4J7JA

The crystal structure of a secreted protein esxb (mutant g53a) from bacillus anthracis str. sterne
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
90
structure length
87
Chain Sequence
b'MAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRAEFIQSKQAMQQYIPILEGISTDLKRIADKFRNTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant, G53A) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 39
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j7jA00
4IYIA 4J10A 4W4LA 4J42A 4J41A 4IYHA 4W4KA 4KXRA 4J7KA 2GTSA 2G38A 4J11A 4J7JA 3FX7A
chains in the Genus database with same CATH superfamily
1OHHG 4GUNA 4UV8A 3SPHA 1FYJA 2BOBC 1H38A 5LMNO 1SS3A 4O4IB 3RVYA 1OCRB 2UXDB 1KKDA 2ZDIC 2WLLA 3W7TA 1J5EB 4TV9A 4FM1A 3WG7C 2QKSA 2ZNIA 4DR4O 3W7SA 3UM7A 4LCUC 4YHHB 4E4EA 1YJNV 3H1KH 4FVMA 3SDLA 2CH7A 2VS0A 3CSXA 5LMUB 5FL7G 2UXCO 4K35A 4QNHB 1TAEA 3E35A 2DMXA 1BT8A 2RN9A 4JYCA 1XQ8A 4TV8A 4CC5A 4FFKA 2BE3A 3CRQA 1BQ0A 1XNRO 1K92A 1PD3A 2XASA 1K4CC 4X65B 2E76B 1R3JC 1S5JA 3OR7C 3G6EV 2OCHA 3X2QC 2LO1A 4FLYA 1QQCA 2ILMA 3JCZA 3OGIB 2ZINA 4HAMA 3OFNG 4MVQA 4MVOA 4J42A 1SA0A 4BIZA 4YJ2A 3CCJV 4LH7A 1HNXO 3G71V 1AR5A 1AP6A 3K9AA 3OTOB 1FXHA 2ZKOA 3AG1C 1ZL8B 4JI7O 1S72V 3UKMA 1EN5A 3ZJZA 4JYBA 4MTGA 2EZPA 2W6JG 5C93A 3GWKC 2F66C 1HNZB 1LUWA 1ROPA 3FB7C 2UXXA 2RMKB 2Z0AA 1YHQV 4TV9B 1HW7A 4CC6A 2X6BA 3IGAC 1G4YB 5BY1A 1Q3EA 4MSWC 3K5OA 1H2NA 2CH7B 4FLVA 1AP5A 2OCCB 4RUEA 1S77D 2GTAA 4UCOA 2QWQB 2UUBB 1YJWV 1DTOA 2BSKA 5IT9N 1QR9A 4BWAA 4UCSA 4TV8B 3VQWA 5EIBD 3ZX6A 1K34A 4GZRB 3T1HB 2DYRB 1NR7A 2ZE7A 1W0KG 4HBNA 2V1DA 2PY5A 2Q7GA 2UXBO 3IFXA 1IURA 4U3JA 3ABMB 1JMKC 3JCUZ 2EIJC 2P4VA 3K0GA 1HR0B 1SA0B 4YJ2B 4P2ZA 3KCYA 1M93A 2DW4A 5F2VO 5ITZB 1PL4A 4JGSA 5JVDB 5JH7A 4DR2B 3R66A 1SQVH 3RYHA 3IC7A 3FYEB 3RYIA 1A32A 1FXKA 3JATA 2VWKA 3OTOO 4NKGB 3JD1A 2HFEC 3CC7V 4DV7B 5LP6C 3VQYA 4O2BA 1SZXA 4LF5B 1FFXA 3GB7C 4KUMA 1GTOA 1IVSA 1FJGB 4LF9B 1WJZA 5J2TB 2EILB 4JYAB 3DC5A 1B6QA 1FXVA 3D36C 4JTCB 4JI5B 2R72A 3MHSC 4O4LA 4DXWA 1Y74A 1AR1B 2NR5A 3W7XA 3I5DA 4DV0O 3VQVA 1JR9A 4O4JA 4MVUA 4LF4B 1SQGA 1SQQH 2LGQA 3SJQC 3K08A 5KAIZ 1HDJA 4OPHA 4C7UA 4JAUA 5GTIZ 4J7ZA 3WB1A 2JEUA 4G2KA 4JI1O 4WFGA 4YIPA 3SYOA 1RPRA 1SZTA 4RAIA 5B5EZ 2Z3YA 2YS8A 4K8XA 1Q43A 4ZOLA 4H0LB 3T1HO 4YIOA 4FK5C 1Z2GA 3JSLA 3J81N 4X1KA 4IL6Z 3M7MX 2Y0PA 4ZKIA 1L0LH 1OV9A 5JH7B 1G6UA 5EC1C 1BSMA 4DUZB 3RYHB 1P7GA 5JCOC 3RYIB 3JAWA 1H2KA 3JATB 3AEIA 4LR3A 3KKYA 4WBNA 4DR2O 2ZM6B 4Z2WA 4O2BB 4I4TA 4IIJB 2IJIA 1R3LC 1YCIA 2PF4E 1FFXB 4WFFA 4WFEA 4U7NA 3DTUB 4LF5O 4UCVA 1WP7A 1PPJH 2HVJC 2ZE8A 1YSCA 3E2EA 1FJGO 1K33A 4J10A 1Y74B 1NT2B 4QE7A 2QDOA 1KP2A 4LBEC 4JI6O 2R9IA 3ZRXA 1E79G 4QGPA 5IYZA 1N34O 3OM3B 4J9YB 2YXLA 5BR8O 1WPXA 4RO2A 4BIUA 3HPLC 1K3EA 5KX5A 5KUMA 2ADQB 2QSAA 4JI2B 3THOA 2F95B 5KMGA 2MW2B 1NTMH 3NXSA 3C90A 2IU0A 5L3GA 2A3QA 2WA4A 5KHIA 1PL0A 4CZZA 4KHPB 4BIOA 2CTQA 4GLXA 1NQTA 4PD4F 5L3EA 3L74H 3A0HZ 3CB2A 3RN4A 1JFFA 1X59A 2ZNJA 1Q86W 2CUGA 1R6TA 2YEVA 4LC1A 2EBOA 5GTHZ 3JAWB 2BCCH 1VF5B 3E22B 5B1OA 4LP8A 1SERA 1D5NA 2WAMA 4J7JA 1TVKA 3K9SA 5CMUA 4LF6O 4DUZO 4X20A 4I4TB 4P9OA 5LA6A 1W59A 2GUZA 2WLKA 2KKWA 4TUYA 2R9RB 3QNEA 3ASOC 4CH3A 2QJ1A 2BTOA 4H37A 2XTAA 1YXBA 4UB6Z 2DOSA 5E1AC 3UCSC 3WFVA 1N32O 1UFIA 4FJCC 5B1BB 1UPGA 2Y48A 1AJQA 2NN4A 3T4DA 4QE9A 5BZBA 5CA1A 4L87A 1G8MA 4JI3B 1ENVA 3APQA 3CRCA 1QHTA 2DQ3A 5IYZB 4F6RA 5LGUA 4EB6A 4NXNB 4ZI7A 3T2MA 4K0KB 4ZHQB 1WNSA 3ASNB 2Q69A 3ABLB 3LDCA 4MVRA 3K57A 5EYPA 5KX5B 3CE2A 1CEZA 1Q90D 1Y6XA 2YIDA 3EFFK 2AHZA 4UVBA 3U0ZA 5KMGB 1I08A 3TXSA 3OEHG 4YJ3B 1VQLV 2ZXWC 4B3TO 4NYKA 1KECA 2XOKG 5H5NA 1JFFB 1GRJA 2WWWA 3EXAA 2Y69C 1PNLA 1GAXA 4WFBV 5DECA 1ZTEA 1DK1A 3L70H 1FKAO 2YIBA 2P90A 1GM9A 2YI9A 4X20B 5LA6B 5GW7A 2GUZB 