4J7UA

Crystal structure of human sepiapterin reductase in complex with sulfathiazole
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
GLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrahydrobiopterin biosynthesis as an off-target of sulfa drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/antibiotic
molecule keywords Sepiapterin reductase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j7uA00
5B1YA 4FFPA 1U5CA 3WLEA 1ISHA 1N92A 2FMUA 1N9GB 3SEFA 4YTEA 4YWJA 5THKA 5COBA 2I5PO 3WX0A 4DA9A 4R3NA 5AVOA 4DIFA 5BNIA 1HTBA 2Y1OA 4UUNA 2PFGA 4CLXA 1CEQA 4WLFA 1LDNA 4DYVA 1U3WA 3BTVA 1F8FA 1L7EA 4I5FA 2E82A 5CDTA 3L6OO 4DLLA 3D4OA 5IN5A 4DPLA 1H2HA 3UGKA 3FF4A 1TI7A 2ZQZA 3OJEA 3G1UA 5C7LO 3RD5A 1DSSG 2CMDA 1Z82A 5JCJD 2GERA 1B3BA 1W8DA 3B1FA 2P91A 2P5YA 3OEWA 4KUHA 1MA0A 3I83A 4Q3AA 1VM6A 4GL4A 1ZXBA 2X1HA 3SXPA 3IQDB 1P9LA 1A9ZA 3GK3A 3GQVA 3PIDA 2C2XA 4XYEA 1KVSA 4EJMA 5LDHA 4GWKA 4OKNA 5T64A 1GY8A 1ZVMA 5BSHA 3JQEA 1LSJA 1WDLA 2XXBA 2H1SA 1E1LA 3CMCO 4M87A 4Z9YA 3BMNA 3GVXA 5EESA 4CUZA 4DXHA 2OP0A 3RBXA 1U7HA 3PTZA 1MFPA 4RVGA 3RC9A 1SBYA 1I0ZA 3WNVA 4E12A 4YJHA 2PLAA 2OO5A 2W2KA 3DBHB 1LX6A 2RBEA 4B4UA 3H4VA 5A02A 4FW8A 2A35A 5B4VA 1N1EA 2DUWA 2QZ9A 1JA9A 2I76A 3PZBA 3PDUA 4PLWA 3IJRA 4BNGA 4I9NA 4CUKA 3TN7A 3GMDA 2DT5A 2DU8A 3KYCA 3H2SA 3Q0EA 9LDTA 3DZJA 4TQGA 3T7CA 2C82A 4GMGA 2NVUB 4D3DA 3DAFA 1ONOA 1YONA 1YL5A 3NRCA 4D42A 3BA1A 5CEJA 3CTMA 2NUAA 2OP1A 1KC3A 1YVEI 1IUKA 3DHEA 2EKLA 2HMTA 4HKTA 1YOVB 4D43A 3E1KA 1MP0A 2PKQP 3WWZA 2V65A 4XQEA 2VWQA 1HETA 4ND2A 3K31A 3RCBA 1R12A 2YV3A 4BS9A 3KEOA 3ICPA 4TZTA 1I3LA 3GZNB 3HUDA 5BNFA 1OC2A 4RVHA 4B7UA 3CUKA 4IDBA 4XYBA 2EF1A 4RPLA 4AJNA 1NR1A 1B8UA 4U6SA 1FK8A 2VTDA 4CUJA 2H63A 3ANMA 4KDFA 4MP3A 3LC7O 3OH8A 1QYWA 1UZNA 4R4JA 2DTEA 2PKQO 1AXGA 4BKPA 1LDEA 1Z73A 2Q3EA 1WLYA 2RCYA 3AI2A 4ITUA 3TZ6A 2FWMX 1KERA 2CVOA 3AOEC 4EITA 4PGFA 3SLGA 4UEJA 2NVWA 3E9NA 2GN4A 3ADOA 1HYEA 3DTYA 2PTGA 2V6FA 4D7AA 1Y8QA 4HADA 1FXSA 3DWFA 1ZO8A 4L4RA 5I7FA 4MVJF 4Q3NA 5A06A 2YHIA 3U9LA 1FF9A 1NAHA 1WDKA 1B7GO 3OF2A 1E77A 2YJZA 4BKRA 2FHSA 3JQ8B 3L4BC 4NBTA 2GCGA 2O4UX 1PQUA 4GH5A 5JC8A 5F21A 2HRBA 1A4IA 1Q7BA 1IULA 2W2LD 3NDJA 2P4HX 1E1NA 1XWFA 4PZCA 1HE2A 1LNQA 1O8CA 1TEHA 5IDWA 1YRLA 4MINA 2PY6A 2D2IA 2OUIA 2WYVA 4NK4A 1ZW1A 3WGQA 2F1KA 1MB4A 1VKOA 1U8XX 2I65A 2NTVA 4FD3A 1PWZA 1WDMA 3JQGA 4XCVA 1U3UA 2F00A 2O50A 3LT1A 3PLRA 3OJLA 2ZYAA 3E9MA 1L1FA 3DAGA 3L9XA 1B16A 3LT0A 5AXBA 3WGYA 3DZBA 1I36A 3ZHYA 2X0JA 1EQUA 3F6YA 4TMFA 1J49A 3JQ7B 1Y9EA 3AOEA 3RWBA 2D5CA 1WP4A 2J6IA 2CDCA 4CMEA 3I6QA 1BXZA 4N54A 3ANNA 4JNKA 3TZCA 3ROPA 4EZBA 2PD6A 1UXJA 1WNTA 1KETA 4PVDA 1JWAB 2P4QA 1KEPA 3GRKA 1F17A 3EC7A 2RHRA 2Z95A 3UKOA 4BNMA 2OBYA 4PIVA 1PZEA 3LYLA 2VYVD 2D5AA 3FNHA 2Y0DA 3K2BA 1DXYA 4J49A 2V7PA 2ZTUA 3CKYA 4E5PA 4FOOA 1ID1A 1RJWA 1XU9A 3EDMA 4CV3A 1U4SA 1CETA 3E18A 2C5EA 3M6IA 3JQBC 4RF3A 1GV1A 4WK6A 3RKUA 3BHJA 3OIFA 4BO8A 4UUPA 4NJMB 5A5EA 1CWUA 1T2CA 2X0RA 4TWRA 2EP5A 3OECA 5JCJA 3WGZA 5J23A 1HE3A 1JQBA 1T2DA 4G2NA 3UUWA 2AEMA 3ZHBA 3PWKA 1ZEJA 2IZ0A 3PHIA 1AN9A 3GG2A 5KJEA 4PRKA 1XR3A 4O5OA 4RZIA 2VNAA 3VHRA 3AY6A 2IRWA 1TT5A 5A05A 4CJXA 5TLSA 4CMEC 2BFMA 3ZV3A 4NU6A 3NDRA 4DLBA 4CLEA 4LVCA 1M76A 3LC1O 2QYSA 1LC0A 2CFCA 3PPIA 2Q50A 1SOVA 2ZYGA 2NNLD 4DRYA 1XLTA 4CM7A 3VH4A 4IBOA 5TSDA 5CG2A 2GZ3A 2YV2A 3AFMA 4QFDA 2C7GA 3V1TC 4FGSA 1N2SA 1PGQA 2WJPA 1Z45A 5COQA 1QV7A 4GSLA 2GUGA 4F46A 1EZ4A 1UZMA 4CM3A 4R1UA 2FZEA 1Z75A 4D41A 1NXQA 2AEJA 4GKBA 4C7KA 2V6BA 1IHXA 4CQMD 3QVWA 4WLUA 1RPNA 3H9EO 4YBZA 5DBFA 1V35A 3VPGA 2NVBA 4JJFA 3FPLA 3JQBA 4M1QA 5HRUA 3AOGA 2ZJ0A 3MWDB 1N5DA 1SEVA 1SMKA 1ORRA 2A9FA 1OC4A 4BGVA 1UP4A 3KZVA 1GQQA 3JD3A 3HDQA 3ZWAA 3PVZA 3LT4A 2B4QA 4CV1A 1PIWA 4YAEA 1ENYA 4JROA 5JDCA 2PKRA 4BNTA 1GZ6A 1XCBA 1H9BA 1O6ZA 3JQCA 4FN4A 3ENKA 5KKCA 2X4GA 1HDYA 1AHHA 5I9LA 2EERA 2EG9A 3ZWBA 3C1TA 4J7CA 1EMDA 5T8KC 5ICSA 4Y6PA 4XDYA 5ENDA 3OJ0A 1Q2XA 2AG5A 1EVYA 1GAEO 1GZ4A 2P68A 2DVMA 1P45A 2LDXA 3CE6A 2EP7A 3ZNNA 4CMGA 1HEUA 3OJFA 3ETDA 3LC2O 3AWDA 4G5HA 3S8MA 2X5JO 4RV9A 2Y99A 3Q11A 3GT0A 3BHIA 1C1XB 4FS3A 2XPCA 2O3RA 1I2CA 3RI3A 1NWCA 1VL8A 1YJ8A 1ADCA 2C5AA 3MJTA 3PGXA 1N8KA 4W7HA 1C1DA 1E92A 3A4VA 4L73A 4JBGA 1M2WA 4BKOA 5JFOA 4DBVO 3UCEA 1PJSA 4W9NC 1MXHA 3E03A 1G6KA 3GH3A 3NJ4A 2YQ4A 2D1YA 5DBIA 7ADHA 4IJVA 1QG6A 1SPXA 4NBUA 2VQ3A 1R66A 3VZPA 5KJ6A 3WJAA 4YJGB 4UEOA 5C3MA 3GEDA 2VWPA 2OMEA 3R3SA 4WCFA 1YL6A 5AOVA 2VZ0A 1P77A 3F3SA 1YH3A 2QYTA 1CQIA 1ULSA 1K0UA 4PLHA 3PDJA 1X0VA 2ZCUA 3QQPA 1BDMA 3DB2A 4MIYA 2VHWA 1DAPA 1QORA 1U4OA 1YGYA 2EJVA 4R16A 3WNQA 4CMBA 1DB3A 4EJ6A 3WQRA 3RUEA 2YFHA 1UP7A 1N7HA 5C5IA 1H2BA 4ALIA 4FB5A 1T2FA 1RWBA 1VI2A 2FN7A 4XDZA 3BTUA 2A92A 4XQCA 1VLLA 3EZLA 5TF4A 4ZQFA 5TT1A 3WWYA 1T4BA 4MJLA 5CDSA 1KEVA 3JQ8A 2WTBA 1GL3A 4PFJA 3V2HA 4O6VA 3Q6IA 4ND1A 2Q45A 3LDHA 1XYGA 4HFNA 2RAFA 2UUOA 4D0SA 4CM4A 1T26A 5ITWA 1E3LA 5KNLA 4YRAA 3IKVA 3GUCA 4E0BA 1E5QA 1R4MB 1ZMTA 1BSVA 2Y1DA 4J0FA 2O3JA 4KZPA 3UH1A 3UCFA 1QLHA 3EY4A 5CPBA 8ADHA 