4J7XA

Crystal structure of human sepiapterin reductase in complex with sulfasalazine
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
GLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human sepiapterin reductase in complex with sulfasalazine
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sepiapterin reductase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B, F, J
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j7xA00
3AW9A 1Y5MA 2PA3A 2TMGA 3EAGA 4WCDA 4YJFB 3EUWA 5DCYA 1XQ6A 1DEHA 3JQ9A 4GVLA 1NQOA 5EINA 2ZCUA 1LEHA 1BSVA 5CEEA 3ASVA 1R16A 1B3BA 3DZHA 1SBYA 2OXIA 1ULUA 5IN4A 1F8FA 1QORA 3KYDA 3PJDA 4DMMA 5CHEA 4AJNA 2YHIA 3JQFA 3KM0A 2OHXA 2JCVA 1YXMA 2ZB7A 3O4RA 2HK9A 3FBGA 2PGLA 3KLMX 4Q3CA 2BRUA 4D0RA 5KVVA 2CFCA 3HB4X 2VHYA 1U7TA 4E0BA 2PKQO 2CVQA 2YUTA 3PQFA 4D42A 1BXGA 2PR2A 1YOVA 1GQ2A 4U6QA 2LDBA 4WUVA 5T64A 1CF2O 5L9AA 2HLPA 1V3UA 4U8GA 4HBGA 3E9QA 3H4VA 1E3JA 3LLSA 3BMNB 1TB4A 1X7DA 1M66A 4N54A 4K9DA 2P91A 2EV9A 3JQGB 3IC5A 4ZQGA 4D0SA 3QWFA 2IZ0A 1E1NA 3H9QA 3KZVA 4UUOA 2DFVA 3PGJA 4DGSA 4E6PA 2XXBA 2CDAA 4CQMB 4YT2A 1Y7TA 4WOKA 3DTYA 4FJ0A 3C1AA 3LT1A 1J0XO 1KETA 3PEFA 1P74A 1X7HA 1NFQA 3PIDA 2IZ1A 4M86A 2C5AA 4BNFA 2HAEA 5GMOA 2OGUA 4IJVA 2W8ZA 2WM3A 4J4HA 1HDCA 5IJZA 4NBRA 3H3JA 3DZIA 3UUWA 5MDHA 1KVUA 3DAFA 1PS0A 3ZWXA 4BO9A 4KOAA 5IDYA 2V6MA 1YBMA 4OIMA 1H6DA 1I2CA 4IUYA 4MIEA 3Q3CA 3TZKA 5HA5A 4YJHA 5T8KA 4YTEA 2NQ8A 3ZU4A 2GN6A 4RJTA 5FEUA 3KETA 4CQMD 4G2NA 4MVJI 1DO8A 2JAPA 3LT2A 5EESA 3ZWMA 1ENYA 3M1AA 2J3JA 3ZHXA 4E12A 2FRDA 1N8KA 3W4KA 4D41A 2EERA 2Y0DA 4MKZA 2CY0A 3WGIA 2P5YA 4CM8B 3RQSA 1DAPA 2Z1MA 5CDGA 1Q2XA 1CRWG 3CXRA 6LDHA 1E3LA 3ZHYA 2GUGA 1Q7CA 5A1TA 2X9NA 1XU9A 3F9IA 4Z3DA 5A9RA 4NR0A 2CUKA 3R0IA 4U7WA 1PS9A 1U8XX 2WMDA 4FCCA 3GH3A 2HUNA 1UR5A 3AY7A 3ZV6A 5KJEA 1B2LA 3DAPA 4RORA 4DMLA 5JXWA 3RKUA 2WDZA 5L51A 4PLVA 4YAKA 4GLLA 4L8VA 1EE9A 1OC4A 3DBVO 4XQGA 1FJHA 3PDJA 2AQHA 1OC2A 2HMUA 1QXSA 1PJQA 5GY7A 5K6AC 4B3JA 4HADA 5CFZA 3WGZA 4J7CA 4F46A 4IS2A 3D3WA 4Y9DA 4AJPA 3JQDA 5JY1A 1HWYA 1HDZA 3H5RA 4IDAA 4YCAA 4ZRMA 3QV1A 3W4IA 5L4SA 3HB5X 2P9CA 1B26A 4WEQA 2FP4A 3JYOA 3MTJA 3VH2A 3R3JA 4XR9A 4IDDA 2ET6A 1H0KA 3BMQB 4FIZA 1WP4A 2O4CA 4OJNA 3WFJA 4HUJA 4NDNE 1EBUA 3MOIA 3DBHA 5TX7A 1QR6A 2B4RO 2VUSA 2PH5A 1NQTA 5AXBA 2ZB8A 3KOUA 1FDUA 1XU7A 1EQ2A 1PZGA 4RF5A 4ALLA 5ITWA 4IY1A 1GU7A 2BFAA 2X0IA 3CSDA 4EJ6A 4E30A 3AM5A 3D5QA 3OA0A 1CJCA 4IMPA 5AXCA 4ZHSA 2VHVA 1BXGB 1T24A 4CLEA 3AY6A 4ND3A 4B7CA 1E6UA 1HE3A 2RH4A 3IUSA 5IXYA 2AW5A 