4TUYB 2HR3A 3F7VC 5EZYA 2B1IA 4YY3B 2OYQA 1N0JA 2Y4UA 3TK1A 5B3SC 1F23A 5LHIA 2ADPA 2QE7G 4LF8B 1RFYA 4IHJA 3FFQA 3T1CA 4EFBA 1V54B 5CA1B 2NNUA 5J2UB 4DV1O 3CC2V 3UT5B 1M56B 2EINC 4F6RB 4EB6B 1OCCB 4ZI7B 1D2DA 3FAVA 4X66B 5E79Z 3VBBA 1XOUA 5IWAO 1WPBA 4DRXA 2IJHA 4DR3B 4FZ1A 2GV9A 2EIKC 4N21A 1I5YA 2YXHA 2AZ2A 1W2BU 2JJ1G 3ZMSA 2EX3A 1M4UA 2YIAA 3DGEA 1I0HA 4OGQB 3S3XA 1NS1A 1IBLO 5JJEB 4LFCO 1GN4A 1KB9F 1GMGA 1KKCA 3JAMN 2HKOA 3M99B 4DR7O 2ZD9A 4UB8Z 2XAJA 4CS4A 4B3SO 1JOYA 2HLDG 3WB0A 1RPOA 1OCRC 5EBWC 2CTRA 4JAVA 1R3KC 1NU1H 2FTKA 4LFBO 1YIJV 1VF7A 1LNQA 5L3BA 2E5LB 5D5PA 4IHJB 5BXZA 3ABTA 1KUQA 1U97A 3E83A 1M57B 1PNKA 4BW9A 4EKWA 4JI0O 1GN3A 3B40A 3ZHUA 3N2KA 1K8AW 1OZ0A 4O4HA 3BPZA 2VQFB 2XAFA 3FAVB 4JTAB 3HKBA 4X1IA 2ZIMA 4RUFA 5FPOA 4DRXB 1XHZA 3JAKA 5J9PC 1MSDA 1VF6A 1TGOA 3ZRVA 3ZRWA 4CH4A 1WN7A 4JI8O 2X7RB 1HWYA 2LFSA 2WA3A 1P49A 1VQ9V 4AQYO 1DF5A 4GCZA 1B04A 2QM4A 4ZIBA 1Q8IA 4JPRA 1DLBA 3RGBA 3RFRA 4LFAO 2GHYA 2W6IG 3KG2A 4TT3G 2CTWA 5LL6Y 4IGGA 1IBMB 1QLEB 1MZEA 5HFMA 4DV3O 2QWPB 1JJ2U 4DW0A 4FLXA 4MVSA 1XILA 3TJTA 2DN9A 2CE4A 4DV6B 1ZWIC 3BRCA 4NXMB 2OCCC 2F23A 2Q4PA 4GKKB 2N04A 1WA8B 3N2KB 3P3NA 2RDCA 1P84F 2E5LO 3T1YO 4ASUG 3EHBB 5CBGA 3VQXA 1BS3A 2O57A 4LWSB 5KLVH 1B3QA 3HKBB 4X1IB 2VQFO 5CBFA 2DYRC 3JAKB 2E74B 4J7KA 4GT1A 3O9OA 4IYHA 1YZBA 3ZRWB 1QLNA 4FLZA 3QG5A 1E1QG 3MAQA 3ABMC 2ZCEA 2A9HA 3D3QA 1B06A 2JVDA 1OCZB 2ZR3A 3QTCA 2IH3C 5EK0A 2WLLB 5EC2C 3JD4A 4R50A 3W7UA 1I94B 2UXDO 2ITDC 5KHJA 3M8AA 3OUSA 4FFBA 1J5EO 3AG3B 2ZE6A 4RWUA 4LF7B 1PNMA 1ZLZA 2X6AA 4I0XA 4YHHO 2Q0OC 2ZR2A 5LMUO 2OT5A 4DYLA 3SJBC 1S5LZ 2YUAA 5D5QA 1JA8A 2H3OA 2EILC 1N8RW 1EM1A 2PTMA 2PYJA 5IYCO 3RBZA 5IYDO 1V55B 3CJHA 5KHGA 4NXMO 4X65O 5LBQA 3KCXA 2XT9A 1ZAUA 1K9MW 3STZC 2EJRA 3K03A 3AG4B 3SYCA 2JJ2G 1XNQB 4MS2A 3ZN0A 1BE3H 2JS3A 2W0FC 4CH5A 3DC6A 2GBOA 2ZE5A 3Q4HA 3ZHTA 2EULA 1XREA 4LH6A 4TOIA 1S3JA 2ITCC 4MTFA 5A2QN 3JD0A 1QR8A 1HNZO 3SR2C 3LSQA 2YIBD 4I7ZB 3ZBHA 4PA3A 2P7TC 2JGUA 4PI0A 3NR7A 3K59A 1Q6UA 1VQ5V 3LNMB 2BSKB 1XL6A 1CP9A 3OD4A 2UUBO 1LR1A 4R6ZA 3B8NA 2B5UA 5CA0A 3OTFA 3QF7A 3K79A 3SYQA 3SJAC 4QJFB 4U3JB 1M5IA 1AR4A 3AK3A 4G28B 3H1IH 3HKDA 2DQ0A 4FZ0A 4I55A 1IXMA 1SQPH 3JYCA 3ETGA 4ABMA 2OTJV 3L72H 2LGWA 5JCOA 4RQFA 3BA9A 4RQEA 1L0NH 3BFRA 1OCOB 5KA5A 2Z5UA 1HR0O 1FXKB 3WU2Z 4DR6B 2LW7A 2ZQMA 1MNGA 2KB1A 1M90W 3Q4HB 1XNQO 4EFEA 4KXRA 1VQKV 1H2SB 3ZS8C 1GKFA 3BEHA 3JD3A 4DV7O 4GKJB 2QTOA 1QBZA 2F1MA 2KG7A 4B08A 4GX5A 3ZN1A 5FNVA 3HR0A 4J80A 4MVZA 1EFRG 1RP3B 4AI8A 5IY5B 4LNUA 4O4LB 4LF9O 2UUCB 5CA3A 3ZIAG 1K73W 1E1RG 3BA8A 4JYAO 5EBMC 2WLIA 4O4JB 4UV9A 1M1KW 1R73A 4WFHA 1TUEB 4JI5O 4PA9A 3OMIB 1YEWA 5CA0B 2FMLA 3ABUA 4KL1A 3MD0A 2QR4A 3IC9A 1MZFA 1XDCA 4LF4O 4ZBMA 5B1BC 4ZOLB 2UUAB 4JZ2A 2XAHA 2QEXV 2HP8A 3HKDB 4Z1VA 4X1KB 3CC4V 1AI4A 3T4ZA 5B66Z 1I7FA 1S0VA 3OUFA 2N05A 3ASNC 4MTOA 3ABKB 2NLJC 3ABLC 3JD2A 2IH1C 4DR5B 2IM9A 2C2AA 2AGAA 3K04A 2F4VB 1QVFU 1Q82W 4FMTA 3PN1A 4WBNB 3TXQA 1MOFA 5DEDA 2P06A 4H44B 5JJJB 1SQXH 1YF2A 2IW5A 3AG2B 3I55V 1YITV 1KD1W 1YVWA 5DN6G 4KP4A 4UCRA 1WP8A 3B2EE 1O9HA 2QM7A 2YI8A 1KYOF 2ZM6O 2KG7B 5LGNA 4BW5A 1H2MA 4HNAA 5FNVB 4CS3A 2YSUB 1JCHA 3STLC 4E2LA 4GKJO 4LNUB 3RW0A 3FYIB 4GX1A 5JJNB 3LDEA 2WLIB 2AXTZ 3E86A 3CPWU 4MW8A 1HNWB 3BCCH 3H1HH 4DV5B 1F7YA 1JPXA 1XEQA 4W4LA 3CCQV 4O2AA 3J7AU 5EIBC 5IJ9A 4X89A 1AVMA 1S76D 1HP8A 1K5SA 4MVMA 3CMEV 2CK3G 2F93B 3RWRD 2OTLV 1V54C 4JF3A 1I5XA 2PYLA 1U96A 3N2GA 1M56C 2CAZC 1DGSA 2UUAO 4UCTA 3SYAA 4JI2O 1OCCC 1EBOA 3JALA 1JJOA 3P30A 4W4KA 1NVPB 2YEVB 4PDVA 2GTSA 2DJVA 4X62B 1P7BA 1IBKB 4KHPO 1VQ4V 2EJ7A 4JASA 4DV4B 1XMOB 2XHBA 1TVKB 3SPJA 2V4DA 1VMGA 3HKCA 3JASA 2YICA 3ICXA 1KP3A 3CP1A 5L3CA 2RJZA 4CS2A 1H8HG 5CB4A 1R6NA 4J9ZB 5K1XA 1D5AA 1NJIW 1Q81W 3TCUA 