3JYPA 5A9SA 3D3WB 5AYVA 2R6JA 2C2YA 2I3AA 3NEPX 4BNYA 4E2WA 1O94A 3ASVA 3PWZA 4IXTA 3VVCA 2FOIA 2I66A 4IQ0A 2VNSA 3GVPA 1E7YA 1JU9A 4ND4A 1GR0A 2QQ5A 5MGBA 1WMBA 1V8BA 1FDVA 4Q9NA 3PQDA 5T5QA 2UUPA 2OFPA 3H8VA 1CIVA 1O0SA 1X15A 5JCXA 1SCUA 1O89A 3Q2KA 5JSFA 1HE5A 5C7OO 4XIYA 3WMXA 1R15A 1EUZA 1ZSVA 2WDZA 1LJ8A 4L8VA 2IZ1A 3G0OA 1TA4A 1V3VA 3W1VA 3HHPA 1B8PA 1QYXA 5H82A 3C7DB 2FP4A 1NM5A 4BNJA 3IMFA 2B0JA 1EBUA 3LZ6A 3PHGA 4QTZA 3LLSA 3LU1A 3RVDA 5C37A 3GDGA 3FR8A 4NR0A 5AXAA 1ENZA 4Y9DA 5L4LA 4TRJA 4XJTA 2C29D 3DBLB 1P74A 1DFIA 1BRMA 2O3UA 4BOYA 2UAGA 2VOJA 3F47A 4DMLA 4E2ZA 7MDHA 1MC5A 1PJQA 2B83A 2Q49A 3ASUA 3NT4A 4GVXA 5HA5A 4U6QA 4E4YA 3S2GA 1BTOA 2NACA 3AW9A 3GGOA 3OA0A 2DAPA 1JVSA 1DLIA 2FY8A 3RAJA 4O63O 4FSHA 1EVIA 1PJBA 1RM5A 3C8MA 3JQFC 3O03A 4R9SA 1ZFNA 2BD0A 5CEEA 1E7RA 4L75A 3ZV6A 2CF6A 3HDJA 2QRJA 4B3HA 2NQ8A 3I4CA 2VZ9A 3QWHA 1EEHA 1EK6A 1JWBB 4U7WA 5IAAA 2WSBA 2IODA 4JXKA 4A27A 4YAJA 3HDYA 3U4IA 4GX2A 1Y81A 2C59A 3GVIA 2B35A 1UAYA 3IP3A 1M67A 3VPSA 1K6IA 1WAMA 4OQYA 2VWGA 1E6EA 4JJGA 2VT3A 4E30A 1GZ3A 5JAMA 3FNFA 4TRRA 3PEFA 1J0XO 2HRZA 1B26A 3DMTC 1T4DA 4FQ8A 1I33A 3MTJA 1H9AA 3WGGA 3GPIA 1Y8RB 3GHYA 4XIJA 1AHIA 2J5QA 3F4LA 1N9GA 3OQ1A 1W0CA 5GZ1A 1IYZA 1R37A 4QECA 5I9NA 3W4JA 2VHYA 2NTJA 5A3JA 3U4DA 2ZCVA 1J6UA 3P2OA 5HS4A 4JIGA 5HWSA 2EXXA 1EDOA 3AY3A 4KMSA 3PIIA 1I30A 2Y1EA 3MJEA 4WEOA 5G0SA 4Z9XA 2I9PA 5G4LA 2HMVA 2FR8A 2GZ1A 2VRBA 3GEMA 1V0JA 2HJSA 2DQ4A 3HQ4O 2AXQA 1E3JA 2GDZA 4JLWA 4WLNA 2BH9A 3BTOA 1R4NA 1I3MA 1KY4A 3KYBA 5DOVA 2O7QA 4DMMA 1WZIA 3CMMA 1NBOA 3GDFA 4OXYA 3ZGYA 1M6WA 2X0NA 4IMPA 3ULKA 1BVRA 3D7LA 1C14A 2I3GA 3P19A 2AA3A 4MP8A 3GFGA 3QY9A 1CYDA 2NADA 2J3JA 1EUCA 4YXFA 2W4QA 4ALKA 3X2EA 3OIDA 4UUOA 4BNKA 5L4NA 5EMHA 1ZCJA 4YAKA 4MVJE 1PJ2A 2EEZA 4YT4A 1TT7A 5T67A 4R68A 1LSUA 4K6FA 1JVBA 4U5QA 4OSOA 3ZWYA 4IPTA 5IFLA 4O0LA 5FYDA 1NR7A 2AHRA 3E8XA 4Y67A 1MUUA 3TL2A 1S7CA 4A7PA 4AFNA 2R00C 4KQWA 4EBFA 3V8BA 3TNLA 4OHUA 3W4KA 5CPFA 2DBZA 4H15A 2NU8A 3HJAA 1KVQA 3TRIA 4E2XA 4YAIA 4AJJA 4IGFA 4RZHA 1U9JA 2PK3A 3HG7A 3K30A 5COAA 5L7TA 2VHVA 1GEEA 1E1MA 5KCZA 4WPGA 1BGVA 5G2OA 5G4KA 3I52A 5JAQA 4YACA 3EYWA 3PLNA 1NQAO 4IGEA 1I32A 1KEWA 4R54A 2ZTLA 3HFSA 1B0AA 5C7IO 1DJQA 3AK4A 4RJTA 3MTGA 1KS9A 3PWSA 4BGUA 3X2FA 2GD1O 1TB4A 2B69A 1BW9A 1QKIA 1ZKMA 5CHEA 5KIAA 4IDAA 5G0UA 4S3MA 5TJ9A 4BO2A 2GN6A 2FRDA 4FR5A 3DQPA 3CINA 2PZKA 4GLLA 3IC5A 4IDGA 4I9UA 4AJ2A 4DREA 4XEHA 2X5OA 3OHSX 1V9LA 1B15A 3E5RA 5BNTA 3WQSB 3AUTA 1GV0A 4PLTA 1YDEA 4RLSA 4U0KA 1FDUA 2W2LA 4A10A 3C7CB 1FJHA 2DPGA 3NGLA 1XIVA 4DPKA 5IDYA 1X14A 4IS2A 3GY0A 3QVXA 1EVJA 2XF8A 3L6DA 1YBMA 1JKFA 5ILOA 1ONPA 4UULA 3JQ6A 5A9SB 3ON5A 4EJ0A 4BB5A 4WCDA 4OGWA 4ND3A 2NU7A 3HDHA 1XEAA 2HQ1A 1BDBA 1HRDA 1PU2A 1L7DA 1VE9A 3AI3A 1DFGA 1GDHA 1SAYA 4CLRB 2YZ7A 3Q9UA 1ULUA 4IQGA 4XRGA 2Q4EA 1OMOA 2B36A 4MIOA 3DFZA 1P0CA 1A7AA 1GUZA 1X0XA 1Y9AA 1ZSNA 3DBRA 4ZVVA 4P4LA 4II2A 3VKUA 3W4IA 3SBOA 4DIOA 1LLQA 4OQZA 5I7SA 3DHNA 3GGGA 3IOYA 4OYRA 3LVFO 1I2BA 1P1RA 4WGGA 2PZLA 3QV1A 3O4RA 2JJYA 1T2EA 3QWIA 1C0LA 3FI9A 4KTVE 3ZWXA 3EUWA 3JD2A 1T2AA 1DC5A 5JO0A 2VT2A 5GZ3A 4W99A 1E3SA 1K5HA 2UYYA 4MVJA 2VYVA 2B4TO 4WLEA 4ZRMA 3WGOA 1NVTA 2EKQA 4JN6B 3LF2A 4AICA 3JYQA 1HDOA 1OBFO 1C0KA 4GVLA 2WE8A 2XXJA 1XHLA 4TROA 3BAZA 3UW3A 4J1NA 4ZHSA 2E37A 2GN8A 4QQRA 3UVEA 3AY7A 3C1AA 4AJLA 3ETGA 3SJUA 3HSKA 5JY6A 1LDBA 2QRLA 2CF5A 5ITVA 1PJ3A 4YRDA 3HB4X 1ZIDA 4B8WA 4BMNA 1Q7GA 3RUAA 1U7TA 3WTBA 4BGIA 4IIVA 4ZA2A 1YB1A 2QW8A 2J3HA 5KVQA 4II3A 2HDHA 4MIEA 5HS6A 4PCVA 4MKRA 4GAEA 2UDPA 4JP3A 3ZW9A 4M49A 1HE4A 2ZJ1A 3RUDA 1U5AA 3DTTA 3OICA 3TL3A 4BNHA 1PJLA 1DLJA 1LC3A 3KSDO 4ILKA 4IZHA 4IZIA 1C1DB 1E3IA 5I8WA 3KB6A 6ADHA 3OEYA 2YHUA 4NJOA 5JDCC 1XQ6A 2AEFA 1XELA 1ISMA 4P8RA 3C7AA 1YBAA 3JQGB 4J7UA 1HSOA 3V5NA 1PS8A 2JCYA 1Q7CA 2VYNA 3QIVA 3K5PA 3ZWVA 4DC0A 1CERA 3NTQA 4LCEA 5JS6A 3ZV4A 3PRJA 4XJSA 4YEDA 4F45A 3O8QB 4RQTA 5TQVA 5EL0A 2NWQA 3GG9A 2O7SA 4UREA 1XKQA 3NTOA 3JD4A 4GBJA 1IE3A 3U62A 4J9VA 4MVJD 1U2GA 3IS3A 4GWGA 4GI2A 3QWBA 2JHGA 4MDHA 1I24A 1LTHR 1D1TA 3UFXA 3PI7A 4J0EA 4E13A 2D0IA 4HFJA 1R4NB 4XGNA 2HJRA 2AMFA 5T6BA 1DDOA 3PQEA 1HL3A 5KJ1A 1A5ZA 3ITKA 4RPGA 4FBGA 3JQ9A 1R0SA 4KDEA 3LK7A 4WNIA 2V6GA 1SOWA 1QYDA 3ZNOA 2ZIZA 1D8AA 1KVUA 3L4SO 2PH3A 1EE9A 2DC1A 3BYZA 4WNCA 2BRUA 1HSZA 3KEQA 1YO6A 3H7AA 4GKVA 5TRTA 5CG1A 5JDIC 1LRKA 2FSSA 4K9DA 1FDWA 4YQYA 1KVRA 3DOCA 2HAEA 4GGPA 3ZDFA 4BO0A 4Z0HO 5IF3A 5KVVA 3JQAD 2FR1A 3KVOA 1MV8A 3PJDA 1X1EA 3FNGA 1NAIA 3K2EA 4XB1A 4B3IA 3IP1A 5TJHA 3ZHZA 4CQLA 2O2SA 3BMQB 4PG6A 1PL6A 3DOJA 1DOHA 4MVJP 5ILGA 2IDZA 3K6JA 3ROKA 1YBVA 3D3EA 5T57A 1YDWA 2JD2A 3RUFA 2QIOA 3GAZA 5MDHA 3DZHA 2OGUA 2PGJA 4R5HA 4LMRA 1GYQA 4XGKA 4E31A 4A0SA 2VYND 4RGBA 3K96A 4U8GA 2OBNA 2VN8A 2P2SA 3QVOA 5JXWA 1GPJA 1Z74A 4N5LA 1J4AA 1NYTA 4BNWA 1O5IA 3QA9A 3TQHA 4FFMA 3WR5A 4BO1A 4PLPA 4XYGA 4BNVA 2CUKA 4X54A 1PSDA 4YYZA 4MVJG 1IZ0A 4Y8VA 4ZQEA 3LLVA 3IDSA 4BO6A 5L7YA 1DIBA 3D4PA 4G65A 5U9CA 4UVIA 1KEUA 3CEAA 3VZRA 4YVFA 1O9BA 4FC6A 2D59A 3VZSA 