4J7JA

The crystal structure of a secreted protein esxb (mutant g53a) from bacillus anthracis str. sterne
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
90
structure length
87
Chain Sequence
MAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRAEFIQSKQAMQQYIPILEGISTDLKRIADKFRNTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a secreted protein EsxB (Mutant, G53A) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
molecule keywords secreted protein EsxB
total genus 39
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j7jA00
4J7KA 4J7JA 4J42A 4KXRA 3FX7A 4J41A 4W4LA 4IYHA 4J11A 4W4KA 2G38A 2GTSA 4J10A 4IYIA
chains in the Genus database with same CATH superfamily
3ASOB 2ZR3A 4F6RB 2Q4PA 1G8MA 2P7TC 2HVJC 1XMQO 4WCEV 2Q73A 2QM7A 3E2EA 5L3CA 4I0XA 2CTQA 2A3QA 4P30A 1OCZC 2XTAA 2IU3A 4I4TA 1KU9A 1N33O 3K79A 3KG2A 3ETDA 4B3TO 3L9DA 3BA9A 4PDRA 3CCRV 5CA0A 4CH3A 5EZYB 4JI7O 2ZR2A 5L3EA 1KD1W 4DR1B 4G2KA 2ZNIA 3T1YO 4LNUB 2RDCA 1X4TA 3H1IH 4DV0O 3FKSG 2VQEB 2H3OA 4CS2A 1V55C 3HR0A 2OWOA 4YJ3A 1SQQH 2ZE5A 5J2TB 2JJ1G 5LYJA 3R65A 1V55B 1ZTEA 1EN5A 3B4SA 5EBWC 3OW2U 1R3IC 2KG7A 4J10A 1P7GA 1OCCC 1S76D 4JI8O 1R6NA 4FMTA 1R6KA 2ARHA 5LYJB 3SR2C 1J5EO 2EULA 4PA9A 4GKKB 1HW7A 5LMUO 1YTFB 1BHBA 2F93B 1VQLV 3MHHC 2YDEA 5LGNA 1SQXH 1VMGA 1N4CA 4DV0B 3RYFB 2DWDC 4JI0O 2PF4E 2FTKA 1XDCA 2LGQA 3ZMUA 3IAYA 1KYOF 3QTCA 5B1AC 5JJJB 4JYYA 4MVUA 1GN6A 1SKVA 5KLVH 3SJBC 3CXCU 3K9SA 2EIKB 3HB3B 2XAGA 3JD2A 3O65A 4O4LA 3WB1A 1Q6HA 3DXRB 4LFCB 2QM8A 4I0XB 4DUYO 1YHQV 2BE3A 1OCOB 5LL6Y 2R9RB 3CX5F 2QSAA 2ZCEA 4NKGB 4NXMO 3N2KB 1H8EG 4CC5A 1URFA 4DV7B 1H2LA 4DV2B 1GM9A 4D7SA 2HHHB 4DV5O 4KFMA 3K5NA 5EC2C 4J11A 1SQGA 4ZOLA 2WAMA 3E89A 3QO5A 3CMAV 4KHPB 4IIJB 2BSKA 2D2CB 3WB0A 4IYHA 4GX5A 1KUQA 1WP7A 3GWOA 4FK5C 4PV1B 1H38A 3RW0A 4H37A 2CTWA 3OEHG 1NT2B 1ZAUA 1OZ0A 2HHHO 2EZOA 3G67A 4Q20A 2JJ2G 4PHZA 2BOCC 5GONB 3B8MA 5EIBD 2F43G 1AI4A 4B3RO 1BE3H 4DK0A 3AG4B 3RYCA 4PDLA 1IBMB 1BHAA 1KBHA 1WN7A 2DQ0A 3BCCH 1WB8A 4NVPA 1VEWA 3UM7A 2WLIB 1Q86W 4YJ2B 2CDYA 4R50A 4YXWG 2X6AA 2QWRB 1M5IA 1TAEA 4QJFB 4U3JB 3STLC 2AZ0A 5JQGB 5LMNB 1QVGU 4LP8A 5IT9N 4H13B 5BY1A 1Q7YW 2OTLV 3FX7A 1ZUQA 4FZ1A 2VQFO 4BW5A 3ZEDA 4GX1A 1XMQB 1WLEA 5GONA 2IJIA 5KHJA 2P90A 4ABMA 1M56B 3ZRSA 4GUNA 2Y0IA 1RPRA 1U97A 1TA8A 3S3WA 3A8TA 3IGAC 3B77A 1M56C 2K9PA 2LW1A 2QWPB 1L1FA 5ITZB 1AJPA 5JVDA 3A0RA 4AILC 5F2VO 1KP2A 4CH5A 1KC8W 1RSOA 4AHCA 1R6TA 4DRXA 2PYLA 3CPWU 4I9QA 2CGNA 2CTPA 4FLZA 3K9AA 3OR7C 4H0LB 5KUKA 4DR2O 4X1KB 2ETNA 2KSDA 1OHHG 3BHPA 3JALA 2OTJV 3Q4HA 1OJHA 4UB6Z 4FJCC 4ZOLB 4JV5B 5KHGA 1HP8A 1MZFA 4LFBB 2B9ZA 1T5EA 4DV4B 4J80A 2R9IA 1NTZH 4GT1A 4DR3O 4IIJA 3P3PA 5IYBO 2ADQB 5GW7A 4O4HB 2VQEO 4MVRA 1NH2D 1VQ5V 2X6CA 1GK9A 5BR8O 1HNZB 2W0FC 4U7NA 4DR4B 2EBOA 3AG1C 4GKKO 4DR7B 3N2KA 5IWAB 4FLTA 3AG2C 4PELA 4IYIA 3OR6C 1K7DA 1DGSA 1H8HG 1BL8A 1K92A 2JIZG 3RWRD 2JEUA 4O2AA 3CE2A 4DV3B 5H6QA 2A06H 3ETQA 3SJAC 1S77D 3ZHTA 1L8DA 1HR0B 2X6BA 2ZD9A 1RM1C 3OE7G 1GM7A 3RYFA 2ZQMA 2OCCB 5TISZ 3BPZA 5CBGA 5JWPA 3SJCC 1NBMG 3CHXA 3ML0A 4JI0B 5A2QN 3KKYA 4LF8B 2PI4A 1SC5B 4GX0A 2P06A 3VQWA 1MABG 4X62B 3E35A 4WFFA 1VQMV 4JI7B 4AQYB 1FYJA 3ABLC 1COWG 2E5LB 5J2TA 1XNQO 1Y74A 4DUYB 3OUFA 5J2UA 4X65B 1Q6UA 3UT5A 1IBKO 3CC4V 1SERA 1VF7A 1CEZA 4QPJA 2HP8A 3CXHF 4TUYA 5JCOA 2QGNA 5CMUA 4J42A 5EZYA 3AK3A 3K5MA 1VF5B 2YSUB 4CZZA 5IY5B 4HNAB 2LJ2A 5D5PA 1AR4A 3ZHSA 4X20A 4BIUA 4TSFG 3AG3B 3ETGA 1ZLZA 3RBZA 2KB1A 1AR1B 3T1CA 1VIBA 1NJIW 2UXCO 4EB6B 1P84F 1K5SA 2M6YA 4J41A 4F6RA 5KMGA 4QPKA 5LP6B 4BIZA 3FYEB 4OGQB 4TQFA 5CB4A 5H5NA 1NQTA 3EFFK 5LA6B 4DK1A 3B09A 3K3WA 5LHIA 1VQ9V 4MVQA 3GVMA 2ZKOA 4ZHQB 2LO1A 3T2MA 3DC6A 2C2AA 3X2QC 1SRYA 3VBBA 3CCQV 3ABMB 3TETA 1FAFA 1DF4A 4KP4A 2XT9A 4JYAO 2UXDB 3T1YB 