1SETA 3CCMV 1Q6IA 3L73H 3LUTB 3B77A 1FFTB 1MG1A 4B3MB 2LJ2A 4NTYA 3P32A 4J41A 3A0BZ 5IE9A 3A8TA 5LHHA 3LNNA 1QCEA 4DR1B 1NTKH 5B1AB 1YDXA 4JI3O 5IJ9B 4ICGA 5CN0A 1HNWO 5EYPB 1KMIZ 4A5UB 2JS5A 4NXNO 1WAZA 4DV2B 3JARA 4K0KO 1F4MA 1M57C 5KHHA 5TISZ 2DWEC 3N2GB 3H1LH 1YTFB 2H8PC 4B3RB 3CD6V 2KSDA 4PJ0Z 2DYSB 3ZHQA 3TETA 1ZUQA 3JALB 2QWRB 3RYCA 2HJFC 3BAAA 1KU9A 1RM1B 2DE0X 3G80A 5H6RA 1W0JG 5LMNB 1VQNV 1H8EG 1CXZB 1K5QA 3DSQA 1IDSA 2CDYA 3O65A 4DW1A 1NBMG 2EIMB 4GYCB 4K3AA 1SKVA 4DR4B 3JASB 2LP7A 5EZYB 1VQOV 2KQXA 3ZEDA 3CXCU 4DV4O 3G6BA 3CS5A 4PA7A 5GONA 2GDSA 4PDLA 4YY3O 4CH6A 4N23A 1DF4A 4B7EA 3LSSA 1SRYA 4NVPA 4F6EA 3I56V 1EZVH 3ZMTA 3UQ8A 1BZKA 2WLHA 4LF8O 3F7YC 3E8GA 1QLEC 1N0NA 3CCSV 1NTZH 2QWOB 3A0RA 4D7SA 4UCUA 2Q73A 3JSNA 3GVMA 2P67A 4TSFG 4XBFA 2WLNA 4X66O 3ZMVA 2K1EA 4R7CA 2XAGA 4FIPC 4R8CA 1FAFA 3OAAG 4DR3O 5FLXN 4FLTA 3ZHRA 2LQTA 4JI7B 1PKXA 2ZDIA 2JGDA 3RYCB 4PELA 3H01A 1URFA 1QNMA 4B3RO 4OX9B 2B1GA 4MT8A 1ZL8A 1GN2A 1EZJA 1VF6C 2Y4TA 2A06H 1VQPV 3RYFA 1EN4A 1XI1A 5CBHA 2BTQA 4PHZA 3U10A 4OPAA 3IAYA 1OCZC 1SESA 5GONB 2A79B 4B7KA 4D6TH 3HKEA 3OE7G 4PA4A 1US6A 2B9ZA 3BY6A 2E75B 3K0DA 4X8AA 3CCVV 4DK1A 4JI4B 4CBCA 3S3WA 3E8FA 1GM8A 3AG3C 1V9PA 4FM0A 4O4HB 5KA6A 3SJCC 4MW3A 3L75H 2YDEA 2UXBB 4NTWA 2LFRA 1O9GA 5LGTA 5JWPA 2A7WA 2P22C 5HFLA 2Q6AA 3ZMZA 3CRMA 4NB5A 2G38A 2ARHA 5K1PA 4PV1B 3ZHVA 2L6LA 5H6QA 3WB2A 4X88A 1ZX3A 1V55C 3C3TA 2JGDB 1Q7YW 3A2FA 2Q8VA 2XUMA 3WG7B 2CGOA 3E8BA 1NVPD 1Z5WA 3RT3C 5ITZA 1R1BA 5JVDA 3E8HA 1XL4A 1GO3F 3L71H 2ODMA 3AG4C 3D3IA 3APOA 1MABG 4OX9O 4J11A 3RYFB 5JQGA 3FB6C 2MK3A 3H1JH 4FLWA 2BTQB 3FX7A 1R6KA 3QO7A 1MSWD 3HKEB 4MTXA 3OT7A 1IBMO 1BL8A 4UVAA 5J2TA 4DV0B 1N33B 1PV0A 1AROP 3C3SA 3X2QB 3G4SV 3FD9A 4JI1B 4DV6O 2HHHB 2AZ0A 4JI4O 3CRAA 4GKKO 2HVKC 2Q0AA 2ATKC 3OEEG 3RVZA 1N4CA 4QIWF 3AG1B 4Z1MG 3L9DA 1VP7A 5C8YA 3W7WA 3HB3B 1YTFD 1EN6A 4JZGA 4HYOA 2N74A 2PZSA 5LOVA 1TA8A 5LP6A 5LHGA 2RCVA 2IBZH 3D8CA 2IJKA 5IJ0A 3ZRSA 2AHYA 3B4SA 4P30A 1OCOC 1SF9A 2W0XA 1Y4MA 4FFBB 1FXKC 5JQGB 3D36A 3OR6C 3CCUV 1I94O 4I0XB 4IIJA 4PI2A 1IXBA 1KC8W 1K7DA 1NR1A 4WCEV 4LF7O 2DWDC 5H9CA 2Y0IA 4WFAV 3VOUA 2H94A 3CMAV 4JI6B 2EZOA 4X9QA 1K4DC 1JQ0A 3BABA 2ETNA 3AG7A 1N34B 1F51A 3CJHB 5IY5C 5BR8B 1N33O 1QVGU 2EIJB 1TUBA 1L8DA 3ETEA 2CGNA 1BHAA 3SPCA 2VWJA 2K9PA 1BMFG 4KFMA 3J80N 4U3FH 1VQ8V 2QKAA 3CCEV 2HHHO 2BOCC 1NH2B 2Q9LA 5C8YB 4JYYA 4IYIA 3K5MA 1THZA 2R70A 1MA1A 2JEXA 5KAFZ 3UO3A 5LOVB 5LP6B 3R65A 1AILA 2IU3A 4X64B 3EVKA 5IJ0B 3B09A 1AI6A 4HZ3A 4D7TA 4WF9V 1Y67A 4LF6B 2X0LA 2WLJA 3ABKC 3E22A 2YXYA 3CRRA 1Y76A 2QKCA 4FLUA 4TQFA 1JX9A 2Q68A 3OW2U 4PDMA 1N32B 3FB5C 3AG2C 1VQMV 4EEQA 1GN6A 1AJNA 1Y66A 2F43G 5EBLC 3OMAB 1ZSPA 3U11A 4FM2A 3TGUH 4PA6A 3IJ4A 1PM9A 2P6JA 3CWBH 4I9WA 4X1YA 2PI5A 1TUBB 4Q6GA 1GM7A 4AILC 1FS0G 5L3FA 4I55B 5BMVA 2V7QG 2Q7HA 4QPJA 1WB7A 4H33A 3AK1A 4ZHQA 3K58A 4XDLA 1J95A 4QPKA 3SPGA 2E3CA 2FB5A 1M9NA 4B3TB 2UXNA 1YJ9V 1QU7A 1Q6HA 2A0LA 2JDIG 3N27A 4UFZA 4BAYA 4YJ3A 1XUQA 4BR6A 3QVNA 4DR6O 2YC0A 2ZIOA 4X64O 1Z5VA 4NTXA 2WPDG 3SPIA 4OXSA 1Y76B 1RSOA 3SGIA 3CX5F 4I50A 3K06A 5B1NA 3F5TA 1LUVA 1ORQC 1YI2V 3E89A 4Q20A 1VEWA 2R9AA 2JIZG 1FPOA 1XHXA 2UUCO 4DV1B 3CXHF 1L1FA 3LDDA 3QO5A 1UJWB 1AB3A 4DO2A 4X1YB 2AW9A 5J2UA 1AI5A 3B8MA 3UT5A 2JK5C 3ML0A 5BMVB 2CTPA 5IWAB 1IZ3A 2X6CA 2P5OA 1GH6A 3MDSA 5B1AC 2VQEB 4NR1A 1WB8A 5IYBO 3CEIA 1BGYH 2ZT9B 3OMNB 2HEPA 1VIBA 5LYJA 2Q67A 4DR5O 1IBLB 3OGCC 4UXNA 4LFCB 3ASOB 2F4VO 3ZMUA 3ZHSA 2DYSC 2L35A 2M6YA 1XMQB 4DR7B 1RM1C 2HG5C 4B3SB 4FPPA 1BCCH 4HNAB 1RSOB 2FYUH 1SQFA 3QO8A 2WLMA 4I50B 2D2CB 2VRZA 1IX9A 3CYOA 2P4KA 2QA4V 2JRIA 2QM8A 4LFBB 2EIMC 2XNDG 5KUKA 3P3PA 1AI7A 1NI8A 3H9VA 2UU9B 2QWNB 1N36B 5H2FZ 4JI0B 1GK9A 4O2AB 1VQ6V 4TWKA 3GWOA 4UVCA 4JV5B 4DV5O 1AJPA 