3NGXA 5ES3A 1LI4A 2YW9A 1VPDA 4HNGA 1ZK0A 4ZN6A 1E0DA 4RQUA 4TKMA 5CDUA 1PX0A 2Y67A 3H9GA 2UVDA 2YUTA 1WWKA 3GGPA 4LSMA 4Q3CA 4QO7A 1QYVA 4Q3DA 4YJFB 3N7UA 3JSAA 4LVUA 4PZEA 4A03A 3ONEA 4EEZA 3GRPA 3ITDA 4N5NA 1B8VA 1WXDA 3JYNA 3TPCA 1UUFA 5FI3A 3RQSA 3DOOA 4ZQHA 2YQ5A 3RC7A 3TF5A 2X6TA 5JDIA 1HYHA 5JAZA 2IE0A 1R6DA 1GCOA 4E21A 4RF4A 4TRMA 1NWHA 3COSA 1BVUA 2DFVA 1QYCA 2DKNA 1ZJZA 1ISFA 1NVGA 1R0LA 1ZJYA 3TZKA 4CLDA 2GSDA 3L6EA 4HP8A 5JNLA 1XGKA 5FF9A 4F6CA 2EKPA 4XR9A 5G0VA 5EQFA 3LQFA 2GLXA 4HWKA 4LN1A 3FPCA 4J4HA 4MVJI 4P38A 1WW8A 1E3EA 1PGJA 3U49A 2J3IA 3K8ZA 3KXDA 3ETEA 1B2LA 1G1AA 3IAHA 3F5QA 4CMIA 1NHGA 4IJKA 4IMRA 1ZK2A 3IUPA 3UN1A 5L95A 1M6HA 3IKTA 3CIFA 3FRJA 3HWRA 3E5MA 3KUXA 5TX7A 1VJ0A 3TJRA 3WDSA 2RHCA 3FHLA 1IB6A 2P9EA 2D4AA 5FEUA 1SO8A 3GNTA 2G0TA 1P0FA 2ZTVA 3H6KA 2WD7B 2DTXA 2X8LA 3DBVO 1ISJA 2W2KB 3O38A 4TVOA 1VRWA 3QHAA 3TWOA 3FWZA 2OOSA 1I10A 5IXSA 3ZV5A 2YV1A 4AVYA 2E48A 2JFFA 2RH8A 3DFUA 4LISA 4F3YA 1IPFA 4CMHA 1MGOA 4W6ZA 3KYDB 5L7WA 2CVQA 2X86A 3GNSA 3PP8A 4Q3EA 1YE3A 3PHHA 4E6PA 4XD2A 5JO9A 2VHXA 3U5TA 3H9JA 3EW7A 1EUDA 4GX0A 3I4FA 4CMCA 8LDHA 2BHLA 3MZ0A 2O2YA 3AU9A 3PYLA 3GC6A 3H5NA 3PYMA 5FI5A 4BKQA 1HDXA 3H3JA 1UXGA 1BXGB 1UDBA 4INAA 2DPHA 3FWNA 4I5GA 3GDOA 4Y6SA 1T1RA 3RSHA 3DHYA 3EMKA 4NFHA 2J8ZA 1WMAA 3HN2A 1HZZA 1EQ2A 5EPOA 1HF3A 3CZRA 3L77A 4O1MA 1HLDA 5JY1A 5I9MA 4QX6A 1SEPA 2O23A 3Q1LA 4RORA 4I9HA 1F12A 3MWEB 4ROSA 5DDIP 4J6FA 2X5KO 3ADPA 4FFOA 3L9WA 4L4XA 2GR9A 1PQPA 2G17A 4IDCA 2X58A 4BMSA 4ZD6A 4CMAA 3FR7A 3V2GA 3R3JA 4H3VA 3VKVA 4WKGA 3JQ7A 1NFFA 3NTRA 5DCUA 1UAGA 3VH1A 4J16A 3QJ5A 4MVJH 4R3WA 3WTCA 4A5OA 1K3TA 5BQFA 1VC2A 3IIEA 4XA8A 3W8DA 4CMKA 3D3WA 3H5AA 2ILTA 1PQWA 4DC1A 3TZHA 1I3KA 1DC6A 3MJ4A 4QXMA 4CR6A 4F6LA 1ONNA 1JN0A 4R1NA 2HK8A 3PFWO 4FGWA 4J1SA 4CODB 1O95A 3EHEA 2E4AA 2Y05A 4AJIA 2ZTMA 2X22A 3AM5A 1H6DA 5G4KB 4B79A 3TOZA 3NAQA 3ZCXA 5DBGA 3SVTA 5JAIA 1EVZA 3OETA 4NHEA 3E82A 5A5FA 1ZH8A 5K9ZA 3NDIA 1ADGA 5JMPA 2NTNA 3ZZNA 4ONEA 5G0TA 2B37A 1PR3A 1E3WB 3GVCA 1FMCA 3G3EA 4ID9A 4YDRA 3GHHA 3WGIA 3JYLA 4HFRA 3QRWA 1E7MA 4R1SA 4WOKA 2ZK7A 4NH4A 1EE2A 2I6TA 1F06A 5TS3A 1QXSA 4BNLA 4L74A 1LUAA 1SC6A 5BSEA 3VVBA 1C0PA 4OM8A 5F5LA 2QG4A 4CQMA 5EINA 4R01A 1PZGA 1PL7A 1RM3A 3H65A 1D7OA 5ADHA 2AQHA 4Z3KA 4WLVA 2Q46A 1MFZA 1PJCA 1XQ1A 5JPIA 1S6YA 3VH2A 1F8GA 4EYEA 3B6ZA 4PN3A 5K0ZA 3R6DA 3WYBA 3L4BA 2WMDA 4IIUA 3D5TA 5JW6A 1ZSYA 3RC1A 1UXKA 1NFQA 4RVUA 1K6JA 4XZ3A 4R41A 4CMJA 4FFLA 4R5MA 2OXIA 4YT2A 4BNFA 4ZGWA 5H83A 3PFFA 3DONA 3ZWOA 2VRCD 1UZLA 3GZNA 5I7VA 4IJUA 4CR8A 3A28A 5KKAA 2A4KA 3WGHA 4NG5A 3BMOA 3MCVA 3MJSA 2VCYA 1HDZA 1DJNA 2PNFA 3EVTA 2HLPA 5U4QA 2B5WA 4AJ4A 4IJWA 4B8ZA 1A4UA 4P4GA 4IY1A 3FBTA 3GN2A 2CY0A 2DM6A 4P22A 4YCAA 1PWXA 4PRLA 4WASA 4FJ0A 3FSRA 4GSKA 4JK3A 5CFZA 1PGNA 3OSUA 3R0IA 5GY7A 1IOLA 1E7WA 1ZNQO 4QO8A 3WMWA 4CM6A 1P44A 1Z7BA 4N18A 1CF2O 3LT2A 3N74A 1CRWG 5IG2A 4RPHA 3QWAA 1A72A 2ZB3A 3OQ6A 1Q0HA 1T1SA 3ZNQA 1WPQA 5K6AA 3INGA 3RIHA 5B4TA 1P33A 3B1JA 3FTPA 1DRWA 4URFA 3RU7A 1GD1O 4MO2A 2ZB4A 5JLAA 1G0NA 3S1LA 3RROA 2G5CA 2GGSA 1PL8A 1R0KA 4EUHA 3TFQA 1LBEA 4HY3A 3VC7A 1LXCA 2WYUA 4CM8B 4RLHA 3PHLA 2Y93A 3KSZO 1YOVA 3QVTA 4YJDA 1V6AA 2PZMA 2JD1A 2W8ZA 1RKXA 3WOHA 3QE3A 3ZN2A 2Z1MA 4OSPA 4NBWA 5I8ZA 4TZKA 4E5NA 5L51A 5U1PA 1OFGA 1PEDA 4DPMA 3EVNA 4J91A 3NT5A 4OMUA 2FR0A 2HUNA 4NBVA 3INTA 5B12A 1FDSA 1EK5A 3KM0A 4Y98A 4YT8A 5KTKA 3C24A 3BXXA 1N7GA 3GF4A 1XU7A 2D3TA 1Q0LA 3HADA 4XGIA 2JD0A 3ZU5A 5F5NA 1UDCA 1E1KA 1YL7A 4ALMA 2G1UA 3H2ZA 2J3KA 1LU9A 3KLMX 4S1VA 2O3TA 3MEQA 1DRUA 5GMOA 4EGFA 2PWZA 1I01A 1Y6JA 3NKLA 4NMHA 3U4CA 4DQUA 3HB5X 2NU9A 3WFIA 4M89A 4XQGA 1HDCA 2EGGA 4LCJA 3UAGA 4HFMA 5A04A 2YFQA 1DIHA 3U0BA 1PGOA 2Q2QA 2P9CA 3VTZA 5F1PA 3MOGA 2Q99A 4J90A 2YHIB 4ALLA 3VDQA 4AL4A 3I9LA 4BGEA 2J5RA 5HM8A 3DZIA 3OP4A 3S2IA 4E2YA 2A94A 4UVDA 2AQKA 3R1IA 4CLRA 4DBZA 4QEDA 3ZHXA 5L9AA 4FIZA 4LRSB 5KJFA 2C54A 4YRBA 3GLQA 3MJCA 4RF2A 4I5EA 3WJ7A 2IZZA 3CSDA 4BQRA 1KY5A 1Z7EA 3WG9A 1ZUD1 3PK0A 3ZU3A 4IXWA 1YQDA 2C07A 5JBIA 3VPHA 4CLOB 3F1LA 3OFSA 2AW5A 4IDEA 2H6EA 4A2CA 2PA3A 1QR6A 4W9NA 4ZQGA 4DUPA 1DIGA 2I99A 3I1JA 3NX4A 1T25A 3JV7A 2GF2A 3W8EA 2PGDA 5IDXA 3G49A 1PTJA 2CVZA 5IZCC 3ZWWA 5ENVA 1PS9A 3GR6A 3QVSA 5IXYA 1MX3A 5L4SA 2IEBA 1SB9A 3WYEA 4GQAA 3QW2A 3NYWA 4DYDA 1PJ4A 1C3VA 4KP7A 1NFRA 3IJPA 3A1NA 1DPGA 3UCXA 3NT2A 4PZDA 1F0YA 4BO3A 2O3QA 1OI7A 3M1LA 2P9GA 1TT5B 4OKIA 4TRNA 4CM1A 4I08A 1UP6A 4JGBA 1BXKA 4OOFA 4BB6A 4YPOA 1U1IA 2OZPA 1HXHA 2X9NA 3KOUA 4BIIA 2W98A 4PLZA 1X1TA 1U8FO 1LDGA 4JX8A 5A3VA 3FNEA 3WB9A 3A14A 3TFOA 1W73A 3P5SA 2X0IA 4QSMA 3HE3A 5CEFA 3V1UA 1BG6A 2HU2A 4PLGA 4PLFA 3D1LA 5GZ6A 3ZWNA 3WGTA 2NV6A 4PG5A 3RFXA 3RUIA 3I9JA 5JC1A 3FN4A 1ZXLA 4OOEA 1D4FA 2GNAA 4HNHA 1CJCA 3RKRA 1A71A 3P7MA 3TSCA 1T24A 1KYQA 2BELA 3VAZA 2VUTA 4TVBA 1ZZEA 4WECA 4IQ8A 4EDFA 2ZB7A 4B7CA 1ZEMA 1GQ2A 4P4NA 1JTVA 5EJ2A 1PGPA 4Q3BA 3BMCA 5G0WA 2DFDA 1B3RA 3PGJA 4XYLA 4HUJA 1UXIA 1KIFA 2Q1SA 2VRCA 3KO8A 1Y8RA 2DLDA 4NZ9A 3S2FA 3AM4A 3T4EA 1A9YA 4CQMB 1DC4A 