1VARA 4X8AA 4O4HA 4JI2B 4NXMB 4JI6B 2NLJC 3CRAA 3ZX6A 4WBNA 3OGCC 2ZDIC 5KHKA 3RVYA 3C3TA 4FFKA 2DYSC 2BTOA 1H2GA 2YXHA 4JASA 2ZM6O 1IBMO 2A9HA 2DE0X 4UCVA 2UU9B 3ZCCA 4B3MB 1H2SB 4BAYA 4PA6A 2GSMB 1WP8A 2NN4A 4WFGA 2MK3A 1I0HA 3F7YC 2IJHA 3K06A 3WFVA 2UXDO 4EFEA 1RM1B 4TWKA 1XL6A 5LOVB 3OGIB 1EFRG 1O9HA 4U3FH 1QVFU 1D5AA 1JFFA 1XNQB 2JGUA 1FKAO 2HFEC 4WFHA 4HZ3A 1EZJA 3ZRWB 2R72A 3OFNG 3K5LA 2PGGA 3CCMV 1SA0B 4XDJA 1GAXA 2Y4TA 3ICXA 4BW9A 3JD0A 1VQPV 3HKEA 2Q69A 2E76B 4DO2A 3OD4A 5EBLC 3APOA 4YJ2A 4JTAB 3RYIB 4DR2B 1H2KA 1TUEB 4AI8A 3LDEA 1E1QG 2DMXA 2QJ1A 5BR8B 2QA4V 1HNZO 1TVKA 3SYQA 4NTWA 1XREA 1FXHA 3MAQA 4LF6B 1Q3EA 3UCSC 3CCUV 4JI4B 4W4KA 3N27A 4OXSA 3J80N 3UQ8A 3T4ZA 1NTMH 1XNRB 3N2GB 4RO2A 3DSQA 5IJ0B 5B3SC 1XILA 3TGUH 4LFAO 1WAZA 1HNXO 4UV8A 2RQ6A 1EN4A 5CA1A 2YS8A 1XBLA 4GLXA 2EIKC 2R70A 1OCRC 2UUBO 4DW1A 2HEPA 3D3QA 2ZT9B 1GN2A 1K73W 4ZI7A 1M4UA 2DWEC 4RWUA 1GMGA 2QWQB 5B66Z 4R6ZA 1AVMA 1FS0G 2CH7B 4I5SA 2W6JG 3DTUB 1W2BU 4DUZO 4Z1MG 4X1IB 5BMVB 4GKJO 4LFBO 1HR0O 4O4IA 5C8YB 2EX3A 5IYCO 3PJSK 4MTFA 3CC2V 3E83A 5LBQA 3U0ZA 1Q90D 3IC9A 3JYCA 2UUAO 3ZRWA 1YJNV 5B5EZ 3K59A 2EJRA 1N34B 2X7RB 4TOIA 3JAWB 3ABTA 2F1MA 3ZMVA 2GBOA 3BA8A 4JI2O 1CXZB 1LUWA 1YI2V 4ZKIA 3AK1A 1HWYA 5IYZB 4NXNO 3WB2A 4HYOA 3I56V 1Z5WA 4LWSB 1H2MA 2JGDA 1VQNV 4JAVA 4KXRA 4LF9O 1Y66A 1XUQA 2CUGA 2A0LA 4JI1B 1O9GA 1QR8A 1XMOB 3UO2A 2FL4A 3AG4C 2AHZA 3W7SA 5B1BC 4PA3A 4HNAA 4UCTA 1TUBA 2ZXWB 2ZE8A 2YIAA 3SGIA 1VQ7V 3FB6C 1FFXB 3F5TA 2ZXWC 3SYPA 4XDKA 2H8PC 4PI0A 3ZHQA 1WJZA 5J2UB 4BWAA 3ASOC 1SZXA 3E8GA 4X66O 1K8AW 4DYLA 2DN9A 2PUSA 3K57A 2NNUA 3DC5A 2UXBB 4X1YB 1K9MW 3AG3C 4RAIA 3K04A 4KHPO 2AW9A 5LMUB 3FB5C 1M90W 4TV8A 1R73A 3B2EE 1PV0A 2F4VO 2CE4A 5B1BB 4DR5B 1L0NH 2JRIA 2KQXA 4P2ZA 3W7TA 4ASUG 3AEIA 3IJ4A 3CJHA 4FLYA 4K3AA 3MDSA 4PDMA 3OMAB 1IXBA 2Q0OC 1QBZA 3CJHB 1GKFA 2Y0PA 1D2DA 1U96A 1QCEA 1ZWIC 3FB7C 5LGUA 3WG7B 3JAKA 4OPHA 4DXWA 1YITV 3B8NA 4KUMA 2DYRB 3JD1A 1XHXA 4JI5O 1FXVA 3BY6A 5B1AB 2ZIMA 1K97A 5E79Z 2EZPA 3AK2A 1TGOA 5BXZA 4B08A 4HAMA 3SYCA 2IM9A 3K08A 2WA3A 4MVMA 4DV1B 3TCUA 1AILA 1M57C 1AR5A 2N05A 3D3IA 4E4EA 3E8BA 3S3XA 3ASNC 3JARA 2PI5A 2G38A 5LHHA 3A2FA 4YY3B 1FFXA 1W59A 1MA1A 1BS3A 1VQ6V 1NKDA 2XAHA 4BIOA 1G1XB 1L0LH 1RFYA 2WLKA 1YJWV 1YTFD 4X65O 2HLDG 1V54C 4K35A 1IBLB 3D36C 4RUFA 1AROP 4L8JA 3C3SA 2H94A 2JS3A 4UXNA 3M8AA 3ZHVA 1K33A 4I7ZB 4DRXB 1J5EB 4NTYA 3SYAA 3ZJZA 1AJQA 3BAAA 5JH7B 4I55B 1K3EA 4FLXA 3M99B 3SYOA 5IYZA 1N36B 4D7TA 2FKXA 4QE9A 1NS1A 1YSCA 3W7UA 2Z5UA 4LF4B 2YXYA 4LFCO 3QO8A 4Z2WA 2D3OW 1N32B 4YY3O 1SF9A 2HR3A 3CS5A 3L72H 2XHBA 1JR9A 3G6BA 1I7FA 1QQCA 2GHYA 5JQGA 3JD3A 4GX2A 4U3JA 4CS4A 1W0KG 5H9CA 1NVPB 2VS0A 2JVDA 1DF5A 4O2BB 4B3SO 1AB3A 2BOBC 4X1IA 5BMVA 1H2NA 2AGAA 3QNEA 2VWJA 4FFBB 4F6EA 2XAQA 4LF5B 1BT8A 3JATB 2OIEA 4DR4O 3FAVA 1VQ8V 4DR5O 5IDJA 3P32A 2YIBA 4R8CA 3JSNA 4ZI7B 2JK5C 1FPOA 1Y67A 5J9PC 2LGWA 4DW0A 3BABA 3HPLC 3WG7C 2UUCO 1BQZA 1ZL8A 5EYPB 2B1IA 5FPRA 4LF9B 2P22C 4JI3B 4X1KA 1XHZA 2P4KA 4KL1A 4UFZA 3K03A 2E5LO 2E74B 4ICGA 4X9QA 5DECA 3JASA 3JASB 1WA8B 5JVDB 4PI2A 2W0XA 4LH6A 1Q6IA 5FNVA 1R1BA 4MTXA 1I08A 3APQA 4EFBA 2AHYA 4IHJA 3JD4A 1VF6C 4FFBA 2WSSG 2IH1C 1UJWB 3OMIB 5EC1C 1N33B 3LNMB 1JMKC 4O2BA 2EIJC 1MG1A 1QR9A 1AI6A 2EINC 3KCYA 1FD9A 2WWWA 5CN0A 2XAFA 2EINB 2UXCB 4DV4O 5LGTA 3CC7V 3CSXA 1N0JA 4I50B 1XI1A 2ZE7A 1A32A 5BZBA 3L73H 3AG7A 1M57B 2PY5A 4B3RB 3ASNB 3EXAA 2FYUH 4I55A 1XQ8A 2Q7EA 4GCZA 2LP7A 2EIMB 4UCRA 5IJ9B 4DR7O 4TV9B 2QE7G 4TT3G 3ABKB 1KKCA 2X0LA 1VQKV 1JCHA 2OT5A 4QGPA 2EIJB 4YIOA 5KHHA 3RVZA 1BZKA 3CCLV 1BSMA 1Q43A 4JYBA 2ITCC 1P4RA 2UXBO 4A5UB 4DV6B 3SPJA 1V9PA 3HKBA 4UUJC 2IJJA 1Z5VA 2Y4UA 4WFEA 4WBNB 2OCCC 3JARB 3G80A 3H1JH 4DR6O 4K8XA 1PNKA 2YEVB 1DLBA 4DV1O 1LUVA 3HKDB 1S5LZ 2KG7B 5GTIZ 