4DUYB 2GSMB 4L8JA 4JAAA 2OWOA 3BVOA 5LXTA 2ZXWB 3K5NA 1P4RA 3F5WC 3UO2A 3SYPA 2PUSA 3DXRA 1R3IC 4P9PA 2Q7EA 1KQSU 4DK0A 2Y69B 3MHHC 4G27B 1X4TA 5IDJA 1NH2D 3LSUA 2D3OW 4JI8B 1KBHA 4PDRA 4XDKA 2OIEA 1BHBA 1BQZA 1F4NA 5FPRA 1XBLA 5LYJB 1PP9H 1G1XB 4H13B 2XAQA 2VQEO 4AQYB 4I5SA 3FKSG 3HKCB 2RNBA 4X62O 3KZIZ 2FL4A 1NZ6A 4U7OA 1IBKO 4O4IA 5B3SB 3ETDA 1VQ7V 1OJHA 1H2LA 4UUJC 5CB4B 4LFAB 4GX2A 1XMOO 2UXCB 3BHPA 1CPYA 1MMMA 3K3WA 5DM6V 2FKXA 3AK2A 1XMQO 4DV3B 4AHCA 1S5HC 2PGGA 3CCLV 1SC5B 1XNRB 1T5EA 5L3DA 3G67A 3ZCCA 2EINB 2IJJA 3ETQA 2LW1A 1VARA 4B3MO 2Q5ZA 1WLEA 1JVMA 5A9GA 3CHXA 4TQDA 3T1YB 1K97A 2OIGA 4F4LA 5KHKA 3K5LA 2UU9O 2EIKB 1N36O 3CCRV 4DR1O 3JARB 4K8ZA 1WA8A 5AG2A 2M7WA 2HJDA 5LXTB 1Q5OA 1HNXB 1H2GA 2WSSG 4JV5O 1FD9A 4IT5A 3DXRB 3PJSK 4DUYO 4LWSA 2QGNA 2RQ6A 3FB8C 4DV2O 4YXWG 4I9QA 1SQBH 4GX0A 4XDJA 2PI4A 4JTDB 1COWG 1NKDA 2QTSA
chains in the Genus database with same CATH topology
4IYIA 4J10A 4W4LA 4J42A 4J41A 4IYHA 4W4KA 4KXRA 4J7KA 2GTSA 2G38A 4J11A 4J7JA 3FX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYI A;  4J10 A;  4W4L A;  4J42 A;  4J41 A;  4IYH A;  4W4K A;  4KXR A;  4J7K A;  2GTS A;  2G38 A;  4J11 A;  4J7J A;  3FX7 A; 
#chains in the Genus database with same CATH topology
 1OHH G;  4GUN A;  4UV8 A;  3SPH A;  1FYJ A;  2BOB C;  1H38 A;  5LMN O;  1SS3 A;  4O4I B;  3RVY A;  1OCR B;  2UXD B;  1KKD A;  2ZDI C;  2WLL A;  3W7T A;  1J5E B;  4TV9 A;  4FM1 A;  3WG7 C;  2QKS A;  2ZNI A;  4DR4 O;  3W7S A;  3UM7 A;  4LCU C;  4YHH B;  4E4E A;  1YJN V;  3H1K H;  4FVM A;  3SDL A;  2CH7 A;  2VS0 A;  3CSX A;  5LMU B;  5FL7 G;  2UXC O;  4K35 A;  4QNH B;  1TAE A;  3E35 A;  2DMX A;  1BT8 A;  2RN9 A;  4JYC A;  1XQ8 A;  4TV8 A;  4CC5 A;  4FFK A;  2BE3 A;  3CRQ A;  1BQ0 A;  1XNR O;  1K92 A;  1PD3 A;  2XAS A;  1K4C C;  4X65 B;  2E76 B;  1R3J C;  1S5J A;  3OR7 C;  3G6E V;  2OCH A;  3X2Q C;  2LO1 A;  4FLY A;  1QQC A;  2ILM A;  3JCZ A;  3OGI B;  2ZIN A;  4HAM A;  3OFN G;  4MVQ A;  4MVO A;  4J42 A;  1SA0 A;  4BIZ A;  4YJ2 A;  3CCJ V;  4LH7 A;  1HNX O;  3G71 V;  1AR5 A;  1AP6 A;  3K9A A;  3OTO B;  1FXH A;  2ZKO A;  3AG1 C;  1ZL8 B;  4JI7 O;  1S72 V;  3UKM A;  1EN5 A;  3ZJZ A;  4JYB A;  4MTG A;  2EZP A;  2W6J G;  5C93 A;  3GWK C;  2F66 C;  1HNZ B;  1LUW A;  1ROP A;  3FB7 C;  2UXX A;  2RMK B;  2Z0A A;  1YHQ V;  4TV9 B;  1HW7 A;  4CC6 A;  2X6B A;  3IGA C;  1G4Y B;  5BY1 A;  1Q3E A;  4MSW C;  3K5O A;  1H2N A;  2CH7 B;  4FLV A;  1AP5 A;  2OCC B;  4RUE A;  1S77 D;  2GTA A;  4UCO A;  2QWQ B;  2UUB B;  1YJW V;  1DTO A;  2BSK A;  5IT9 N;  1QR9 A;  4BWA A;  4UCS A;  4TV8 B;  3VQW A;  5EIB D;  3ZX6 A;  1K34 A;  4GZR B;  3T1H B;  2DYR B;  1NR7 A;  2ZE7 A;  1W0K G;  4HBN A;  2V1D A;  2PY5 A;  2Q7G A;  2UXB O;  3IFX A;  1IUR A;  4U3J A;  3ABM B;  1JMK C;  3JCU Z;  2EIJ C;  2P4V A;  3K0G A;  1HR0 B;  1SA0 B;  4YJ2 B;  4P2Z A;  3KCY A;  1M93 A;  2DW4 A;  5F2V O;  5ITZ B;  1PL4 A;  4JGS A;  5JVD B;  5JH7 A;  4DR2 B;  3R66 A;  1SQV H;  3RYH A;  3IC7 A;  3FYE B;  3RYI A;  1A32 A;  1FXK A;  3JAT A;  2VWK A;  3OTO O;  4NKG B;  3JD1 A;  2HFE C;  3CC7 V;  4DV7 B;  5LP6 C;  3VQY A;  4O2B A;  1SZX A;  4LF5 B;  1FFX A;  3GB7 C;  4KUM A;  1GTO A;  1IVS A;  1FJG B;  4LF9 B;  1WJZ A;  5J2T B;  2EIL B;  4JYA B;  3DC5 A;  1B6Q A;  1FXV A;  3D36 C;  4JTC B;  4JI5 B;  2R72 A;  3MHS C;  4O4L A;  4DXW A;  1Y74 A;  1AR1 B;  2NR5 A;  3W7X A;  3I5D A;  4DV0 O;  3VQV A;  1JR9 A;  4O4J A;  4MVU A;  4LF4 B;  1SQG A;  1SQQ H;  2LGQ A;  3SJQ C;  3K08 A;  5KAI Z;  1HDJ A;  4OPH A;  4C7U A;  4JAU A;  5GTI Z;  4J7Z A;  3WB1 A;  2JEU A;  4G2K A;  4JI1 O;  4WFG A;  4YIP A;  3SYO A;  1RPR A;  1SZT A;  4RAI A;  5B5E Z;  2Z3Y A;  2YS8 A;  4K8X A;  1Q43 A;  4ZOL A;  4H0L B;  3T1H O;  4YIO A;  