4XRRA 3GFBA 1KVTA 3Q2IA 4M8SA 4YA6A 4MOWA 2DBRA 3FBGA 5CDYA 3M1AA 2EW2A 3O9ZA 4MVJM 1HWYA 4XB2A 2NU6A 3JQAA 4K1LA 1NVMB 2JL1A 3UF0A 1UXHA 3ONFA 4NQZA 3IL2A 4OXKA 2SCUA 3M2TA 1LA2A 1IL0A 3I9OA 5CAEA 1NTOA 2PH5A 1E5LA 4JP2A 3BTSA 1RYEA 2ZKLA 4KOAA 3KLPX 4BNUA 1IPEA 1Y1PA 4PLYA 1LRJA 3VPFA 1RM0A 3K9QO 4YJHB 1KOLA 3W6UA 2IXBA 2YDYA 1LDYA 3L0DA 3VDRA 3JQDA 1P1IA 1YB5A 1YS4A 3DBHA 3L07A 4B4OA 5TIIA 4J1TA 5EN4A 4E5KA 4O59O 3E6AA 3ICCA 1E6UA 3H9QA 4OXNA 1TXGA 2EHDA 2B5VA 4CV2A 4YQZA 2GPTA 4D45A 3SJ7A 1X7DA 4IDFA 4B4VA 4U0JA 2JCXA 1JKJA 3GZ4A 4GPD1 3AUUA 3RASA 2NVUA 2QZZA 3PJFA 4FPXA 5A9TA 3ZU2A 2DBVO 2GYYA 1TVEA 1NPTO 3I9NA 2D8AA 1WVGA 2EWMA 1MG0A 1GYRA 4DVJA 3WIDA 1K2WA 1PZFA 2PD4A 4GLOA 4R1TA 2VOEA 5L45A 1GQYA 1P3DA 5JE8A 4BVAA 2GZ2A 3OMLA 2HK7A 1U2DA 3G1TA 5F1KA 1EFKA 2POQX 5B37A 1JDJA 3JYOA 4ZU3A 1Q0QA 1YJQA 4HXYA 5KOIA 5DOZA 3QLJA 4E33A 3GMSA 1ML3A 2HO5A 1GUYA 2Y68A 2AG8A 2OORA 2JKVA 3GN1A 4D3SA 1NP3A 1HDGO 1RM4A 1QV6A 1BW9B 1LQTA 3AU8A 1Y5MA 3D4NA 5BSGA 2RH4A 4ALJA 5KVCA 1HT0A 5AXDA 3DMTA 2JCVA 4J4TA 3RJ9A 1P1FA 4BO5A 3S2EA 1ADFA 1ENOA 5F3RA 2O48X 3H9UA 2E49A 2G76A 4FDAA 4OH1A 4DIBA 5ICMA 5L53A 2JAPA 2EGHA 5DP1A 1Y8QB 4RDIA 2XAAA 4JBIA 2Z1NA 1ZBQA 3BZUA 4NI5A 1P1KA 5TNXA 1A7KA 2Q1WA 4LSWA 2AQ8A 1UH5A 2LDBA 3KYCB 3BMQA 1H5QA 1QRRA 4PLVA 2X9VA 3DO5A 3I23A 2P5UA 3F46A 1RYDA 4Q39A 2EW8A 2Q4BA 4FJ2A 2BF7A 4N5MA 3JQFA 4NBRA 3EAGA 4RDHA 1H0KA 1LDMA 5EIOA 3UXYA 1JLLA 5JYEA 3C1OA 4I5DA 4NK5A 3DXFA 4D44A 1PS0A 4JBHA 2AE1A 4BO4A 5K6AC 1V3TA 3ZH2A 3VOSA 4K6CA 9LDBA 2Y66A 3CZMA 2VTEA 2O3SA 4J2HA 2FPIA 3HFGA 1H94A 1P1JA 3RBVA 3CPSA 4QT0A 1E3WA 2CSUA 2VWHA 3EK2A 4OIMA 4TSKA 1NQ5A 4WCFB 4RL6A 4NU5A 2C7VA 2Y1CA 3AM3A 3KHUA 1TLTA 2CDBA 4WE3A 1X13A 4OL9A 4MPDA 2IYPA 3OM9A 3ZU4A 1F14A 3NJ8A 4M55A 2BFPA 5IJZA 4UVEA 5F1OA 3OQBA 4EW6A 4RCVA 1VL0A 2EV9A 1BWSA 4BKUA 3VTFA 3JCZA 4YR9A 3M2PA 4HBGA 1EFLA 5IZ4A 2O4CA 3WICA 4BO9A 4E3ZA 3UICA 1YXMA 1FDTA 1NQOA 5LCXA 4LK3A 4E5YA 1LSSA 3ANLA 2H5LA 3T4XA 3AFNA 3OIGA 3OA2A 4JQCA 2FPGA 4HV4A 2YDXA 1OOEA 1R4MA 4NDNE 1UR5A 3S55A 2C20A 4PG7A 1JKIA 1X7GA 3GEGA 1AE1A 5DCYA 4LRTB 3HN7A 4BNXA 3AJRA 4WJZA 1VSVA 4R9RA 3F5SA 3HZZA 4C4OA 3DBLA 2IEDA 2QRKA 3I3OA 4DTIA 5L40A 1CQJA 3RFVA 4JCOA 2CZCA 1ARZA 3GNQA 4WEQA 2HMUA 3C85A 3BMCB 4KWHA 3HNPA 5BSFA 3NV9A 1ZMOA 4EUFA 2G82A 1OAAA 1BMDA 4GMFA 1J5PA 3MOIA 1I8TA 3O8QA 1E6WA 4RVDA 2CDAA 4ZJUA 1HYGA 4BMVA 3KBOA 3KYDA 1V3UA 5LDGA 4PLCA 2IXAA 4DLAA 1PR9A 3D0OA 3ZW8A 3SX2A 2Q2WA 5TGDA 3DZFA 2BMAA 5BT9A 4DWVA 3ROMA 3N58A 2Y0EA 4G81A 3ROQA 4TKLA 4L4SA 1LEHA 2PGLA 2BGKA 3DR3A 3T7EA 1W4ZA 5CP8A 4IS3A 3LSYA 3UHAA 4DQVA 2ZB8A 4L76A 5T8KA 3WYCA 2GASA 2DTDA 3E9QA 3ST7A 2Q1TA 1GADO 3AI1A 4RVFA 3UOGA 5DP2A 3ZWMA 1SZJG 3NUGA 2VUSA 2Y1FA 1H6BA 1DIRA 4Y6RA 1IY8A 1GFSA 2BGLA 3KRTA 4UUMA 2TMGA 3STHA 1DBVO 1DHRA 2DBQA 3BHMA 3WBBA 5A1TA 5EERA 4EI2A 1KC1A 1ZK4A 3DMYA 4AJOA 4AJKA 1DC3A 4BNIA 1Y5RA 3G79A 1DHTA 3O26A 1DEHA 4E5MA 1EBFA 3PZRA 5DZSA 3PHJA 2QX7A 3V1YA 4A26A 4UVGA 3CXRA 4CL3A 1QMGA 3FCOA 1MC4A 1XDWA 2NM0A 4NIMA 3WSVA 2ET6A 3W6ZA 4ALNA 1GCUA 4CPDA 4ZICA 4EEXA 2WYWA 3F9IA 1PZHA 2X7HA 4GX1A 1NPYA 1U3VA 4UVHA 2Y0CA 2X23A 5BR7A 4IDDA 4M54A 1VL6A 1HLPA 4EUEA 3RU9A 3DAPA 4OO3A 1C1XA 1BHSA 4L0QA 3ZI0A 1GEGA 1VJTA 4CM9A 3OJOA 3P2YA 1U28A 3OBBA 4J2OA 3INRA 1DFHA 1E7QA 3ORFA 1E7SA 4QFCA 1GYPA 1LRLA 2ZATA 4BNNA 3U4HA 1VSUA 3DC2A 4E32A 3I5MA 4JJIA 1H6AA 1P31A 5AXCA 2J5KA 5THQA 3FTNA 2Q2VA 3U3XA 4MP6A 4CMIB 2TMDA 4KQXA 4ZRNA 1LQUA 3WQQA 4RPJA 1OZAA 3E48A 2PZJA 2UV8A 3GPDG 3RFTA 4BNZA 4CLOA 4XYMA 4M86A 3U09A 1K6XA 3RJ5A 1ZK3A 4AJPA 1NHWA 1DIAA 1U3TA 2JFGA 5H81A 3Q9NA 4AJHA 5CDGA 1YQXA 2W90A 1W6UA 2XOXA 1ENPA 2HK9A 4W7IA 5L3ZA 2BGMA 4YJFA 4KWIA 1QLJA 2E6UX 3SC4A 3EZYA 3JD0A 2H9IA 3KSUA 3W8FA 4RF5A 3LF1A 3RUCA 4YAGA 5JYDA 3VH3A 5IN4A 3KTDA 4ZQBA 3CH6A 4FCCA 3ONDA 4QUKA 3RUHA 1DRVA 4PVCA 4J1QA 4DQXA 4FFNA 1P1HA 5FFFA 3VZQA 5KVSA 2PR2A 5FWNA 3K73O 2FSVA 4RVSA 5A9RA 1H6CA 2JFHA 2WM3A 4K26A 2BI8A 1EDZA 2GRAA 2R00A 1HZJA 3DZGA 1JW9B 2AQIA 4WLOA 3BMNB 1LLDA 5A4DA 4NJMA 4J4BA 2HCTA 1XA0A 3IUSA 4J3FA 4XX0A 5IZCA 3BMOB 1IZ9A 4OJNA 1Q1NA 1NPDA 4UEKA 1NASA 2GO1A 3DL2A 4BV8A 5ER6A 3WFJA 3PXXA 3A9WA 4I1IA 1NQTA 4RO0A 1LSOA 2BI7A 5DNAA 3VPXA 4FFRA 2OL4A 2DUUA 4YJGA 1HDRA 2B4RO 4CL8A 4H7PA 4BL5A 5AQ1A 2JHFA 1MXFA 1NNUA 1DO8A 4CM5A 2NSDA 3GUYA 3DZKA 4R69A 2BLLA 2VHZA 1XG5A 1YQGA 4LGVA 4YT5A 1PJTA 1I3NA 4MKZA 3D5QA 5HTOA 2BKAA 3WLFA 1MLDA 3PJEA 1NX6A 4J7XA 4Z3DA 4J43A 4Z0PA 4NFYA 2JAHA 4DL9A 4WOJA 2BFOA 1UJMA 1K89A 1UDAA 4NFSA 4LMPA 4BHTA 4BV9A 1YB4A 4R51A 5TC4A 2BFAA 4B3JA 4I8XA 2I67A 3DEYX 1X7HA 2X9GA 4CM8A 1GU7A 5DT9A 4D79A 4FC7A 4NPCA 1JAXA 5IDQA 2Q1UA 2HSDA 1N1GA 1I2ZA 3DDNA 4CM4B 5HBRA 1VKNA 3ENNA 1YKFA 4Z0TA 1QP8A 3A06A 2FZWA 2ZYDA 1GUFA 3B20A 3BIOA 4D3FA 3I9MA 3TZQA 1D3AA 3KV3O 4IUYA 2EIHA 1WZEA 1DAOA 3JTMA 1YWGO 4HX5A 4B7XA 3WBFA 4OAQA 1AXEA 2HMWA 1VJ1A 4AJEA 4Z9FA 5DCWA 5DN9A 1SNYA 1Z6ZA 1ADBA 4XKJA 4DGSA 3RBZA 3B1KA 4N7RA 5TT0A 4UAGA 3ZWCA 1LLCA 2AE2A 4LW8A 4YB8A 4XR4A 3AUAA 1A27A 4IINA 5KJCA 3GVHA 