2OCHA 3UO3A 2ZM6B 2UUBB 1S0VA 2IH3C 5EIBC 4MVSA 2XASA 1CPYA 4UCUA 2ZINA 1ENVA 3SPIA 3W7XA 1PPJH 2CK3G 2QKSA 4ZHQA 4DR3B 3ABKC 2Q68A 1BGYH 4LH7A 1Z2GA 5LA6A 4YIPA 4GKJB 3JAKB 3EVKA 4O4LB 1K4DC 5KMGB 2CAZC 1SQFA 4EB6A 3CRMA 2UUAB 4J9YB 2V1DA 4X89A 4J7JA 4FZ0A 4DV3O 1F23A 3VQXA 1N34O 3LSUA 1GM8A 1PKXA 1DTOA 1EM1A 4JF3A 2HJDA 1MSDA 2EILC 5JCOC 4UVAA 2ODMA 3E8FA 4AQYO 5IWAO 4X1YA 1OCRB 2QWOB 3SDLA 5KA6A 1MSWD 4RUEA 3TK1A 5CA3A 4LF8O 4MW3A 5HFLA 4MW8A 2BTQA 3UT5B 2Q0AA 4DV7O 4JGSA 1IZ3A 5IYDO 4Z1VA 4P9OA 4RQEA 1JX9A 3HKBB 3H9VA 3OEEG 2YIDA 4B3SB 3SPHA 4IL6Z 1TUBB 3HKDA 2YEVA 2WA4A 3VOUA 3LSSA 2DYRC 3OT7A 4F4LA 1QLNA 3JSLA 1DK1A 4D6TH 4LNUA 4JI3O 1I5YA 3J81N 1RPOA 4PJ0Z 1HDJA 4FLVA 4IGGA 2JS5A 1E1RG 2UXXA 1FJGB 1AJNA 2ZDIA 4NB5A 2QR4A 2HVKC 4G27B 4J7ZA 3L75H 1NVPD 4C7UA 3HKCA 3L71H 3CRQA 4TV9A 4YHHO 3OUSA 4FIPC 1BMFG 4O2AB 3NXSA 2YI8A 2DJVA 2JGDB 3QG5A 3IC7A 4CC6A 1GRJA 1XOUA 2PTMA 1S72V 3OAAG 1EZVH 1E79G 3FYIB 3JCUZ 4B7EA 3KCXA 3AG2B 1G6UA 1ROPA 3QO7A 3I5DA 1J95A 1NR1A 1ORQC 1NZ6A 2LFRA 3E8HA 4FM0A 1XEQA 1MNGA 3CP1A 1B04A 2CTRA 2QKAA 1PL4A 5DN6G 2RMKB 2ITDC 3F5WC 4X64B 1PP9H 2RNBA 2CGOA 5C8YA 2DQ3A 2Q7GA 4JI1O 3O9OA 2WLNA 1JPXA 2QTOA 3A0HZ 3CCEV 1G4YB 2FB5A 1JJOA 4LF5O 1IDSA 3Q4HB 5B1OA 2MW2B 5CA1B 4FM2A 1GH6A 3E86A 1KMIZ 2WLMA 3DGEA 5L3DA 2HG5C 3T1HB 1Y76A 4OPAA 4J9ZB 1SQPH 1NH2B 4I9WA 5K1PA 3LDDA 2GDSA 1B3QA 1ZSPA 4GYCB 5ITZA 1I5XA 3PN1A 2Q67A 3ZHUA 1N8RW 1JA8A 2GTSA 5IJ0A 1R3KC 4H33A 1ZX3A 5DM6V 5FL7G 3H01A 5B3SB 1AP5A 2P6JA 3L70H 3L74H 4FM1A 5LXTB 2KKWA 5JJNB 2P4VA 3E22A 2QWNB 1TVKB 3OTFA 1N36O 5IY5C 3HKEB 2K1EA 4FVMA 2EILB 3FAVB 4DR6B 4TQDA 3U11A 2E75B 5L3GA 3ZN1A 3I55V 4CS3A 3CCVV 3RYIA 3LDCA 1N32O 1EN6A 1QLEC 1KKDA 1IXMA 1M9NA 1JFFB 4MSWC 3ZIAG 1N0NA 2ZIOA 4P9PA 4EEQA 3K0DA 3A0BZ 3RYCB 2GV9A 4G28B 2E3CA 2WLLA 3H1KH 1NU1H 3UKMA 2Z3YA 4NR1A 2GUZB 1KECA 3ZMTA 2UXNA 5GTHZ 2IBZH 5KHIA 1QU7A 3QVNA 1UFIA 3JCZA 2HKOA 2DOSA 1SETA 2FMLA 5KAFZ 1NTKH 2Q8VA 1YIJV 3SPCA 2ADPA 4LF7O 4PD4F 2YI9A 1AP6A 3T4DA 2DYSB 2R9AA 4CH6A 1FXKB 1BQ0A 4NXNB 3ZMSA 4JI8B 2BSKB 4IT5A 3VQVA 1Q81W 3AG1B 4X62O 2VRZA 4UV9A 4UVCA 5KAIZ 2P5OA 4R7CA 5B1NA 3GB7C 4HBNA 3LNNA 4X64O 3BVOA 2P67A 2AZ2A 4ZIBA 2XAJA 1XNRO 2LW7A 5C93A 3ETEA 4YHHB 2EJ7A 2JEXA 4DUZB 2YC0A 1VP7A 2Q6AA 2F4VB 4EKWA 3DXRA 5EK0A 1IVSA 3RT3C 1QNMA 4XDLA 3RFRA 2IJKA 5LP6A 4LR3A 1FXKC 1YDXA 5H2FZ 3D36A 3OTOB 2WLJA 5AG2A 1GO3F 3TJTA 4Q6GA 3LUTB 3G4SV 1RP3B 5LMNO 1Q82W 5CB4B 1YJ9V 1D5NA 1Q5OA 1XMOO 4X20B 3FB8C 3ABLB 1NR7A 4TV8B 4JAUA 1P49A 4DV2O 3GWKC 4LF4O 2PYJA 2PZSA 3ZMZA 1XL4A 2WLHA 3TXQA 1US6A 1GN4A 4JPRA 4UCOA 1JJ2U 2ZE6A 3H1LH 2UU9O 4B3MO 5KUMA 4JTDB 2QTSA 4NYKA 5LHGA 1R3JC 3ZBHA 2F66C 4H44B 3MD0A 3J7AU 1I94B 4U7OA 2LFSA 2ILMA 1SESA 2A7WA 5CBFA 3T1HO 2V7QG 3QF7A 2ZNJA 4NTXA 1Y74B 5KX5B 4FLWA 3NR7A 4TUYB 2RN9A 1S3JA 4WF9V 5KX5A 3BEHA 4YJ3B 4JV5O 4JZ2A 3ZS8C 3X2QB 4LBEC 3ABMC 4MVZA 1B06A 5HFMA 4K0KB 1QHTA 1M93A 1F7YA 3TXSA 2B5UA 3EHBB 4MTGA 3R66A 1FXKA 4GZRB 3G6EV 3KZIZ 4JZGA 2XNDG 1QLEB 4L87A 5CA0B 4LF7B 2Y69B 1PL0A 4I4TB 1SQBH 4FLUA 4PA4A 3K5OA 2QEXV 3JAWA 3SJQC 4OX9B 2VWKA 1OV9A 5IJ9A 3CCSV 1FJGO 4XBFA 4PA7A 4LWSA 3STZC 1SQVH 2EIMC 3C90A 4UB8Z 3CB2A 5IE9A 4UCSA 2RCVA 2YUAA 1KB9F 3D8CA 3F7VC 4JYCA 2WLLB 3G71V 4B7KA 4WFBV 3ABUA 1F51A 5D5QA 4RQFA 4K0KO 1FFTB 2YICA 2Q5ZA 2YXLA 4I50A 1YXBA 3OMNB 2HJFC 5L3BA 4O4JA 4LC1A 1YCIA 2DW4A 4QE7A 1W0JG 2WPDG 4J7KA 3CEIA 1JVMA 2CH7A 3ZN0A 4CBCA 5K1XA 1K5QA 3H1HH 1Y6XA 1OCOC 3K0GA 1HNWB 1KP3A 4JTCB 3FFQA 3E22B 1PNLA 4LF6O 4JYAB 2NR5A 1JQ0A 1Q8IA 4O4IB 1GTOA 2Y69C 2Q9LA 1PM9A 3CYOA 4DR1O 5LXTA 2JDIG 2Q7HA 4IHJB 3CMEV 3JALB 4B3TB 5FNVB 1IBLO 2N74A 2XOKG 1VF6A 4JI5B 4DV6O 1WPBA 4E2LA 2F95B 3N2GA 1PD3A 1JOYA 2M7WA 1YZBA 1IBKB 1WA8A 1SZTA 1RSOB 1VQOV 1WB7A 5FLXN 2V4DA 3RYHB 3CCJV 