4FK5 C;  1Z2G A;  3JSL A;  3J81 N;  4X1K A;  4IL6 Z;  3M7M X;  2Y0P A;  4ZKI A;  1L0L H;  1OV9 A;  5JH7 B;  1G6U A;  5EC1 C;  1BSM A;  4DUZ B;  3RYH B;  1P7G A;  5JCO C;  3RYI B;  3JAW A;  1H2K A;  3JAT B;  3AEI A;  4LR3 A;  3KKY A;  4WBN A;  4DR2 O;  2ZM6 B;  4Z2W A;  4O2B B;  4I4T A;  4IIJ B;  2IJI A;  1R3L C;  1YCI A;  2PF4 E;  1FFX B;  4WFF A;  4WFE A;  4U7N A;  3DTU B;  4LF5 O;  4UCV A;  1WP7 A;  1PPJ H;  2HVJ C;  2ZE8 A;  1YSC A;  3E2E A;  1FJG O;  1K33 A;  4J10 A;  1Y74 B;  1NT2 B;  4QE7 A;  2QDO A;  1KP2 A;  4LBE C;  4JI6 O;  2R9I A;  3ZRX A;  1E79 G;  4QGP A;  5IYZ A;  1N34 O;  3OM3 B;  4J9Y B;  2YXL A;  5BR8 O;  1WPX A;  4RO2 A;  4BIU A;  3HPL C;  1K3E A;  5KX5 A;  5KUM A;  2ADQ B;  2QSA A;  4JI2 B;  3THO A;  2F95 B;  5KMG A;  2MW2 B;  1NTM H;  3NXS A;  3C90 A;  2IU0 A;  5L3G A;  2A3Q A;  2WA4 A;  5KHI A;  1PL0 A;  4CZZ A;  4KHP B;  4BIO A;  2CTQ A;  4GLX A;  1NQT A;  4PD4 F;  5L3E A;  3L74 H;  3A0H Z;  3CB2 A;  3RN4 A;  1JFF A;  1X59 A;  2ZNJ A;  1Q86 W;  2CUG A;  1R6T A;  2YEV A;  4LC1 A;  2EBO A;  5GTH Z;  3JAW B;  2BCC H;  1VF5 B;  3E22 B;  5B1O A;  4LP8 A;  1SER A;  1D5N A;  2WAM A;  4J7J A;  1TVK A;  3K9S A;  5CMU A;  4LF6 O;  4DUZ O;  4X20 A;  4I4T B;  4P9O A;  5LA6 A;  1W59 A;  2GUZ A;  2WLK A;  2KKW A;  4TUY A;  2R9R B;  3QNE A;  3ASO C;  4CH3 A;  2QJ1 A;  2BTO A;  4H37 A;  2XTA A;  1YXB A;  4UB6 Z;  2DOS A;  5E1A C;  3UCS C;  3WFV A;  1N32 O;  1UFI A;  4FJC C;  5B1B B;  1UPG A;  2Y48 A;  1AJQ A;  2NN4 A;  3T4D A;  4QE9 A;  5BZB A;  5CA1 A;  4L87 A;  1G8M A;  4JI3 B;  1ENV A;  3APQ A;  3CRC A;  1QHT A;  2DQ3 A;  5IYZ B;  4F6R A;  5LGU A;  4EB6 A;  4NXN B;  4ZI7 A;  3T2M A;  4K0K B;  4ZHQ B;  1WNS A;  3ASN B;  2Q69 A;  3ABL B;  3LDC A;  4MVR A;  3K57 A;  5EYP A;  5KX5 B;  3CE2 A;  1CEZ A;  1Q90 D;  1Y6X A;  2YID A;  3EFF K;  2AHZ A;  4UVB A;  3U0Z A;  5KMG B;  1I08 A;  3TXS A;  3OEH G;  4YJ3 B;  1VQL V;  2ZXW C;  4B3T O;  4NYK A;  1KEC A;  2XOK G;  5H5N A;  1JFF B;  1GRJ A;  2WWW A;  3EXA A;  2Y69 C;  1PNL A;  1GAX A;  4WFB V;  5DEC A;  1ZTE A;  1DK1 A;  3L70 H;  1FKA O;  2YIB A;  2P90 A;  1GM9 A;  2YI9 A;  4X20 B;  5LA6 B;  5GW7 A;  2GUZ B;  4TUY B;  2HR3 A;  3F7V C;  5EZY A;  2B1I A;  4YY3 B;  2OYQ A;  1N0J A;  2Y4U A;  3TK1 A;  5B3S C;  1F23 A;  5LHI A;  2ADP A;  2QE7 G;  4LF8 B;  1RFY A;  4IHJ A;  3FFQ A;  3T1C A;  4EFB A;  1V54 B;  5CA1 B;  2NNU A;  5J2U B;  4DV1 O;  3CC2 V;  3UT5 B;  1M56 B;  2EIN C;  4F6R B;  4EB6 B;  1OCC B;  4ZI7 B;  1D2D A;  3FAV A;  4X66 B;  5E79 Z;  3VBB A;  1XOU A;  5IWA O;  1WPB A;  4DRX A;  2IJH A;  4DR3 B;  4FZ1 A;  2GV9 A;  2EIK C;  4N21 A;  1I5Y A;  2YXH A;  2AZ2 A;  1W2B U;  2JJ1 G;  3ZMS A;  2EX3 A;  1M4U A;  2YIA A;  3DGE A;  1I0H A;  4OGQ B;  3S3X A;  1NS1 A;  1IBL O;  5JJE B;  4LFC O;  1GN4 A;  1KB9 F;  1GMG A;  1KKC A;  3JAM N;  2HKO A;  3M99 B;  4DR7 O;  2ZD9 A;  4UB8 Z;  2XAJ A;  4CS4 A;  4B3S O;  1JOY A;  2HLD G;  3WB0 A;  1RPO A;  1OCR C;  5EBW C;  2CTR A;  4JAV A;  1R3K C;  1NU1 H;  2FTK A;  4LFB O;  1YIJ V;  1VF7 A;  1LNQ A;  5L3B A;  2E5L B;  5D5P A;  4IHJ B;  5BXZ A;  3ABT A;  1KUQ A;  1U97 A;  3E83 A;  1M57 B;  1PNK A;  4BW9 A;  4EKW A;  4JI0 O;  1GN3 A;  3B40 A;  3ZHU A;  3N2K A;  1K8A W;  1OZ0 A;  4O4H A;  3BPZ A;  2VQF B;  2XAF A;  3FAV B;  4JTA B;  3HKB A;  4X1I A;  2ZIM A;  4RUF A;  5FPO A;  4DRX B;  1XHZ A;  3JAK A;  5J9P C;  1MSD A;  1VF6 A;  1TGO A;  3ZRV A;  3ZRW A;  4CH4 A;  1WN7 A;  4JI8 O;  2X7R B;  1HWY A;  2LFS A;  2WA3 A;  1P49 A;  1VQ9 V;  4AQY O;  1DF5 A;  4GCZ A;  1B04 A;  2QM4 A;  4ZIB A;  1Q8I A;  4JPR A;  1DLB A;  3RGB A;  3RFR A;  4LFA O;  2GHY A;  2W6I G;  3KG2 A;  4TT3 G;  2CTW A;  5LL6 Y;  4IGG A;  1IBM B;  1QLE B;  1MZE A;  5HFM A;  4DV3 