4D0RA 1G0OA 1AGNA 3DBRB 2C0CA 4A73A 4AJ1A 4Z6KA 3QP9A 4CV0A 4IM7A 3WIEA 3MJVA 4D46A 4PG8A 3G17A 3QSGA 5I7EA 1GPDG 1XSEA 1BXGA 1Y7TA 3F1KA 2EJWA 2WE7A 4ND5A 2Y1GA 1D1SA 4GX5A 3WSWA 3H3FA 3Q3CA 1GTMA 2R2GA 4WUVA 4XWYA 4XQ9A 3WXBA 1KBZA 2PD3A 3I9KA 2HMSA 3TOXA 1CDOA 2NLOA 3FD8A 3C3XA 3JQ9C 4AG3A 2Z5LA 3V2UA 4BUCA 5KWEA 2NQTA 2QHXA 2V6MA 1B14A 3PQFA 3SC6A 2CD9A 5A03A 2GN9A 1ZK1A 3GA0A 1R16A 3GOHA 4B4WA 2WD7A 4CM9D 4RPKA 4CLHA 4MKXA 4CQLB 2FPPA 1HKUA 3F4BA 3B70A 3I6IA 2VZ8A 3ZWPA 4ESOA 2PV7A 4W4TA 1M75A 3QWFA 4FOSA 1MG5A 4NNJA 1ISIA 1I5RA 4CR7A 4GGOA 1H93A 4BO7A 5DF1A 3AUSA 2IYOA 6LDHA 4BQPA 2HKIA 3GAFA 5DULA 1LLUA 1JAYA 3TDKA 1M66A 1SB8A 4K28A 3K92A 1QSGA 3PYXA 2WEKA 3ZNPA 3PJGA 2CNBA 5B4UA 3JQAB 2WD8A 3EGOA 3ABIA 4WCFC 4KTTE 4J9UE 3SLKA 2YY7A 4KUEA 3JD1A 3H5RA 4PG4A 4H16A 1ISGA 5EQDA 2ZQYA 4FJ1A 2YYYA 5JMWA 5ER9A 4KUGA 3D64A 1AUPA 2OHXA 1IHYA 2RIRA 5LC1A 3RC2A 4C7JA 4L9RA 2VUUA 3WS7A 3KETA 4W82A 2WWRA 1C0IA
chains in the Genus database with same CATH superfamily
5JT1A 1PQYA 2ISQA 4GP9A 2DQZA 3FGNA 1YZKA 1GRRA 4B71A 3EIFA 3UAWA 2PWBA 5AK0A 3ZDXB 4F4JA 5HOEA 5COBA 3GBPA 4PEVA 2ZYTX 1Z0SA 1AS2A 4DA9A 3EH2A 5IDQA 3PXEA 1QHXA 4R3NA 2OXCA 1WUKS 5C5DA 3E3MA 1W4RA 2B0CA 2PFGA 4Z4FA 1LDNA 4W6QA 1HOTA 4DYVA 3BTVA 3QIAA 3RYHB 2W6PA 3A58B 4C0LA 1MAVA 4UZSA 5E2BA 4FHEA 3H5OA 4DM3A 4UTVA 1C4XA 2RI6A 1M1NA 3PFGA 5AW8A 1Z2EA 4FZ3A 4ZYWA 2R8YA 2GEDA 3OZTA 4DMFA 1X9HA 3OJEA 2XB2A 4X92A 3W5CA 3MD9A 4B47A 3RD5A 3MAAC 1DSSG 2CMDA 3ESYA 4L1KA 4XWTA 4MI3A 4DJ5X 5JCJD 4GM0A 1KI4A 3B1FA 1WOMA 2FZGA 2RGYA 3DUWA 4QU5A 3OEWA 3AEQB 4KUHA 4IG4A 3U61B 4Q3AA 1AA6A 3DE4X 1V11B 4GL4A 4WNYA 3SXPA 2X1HA 2ZJ7A 3OPNA 5MGNA 3GK3A 3IA7A 2GWHA 3DKIA 3PIDA 4HO1X 5GV7A 1CNFA 3HBLA 5ALTA 4PCLA 5LDHA 3R5TA 2Z2ZA 3T3HA 1F2DA 1ZVMA 3M81A 5HE9A 2IVFA 1F2UB 2XXBA 2XVXA 4BVJA 2OD9A 4M87A 4XJXA 1AKQA 2QJTA 1RLIA 3BMNA 2I91A 4J0KA 4RKYA 1U7HA 1B0PA 1MFPA 2IHYA 4RVGA 1HNNA 3RC9A 5K8JB 1BHJA 3WNVA 2CC2A 3I34X 1ZWKA 4DDHA 1OV4A 1RHUA 2W2KA 3MMXA 2QQEA 3W3AD 3G9UA 1E2LA 1DKOA 4LYDA 2OQVA 5JU6A 1BHQ1 2DUWA 2QZ9A 4JP5A 3GFTA 1JA9A 3RVPA 2BW0A 1A7UA 5TEVA 4AUEA 3HJNA 1QFSA 2WKPA 2DT5A 4ZEOA 2DU8A 5ERXA 3WISA 1QB7A 1RJDA 1ICIA 1M72A 3H2SA 5DTRA 1FFXB 4CCYB 1ISSA 3DZJA 4AKEA 3ZDEA 1PVOA 1H42A 2FWPA 1C5KA 2RHOA 3H17A 3OY2A 4C21A 3FCSB 1YL5A 4OAPA 3BA1A 3ZHUA 4I9GA 4EFNA 4RZ2A 1JSZA 1YVEI 2R7MA 3EDCA 3DHEA 1R64A 4OXIA 2GM5A 3LVQE 2VF5X 2YMMA 3E1KA 4UU0A 3TS1A 1QIFA 2KPOA 3SAJA 3Q87B 3LO8A 3IE0A 3IHTA 1P75A 3N5CA 3RCBA 4BFTA 4EABA 1JA0A 3AVUA 3FYCA 3ICPA 4TZTA 3KEGA 1SIUA 1VB3A 2GBIA 2HPVA 4UAJA 4IDBA 2FF7A 3ML1A 1DOAA 2WSIA 2ZRFA 4YRRA 3WV4A 2HA4A 2VTDA 1EXWA 1Q74A 1BU8A 4X8HA 4CUJA 2J4FA 1QCDA 1GTJ1 1OYYA 2LWIA 2O2CA 4UHEA 3W1EA 5KYYB 3K4HA 3QZUA 4KDFA 1UQRA 1TKRA 4H1VA 4MP3A 1PLLA 4DHEA 4DS3A 1QYWA 1UZNA 4QQNA 2GXAA 2CMKA 3DF9A 2YWDA 1XRRA 1DJOA 1LDEA 2Q3EA 3K16A 2V3VA 3QEMA 1RLUA 1ZOOA 1KERA 2OXFA 1SXIA 3CLUC 1Q3TA 3R75A 1ZAYA 5CK5A 4XUCA 2AGVA 4EITA 2CN1A 4PGFA 3SC2A 4MX8A 3RJZA 3DUFB 2WT4A 1T29A 2JJ1A 4TN5A 5BPHA 2WOOA 3C43A 2P2LA 2JLUA 1HE8B 1IZ8A 3OP1A 3U7FB 2AR7A 2XADA 3PEYA 1LY1A 3KELA 4P53A 1ULHA 2QTCA 1N6LA 5ALKA 5I7FA 1SVSA 5TQJA 5A06A 3LP8A 2J67A 4Q4AA 4DHWA 1E77A 3BCSA 4M7OA 4MZDA 3GJXC 1RWKA 2PBLA 1AKWA 4GH5A 1G63A 4ARZB 1ZIXA 2HRBA 1PYGA 1A4IA 1R4ZA 3DA8A 2CHUA 3OEHD 3R3YA 3HY3A 3RSOA 4Q0MA 4PC6A 1VP9A 2YY5A 5JECA 1O0BA 1W94A 4Y2TA 1E1NA 2ZJ5A 4PZCA 1YSCA 4AKSA 3EZ9A 1A9OA 5E4FA 3GLGE 3HUEA 1O8CA 2O8DB 4H7KA 5GJWC 2DHCA 4HG2A 5U4XA 5KNCH 3R5XA 1RW4A 1YRLA 4FR2A 1KQOA 2PY6A 2D2IA 3BWDD 4CYMA 1ZW1A 2F1KA 1J2UA 3AYZB 4R6WA 1VKOA 1DAHA 1PWZA 1JDVA 2W6ZA 3JQGA 4B09A 1RAAA 4DCVA 3RANA 3PNVA 3LT1A 3PLRA 2AZTA 5L3ZA 1XC7A 1M0SA 3N2KA 4LV6A 2H5JA 4MUFA 2PVCA 2H2AA 3EW9A 3OJXA 1G2QA 4JBNA 4ZALA 3DAGA 1NSTA 1L1FA 3E58A 4LY9A 1B16A 1R6BX 3LT0A 1V48A 3ZHYA 4EHJA 2XBMA 2X0JA 1EQUA 4JL5A 3HJFA 1MPTA 2AUTA 2QVLA 1NW4A 3CZQA 3LFHA 2H51A 5K3DA 4K3VA 3ZWDA 4EB0A 3VUEA 2FLKA 2FSVC 1SBQA 1XF9A 4KAJA 1P73A 4IHQA 4TL7A 4DT1A 4S2EA 4BMXA 1CR4A 1CUBA 1U7DA 1IHOA 4D8XA 4N54A 3ANNA 2VTKA 4P2GA 3D3JA 2X0DA 4UNRA 4G01B 3G2NA 1XZQA 5BN4B 1U2SA 1YD7A 4C4RA 1RAEA 2O07A 1Y6ZA 3AMVA 4OAOA 4PQRA 2P4QA 1KEPA 4H4EA 1WCYA 3WLOA 4QATA 2BZ1A 3T9CA 2RHRA 3LAWA 3SKXA 2C4NA 1R27A 4RGVA 3I04A 1R6AA 2VYVD 3AH8A 3RC8A 3FNHA 3K2BA 4D4KA 2DHEA 3WL6A 1ECJA 3KJEA 4QYMA 1EHYA 4CFSA 1E9VA 2J6HA 1CE8A 1ID1A 3F96A 4HQLA 1RDFA 3IEXA 1RJWA 3T54A 4FK8A 1E9RA 3M0EA 3NHJA 1CETA 1UBMS 3E18A 3M6IA 4Q7EA 1JQAA 1ZU5A 4G63A 5ALXA 3B6KA 3IAS1 2FLWA 4IUDS 4UUPA 2BF4A 4KIFA 1FYEA 1PTJC 3L4EA 1JR3D 3JALB 3ICVA 4D8TA 1FA9A 1ZD3A 1KI8A 2YNMD 1T2CA 4Y7CA 3NOVA 2QR2A 1NF9A 2X0RA 2EC5A 2DQSA 4KGXA 2FZCA 1YR7A 2NAPA 4UUBA 3EFHA 2V7GA 3ILXA 3KXIA 5JJBA 1T9BA 2G71A 4BLRA 1VIVA 4O4LF 4RTJA 5CGQB 1Q0TA 4MDFA 2AEMA 4CG1A 1SR8A 3OWHA 3KWFA 1K63A 2XTAA 1VCOA 2BL4A 2CFSA 4EWLA 1MF7A 4H35A 3OLZA 3BIFA 1AN9A 1XEXB 2YYAA 2XCSB 1KPHA 3PRHA 3WNDA 4C08A 1BEUB 4P7KA 2OBMA 3VHRA 3LPCA 1XTIA 2YYSA 1XK6A 2BFMA 4JA2A 4V0ME 4EKYA 4UQPA 4LVCA 1UJBA 1NXXA 