;  3RFG A;  4LG8 A;  3DXM C;  4HDJ A;  4NSX A;  4CC9 A;  5TEF A;  2PBI B;  2HXC A;  5EMM B;  1K32 A;  5IT9 g;  2H47 A;  3ORV D;  4L3H D;  4D6V A;  4IA9 A;  5SXM A;  3VGZ A;  3PXT D;  3MXX A;  2GC7 A;  4GZ8 A;  4ZOV A;  2AH0 A;  1R5M A;  5B4W A;  2H14 A;  2UZX B;  3VA6 A;  4D0K A;  2OK6 A;  4FAV D;  4CY2 A;  3J80 g;  2IUR A;  3KRX B;  2B5L A;  2YB8 B;  2HJ4 A;  4L1Q D;  4A0A A;  4J82 A;  3J81 g;  5I5M A;  4UI9 R;  4FA1 D;  5AFU 3;  4U7A A;  3JRO A;  1TYQ C;  2HES X;  3BWS A;  3RRM C;  4BL0 A;  4XYH A;  1PBY B;  2HJB A;  2P9L C;  5HE0 B;  2J56 H;  2OVP B;  4A08 B;  3OKY B;  2IUQ A;  2I0R A;  2TRC B;  1B9X A;  3SWS D;  3SXT D;  2XL3 A;  2J57 G;  3PSL A;  4PBZ A;  3SVW D;  3PE7 A;  3EMH A;  5EM2 B;  3RN1 D;  3I89 A;  3NVX A;  5CXC A;  4CZY A;  2H9N A;  3EI3 A;  3RMZ D;  4J86 A;  3RLM D;  2AGX A;  2HKR A;  5FA5 B;  5K19 A;  3OL2 B;  2CO0 A;  2P9K C;  4J8G A;  5FXY A;  3EI2 B;  4AOW A;  4K3J B;  5AMS A;  2Z2P A;  4GM8 A;  4J77 A;  2XU7 A;  4GMB A;  5JWZ A;  3I7L A;  1GP2 B;  5H1M A;  2Z2O A;  1FWX A;  4JSP C;  3IIW A;  3IJ0 A;  2HKM A;  3EI2 A;  3GFC A;  1JMX B;  5H14 A;  4CY3 A;  3DSM A;  5EAM A;  4J0W A;  1GG2 B;  5FKS A;  3UVO A;  2UZY B;  3SBQ A;  4O3U B;  3GRE A;  3I8E A;  3U4Y A;  3V7D B;  4PC0 A;  4ZOZ A;  2QXV A;  4XEI C;  3UVL A;  3SN6 B;  4E54 B;  2I0T A;  3DXK C;  1Q47 A;  3UKU C;  5C2V B;  3P4F A;  1VYH C;  4Z8L A;  5C2W B;  4JXM A;  3F3G A;  2J55 H;  3EI3 B;  3PXW D;  3JRP A;  3ZWL B;  4L9O A;  3FGB A;  3EU7 A;  4A09 A;  4QRJ A;  3V5W B;  2O9K A;  3F3P A;  4IMM A;  3RSE C;  4R7A B;  2CN2 A;  5CXB A;  2OVQ B;  2H6Q A;  3C5M A;  5EMK B;  4FHL A;  1P22 A;  4CI3 A;  5KDO B;  3UVK A;  4PSW B;  4ES0 A;  2MTA H;  4FB1 D;  5GMK n;  2IUV A;  3N0D A;  2XYI A;  5IC7 A;  1SQ9 A;  3JB9 L;  2YNN A;  5HQG A;  2YMU A;  4CZV A;  5EMJ B;  3AL8 B;  5EAR A;  3EI1 A;  4GM9 A;  4E54 A;  1GOT B;  4A2M A;  2YBA A;  1QNI A;  2P9U C;  3E0C A;  1XKS A;  3OW8 A;  3I7H A;  2BCJ B;  2YNO A;  3AFC A;  2EBS A;  2CE9 A;  1SQJ A;  4ZN4 A;  5CYK A;  1OMW B;  3IIY A;  4PBY A;  4A0B B;  1PGU A;  4A09 B;  1YFQ A;  4FA9 D;  2B5N A;  3K27 A;  3BG1 A;  2GC4 A;  4TZ4 A;  4FA5 D;  3IJ1 A;  3KRW B;  3DM0 A;  4CY5 A;  3IJC A;  4BUJ C;  4A7J A;  4LG9 A;  3ODT A;  5A2Q g;  4H5J A;  4YVD A;  4GGA A;  3SCY A;  1NR0 A;  4A2L A;  4ZOX A;  3CFV A;  4QQE A;  5EM2 A;  3B7F A;  3L4M D;  1MDA H;  5I5J A;  3EI1 B;  4XYI A;  2CNX A;  5FKT A;  5HE3 B;  4J73 A;  2CO0 C;  3SJL D;  2YNP A;  4ESG A;  1MG3 A;  3N0E A;  2IUP A;  4CI1 A;  4J84 A;  1A0R B;  5EAL A;  2AGW A;  4CI8 A;  1S4U X;  3SBP A;  4J78 A;  3W15 A;  2IWF A;  5EML B;  4CY1 A;  1JJU B;  3I8C A;  2QC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...