4PDVA 1Y4MA 2QM4A 2O57A 3RGBA 1Y76B 1K4CC 5A9GA 3M7MX 2OYQA 4LFAB 5DEDA 4MS2A 1HNXB 4CH4A 1YF2A 5FPOA 1HNWO 5EYPA 1ZL8B 2UUCB 4N21A 4QNHB 3CD6V 4N23A 1AI5A 2GUZA 2LQTA 3LSQA 1K34A 3THOA 1VQ4V 4DV5B 3ZRXA 1OCCB 4JAAA 3JATA 1EBOA 3P30A 5LP6C 1WNSA 2Z0AA 1F4MA 1X59A 1P7BA 2OIGA 1GN3A 4MTOA 1IURA 5E1AC 2ATKC 5EBMC 4JI6O 1I94O 4W4LA 5H6RA 1PNMA 1SA0A 3CWBH 3SPGA 5LOVA 3BFRA 3CRCA 2WLIA 3WU2Z 1CP9A 4LCUC 1LNQA 3W7WA 1F4NA 3CRRA 2IW5A 1MZEA 1M1KW 1MOFA 2W6IG 4ZBMA 3HKCB 2L6LA 1WPXA 1THZA 4JI4O 3U10A 2N04A 1NI8A 2QKCA 5JH7A 3RYHA 2A79B 5CBHA 1SS3A 4BR6A 1YVWA 1IX9A 2VQFB 1UPGA 1S5HC 3ZRVA 4FPPA 3IFXA 1S5JA 2YIBD 1KQSU 3RN4A 4UVBA 4K8ZA 5L3FA 4QIWF 1V54B 1LR1A 3B40A 3OM3B 2AXTZ 1OCZB 4X88A 3JAMN 4OX9O 2Y48A 3P3NA 1YEWA 2XUMA 1BCCH 3OTOO 1AI7A 3ZHRA 4MVOA 5JJEB 2QDOA 3MHSC 4WFAV 5KA5A 2BTQB 3FD9A 3BRCA 3VQYA 2GTAA 2F23A 2L35A 4O4JB 4X66B 2RJZA 3K58A 4MT8A 2IU0A 2BCCH 1B6QA 1MMMA 1R3LC 2B1GA
chains in the Genus database with same CATH topology
4J7KA 4J7JA 4J42A 4KXRA 3FX7A 4J41A 4W4LA 4IYHA 4J11A 4W4KA 2G38A 2GTSA 4J10A 4IYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7K A;  4J7J A;  4J42 A;  4KXR A;  3FX7 A;  4J41 A;  4W4L A;  4IYH A;  4J11 A;  4W4K A;  2G38 A;  2GTS A;  4J10 A;  4IYI A; 
#chains in the Genus database with same CATH topology
 3ASO B;  2ZR3 A;  4F6R B;  2Q4P A;  1G8M A;  2P7T C;  2HVJ C;  1XMQ O;  4WCE V;  2Q73 A;  2QM7 A;  3E2E A;  5L3C A;  4I0X A;  2CTQ A;  2A3Q A;  4P30 A;  1OCZ C;  2XTA A;  2IU3 A;  4I4T A;  1KU9 A;  1N33 O;  3K79 A;  3KG2 A;  3ETD A;  4B3T O;  3L9D A;  3BA9 A;  4PDR A;  3CCR V;  5CA0 A;  4CH3 A;  5EZY B;  4JI7 O;  2ZR2 A;  5L3E A;  1KD1 W;  4DR1 B;  4G2K A;  2ZNI A;  3T1Y O;  4LNU B;  2RDC A;  1X4T A;  3H1I H;  4DV0 O;  3FKS G;  2VQE B;  2H3O A;  4CS2 A;  1V55 C;  3HR0 A;  2OWO A;  4YJ3 A;  1SQQ H;  2ZE5 A;  5J2T B;  2JJ1 G;  5LYJ A;  3R65 A;  1V55 B;  1ZTE A;  1EN5 A;  3B4S A;  5EBW C;  3OW2 U;  1R3I C;  2KG7 A;  4J10 A;  1P7G A;  1OCC C;  1S76 D;  4JI8 O;  1R6N A;  4FMT A;  1R6K A;  2ARH A;  5LYJ B;  3SR2 C;  1J5E O;  2EUL A;  4PA9 A;  4GKK B;  1HW7 A;  5LMU O;  1YTF B;  1BHB A;  2F93 B;  1VQL V;  3MHH C;  2YDE A;  5LGN A;  1SQX H;  1VMG A;  1N4C A;  4DV0 B;  3RYF B;  2DWD C;  4JI0 O;  2PF4 E;  2FTK A;  1XDC A;  2LGQ A;  3ZMU A;  3IAY A;  1KYO F;  3QTC A;  5B1A C;  5JJJ B;  4JYY A;  4MVU A;  1GN6 A;  1SKV A;  5KLV H;  3SJB C;  3CXC U;  3K9S A;  2EIK B;  3HB3 B;  2XAG A;  3JD2 A;  3O65 A;  4O4L A;  3WB1 A;  1Q6H A;  3DXR B;  4LFC B;  2QM8 A;  4I0X B;  4DUY O;  1YHQ V;  2BE3 A;  1OCO B;  5LL6 Y;  2R9R B;  3CX5 F;  2QSA A;  2ZCE A;  4NKG B;  4NXM O;  3N2K B;  1H8E G;  4CC5 A;  1URF A;  4DV7 B;  1H2L A;  4DV2 B;  1GM9 A;  4D7S A;  2HHH B;  4DV5 O;  4KFM A;  3K5N A;  5EC2 C;  4J11 A;  1SQG A;  4ZOL A;  2WAM A;  3E89 A;  3QO5 A;  3CMA V;  4KHP B;  4IIJ B;  2BSK A;  2D2C B;  3WB0 A;  4IYH A;  4GX5 A;  1KUQ A;  1WP7 A;  3GWO A;  4FK5 C;  4PV1 B;  1H38 A;  3RW0 A;  4H37 A;  2CTW A;  3OEH G;  1NT2 B;  1ZAU A;  1OZ0 A;  2HHH O;  2EZO A;  3G67 A;  4Q20 A;  2JJ2 G;  4PHZ A;  2BOC C;  5GON B;  3B8M A;  5EIB D;  2F43 G;  1AI4 A;  4B3R O;  1BE3 H;  4DK0 A;  3AG4 B;  3RYC A;  4PDL A;  1IBM B;  1BHA A;  1KBH A;  1WN7 A;  2DQ0 A;  3BCC H;  1WB8 A;  4NVP A;  1VEW A;  3UM7 A;  2WLI B;  1Q86 W;  4YJ2 B;  2CDY A;  4R50 A;  4YXW G;  2X6A A;  2QWR B;  1M5I A;  1TAE A;  4QJF B;  4U3J B;  3STL C;  2AZ0 A;  5JQG B;  5LMN B;  1QVG U;  4LP8 A;  5IT9 N;  4H13 B;  5BY1 A;  1Q7Y W;  2OTL V;  3FX7 A;  1ZUQ A;  4FZ1 A;  2VQF O;  4BW5 A;  3ZED A;  4GX1 A;  1XMQ B;  1WLE A;  5GON A;  2IJI A;  5KHJ A;  2P90 A;  4ABM A;  1M56 B;  3ZRS A;  4GUN A;  2Y0I A;  1RPR A;  1U97 A;  1TA8 A;  3S3W A;  3A8T A;  3IGA C;  3B77 A;  1M56 C;  2K9P A;  2LW1 