5D01A 3ZE7A 2A84A 4R2IA 4YCNA 4X65B 1LC0A 1JF8A 2R6DA 5CBKA 1SOVA 1DQSA 2DJIA 3PDIA 4AW9A 4CM7A 4PHGA 1TMGE 1H4SA 3N0WA 1HLFA 2C7GA 4QFDA 4KPGA 1EA5A 4FGSA 4MR9B 3RTAA 4L28A 4DG8A 4EQZA 3C1UA 3IT0A 1LQ2A 4XCXA 4OYLA 4GSLA 4F46A 2ZP1A 3SHTA 1DUVG 1VKRA 2G40A 2P2CA 1P2DA 4R1UA 5LP1A 4E07A 4CQMD 1UBGA 3N9IA 3H7IA 4H2DA 4WLUA 3IUQA 4MWZA 3H9EO 1IRIA 1CJTC 2C2GA 3DAHA 2WF5A 3NWJA 1KZGB 4KO8A 2NVBA 3QLVA 2BGUA 4UTNA 2OM2A 3FPLA 3W2GA 4C2UA 1IXZA 4XD7A 3EE6A 3BE6A 3VYUB 3V55A 4OJKA 3WVNA 3T1OA 4MV7A 1G38A 5EIWA 1NW5A 2IYRA 2Z57A 4MGKR 1JH8A 3I2HA 4EHAA 2WW8A 4NPAA 3GLHA 3F8TA 2BHSA 3SX0A 1V43A 3ZWAA 5A1JA 5KQMA 3LT4A 3THXB 3CRVA 1O4WA 2B4QA 2FMXA 3GARA 3ETHA 4QQFA 4S0XA 4JLUA 5AI4A 3IDFA 5DISB 5HFNA 5AW1A 1T2VA 2XBUA 1G4HA 5FADA 2PUHA 4W5WA 4FN4A 1CRQA 1UIMA 2WWIA 4BLPA 1MX1A 4EQ6B 5CFMA 1GZHB 1HDYA 2G9NA 1C3XA 2HQOA 2EERA 4U9IS 1MDBA 2BM8A 1LBHA 5F52A 3T9EA 4DCCA 4DEVA 1IBMB 5EE0A 5T8KC 3ILYA 2D62A 4Y6PA 2XDQA 1X7YB 2AFIA 4FMPA 2JLCA 5ENDA 1EVYA 3J81A 2C99A 1P45A 4NZOA 1EM8B 2C5GA 1KHTA 1XHFA 3IAS6 1GITA 2I1VB 3LC2O 4G5HA 4LPSA 3PHCA 2X5JO 2F4VB 1RI1A 2Y99A 5DI9A 3Q11A 4YCBA 3TR6A 4OK5A 3DVQX 3TQIA 2P3LA 2ZRJA 3HVRA 1OTXA 2WNHA 1YT5A 3EGDB 4FS3A 1XRJA 1EI9A 2XPCA 4MKHA 4EHHA 5B30A 2JJ8A 1CZLA 3OQJA 4HF7A 4OI0A 3K5IA 3ER8A 4FKMA 2C5AA 4G4GA 5K8VA 4LDJA 3QKTA 4KPUA 4ZPXA 4W7HA 1FNBA 2JCBA 1C1DA 3A4VA 5A7FA 1BX1A 1RYYA 1EVLA 1M2WA 2XCUA 2Z3WA 4JBGA 4U2EA 4BV2A 3NUZA 2GTPA 5K0BA 2UXDB 9ABPA 1WW2A 4N3CA 1YCFA 4Y2PA 4DBVO 5JFOA 2C9DA 4JXZA 4GWLA 5HKKD 2ZBDA 5KTOA 1DADA 1ZRNA 1Q1ZA 5LOVB 4RQAA 3RS9A 3CRNA 5A6VA 5FV4A 4MDEA 3I28A 2YQ4A 1B6RA 1NOIA 1T8PA 1ZM3A 4C4ZA 1QG6A 3SFZA 4RMGA 3EF3A 2Y2VA 1O9HA 1S9DA 4ER5A 3UUGA 1K7EB 3N0VA 2ZRCA 4RESA 2B2NA 2GKGA 2J4CA 1NN1A 1QIHA 4TV9B 3TFWA 1WB9A 3WJAA 4RKQA 5JRDS 2SKDA 3GEDA 2VWPA 1ZUNA 1ODJA 2G0AA 5G40A 3C8DA 3BVPA 2WM9B 4N7BA 2HRRA 1YH3A 2C4UA 1CQIA 3D7MA 3K8YA 2ZZMA 3EFBA 4ITRC 1BDMA 5CB6A 2AZDA 3I2KA 3M6WA 1BEEA 1E2GA 2HWWA 1QORA 2G5GX 1YGYA 3EIOA 4R16A 4EJ6A 1A8SA 1QH8A 2VFAA 4Z54A 4B75A 1UFQA 3DC7A 1FMTA 1O6CA 2YFHA 3X2SA 1N7HA 1H2BA 4H1WA 2OWDA 3BIWA 4I50B 4XX1A 1VLLA 2QU7A 3EZLA 4MRRA 1J2YA 3HSSA 5TT1A 4G97A 1L7VC 3KEFA 4WRRA 3TLMA 2V97A 1OBCA 1KEVA 4KN9S 1JSXA 2Q3FA 4HQ6A 4PFJA 1LZLA 1JQDA 3NP9A 1A1SA 3O4FA 4RVCA 2AX3A 5EAIA 1AMUA 4N6OA 4P3NA 3K15A 1ZRSA 4M0EA 5ES4B 3G89A 3IKMB 4CI0B 2X8JB 1EWYA 4Q1EA 1XYGA 4HFNA 3G1WA 2RAFA 4D0SA 3ZGZA 5FO1A 4B3TB 3Q8MA 3CJTA 2J3EA 3IBCA 3UMFA 4XTRA 5KNLA 4YRAA 3IKVA 5CA0F 2PNJA 3AZOA 3GUCA 2NP7A 5AK3A 1Z5OA 4E0BA 4RD6A 4G8BA 3VYSB 3TBFA 1KP3A 1O2DA 2JLSA 4FW9A 4J0FA 1ACLA 4KZPA 4QU9A 4ZOBA 3T3DA 3EY4A 5CPBA 1FW6A 3R7BA 1G8AA 5A4MS 1ZI9A 1NYLA 2XF2A 3D3WB 2OYSA 4UFOA 2C2YA 3SQDA 2I3AA 3DNFA 3CRZA 3NEPX 4KIJA 2LD4A 4BNYA 3A2MA 4CKWB 1O94A 2FSUA 2FOIA 1G8HA 1H1TA 1TOAA 2VNSA 3GVPA 3P52A 4DOMA 1E7YA 2GZAA 1JU9A 4ND4A 2FFBA 4KMRA 1L4FA 2QZPA 3SFVA 3LV8A 4Q9NA 4Z7JA 5KOHB 1B8NA 5KMGA 1KGSA 2AR0A 4MV8A 3D0QA 1Y3FE 4GRDA 1O0SA 3AX6A 5JCXA 1ESMA 1SCUA 4C05A 3WRYC 1C50A 5JSFA 5C7OO 3MS4A 3W04A 1KYVA 3MWFA 5ITZB 2FW6A 2GJAA 2CJFA 5JLJA 1R15A 2G3YA 3ECCA 3L8HA 3U7QB 1EUZA 4F4HA 3L82B 2NP6A 4P7JA 3IIJA 4L8VA 4LJSA 1WCIB 2IZ1A 4KSBA 4U3JB 4ERXA 4X7BA 3W1VA 3BREA 1CC1S 1DBIA 1FFSA 2H3EA 1H8HD 1EM6A 3I42A 5D6OA 2FP4A 5FOSA 5CBPA 2B0JA 3DDHA 5T6MA 1EBUA 3GCWA 4CNBA 1T3GA 1F8XA 4KQ2A 2PUCA 3LK6A 1P7ZA 7YASA 3EZFA 4QZVA 4KE6A 4KE7A 2H2GA 2WSMA 4H31A 4QXPA 2BEVA 3FR8A 4NR0A 3M9WA 5AXAA 4Y9DA 2HDWA 2GPYA 3SHQA 3WXMA 2O8EA 1KRWA 2O3UA 2O9JA 4G1BA 3TSYA 2Q2NA 3JALA 5K6RA 2FPLA 1PJQA 3A31A 2YQZA 4L3VA 4AMUA 4PV7A 4GOOD 2B6NA 3K6KA 4GQBA 3OA0A 4TTRA 4AY5A 2E87A 2F3TA 2QVGA 3GGOA 4D2IA 5HSGA 1NT2A 1BCRB 1ZJJA 4IHAA 4D0GA 3IV6A 3VTKA 3ZGOA 1P4SA 4B3GA 2QTGA 1RM5A 3FB4A 3JQFC 4LDZA 4BQEA 1ZYUA 1E7RA 1N6NA 3CX8A 3AHDA 2X9LA 1ULZA 4YNBA 3U48A 2DHQA 2VF7A 5KYGA 3LUJA 3HDJA 4CGZA 1YZ3A 2NQ8A 3I4CA 4UU8A 1EK6A 4YRZA 2EBFX 4U7WA 5DU2A 1RPTA 3U1VA 3DJYA 2WSBA 4QTUB 3NHSA 3NV9A 4I1UA 2R4QA 3C3EA 4IYRA 1V4VA 5JIBA 3RAGA 5K0JA 3H2HA 2NUAB 3NC1C 1G5HA 1YVRA 3CY6A 3HDYA 3U4IA 2HCJB 1C8LA 3CUUA 2PYIA 1YA6A 2WFLA 2QL5A 4QFMA 1XDGA 3HDTA 1UAYA 4QASA 4JU9A 2BDTA 4KJXA 3R7DA 2WZDA 2QBYA 3OFVA 3KFLA 2VT3A 2QGNA 2R6AA 2QRPA 5LP6B 3BF8A 4QYIB 4GEKA 4L6AA 5DLDA 4NAVA 2JGLA 1CDZA 5CYOA 4AYWA 5JAMA 2WLTA 3SZUA 1W52X 4LQDA 2I80A 1G8MA 2HRZA 1B26A 2WIKA 1T4DA 1AQNA 2Q0HA 3HK2A 3MTJA 2W6OA 1H9AA 2F9MA 3G0DA 1YMVA 2O5CA 3KQKA 4X90A 4H77A 1WOYA 3C0KA 4KODA 3CLRD 3WLHA 3F4LA 3BB4A 3OQ1A 1W0CA 4O2BF 3K0FA 1R37A 4XQ0A 5EUBA 5TLSA 5EKUA 5IUKC 2JI8A 2NTJA 4NMLA 4EHIA 1KMNA 5AP9A 1E2FA 2W4IA 3B7PA 3MIZA 4X63A 4NEGA 2CUZA 3FFAA 1I30A 2H2HA 3NHKA 5FWXB 4NCIA 4OUDB 2XOEA 2H4YA 3IMEA 4WMLA 3AEXA 5G4LA 2NSHA 3GLKA 3CNLA 2CZQA 5IULC 2XSZA 3GEMA 2DQ4A 4YV7A 5CA0B 1EB8A 1Y3BE 2BH9A 4TGLA 2QP4A 1GN9A 1I3MA 1R4NA 1WXFA 2YHBA 1ZNYA 2O7QA 5DOVA 1WZIA 4F2WA 1Q95A 1XQXA 2OFWA 3ULKA 1KF0A 3DS8A 2WHRA 1X1DA 5JQGA 3Q4GA 1EM8A 2DECA 2AI3A 1UDXA 2AA3A 2I8LA 4FGJA 2KHZA 1G42A 4BAZA 2V45A 1L5KA 1HFEL 1XVUA 1JG4A 3P9YA 