O;  2QWP B;  1JJ2 U;  4DW0 A;  4FLX A;  4MVS A;  1XIL A;  3TJT A;  2DN9 A;  2CE4 A;  4DV6 B;  1ZWI C;  3BRC A;  4NXM B;  2OCC C;  2F23 A;  2Q4P A;  4GKK B;  2N04 A;  1WA8 B;  3N2K B;  3P3N A;  2RDC A;  1P84 F;  2E5L O;  3T1Y O;  4ASU G;  3EHB B;  5CBG A;  3VQX A;  1BS3 A;  2O57 A;  4LWS B;  5KLV H;  1B3Q A;  3HKB B;  4X1I B;  2VQF O;  5CBF A;  2DYR C;  3JAK B;  2E74 B;  4J7K A;  4GT1 A;  3O9O A;  4IYH A;  1YZB A;  3ZRW B;  1QLN A;  4FLZ A;  3QG5 A;  1E1Q G;  3MAQ A;  3ABM C;  2ZCE A;  2A9H A;  3D3Q A;  1B06 A;  2JVD A;  1OCZ B;  2ZR3 A;  3QTC A;  2IH3 C;  5EK0 A;  2WLL B;  5EC2 C;  3JD4 A;  4R50 A;  3W7U A;  1I94 B;  2UXD O;  2ITD C;  5KHJ A;  3M8A A;  3OUS A;  4FFB A;  1J5E O;  3AG3 B;  2ZE6 A;  4RWU A;  4LF7 B;  1PNM A;  1ZLZ A;  2X6A A;  4I0X A;  4YHH O;  2Q0O C;  2ZR2 A;  5LMU O;  2OT5 A;  4DYL A;  3SJB C;  1S5L Z;  2YUA A;  5D5Q A;  1JA8 A;  2H3O A;  2EIL C;  1N8R W;  1EM1 A;  2PTM A;  2PYJ A;  5IYC O;  3RBZ A;  5IYD O;  1V55 B;  3CJH A;  5KHG A;  4NXM O;  4X65 O;  5LBQ A;  3KCX A;  2XT9 A;  1ZAU A;  1K9M W;  3STZ C;  2EJR A;  3K03 A;  3AG4 B;  3SYC A;  2JJ2 G;  1XNQ B;  4MS2 A;  3ZN0 A;  1BE3 H;  2JS3 A;  2W0F C;  4CH5 A;  3DC6 A;  2GBO A;  2ZE5 A;  3Q4H A;  3ZHT A;  2EUL A;  1XRE A;  4LH6 A;  4TOI A;  1S3J A;  2ITC C;  4MTF A;  5A2Q N;  3JD0 A;  1QR8 A;  1HNZ O;  3SR2 C;  3LSQ A;  2YIB D;  4I7Z B;  3ZBH A;  4PA3 A;  2P7T C;  2JGU A;  4PI0 A;  3NR7 A;  3K59 A;  1Q6U A;  1VQ5 V;  3LNM B;  2BSK B;  1XL6 A;  1CP9 A;  3OD4 A;  2UUB O;  1LR1 A;  4R6Z A;  3B8N A;  2B5U A;  5CA0 A;  3OTF A;  3QF7 A;  3K79 A;  3SYQ A;  3SJA C;  4QJF B;  4U3J B;  1M5I A;  1AR4 A;  3AK3 A;  4G28 B;  3H1I H;  3HKD A;  2DQ0 A;  4FZ0 A;  4I55 A;  1IXM A;  1SQP H;  3JYC A;  3ETG A;  4ABM A;  2OTJ V;  3L72 H;  2LGW A;  5JCO A;  4RQF A;  3BA9 A;  4RQE A;  1L0N H;  3BFR A;  1OCO B;  5KA5 A;  2Z5U A;  1HR0 O;  1FXK B;  3WU2 Z;  4DR6 B;  2LW7 A;  2ZQM A;  1MNG A;  2KB1 A;  1M90 W;  3Q4H B;  1XNQ O;  4EFE A;  4KXR A;  1VQK V;  1H2S B;  3ZS8 C;  1GKF A;  3BEH A;  3JD3 A;  4DV7 O;  4GKJ B;  2QTO A;  1QBZ A;  2F1M A;  2KG7 A;  4B08 A;  4GX5 A;  3ZN1 A;  5FNV A;  3HR0 A;  4J80 A;  4MVZ A;  1EFR G;  1RP3 B;  4AI8 A;  5IY5 B;  4LNU A;  4O4L B;  4LF9 O;  2UUC B;  5CA3 A;  3ZIA G;  1K73 W;  1E1R G;  3BA8 A;  4JYA O;  5EBM C;  2WLI A;  4O4J B;  4UV9 A;  1M1K W;  1R73 A;  4WFH A;  1TUE B;  4JI5 O;  4PA9 A;  3OMI B;  1YEW A;  5CA0 B;  2FML A;  3ABU A;  4KL1 A;  3MD0 A;  2QR4 A;  3IC9 A;  1MZF A;  1XDC A;  4LF4 O;  4ZBM A;  5B1B C;  4ZOL B;  2UUA B;  4JZ2 A;  2XAH A;  2QEX V;  2HP8 A;  3HKD B;  4Z1V A;  4X1K B;  3CC4 V;  1AI4 A;  3T4Z A;  5B66 Z;  1I7F A;  1S0V A;  3OUF A;  2N05 A;  3ASN C;  4MTO A;  3ABK B;  2NLJ C;  3ABL C;  3JD2 A;  2IH1 C;  4DR5 B;  2IM9 A;  2C2A A;  2AGA A;  3K04 A;  2F4V B;  1QVF U;  1Q82 W;  4FMT A;  3PN1 A;  4WBN B;  3TXQ A;  1MOF A;  5DED A;  2P06 A;  4H44 B;  5JJJ B;  1SQX H;  1YF2 A;  2IW5 A;  3AG2 B;  3I55 V;  1YIT V;  1KD1 W;  1YVW A;  5DN6 G;  4KP4 A;  4UCR A;  1WP8 A;  3B2E E;  1O9H A;  2QM7 A;  2YI8 A;  1KYO F;  2ZM6 O;  2KG7 B;  5LGN A;  4BW5 A;  1H2M A;  4HNA A;  5FNV B;  4CS3 A;  2YSU B;  1JCH A;  3STL C;  4E2L A;  4GKJ O;  4LNU B;  3RW0 A;  3FYI B;  4GX1 A;  5JJN B;  3LDE A;  2WLI B;  2AXT Z;  3E86 A;  3CPW U;  4MW8 A;  1HNW B;  3BCC H;  3H1H H;  4DV5 B;  1F7Y A;  1JPX A;  1XEQ A;  4W4L A;  3CCQ V;  4O2A A;  3J7A U;  5EIB C;  5IJ9 A;  4X89 A;  1AVM A;  1S76 D;  1HP8 A;  1K5S A;  4MVM A;  3CME V;  2CK3 G;  2F93 B;  3RWR D;  2OTL V;  1V54 C;  4JF3 A;  1I5X A;  2PYL A;  1U96 A;  3N2G A;  1M56 C;  2CAZ C;  1DGS A;  2UUA O;  4UCT A;  3SYA A;  4JI2 O;  1OCC C;  1EBO A;  3JAL A;  1JJO A;  3P30 A;  4W4K A;  1NVP B;  2YEV B;  4PDV A;  2GTS A;  2DJV