A;  2QWP B;  1L1F A;  5ITZ B;  1AJP A;  5JVD A;  3A0R A;  4AIL C;  5F2V O;  1KP2 A;  4CH5 A;  1KC8 W;  1RSO A;  4AHC A;  1R6T A;  4DRX A;  2PYL A;  3CPW U;  4I9Q A;  2CGN A;  2CTP A;  4FLZ A;  3K9A A;  3OR7 C;  4H0L B;  5KUK A;  4DR2 O;  4X1K B;  2ETN A;  2KSD A;  1OHH G;  3BHP A;  3JAL A;  2OTJ V;  3Q4H A;  1OJH A;  4UB6 Z;  4FJC C;  4ZOL B;  4JV5 B;  5KHG A;  1HP8 A;  1MZF A;  4LFB B;  2B9Z A;  1T5E A;  4DV4 B;  4J80 A;  2R9I A;  1NTZ H;  4GT1 A;  4DR3 O;  4IIJ A;  3P3P A;  5IYB O;  2ADQ B;  5GW7 A;  4O4H B;  2VQE O;  4MVR A;  1NH2 D;  1VQ5 V;  2X6C A;  1GK9 A;  5BR8 O;  1HNZ B;  2W0F C;  4U7N A;  4DR4 B;  2EBO A;  3AG1 C;  4GKK O;  4DR7 B;  3N2K A;  5IWA B;  4FLT A;  3AG2 C;  4PEL A;  4IYI A;  3OR6 C;  1K7D A;  1DGS A;  1H8H G;  1BL8 A;  1K92 A;  2JIZ G;  3RWR D;  2JEU A;  4O2A A;  3CE2 A;  4DV3 B;  5H6Q A;  2A06 H;  3ETQ A;  3SJA C;  1S77 D;  3ZHT A;  1L8D A;  1HR0 B;  2X6B A;  2ZD9 A;  1RM1 C;  3OE7 G;  1GM7 A;  3RYF A;  2ZQM A;  2OCC B;  5TIS Z;  3BPZ A;  5CBG A;  5JWP A;  3SJC C;  1NBM G;  3CHX A;  3ML0 A;  4JI0 B;  5A2Q N;  3KKY A;  4LF8 B;  2PI4 A;  1SC5 B;  4GX0 A;  2P06 A;  3VQW A;  1MAB G;  4X62 B;  3E35 A;  4WFF A;  1VQM V;  4JI7 B;  4AQY B;  1FYJ A;  3ABL C;  1COW G;  2E5L B;  5J2T A;  1XNQ O;  1Y74 A;  4DUY B;  3OUF A;  5J2U A;  4X65 B;  1Q6U A;  3UT5 A;  1IBK O;  3CC4 V;  1SER A;  1VF7 A;  1CEZ A;  4QPJ A;  2HP8 A;  3CXH F;  4TUY A;  5JCO A;  2QGN A;  5CMU A;  4J42 A;  5EZY A;  3AK3 A;  3K5M A;  1VF5 B;  2YSU B;  4CZZ A;  5IY5 B;  4HNA B;  2LJ2 A;  5D5P A;  1AR4 A;  3ZHS A;  4X20 A;  4BIU A;  4TSF G;  3AG3 B;  3ETG A;  1ZLZ A;  3RBZ A;  2KB1 A;  1AR1 B;  3T1C A;  1VIB A;  1NJI W;  2UXC O;  4EB6 B;  1P84 F;  1K5S A;  2M6Y A;  4J41 A;  4F6R A;  5KMG A;  4QPK A;  5LP6 B;  4BIZ A;  3FYE B;  4OGQ B;  4TQF A;  5CB4 A;  5H5N A;  1NQT A;  3EFF K;  5LA6 B;  4DK1 A;  3B09 A;  3K3W A;  5LHI A;  1VQ9 V;  4MVQ A;  3GVM A;  2ZKO A;  4ZHQ B;  2LO1 A;  3T2M A;  3DC6 A;  2C2A A;  3X2Q C;  1SRY A;  3VBB A;  3CCQ V;  3ABM B;  3TET A;  1FAF A;  1DF4 A;  4KP4 A;  2XT9 A;  4JYA O;  2UXD B;  3T1Y B;  1VAR A;  4X8A A;  4O4H A;  4JI2 B;  4NXM B;  4JI6 B;  2NLJ C;  3CRA A;  3ZX6 A;  4WBN A;  3OGC C;  2ZDI C;  5KHK A;  3RVY A;  3C3T A;  4FFK A;  2DYS C;  2BTO A;  1H2G A;  2YXH A;  4JAS A;  2ZM6 O;  1IBM O;  2A9H A;  2DE0 X;  4UCV A;  2UU9 B;  3ZCC A;  4B3M B;  1H2S B;  4BAY A;  4PA6 A;  2GSM B;  1WP8 A;  2NN4 A;  4WFG A;  2MK3 A;  1I0H A;  3F7Y C;  2IJH A;  3K06 A;  3WFV A;  2UXD O;  4EFE A;  1RM1 B;  4TWK A;  1XL6 A;  5LOV B;  3OGI B;  1EFR G;  1O9H A;  4U3F H;  1QVF U;  1D5A A;  1JFF A;  1XNQ B;  2JGU A;  1FKA O;  2HFE C;  4WFH A;  4HZ3 A;  1EZJ A;  3ZRW B;  2R72 A;  3OFN G;  3K5L A;  2PGG A;  3CCM V;  1SA0 B;  4XDJ A;  1GAX A;  2Y4T A;  3ICX A;  4BW9 A;  3JD0 A;  1VQP V;  3HKE A;  2Q69 A;  2E76 B;  4DO2 A;  3OD4 A;  5EBL C;  3APO A;  4YJ2 A;  4JTA B;  3RYI B;  4DR2 B;  1H2K A;  1TUE B;  4AI8 A;  3LDE A;  1E1Q G;  2DMX A;  2QJ1 A;  5BR8 B;  2QA4 V;  1HNZ O;  1TVK A;  3SYQ A;  4NTW A;  1XRE A;  1FXH A;  3MAQ A;  4LF6 B;  1Q3E A;  3UCS C;  3CCU V;  4JI4 B;  4W4K A;  3N27 A;  4OXS A;  3J80 N;  3UQ8 A;  3T4Z A;  1NTM H;  1XNR B;  3N2G B;  4RO2 A;  3DSQ A;  5IJ0 B;  5B3S C;  1XIL A;  3TGU H;  4LFA O;  1WAZ A;  1HNX O;  4UV8 A;  2RQ6 A;  1EN4 A;  5CA1 A;  2YS8 A;  1XBL A;  4GLX A;  2EIK C;  2R70 A;  1OCR C;  2UUB O;  4DW1 A;  2HEP A;  3D3Q A;  2ZT9 B;  1GN2 A;  1K73 W;  4ZI7 A;  1M4U A;  2DWE C;  4RWU A;  1GMG A;  2QWQ B;  5B66 Z;  4R6Z A;  1AVM A;  1FS0 G;  2CH7 B;  4I5S A;  2W6J G;  3DTU B;  1W2B U;  4DUZ O;  4Z1M G;  4X1I B;  5BMV B;  4GKJ O;  4LFB O;  1HR0 O;  4O4I A;  5C8Y B;  2EX3 A;  5IYC O;  3PJS K;  4MTF A;  3CC2 V;  3E83 A;  5LBQ A;  3U0Z A;  1Q90 