2J3JA 3JTEA 2JLYA 1ADYA 3UJ9A 1Z88A 4X1IB 5TDHA 1HORA 3VBEA 1Z0DA 4BNKA 5EMHA 4FYIA 1ZCJA 4YT4A 3TCNA 1PJ2A 2JK1A 1KH2A 1R3DA 5T67A 3KOYA 1CFZA 1LSUA 4ENPA 1RWVA 1IOVA 4FYVA 1I5OA 1JVBA 4OSOA 1I0IA 3FDJA 4J03A 1JHYA 2Q3CA 5IFLA 1ZH0A 2RJNA 4YIKA 1ZOSA 1KSFX 4X9XA 4H6XA 5ALUA 3E8XA 5LOVA 2R86A 2VLIA 2ONJA 1S7CA 1E1DA 1NJ5A 2HHLA 2WMNB 2GBFA 2ZJ8A 5E1BA 4EDHA 2G6TA 4LECA 1OFIA 3AKDA 3TNLA 1T2UA 4OHUA 3W4KA 3AFIA 4EJSB 1DAEA 3T3IA 1CR6A 4BVLA 3GAMA 3ZU6A 2GF9A 5L6LB 1J8FA 3INYA 4DMCA 2JLQA 3D6TB 5AOBA 1XKTA 2SBTA 1TM1E 4DLXA 4RZHA 4LC0A 1FJXA 2VCHA 2VBFA 1WMDA 1PSWA 2XNKA 3DSRA 1DS6A 2FPKA 1D9ZA 2QTVB 3DPUA 1D6NA 1E1MA 1MJHA 3S2UA 1P81A 4YJKA 1NW9B 1BGVA 3D1VA 5G2OA 5G4KA 1KI9A 5B1HA 5B3JA 3CLTC 3I52A 4JYCA 4KIWA 4LXIA 5JAQA 4DFDA 5KB3A 3IUNA 4G5XA 3RVOA 1GRCA 2ZRGA 1F0PA 1TFUA 2FUNB 1RQPA 4HEA6 3LBIA 5FL7A 2I4TA 2D0DA 5K3AA 3MTGA 4MW7A 3UGQA 5LPNA 3L7CA 4A82A 2DPYA 5K5EA 2WICA 4OLBA 5DSTA 1BW9A 3TCXB 4I6JA 3QLUC 5KIAA 4IDAA 5G0UA 3K09C 2D0PB 4S3MA 3VV3A 2H4JA 5JHHB 1VHDA 2GN6A 2YOFA 3MUFA 4Q1CA 5EHXA 1CLUA 1UBCA 4IDGA 1IONA 3IC5A 1Y3AA 1R10A 3D43A 4I9UA 4XEHA 2OQIA 4DREA 5KSOA 3L6UA 3P8ZA 2PMFA 1GGJA 4QT4A 3GYBA 3TINA 3BEOA 5F7XA 2KM1A 3WQSB 3AUTA 2YXLA 2NG1A 1GV0A 1IUNA 2ZUCA 2I8AA 1FDUA 2W2LA 1EFVB 1VHLA 4YRTA 4A10A 4AK9A 3KT8A 2IOYA 1G21B 4C14A 4QDTA 3AF1A 4GPAA 4IS2A 3STTA 3RRJA 3L6DA 1U0FA 1MR3F 1YBMA 1Z4PX 5JBQA 2ZSDA 4QYWA 3K6SA 4HAZA 2OV6A 2OHIA 2RG1A 4WCDA 1Z2AA 4FYXA 4F3CA 3GUVA 3HDHA 4HQRA 4MQMA 5H9WA 1SC1A 2XCRB 1DFGA 1X1BA 3CZ9A 3ZUGA 2OAQ1 1XTZA 1L7AA 4IQGA 2Q4EA 3ECAA 3T5PA 1JGTA 1OMOA 1ZM2A 2B36A 1T3ZA 3GA7A 4MIOA 4Q4HB 3ZHCA 1A7AA 3SZ3A 3LUFA 3PPWA 4DIOA 3BQMB 1ULBA 2DH6A 2PJZA 2H4XA 3A6ZA 3LUDA 4OQZA 5WRFA 1TA9A 1QH1B 3CYFA 2ZTSA 4ZQIA 4D97A 1UOQA 4AS3A 4OB8A 4OQ4A 2G77B 2YJ6A 1P9WA 3LVFO 1DQPA 1RFLA 1KJJA 1WKBA 1NVVR 2CEKA 1V3QE 3QV1A 1ZCBA 2JJYA 3QWIA 1X2BA 2H17A 1C0LA 1SCDA 1TKCA 1R5BA 3G7NA 3LHIA 4FQ5A 1H2RS 2ATCA 3WLRA 1P4RA 2WPDD 1SG6A 1FDOA 4MB6A 1DC5A 4L0MA 2Y2UA 3UT0A 5GZ3A 2OFXA 3SVLA 2Q9CA 5HX7A 1E2BA 1S3FA 1KP9A 4MVJA 4WLEA 5HKLA 3ECSA 1E63A 3S44A 5A4FS 3CRQA 2FWAA 1NVTA 2EKQA 2GUWA 3UQZA 2PPVA 2B34A 2ODAA 1I6WA 2PFSA 1P2GA 3CPHA 3JYQA 1LVHA 3LF2A 3QPVA 3GFVA 4RU1A 4YRQA 4KKXB 2Q7XA 4X8MA 5KTNA 3NFYA 4KQFA 3IXQA 1WEHA 1BH6A 2BDEA 3FTDA 4QIHA 5TS2A 3VR4A 2UZ0A 4J1NA 2E37A 4QQRA 4MWSA 1T0UA 3AT1A 3LW7A 3C1AA 2YBDA 3VGPA 4UM5A 1OIVA 4HDOB 3HSKA 4S1WA 5JY6A 1QZUA 5HG0A 5SZIA 2FPMA 2FPUA 2TYSB 4WBNA 1PJ3A 3NVAA 3EMDA 3HB4X 2JGRA 2JFWA 4HVLA 5IM4F 3AR3A 3RUAA 1U7TA 3CX6A 3M70A 4JWKA 4OH7A 5MN6A 3ZY6A 4ZA2A 5IT4A 3ZVNA 4BIMA 3THWB 1TK3A 2UXCB 3N2GB 3O3NB 4HMPA 1KRHA 1K5DA 4M0CA 3LDAA 1Y37A 1YR6A 4Q3OA 4TM7A 5EGSA 4MI1A 4HDKA 5CIQA 1QQ6A 1J5EB 2RGGA 4GAEA 4JP3A 3ZW9A 1XZLA 2ZJ1A 2Z6AA 1U5AA 2V3WA 4PTYA 3QE0A 5INTA 3GPLA 3VX3A 2IYLD 3KSDO 4MGIR 2UVPA 1XZCA 2WQZA 5I7OA 5JSUA 2Q5JA 1QFYA 1U28C 4IZIA 5LKAA 2F1OA 1JPUA 1E3IA 4JC0A 5B55A 4ESVA 4GRIA 4NECA 3BMXA 1KP2A 3H8WA 4N0EA 2JH9A 4NJOA 2AEFA 5B3JC 1XELA 1ISMA 4D99A 3I12A 1EGVB 3C7AA 3MAJA 3V5NA 3KVRA 1PS8A 3SEZA 4F3NA 2VYNA 2G7MC 3WLQA 4R1OA 4BJHB 4B2YA 1XVLA 3SP1A 4P0QB 5JAZA 2R5NA 2CJXA 4F45A 3O8QB 3KQLA 3P0JA 4JSTA 2FN3A 4BWYA 4H60A 2O7SA 3AXTA 1E5XA 2ZIGA 3UK7A 3JD4A 3R9XA 5BSMA 1MQ8B 3OT4A 4N1AA 4AT1A 4ZTBA 5JXJA 1DAIA 1RQXA 2OAP1 3FDZA 4ZT3A 1BEZA 1UBHS 4GWGA 3QWBA 4EKIA 4MDHA 1SXJC 3NGMA 2EARA 4FHDA 2PUBA 1QRDA 1Z47A 3O0TA 1D1TA 2HHJA 1S9HA 1GFZA 1XCGB 4HPWA 4PCUA 1ORDA 2C77A 5DW0A 3UFXA 4WKNA 3N1UA 1PJ8A 3DAOA 2A5FA 4QM7A 3OFND 3NWOA 1JFSA 1DDOA 2VDRB 3PGA1 1VG0B 3PQEA 3B48A 4D6PA 2VPYA 4EY5A 5FLXA 1R0SA 4KDEA 4NYJQ 4OBXA 2QD4A 3TGWA 2HEGA 2C4MA 4N47A 5LWQA 1RZ3A 3ZNOA 1DAGA 2ZIZA 4ARIA 2M9MA 1X92A 1GUDA 3QG5A 1EE9A 2DC1A 2I62A 4LZOA 4RJKA 5HVNA 1F7VA 2OBLA 1HSZA 3KEQA 4Z4GA 3H7AA 3C3WA 1WHTB 1LRKA 2FSSA 2WWFA 4LDQA 4X8OA 2ORYA 4ZVQA 1LF5A 1YHNA 4FX2A 1AS3A 3C41J 4GGPA 4ND6A 5IF3A 1JHMA 1Y6GA 1PVVA 4UOZA 1NV8A 1OXTA 1RPZA 2BFCB 3FNGA 4ILEA 1FRVA 3DYVA 4MGHA 5TJHA 3M82A 1F2TA 1L7NA 2AN9A 1PR1A 1M5UA 3GP3A 5J4LA 5IH7A 3U5ZB 1W36B 2C8JA 3DOJA 4PG6A 4UEQA 2FK8A 3OQMA 5DK6A 1ULAA 4DCPA 1I2AA 4FDUA 4O4JB 5IARA 1I4WA 1C41A 1YACA 1YBVA 3I1YA 5ECDA 2XODA 4JQYA 1SXQA 4ZOCA 1GPBA 1RWOA 1Y1KE 2R65A 3D3EA 1WULS 2DQKA 3AR8A 1CUIA 1T3LA 3H2BA 4GPIB 5T57A 1RJFA 1AKTA 4AUKA 5JD4A 1KDZA 4OY3A 5MDHA 2OGUA 4KVAA 1XX6A 5DGTA 2QMYA 4OP3A 4E31A 4XGKA 2VYND 4RGBA 1FXWF 1KQNA 3THRA 3EY9A 4MHTA 2XKKA 3QVOA 1H2AS 3FKJA 3WTBA 1SC3A 3DE7X 3EIXA 3ZCPA 4FDTA 1WF3A 1TIKA 3TQHA 3U2QA 1YMQA 4DQ0A 1ZOPA 2DLNA 2YXDA 4FFMA 1XVVA 2HIMA 4PLPA 2CUKA 3OOJA 2XZLA 3FWPA 1MZPA 1YR2A 1CPYA 4DCJA 2ZG6A 3WQBA 4BBAA 3LHSA 3D8SA 1T5DX 4BO6A 5CJ2A 1XALA 3RS8A 1IEWA 3LS2A 1NONA 2BMDA 1KEUA 1G8SA 1SVOA 4UVIA 1HDIA 3RYFB 3TIVA 3ICQB 2B82A 2D59A 2O0HA 3BERA 2NZ2A 3HDGA 3THSA 3SIRA 4AZWA 2PGIA 3A9VA 3WLMA 1VPTA 5ES3A 3EQZA 1WM1A 2NO1A 4HNGA 4YRIA 2XQJA 1ZZGA 4Q00A 4HBZA 4B7ZA 3AL0C 3H75A 4TKMA 3RYCA 4KR0A 5CDUA 1PX0A 2L19A 4XWAA 3OFNA 4LY3A 4CKBB 1KSHA 2WVJA 2PUDA 2UVDA 1WWKA 4LSMA 4F96A 