A;  4X62 B;  1P7B A;  1IBK B;  4KHP O;  1VQ4 V;  2EJ7 A;  4JAS A;  4DV4 B;  1XMO B;  2XHB A;  1TVK B;  3SPJ A;  2V4D A;  1VMG A;  3HKC A;  3JAS A;  2YIC A;  3ICX A;  1KP3 A;  3CP1 A;  5L3C A;  2RJZ A;  4CS2 A;  1H8H G;  5CB4 A;  1R6N A;  4J9Z B;  5K1X A;  1D5A A;  1NJI W;  1Q81 W;  3TCU A;  1SET A;  3CCM V;  1Q6I A;  3L73 H;  3LUT B;  3B77 A;  1FFT B;  1MG1 A;  4B3M B;  2LJ2 A;  4NTY A;  3P32 A;  4J41 A;  3A0B Z;  5IE9 A;  3A8T A;  5LHH A;  3LNN A;  1QCE A;  4DR1 B;  1NTK H;  5B1A B;  1YDX A;  4JI3 O;  5IJ9 B;  4ICG A;  5CN0 A;  1HNW O;  5EYP B;  1KMI Z;  4A5U B;  2JS5 A;  4NXN O;  1WAZ A;  4DV2 B;  3JAR A;  4K0K O;  1F4M A;  1M57 C;  5KHH A;  5TIS Z;  2DWE C;  3N2G B;  3H1L H;  1YTF B;  2H8P C;  4B3R B;  3CD6 V;  2KSD A;  4PJ0 Z;  2DYS B;  3ZHQ A;  3TET A;  1ZUQ A;  3JAL B;  2QWR B;  3RYC A;  2HJF C;  3BAA A;  1KU9 A;  1RM1 B;  2DE0 X;  3G80 A;  5H6R A;  1W0J G;  5LMN B;  1VQN V;  1H8E G;  1CXZ B;  1K5Q A;  3DSQ A;  1IDS A;  2CDY A;  3O65 A;  4DW1 A;  1NBM G;  2EIM B;  4GYC B;  4K3A A;  1SKV A;  4DR4 B;  3JAS B;  2LP7 A;  5EZY B;  1VQO V;  2KQX A;  3ZED A;  3CXC U;  4DV4 O;  3G6B A;  3CS5 A;  4PA7 A;  5GON A;  2GDS A;  4PDL A;  4YY3 O;  4CH6 A;  4N23 A;  1DF4 A;  4B7E A;  3LSS A;  1SRY A;  4NVP A;  4F6E A;  3I56 V;  1EZV H;  3ZMT A;  3UQ8 A;  1BZK A;  2WLH A;  4LF8 O;  3F7Y C;  3E8G A;  1QLE C;  1N0N A;  3CCS V;  1NTZ H;  2QWO B;  3A0R A;  4D7S A;  4UCU A;  2Q73 A;  3JSN A;  3GVM A;  2P67 A;  4TSF G;  4XBF A;  2WLN A;  4X66 O;  3ZMV A;  2K1E A;  4R7C A;  2XAG A;  4FIP C;  4R8C A;  1FAF A;  3OAA G;  4DR3 O;  5FLX N;  4FLT A;  3ZHR A;  2LQT A;  4JI7 B;  1PKX A;  2ZDI A;  2JGD A;  3RYC B;  4PEL A;  3H01 A;  1URF A;  1QNM A;  4B3R O;  4OX9 B;  2B1G A;  4MT8 A;  1ZL8 A;  1GN2 A;  1EZJ A;  1VF6 C;  2Y4T A;  2A06 H;  1VQP V;  3RYF A;  1EN4 A;  1XI1 A;  5CBH A;  2BTQ A;  4PHZ A;  3U10 A;  4OPA A;  3IAY A;  1OCZ C;  1SES A;  5GON B;  2A79 B;  4B7K A;  4D6T H;  3HKE A;  3OE7 G;  4PA4 A;  1US6 A;  2B9Z A;  3BY6 A;  2E75 B;  3K0D A;  4X8A A;  3CCV V;  4DK1 A;  4JI4 B;  4CBC A;  3S3W A;  3E8F A;  1GM8 A;  3AG3 C;  1V9P A;  4FM0 A;  4O4H B;  5KA6 A;  3SJC C;  4MW3 A;  3L75 H;  2YDE A;  2UXB B;  4NTW A;  2LFR A;  1O9G A;  5LGT A;  5JWP A;  2A7W A;  2P22 C;  5HFL A;  2Q6A A;  3ZMZ A;  3CRM A;  4NB5 A;  2G38 A;  2ARH A;  5K1P A;  4PV1 B;  3ZHV A;  2L6L A;  5H6Q A;  3WB2 A;  4X88 A;  1ZX3 A;  1V55 C;  3C3T A;  2JGD B;  1Q7Y W;  3A2F A;  2Q8V A;  2XUM A;  3WG7 B;  2CGO A;  3E8B A;  1NVP D;  1Z5W A;  3RT3 C;  5ITZ A;  1R1B A;  5JVD A;  3E8H A;  1XL4 A;  1GO3 F;  3L71 H;  2ODM A;  3AG4 C;  3D3I A;  3APO A;  1MAB G;  4OX9 O;  4J11 A;  3RYF B;  5JQG A;  3FB6 C;  2MK3 A;  3H1J H;  4FLW A;  2BTQ B;  3FX7 A;  1R6K A;  3QO7 A;  1MSW D;  3HKE B;  4MTX A;  3OT7 A;  1IBM O;  1BL8 A;  4UVA A;  5J2T A;  4DV0 B;  1N33 B;  1PV0 A;  1ARO P;  3C3S A;  3X2Q B;  3G4S V;  3FD9 A;  4JI1 B;  4DV6 O;  2HHH B;  2AZ0 A;  4JI4 O;  3CRA A;  4GKK O;  2HVK C;  2Q0A A;  2ATK C;  3OEE G;  3RVZ A;  1N4C A;  4QIW F;  3AG1 B;  4Z1M G;  3L9D A;  1VP7 A;  5C8Y A;  3W7W A;  3HB3 B;  1YTF D;  1EN6 A;  4JZG A;  4HYO A;  2N74 A;  2PZS A;  5LOV A;  1TA8 A;  5LP6 A;  5LHG A;  2RCV A;  2IBZ H;  3D8C A;  2IJK A;  5IJ0 A;  3ZRS A;  2AHY A;  3B4S A;  4P30 A;  1OCO C;  1SF9 A;  2W0X A;  1Y4M A;  4FFB B;  1FXK C;  5JQG B;  3D36 A;  3OR6 C;  3CCU V;  1I94 O;  4I0X B;  4IIJ A;  4PI2 A;  1IXB A;  1KC8 W;  1K7D A;  1NR1 A;  4WCE V;  4LF7 O;  2DWD C;  5H9C A;  2Y0I A;  4WFA V;  3VOU A;  2H94 A;  3CMA V;  4JI6 B;  2EZO A;  4X9Q A;  1K4D C;  1JQ0 A;  3BAB A;  2ETN A;  3AG7 A;  1N34 B;  1F51 A;  3CJH B;  5IY5 C;  5BR8 B;  1N33 O;  1QVG U;  2EIJ B;  1TUB A;  1L8D A;  3ETE A;  2CGN A;  1BHA A;  3SPC A;  