D;  3IC9 A;  3JYC A;  2UUA O;  3ZRW A;  1YJN V;  5B5E Z;  3K59 A;  2EJR A;  1N34 B;  2X7R B;  4TOI A;  3JAW B;  3ABT A;  2F1M A;  3ZMV A;  2GBO A;  3BA8 A;  4JI2 O;  1CXZ B;  1LUW A;  1YI2 V;  4ZKI A;  3AK1 A;  1HWY A;  5IYZ B;  4NXN O;  3WB2 A;  4HYO A;  3I56 V;  1Z5W A;  4LWS B;  1H2M A;  2JGD A;  1VQN V;  4JAV A;  4KXR A;  4LF9 O;  1Y66 A;  1XUQ A;  2CUG A;  2A0L A;  4JI1 B;  1O9G A;  1QR8 A;  1XMO B;  3UO2 A;  2FL4 A;  3AG4 C;  2AHZ A;  3W7S A;  5B1B C;  4PA3 A;  4HNA A;  4UCT A;  1TUB A;  2ZXW B;  2ZE8 A;  2YIA A;  3SGI A;  1VQ7 V;  3FB6 C;  1FFX B;  3F5T A;  2ZXW C;  3SYP A;  4XDK A;  2H8P C;  4PI0 A;  3ZHQ A;  1WJZ A;  5J2U B;  4BWA A;  3ASO C;  1SZX A;  3E8G A;  4X66 O;  1K8A W;  4DYL A;  2DN9 A;  2PUS A;  3K57 A;  2NNU A;  3DC5 A;  2UXB B;  4X1Y B;  1K9M W;  3AG3 C;  4RAI A;  3K04 A;  4KHP O;  2AW9 A;  5LMU B;  3FB5 C;  1M90 W;  4TV8 A;  1R73 A;  3B2E E;  1PV0 A;  2F4V O;  2CE4 A;  5B1B B;  4DR5 B;  1L0N H;  2JRI A;  2KQX A;  4P2Z A;  3W7T A;  4ASU G;  3AEI A;  3IJ4 A;  3CJH A;  4FLY A;  4K3A A;  3MDS A;  4PDM A;  3OMA B;  1IXB A;  2Q0O C;  1QBZ A;  3CJH B;  1GKF A;  2Y0P A;  1D2D A;  1U96 A;  1QCE A;  1ZWI C;  3FB7 C;  5LGU A;  3WG7 B;  3JAK A;  4OPH A;  4DXW A;  1YIT V;  3B8N A;  4KUM A;  2DYR B;  3JD1 A;  1XHX A;  4JI5 O;  1FXV A;  3BY6 A;  5B1A B;  2ZIM A;  1K97 A;  5E79 Z;  2EZP A;  3AK2 A;  1TGO A;  5BXZ A;  4B08 A;  4HAM A;  3SYC A;  2IM9 A;  3K08 A;  2WA3 A;  4MVM A;  4DV1 B;  3TCU A;  1AIL A;  1M57 C;  1AR5 A;  2N05 A;  3D3I A;  4E4E A;  3E8B A;  3S3X A;  3ASN C;  3JAR A;  2PI5 A;  2G38 A;  5LHH A;  3A2F A;  4YY3 B;  1FFX A;  1W59 A;  1MA1 A;  1BS3 A;  1VQ6 V;  1NKD A;  2XAH A;  4BIO A;  1G1X B;  1L0L H;  1RFY A;  2WLK A;  1YJW V;  1YTF D;  4X65 O;  2HLD G;  1V54 C;  4K35 A;  1IBL B;  3D36 C;  4RUF A;  1ARO P;  4L8J A;  3C3S A;  2H94 A;  2JS3 A;  4UXN A;  3M8A A;  3ZHV A;  1K33 A;  4I7Z B;  4DRX B;  1J5E B;  4NTY A;  3SYA A;  3ZJZ A;  1AJQ A;  3BAA A;  5JH7 B;  4I55 B;  1K3E A;  4FLX A;  3M99 B;  3SYO A;  5IYZ A;  1N36 B;  4D7T A;  2FKX A;  4QE9 A;  1NS1 A;  1YSC A;  3W7U A;  2Z5U A;  4LF4 B;  2YXY A;  4LFC O;  3QO8 A;  4Z2W A;  2D3O W;  1N32 B;  4YY3 O;  1SF9 A;  2HR3 A;  3CS5 A;  3L72 H;  2XHB A;  1JR9 A;  3G6B A;  1I7F A;  1QQC A;  2GHY A;  5JQG A;  3JD3 A;  4GX2 A;  4U3J A;  4CS4 A;  1W0K G;  5H9C A;  1NVP B;  2VS0 A;  2JVD A;  1DF5 A;  4O2B B;  4B3S O;  1AB3 A;  2BOB C;  4X1I A;  5BMV A;  1H2N A;  2AGA A;  3QNE A;  2VWJ A;  4FFB B;  4F6E A;  2XAQ A;  4LF5 B;  1BT8 A;  3JAT B;  2OIE A;  4DR4 O;  3FAV A;  1VQ8 V;  4DR5 O;  5IDJ A;  3P32 A;  2YIB A;  4R8C A;  3JSN A;  4ZI7 B;  2JK5 C;  1FPO A;  1Y67 A;  5J9P C;  2LGW A;  4DW0 A;  3BAB A;  3HPL C;  3WG7 C;  2UUC O;  1BQZ A;  1ZL8 A;  5EYP B;  2B1I A;  5FPR A;  4LF9 B;  2P22 C;  4JI3 B;  4X1K A;  1XHZ A;  2P4K A;  4KL1 A;  4UFZ A;  3K03 A;  2E5L O;  2E74 B;  4ICG A;  4X9Q A;  5DEC A;  3JAS A;  3JAS B;  1WA8 B;  5JVD B;  4PI2 A;  2W0X A;  4LH6 A;  1Q6I A;  5FNV A;  1R1B A;  4MTX A;  1I08 A;  3APQ A;  4EFB A;  2AHY A;  4IHJ A;  3JD4 A;  1VF6 C;  4FFB A;  2WSS G;  2IH1 C;  1UJW B;  3OMI B;  5EC1 C;  1N33 B;  3LNM B;  1JMK C;  4O2B A;  2EIJ C;  1MG1 A;  1QR9 A;  1AI6 A;  2EIN C;  3KCY A;  1FD9 A;  2WWW A;  5CN0 A;  2XAF A;  2EIN B;  2UXC B;  4DV4 O;  5LGT A;  3CC7 V;  3CSX A;  1N0J A;  4I50 B;  1XI1 A;  2ZE7 A;  1A32 A;  5BZB A;  3L73 H;  3AG7 A;  1M57 B;  2PY5 A;  4B3R B;  3ASN B;  3EXA A;  2FYU H;  4I55 A;  1XQ8 A;  2Q7E A;  4GCZ A;  2LP7 A;  2EIM B;  4UCR A;  5IJ9 B;  4DR7 O;  4TV9 B;  2QE7 G;  4TT3 G;  3ABK B;  1KKC A;  2X0L A;  1VQK V;  1JCH A;  2OT5 A;  4QGP A;  2EIJ B;  4YIO A;  5KHH A;  3RVZ A;  1BZK A;  3CCL V;  1BSM A;  1Q43 A;  4JYB A;  2ITC C;  1P4R A;  2UXB O;  