1FNCA 2BP7A 2PS0A 1PUXA 3GJSA 4QO7A 4ZZ0A 5BMVA 3ICWA 5C18A 5BN3B 4ZVNA 2HI0A 1GPKA 3GRPA 3ITDA 1U04A 5BUSA 1B8VA 1WXDA 2MTBA 3JYNA 1N4AA 4P54A 5HM6A 1OI4A 3R0VA 2QM3A 4PRYA 6PFKA 1IOWA 4L9WA 3DOOA 5FDFA 5G41A 3TF5A 1Z0FA 2I4OA 3PC8C 3MSXA 5ESXA 1G21A 1HYHA 2DJ5A 2VJKA 3DT8A 3EVFA 2Q27A 2VL7A 1FDIA 1R6DA 2G6BA 3HWWA 4JR1A 4Q7JB 3WJ2A 3OPMA 5B58C 2EJUA 5EJ6A 1CJUC 3EBPA 4NU0A 2VA9A 2GI4A 2QOEA 3ESXA 4NWIA 1QYCA 1FJGB 1ZJYA 4D98A 1KI2A 1R0LA 1ZGGA 4PBRA 1G6OA 2R1VA 2IIVA 3VR4H 4CLDA 1YRWA 3BIXA 3NEJA 1FNDA 3DDCA 4TZ0A 3STWA 3ORSA 1IDOA 5L3QA 4XR9A 2HIAA 2JIPA 1C9YA 1UM9A 3OQHA 5LQNA 4HWKA 1N9ZA 3UYLA 3T3NA 1LVGA 5FPYA 5HJEA 3FPCA 2O8CA 4MVJI 1WW8A 2XHEA 1UZUA 3KXDA 1NLMA 3IAHA 1V9SA 2QQGA 3F5QA 4EIWA 3KLOA 2AH5A 5B57C 3UN1A 1M6HA 3FRJA 3E5MA 3WRXC 3Q3IA 4UQLA 3W5BA 3TJZA 4KPEC 4B6SA 2C5LA 1V8FA 3CCFA 4HRYA 4LYFA 3UKJA 2X41A 5D3ZA 3WDSA 3NWBA 4ZJZA 4DSTA 3OE7A 3V46A 5LKRA 1P0FA 2Z9BA 4KR7A 4AI6A 3I62A 3LKZA 4FZVA 2JEZA 1C3OB 3O38A 2J3DA 3E7DA 4TVOA 4XDGA 3E1GA 3VKWA 5G1NA 1ISPA 3HRKA 3L05A 6NULA 1PR2A 3TX6A 4DXAA 3AUJB 2A5LA 4AVYA 1SQGA 4OVKA 2E48A 2JFFA 3PEEA 4F56A 2GPBA 3S8YA 2FR8C 1I3OA 5K3OA 3ZD8A 3TMKA 2DUNA 1TVCA 4X71A 3U7IA 1KQFA 3IP9A 2G04A 3LUGA 4BC1A 4E6PA 1LB1B 2VHXA 4ZVMA 3TEFA 2PEYA 3EW7A 1Y9ZA 4ZVLA 2JLVA 2RKWA 3I4FA 1H1DA 2JPDA 3IR5A 1EXVA 5DTIA 4MK4A 3VYTB 3GC6A 3PYMA 4G1VA 3B52X 3Q0IA 1RP1A 3UV6A 3P0RA 3SIWA 5A3RA 4RXUA 5FLEX 2D54A 1AQUA 1UXGA 1R0WA 1BXGB 4RK4A 3OCYA 1RMTA 4I5GA 3GDOA 2OKGA 4QXAA 4NFLA 1NXPA 2WKWA 3DHYA 1N0IA 5DBEX 3P2JA 3TUIC 2O0KA 2PKCA 3EMKA 3OE4A 3ETJA 3HN2A 2BH2A 4BMCA 1Z38A 4RTSA 1TEXA 1EQ2A 1THZA 5EPOA 2BCJQ 3CZRA 3IXLA 3L77A 4JLOA 5AKIA 5JY1A 5I9MA 2O23A 1W25A 1YBHA 4FONA 3MCAA 4YP7A 3UG7A 2PUEA 2FMTA 4RORA 3DEJA 3AP2A 2VJCA 4ROSA 1BVHA 3A10A 4JJ7A 3H19A 2BTQA 4M1EA 3I37X 2EJTA 2G17A 2JIRA 4BMSA 5SZHB 2HA0A 2Q6IA 3OX3A 1YDFA 3MTQA 1VG9B 1XRMA 5M5BA 4NOJA 3SQOA 4LAFA 1IY1A 4KXLA 1NFFA 1N5KA 3RUPA 5FOQA 2AZXA 1AF4A 4F5ZA 2MINA 1ZP6A 3N2YA 2Y77A 3BPSA 2F3PA 1VC2A 3WTCA 4D4GA 4RZSA 5JSQA 4K9LA 4PYNA 2Z3VA 3PGMA 1NJSA 1Z6YA 3W8DA 1QJ4A 1VBNA 4DA6A 1BU5A 3HJTA 5LXTA 1GWNA 2YNMA 4ESEA 2I2AA 3TZHA 1U3DA 4EYQA 1MB0A 2OSVA 2FPOA 4CR6A 4F6LA 4V1CB 1ONNA 4B1FA 3PFWO 4MUMA 5GAJA 3QI7A 1NN0A 1TZCA 4QUIA 4CODB 3DFKA 1YB6A 2Y05A 1ZH4A 4B79A 4Q4DA 2X22A 2ZIWB 3AM5A 3ASZA 4JYBA 3KQMA 5EWMA 3TOZA 2F8SA 1DEKA 5SYNA 5DBGA 2ZDGA 2BHNA 5KKNB 3IKLA 5LM3A 4A2QA 3E82A 4JI0B 5DM70 1LFAA 1ZH8A 5A5FA 3HB7A 1K7XB 2NTNA 3HM2A 3LPDA 4BFYA 4L72A 4OI1A 4Z4HA 4X62B 1QR2A 1J42A 2B37A 4NYIQ 3A25A 4IUBS 4YJ3B 421PA 4KPUB 2IOQA 2PVSA 1ZGBA 4HWOA 3F5DA 3QRWA 4R1SA 4WOKA 4E22A 5KYUB 2FMKA 3VYWA 2I6TA 3PPYA 4YCCA 3GLIA 1MEOA 1F06A 1BA3A 3T0FA 5TS3A 1A88A 5JJKA 2G08A 1PR4A 5BSEA 1NNI1 3T1QA 3VVBA 1H0HA 4KXVA 3J7TA 1VHQA 5F5LA 4WHMA 4CQMA 5EJ5A 2I7TA 2XGSA 1FUEA 1YUBA 3K0FB 3O3CA 3T5GA 4H4CA 3TTSA 2O14A 5HYVA 4GGMX 2MHCA 3Q3GE 1M6VB 1DV1A 4XUEA 4RYLA 4QNMA 1NY6A 2ZYUX 1F8GA 1Z29A 2WVHA 3PJRA 3USZA 3IHWA 5FWXA 5K01A 1TYAE 2HFJA 2HNAA 3R6DA 2H07A 5JNRA 2Q9UA 5JSZA 1LPAB 1NL3A 3R24A 4IIUA 3D5TA 2OCAA 5JW6A 1ZSYA 3IHLA 4MB0A 3RC1A 1T9AA 1UXKA 4RVUA 2EX1A 4NEHB 1SH7A 3BBPA 3R41A 4KL8S 4N65A 4XZ3A 2HY7A 4QFBA 4R5MA 4RKFA 4YT2A 3VNUA 5JVDA 1PD0A 1PCXA 2PRIA 4FI3C 4INJA 3TOCA 3ZWOA 2ZR8A 2BEWA 5EMJA 5I7VA 4CR8A 3A28A 1XJCA 3WHLA 1N6PA 4AC9A 2A4KA 2ZANA 5JANA 4NG5A 3MCVA 4ZO9A 4TKVB 2PE5A 4O29A 3COVA 1HDZA 3DMFA 1DJNA 1U0EA 3OY7A 2G9RA 3EVTA 2HLPA 2UZ3A 4FUQA 1YU9A 4PQFA 5U4QA 1E5DA 4MR7A 1GGNA 3CF6R 4CIWA 2Y4OA 4K87A 1E5VA 2I2DA 5CITA 1BFUA 2HU7A 1PWXA 4TQ9A 3L7YA 1I4TD 4PRLA 5H02A 3RYFA 3AI7A 1H69A 4FJ0A 3FSRA 4GSKA 1Z6QA 3V4FA 4K9MA 2IS2A 1XFAA 1CQJB 4XEUA 1AKRA 1PZMA 3G9ZA 3NDPA 3HZHA 3P4YA 4KNVA 1P44A 2M6LA 3HJGA 4EG0A 3LT2A 4EW2A 2P6PA 5IG2A 4RPHA 3MWKA 4LGYA 1MAUA 4XM2A 1QOQB 4Y2SA 3QYFA 4DDMA 3T0IA 5K6AA 3OOHA 2B4AA 3OTWA 4NG4A 5B4TA 1P33A 2ZWMA 4XIIA 3QKSA 1DRWA 1Z34A 3FIUA 1TJPB 4AQYB 2M32A 5KCMA 2P30A 3QF4A 2ZE6A 3L6CA 4AN1A 4PCAA 3AF6A 4FWBA 4DR6B 5BRNA 4ZT6A 5FKJA 2AOUB 1PWHA 1BMFD 1R0KA 5SICE 2XDYA 3SOZA 2W6IA 1KL7A 3TFQA 4QDKA 4HY3A 3CZ5A 3H87A 5BWOA 3K53A 1P7WA 3KSZO 3GH1A 3L7DA 1YOVA 1W581 3QVTA 4CG2A 1DXHA 5CDHA 2W8ZA 5DM4A 1RKXA 4K86A 3QE3A 3ZN2A 1KZ1A 3L8CA 4FMDF 2X8WA 4NAUA 3RVKA 2ACVA 4BN0A 4LQLA 4TZKA 4GBGA 5AW0A 5U1PA 5JALA 4HZUB 4QTXA 5L51A 2QGFA 5E38A 1USVA 5JR3A 1PEDA 1WXXA 2CYCA 4LA4A 4ZVTA 4ER0A 3R6GA 4X93A 3NT5A 4B8YA 1XMJA 1LX7A 2HUNA 5CLLA 1XA4A 1WLSA 3P32A 5E7IA 1EK5A 2OG1A 3KM0A 4HL6A 4YT8A 4RV5A 2YWJA 1X77A 3S5JA 3W05A 4XGIA 3ZU5A 2RDMA 3CLSD 3A7DA 3AYXB 3OI7A 1E1KA 1I51A 2RKOA 3WDKA 2G1UA 5ADUS 3G2OA 2J3KA 1EFHA 1LU9A 2VJPA 4S1VA 3GFFA 2HWYA 4RM2A 4OGGA 5GMOA 5ALLA 3GV0A 3G5LA 4EGFA 3KVNA 2WU3A 5TEWA 2R97A 1MX9A 2LV8A 4WXEA 3FYUC 2VTVA 4NEQA 1FQOA 2EKDA 3Q3VA 3AETB 4L4UA 2E4UA 3BD8A 4MA0A 4NLLA 3OIWA 4WH0A 1D4OA 3K6SB 3S1AB 1G9XA 4FKBA 2EGGA 4CKWA 1WBBA 4HFMA 2GH1A 2FH5B 3MFYA 2YFQA 1DIHA 1XNHA 4XLLA 2CLHB 3DD5A 3VU9A 4WJLA 3OSZA 5F1PA 5FUBA 4G0VA 2AIRA 2CDNA 1U9CA 1LS1A 4PZPA 2GZSA 3LBNA