2VWJ A;  2K9P A;  1BMF G;  4KFM A;  3J80 N;  4U3F H;  1VQ8 V;  2QKA A;  3CCE V;  2HHH O;  2BOC C;  1NH2 B;  2Q9L A;  5C8Y B;  4JYY A;  4IYI A;  3K5M A;  1THZ A;  2R70 A;  1MA1 A;  2JEX A;  5KAF Z;  3UO3 A;  5LOV B;  5LP6 B;  3R65 A;  1AIL A;  2IU3 A;  4X64 B;  3EVK A;  5IJ0 B;  3B09 A;  1AI6 A;  4HZ3 A;  4D7T A;  4WF9 V;  1Y67 A;  4LF6 B;  2X0L A;  2WLJ A;  3ABK C;  3E22 A;  2YXY A;  3CRR A;  1Y76 A;  2QKC A;  4FLU A;  4TQF A;  1JX9 A;  2Q68 A;  3OW2 U;  4PDM A;  1N32 B;  3FB5 C;  3AG2 C;  1VQM V;  4EEQ A;  1GN6 A;  1AJN A;  1Y66 A;  2F43 G;  5EBL C;  3OMA B;  1ZSP A;  3U11 A;  4FM2 A;  3TGU H;  4PA6 A;  3IJ4 A;  1PM9 A;  2P6J A;  3CWB H;  4I9W A;  4X1Y A;  2PI5 A;  1TUB B;  4Q6G A;  1GM7 A;  4AIL C;  1FS0 G;  5L3F A;  4I55 B;  5BMV A;  2V7Q G;  2Q7H A;  4QPJ A;  1WB7 A;  4H33 A;  3AK1 A;  4ZHQ A;  3K58 A;  4XDL A;  1J95 A;  4QPK A;  3SPG A;  2E3C A;  2FB5 A;  1M9N A;  4B3T B;  2UXN A;  1YJ9 V;  1QU7 A;  1Q6H A;  2A0L A;  2JDI G;  3N27 A;  4UFZ A;  4BAY A;  4YJ3 A;  1XUQ A;  4BR6 A;  3QVN A;  4DR6 O;  2YC0 A;  2ZIO A;  4X64 O;  1Z5V A;  4NTX A;  2WPD G;  3SPI A;  4OXS A;  1Y76 B;  1RSO A;  3SGI A;  3CX5 F;  4I50 A;  3K06 A;  5B1N A;  3F5T A;  1LUV A;  1ORQ C;  1YI2 V;  3E89 A;  4Q20 A;  1VEW A;  2R9A A;  2JIZ G;  1FPO A;  1XHX A;  2UUC O;  4DV1 B;  3CXH F;  1L1F A;  3LDD A;  3QO5 A;  1UJW B;  1AB3 A;  4DO2 A;  4X1Y B;  2AW9 A;  5J2U A;  1AI5 A;  3B8M A;  3UT5 A;  2JK5 C;  3ML0 A;  5BMV B;  2CTP A;  5IWA B;  1IZ3 A;  2X6C A;  2P5O A;  1GH6 A;  3MDS A;  5B1A C;  2VQE B;  4NR1 A;  1WB8 A;  5IYB O;  3CEI A;  1BGY H;  2ZT9 B;  3OMN B;  2HEP A;  1VIB A;  5LYJ A;  2Q67 A;  4DR5 O;  1IBL B;  3OGC C;  4UXN A;  4LFC B;  3ASO B;  2F4V O;  3ZMU A;  3ZHS A;  2DYS C;  2L35 A;  2M6Y A;  1XMQ B;  4DR7 B;  1RM1 C;  2HG5 C;  4B3S B;  4FPP A;  1BCC H;  4HNA B;  1RSO B;  2FYU H;  1SQF A;  3QO8 A;  2WLM A;  4I50 B;  2D2C B;  2VRZ A;  1IX9 A;  3CYO A;  2P4K A;  2QA4 V;  2JRI A;  2QM8 A;  4LFB B;  2EIM C;  2XND G;  5KUK A;  3P3P A;  1AI7 A;  1NI8 A;  3H9V A;  2UU9 B;  2QWN B;  1N36 B;  5H2F Z;  4JI0 B;  1GK9 A;  4O2A B;  1VQ6 V;  4TWK A;  3GWO A;  4UVC A;  4JV5 B;  4DV5 O;  1AJP A;  4DUY B;  2GSM B;  4L8J A;  4JAA A;  2OWO A;  3BVO A;  5LXT A;  2ZXW B;  3K5N A;  1P4R A;  3F5W C;  3UO2 A;  3SYP A;  2PUS A;  3DXR A;  1R3I C;  4P9P A;  2Q7E A;  1KQS U;  4DK0 A;  2Y69 B;  3MHH C;  4G27 B;  1X4T A;  5IDJ A;  1NH2 D;  3LSU A;  2D3O W;  4JI8 B;  1KBH A;  4PDR A;  4XDK A;  2OIE A;  1BHB A;  1BQZ A;  1F4N A;  5FPR A;  1XBL A;  5LYJ B;  1PP9 H;  1G1X B;  4H13 B;  2XAQ A;  2VQE O;  4AQY B;  4I5S A;  3FKS G;  3HKC B;  2RNB A;  4X62 O;  3KZI Z;  2FL4 A;  1NZ6 A;  4U7O A;  1IBK O;  4O4I A;  5B3S B;  3ETD A;  1VQ7 V;  1OJH A;  1H2L A;  4UUJ C;  5CB4 B;  4LFA B;  4GX2 A;  1XMO O;  2UXC B;  3BHP A;  1CPY A;  1MMM A;  3K3W A;  5DM6 V;  2FKX A;  3AK2 A;  1XMQ O;  4DV3 B;  4AHC A;  1S5H C;  2PGG A;  3CCL V;  1SC5 B;  1XNR B;  1T5E A;  5L3D A;  3G67 A;  3ZCC A;  2EIN B;  2IJJ A;  3ETQ A;  2LW1 A;  1VAR A;  4B3M O;  2Q5Z A;  1WLE A;  1JVM A;  5A9G A;  3CHX A;  4TQD A;  3T1Y B;  1K97 A;  2OIG A;  4F4L A;  5KHK A;  3K5L A;  2UU9 O;  2EIK B;  1N36 O;  3CCR V;  4DR1 O;  3JAR B;  4K8Z A;  1WA8 A;  5AG2 A;  2M7W A;  2HJD A;  5LXT B;  1Q5O A;  1HNX B;  1H2G A;  2WSS G;  4JV5 O;  1FD9 A;  4IT5 A;  3DXR B;  3PJS K;  4DUY O;  4LWS A;  2QGN A;  2RQ6 A;  3FB8 C;  4DV2 O;  4YXW G;  4I9Q A;  1SQB H;  4GX0 A;  4XDJ A;  2PI4 A;  4JTD B;  1COW G;  1NKD A;  2QTS A; 
#chains in the Genus database with same CATH homology
 4IYI A;  4J10 A;  4W4L A;  4J42 A;  4J41 A;  4IYH A;  4W4K A;  4KXR A;  4J7K A;  2GTS A;  2G38 A;  4J11 A;  4J7J A;  3FX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...