4A5U B;  4DV6 B;  3SPJ A;  1V9P A;  3HKB A;  4UUJ C;  2IJJ A;  1Z5V A;  2Y4U A;  4WFE A;  4WBN B;  2OCC C;  3JAR B;  3G80 A;  3H1J H;  4DR6 O;  4K8X A;  1PNK A;  2YEV B;  1DLB A;  4DV1 O;  1LUV A;  3HKD B;  1S5L Z;  2KG7 B;  5GTI Z;  2OCH A;  3UO3 A;  2ZM6 B;  2UUB B;  1S0V A;  2IH3 C;  5EIB C;  4MVS A;  2XAS A;  1CPY A;  4UCU A;  2ZIN A;  1ENV A;  3SPI A;  3W7X A;  1PPJ H;  2CK3 G;  2QKS A;  4ZHQ A;  4DR3 B;  3ABK C;  2Q68 A;  1BGY H;  4LH7 A;  1Z2G A;  5LA6 A;  4YIP A;  4GKJ B;  3JAK B;  3EVK A;  4O4L B;  1K4D C;  5KMG B;  2CAZ C;  1SQF A;  4EB6 A;  3CRM A;  2UUA B;  4J9Y B;  2V1D A;  4X89 A;  4J7J A;  4FZ0 A;  4DV3 O;  1F23 A;  3VQX A;  1N34 O;  3LSU A;  1GM8 A;  1PKX A;  1DTO A;  1EM1 A;  4JF3 A;  2HJD A;  1MSD A;  2EIL C;  5JCO C;  4UVA A;  2ODM A;  3E8F A;  4AQY O;  5IWA O;  4X1Y A;  1OCR B;  2QWO B;  3SDL A;  5KA6 A;  1MSW D;  4RUE A;  3TK1 A;  5CA3 A;  4LF8 O;  4MW3 A;  5HFL A;  4MW8 A;  2BTQ A;  3UT5 B;  2Q0A A;  4DV7 O;  4JGS A;  1IZ3 A;  5IYD O;  4Z1V A;  4P9O A;  4RQE A;  1JX9 A;  3HKB B;  3H9V A;  3OEE G;  2YID A;  4B3S B;  3SPH A;  4IL6 Z;  1TUB B;  3HKD A;  2YEV A;  2WA4 A;  3VOU A;  3LSS A;  2DYR C;  3OT7 A;  4F4L A;  1QLN A;  3JSL A;  1DK1 A;  4D6T H;  4LNU A;  4JI3 O;  1I5Y A;  3J81 N;  1RPO A;  4PJ0 Z;  1HDJ A;  4FLV A;  4IGG A;  2JS5 A;  1E1R G;  2UXX A;  1FJG B;  1AJN A;  2ZDI A;  4NB5 A;  2QR4 A;  2HVK C;  4G27 B;  4J7Z A;  3L75 H;  1NVP D;  4C7U A;  3HKC A;  3L71 H;  3CRQ A;  4TV9 A;  4YHH O;  3OUS A;  4FIP C;  1BMF G;  4O2A B;  3NXS A;  2YI8 A;  2DJV A;  2JGD B;  3QG5 A;  3IC7 A;  4CC6 A;  1GRJ A;  1XOU A;  2PTM A;  1S72 V;  3OAA G;  1EZV H;  1E79 G;  3FYI B;  3JCU Z;  4B7E A;  3KCX A;  3AG2 B;  1G6U A;  1ROP A;  3QO7 A;  3I5D A;  1J95 A;  1NR1 A;  1ORQ C;  1NZ6 A;  2LFR A;  3E8H A;  4FM0 A;  1XEQ A;  1MNG A;  3CP1 A;  1B04 A;  2CTR A;  2QKA A;  1PL4 A;  5DN6 G;  2RMK B;  2ITD C;  3F5W C;  4X64 B;  1PP9 H;  2RNB A;  2CGO A;  5C8Y A;  2DQ3 A;  2Q7G A;  4JI1 O;  3O9O A;  2WLN A;  1JPX A;  2QTO A;  3A0H Z;  3CCE V;  1G4Y B;  2FB5 A;  1JJO A;  4LF5 O;  1IDS A;  3Q4H B;  5B1O A;  2MW2 B;  5CA1 B;  4FM2 A;  1GH6 A;  3E86 A;  1KMI Z;  2WLM A;  3DGE A;  5L3D A;  2HG5 C;  3T1H B;  1Y76 A;  4OPA A;  4J9Z B;  1SQP H;  1NH2 B;  4I9W A;  5K1P A;  3LDD A;  2GDS A;  1B3Q A;  1ZSP A;  4GYC B;  5ITZ A;  1I5X A;  3PN1 A;  2Q67 A;  3ZHU A;  1N8R W;  1JA8 A;  2GTS A;  5IJ0 A;  1R3K C;  4H33 A;  1ZX3 A;  5DM6 V;  5FL7 G;  3H01 A;  5B3S B;  1AP5 A;  2P6J A;  3L70 H;  3L74 H;  4FM1 A;  5LXT B;  2KKW A;  5JJN B;  2P4V A;  3E22 A;  2QWN B;  1TVK B;  3OTF A;  1N36 O;  5IY5 C;  3HKE B;  2K1E A;  4FVM A;  2EIL B;  3FAV B;  4DR6 B;  4TQD A;  3U11 A;  2E75 B;  5L3G A;  3ZN1 A;  3I55 V;  4CS3 A;  3CCV V;  3RYI A;  3LDC A;  1N32 O;  1EN6 A;  1QLE C;  1KKD A;  1IXM A;  1M9N A;  1JFF B;  4MSW C;  3ZIA G;  1N0N A;  2ZIO A;  4P9P A;  4EEQ A;  3K0D A;  3A0B Z;  3RYC B;  2GV9 A;  4G28 B;  2E3C A;  2WLL A;  3H1K H;  1NU1 H;  3UKM A;  2Z3Y A;  4NR1 A;  2GUZ B;  1KEC A;  3ZMT A;  2UXN A;  5GTH Z;  2IBZ H;  5KHI A;  1QU7 A;  3QVN A;  1UFI A;  3JCZ A;  2HKO A;  2DOS A;  1SET A;  2FML A;  5KAF Z;  1NTK H;  2Q8V A;  1YIJ V;  3SPC A;  2ADP A;  4LF7 O;  4PD4 F;  2YI9 A;  1AP6 A;  3T4D A;  2DYS B;  2R9A A;  4CH6 A;  1FXK B;  1BQ0 A;  4NXN B;  3ZMS A;  4JI8 B;  2BSK B;  4IT5 A;  3VQV A;  1Q81 W;  3AG1 B;  4X62 O;  2VRZ A;  4UV9 A;  4UVC A;  5KAI Z;  2P5O A;  4R7C A;  5B1N A;  3GB7 C;  4HBN A;  3LNN A;  4X64 O;  3BVO A;  2P67 A;  2AZ2 A;  4ZIB A;  2XAJ A;  1XNR O;  2LW7 A;  5C93 A;  3ETE A;  4YHH B;  2EJ7 A;  2JEX A;  4DUZ B;  2YC0 A;  1VP7 A;  2Q6A A;  2F4V B;  4EKW A;  3DXR A;  5EK0 A;  1IVS A;  3RT3 C;  1QNM A;  4XDL A;  3RFR A;  2IJK A;  5LP6 A;  4LR3 A;  1FXK C;  1YDX A;  5H2F Z;  3D36 A;  3OTO B;  2WLJ A;  5AG2 A;  1GO3 F;  3TJT A;  4Q6G A;  3LUT B;  3G4S V;  1RP3 B;  5LMN O;  1Q82 W;  5CB4 B;  1YJ9 V;  1D5N A;  1Q5O A;  1XMO O;  4X20 B;  3FB8 C;  3ABL B;  1NR7 A;  4TV8 B;  4JAU A;  1P49 A;  4DV2 O;  3GWK C;  4LF4 O;  2PYJ A;  2PZS A;  3ZMZ A;  1XL4 A;  2WLH A;  3TXQ A;  1US6 A;  1GN4 A;  4JPR A;  4UCO A;  1JJ2 U;  2ZE6 A;  3H1L H;  2UU9 O;  4B3M O;  5KUM A;  4JTD B;  2QTS A;  4NYK A;  5LHG A;  1R3J C;  3ZBH A;  2F66 C;  4H44 B;  3MD0 A;  3J7A U;  1I94 B;  4U7O A;  2LFS A;  2ILM A;  1SES A;  2A7W A;  5CBF A;  3T1H O;  2V7Q G;  3QF7 A;  2ZNJ A;  4NTX A;  1Y74 B;  5KX5 B;  4FLW A;  3NR7 A;  4TUY B;  2RN9 A;  1S3J A;  4WF9 V;  5KX5 A;  3BEH A;  4YJ3 B;  4JV5 O;  4JZ2 A;  3ZS8 C;  3X2Q B;  4LBE C;  3ABM C;  4MVZ A;  1B06 A;  5HFM A;  4K0K B;  1QHT A;  1M93 A;  1F7Y A;  3TXS A;  2B5U A;  3EHB B;  4MTG A;  3R66 A;  1FXK A;  4GZR B;  3G6E V;  3KZI Z;  4JZG A;  2XND G;  1QLE B;  4L87 A;  5CA0 B;  4LF7 B;  2Y69 B;  1PL0 A;  4I4T B;  1SQB H;  4FLU A;  4PA4 A;  3K5O A;  2QEX V;  3JAW A;  3SJQ C;  4OX9 B;  2VWK A;  1OV9 A;  5IJ9 A;  3CCS V;  1FJG O;  4XBF A;  4PA7 A;  4LWS A;  3STZ C;  1SQV H;  2EIM C;  3C90 A;  4UB8 Z;  3CB2 A;  5IE9 A;  4UCS A;  2RCV A;  2YUA A;  1KB9 F;  3D8C A;  3F7V C;  4JYC A;  2WLL B;  3G71 V;  4B7K A;  4WFB V;  3ABU A;  1F51 A;  5D5Q A;  4RQF A;  4K0K O;  1FFT B;  2YIC A;  2Q5Z A;  2YXL A;  4I50 A;  1YXB A;  3OMN B;  2HJF C;  5L3B A;  4O4J A;  4LC1 A;  1YCI A;  2DW4 A;  4QE7 A;  1W0J G;  2WPD G;  4J7K A;  3CEI A;  1JVM A;  2CH7 A;  3ZN0 A;  4CBC A;  5K1X A;  1K5Q A;  3H1H H;  1Y6X A;  1OCO C;  3K0G A;  1HNW B;  1KP3 A;  4JTC B;  3FFQ A;  3E22 B;  1PNL A;  4LF6 O;  4JYA B;  2NR5 A;  1JQ0 A;  1Q8I A;  4O4I B;  1GTO A;  2Y69 C;  2Q9L A;  1PM9 A;  3CYO A;  4DR1 O;  5LXT A;  2JDI G;  2Q7H A;  4IHJ B;  3CME V;  3JAL B;  4B3T B;  5FNV B;  1IBL O;  2N74 A;  2XOK G;  1VF6 A;  4JI5 B;  4DV6 O;  1WPB A;  4E2L A;  2F95 B;  3N2G A;  1PD3 A;  1JOY A;  2M7W A;  1YZB A;  1IBK B;  1WA8 A;  1SZT A;  1RSO B;  1VQO V;  1WB7 A;  5FLX N;  2V4D A;  3RYH B;  3CCJ V;  4PDV A;  1Y4M A;  2QM4 A;  2O57 A;  3RGB A;  1Y76 B;  1K4C C;  5A9G A;  3M7M X;  2OYQ A;  4LFA B;  5DED A;  4MS2 A;  1HNX B;  4CH4 A;  1YF2 A;  5FPO A;  1HNW O;  5EYP A;  1ZL8 B;  2UUC B;  4N21 A;  4QNH B;  3CD6 V;  4N23 A;  1AI5 A;  2GUZ A;  2LQT A;  3LSQ A;  1K34 A;  3THO A;  1VQ4 V;  4DV5 B;  3ZRX A;  1OCC B;  4JAA A;  3JAT A;  1EBO A;  3P30 A;  5LP6 C;  1WNS A;  2Z0A A;  1F4M A;  1X59 A;  1P7B A;  2OIG A;  1GN3 A;  4MTO A;  1IUR A;  5E1A C;  2ATK C;  5EBM C;  4JI6 O;  1I94 O;  4W4L A;  5H6R A;  1PNM A;  1SA0 A;  3CWB H;  3SPG A;  5LOV A;  3BFR A;  3CRC A;  2WLI A;  3WU2 Z;  1CP9 A;  4LCU C;  1LNQ A;  3W7W A;  1F4N A;  3CRR A;  2IW5 A;  1MZE A;  1M1K W;  1MOF A;  2W6I G;  4ZBM A;  3HKC B;  2L6L A;  1WPX A;  1THZ A;  4JI4 O;  3U10 A;  2N04 A;  1NI8 A;  2QKC A;  5JH7 A;  3RYH A;  2A79 B;  5CBH A;  1SS3 A;  4BR6 A;  1YVW A;  1IX9 A;  2VQF B;  1UPG A;  1S5H C;  3ZRV A;  4FPP A;  3IFX A;  1S5J A;  2YIB D;  1KQS U;  3RN4 A;  4UVB A;  4K8Z A;  5L3F A;  4QIW F;  1V54 B;  1LR1 A;  3B40 A;  3OM3 B;  2AXT Z;  1OCZ B;  4X88 A;  3JAM N;  4OX9 O;  2Y48 A;  3P3N A;  1YEW A;  2XUM A;  1BCC H;  3OTO O;  1AI7 A;  3ZHR A;  4MVO A;  5JJE B;  2QDO A;  3MHS C;  4WFA V;  5KA5 A;  2BTQ B;  3FD9 A;  3BRC A;  3VQY A;  2GTA A;  2F23 A;  2L35 A;  4O4J B;  4X66 B;  2RJZ A;  3K58 A;  4MT8 A;  2IU0 A;  2BCC H;  1B6Q A;  1MMM A;  1R3L C;  2B1G A; 
#chains in the Genus database with same CATH homology
 4J7K A;  4J7J A;  4J42 A;  4KXR A;  3FX7 A;  4J41 A;  4W4L A;  4IYH A;  4J11 A;  4W4K A;  2G38 A;  2GTS A;  4J10 A;  4IYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...