3E9MA 3GN2A 4EEXA 1DOHA 3ZU2A 1BDBA 4IQ0A 2RAFA 5KJCA 1NR1A 3PHLA 4YQYA 4OSOA 4ALIA 1HYEA 2YY7A 5TQVA 3FPLA 1XLTA 1U5AA 2J3IA 2EJVA 3B70A 3WLEA 1PZFA 3KEOA 1NWHA 1YE3A 1CYDA 4OYRA 3T4XA 1YONA 2X4GA 1NASA 4K6FA 2NU6A 3NUGA 2X1HA 3H5NA 5T6BA 2Y1OA 2IRWA 4XYEA 5CPFA 2BH9A 3TZ6A 3DZFA 2HMVA 1P1KA 3JTMA 3R1IA 3ZN2A 3A9WA 1B0AA 1UDBA 3PHGA 2DFDA 3DMTC 3NKLA 3GVHA 2OMEA 3Q2KA 4GKVA 3V2UA 4XCVA 3GZNA 3WTCA 4IBOA 3WOHA 2C7VA 5A06A 1KEVA 3JQBA 3B6ZA 3RASA 3SC6A 3U62A 4RO0A 1IOLA 4XR4A 3MJEA 2IYOA 2QYSA 5EMHA 1UUFA 1NWCA 4EZBA 1WWKA 3I9MA 4CM5A 1EFLA 3HWRA 4J1TA 5BSFA 2BFPA 3JQ8A 4RZIA 5IDWA 2FOIA 4P38A 3HSKA 3IP3A 5EQFA 3UGKA 1MB4A 5LDHA 3GEMA 4RZHA 1F0YA 1N92A 3F6YA 5EJ2A 3FWZA 3SC4A 1NAHA 5CDSA 3U3XA 2Y66A 1B8UA 1ZK2A 2PNFA 2X5KO 3JD1A 3K92A 4PLZA 2WSBA 4FOOA 3OJEA 4NHEA 4QT0A 4CLXA 2AEJA 4WKGA 1HTBA 3SX2A 4DPMA 3IJRA 3DWFA 3OETA 4LISA 3RVDA 1A9YA 1XYGA 2O2YA 5G4KA 1FDSA 5JO9A 3RUCA 3O8QA 1VSUA 4JJIA 1U3WA 4BNJA 5U9CA 2YQ4A 3VHRA 4ZGWA 1D1SA 5JMWA 5C7LO 3ZHZA 3ANLA 1UP4A 2D5AA 4YBZA 2E37A 5JLAA 3OP4A 4QFCA 5EIOA 1SC6A 3CMCO 3M2TA 1PQPA 2R00C 5LCXA 4C4OA 2H1SA 3NT2A 5L53A 3GG9A 4CMAA 5A03A 2VN8A 3GVXA 2C82A 2W2KB 1ZNQO 4AJ4A 3OBBA 1P1HA 2WD7A 3G3EA 4NFHA 3RUAA 3KLPX 1HLPA 1GYRA 1PGPA 1EK5A 3CPSA 3JQAD 3KSDO 4JBHA 4B4UA 5A9SB 3N58A 5IN5A 1T26A 5FWNA 2I99A 4J0EA 1YO6A 1I0ZA 1ZEJA 4LMPA 1SOVA 2AA3A 4DQVA 2BFOA 2X86A 1L1FA 5IZCA 1C1XB 4GI2A 1CWUA 4BO3A 3HHPA 4F6CA 2A9FA 4YRDA 5JY6A 3ONDA 4B79A 3TDKA 1I01A 3KSUA 1GPDG 4J0FA 1MFZA 4HFJA 1PQUA 2UV8A 1PQWA 3NJ4A 1EQUA 4IINA 3KRTA 4XYLA 1BTOA 5IAAA 3JQ7B 3H5AA 2O3QA 4RDHA 4PGFA 4XKJA 3NT5A 3VPSA 1NYTA 3UAGA 5TF4A 3Q11A 5HS4A 4CV0A 1X7GA 1MC4A 3KEQA 1IZ0A 1DIHA 5F21A 4RPGA 1IUKA 2FN7A 1F8GA 2I5PO 5K9ZA 3RFXA 2PKRA 4B3HA 2X6TA 2BGLA 4R5HA 3CZRA 1ZXBA 3DOOA 1P33A 1PEDA 2WYWA 3H8VA 3NDIA 1UXIA 2PD6A 4R1NA 4WPGA 1LLCA 3GUCA 4IDEA 1PJTA 4Q3EA 4I9UA 2JJYA 1D8AA 4D44A 1LSJA 4MKRA 4BNHA 4QXMA 3NAQA 5JFOA 4WNIA 4L4SA 4PG6A 3G1TA 4ZQEA 1C0PA 2O23A 4YAJA 1GY8A 5KTKA 3D1LA 3N7UA 3PFWO 2ZKLA 1WDKA 3WLFA 3GEDA 3GZ4A 4CMCA 1E3WB 3FF4A 3TPCA 1FK8A 1R15A 2XOXA 4R5MA 5JS6A 4CR7A 4AJ2A 3QWBA 4GSLA 3OA2A 5ER6A 3Q6IA 3EVTA 4E13A 1KY4A 4Z3KA 5HRUA 1PU2A 4NBUA 3RC1A 3UFXA 4GX2A 1Z6ZA 2UAGA 1F14A 2X58A 1LQTA 1MUUA 1KVSA 1AUPA 2YHIB 3GT0A 3OJOA 4I5FA 4NU5A 1GQYA 5BSEA 2BI7A 3ZV3A 3GLQA 4DTIA 1NXQA 2BLLA 2CMDA 4S1VA 1P77A 1E5LA 2YV1A 4E32A 1I10A 2PD4A 1MX3A 3QA9A 3OHSX 4IZHA 3PZBA 2G0TA 1YBVA 4NK5A 3BMOB 1ZJYA 3GMSA 4Q3AA 4QEDA 5EERA 2FR8A 1RM4A 4NBTA 4Q39A 2OUIA 4EGFA 2G82A 5GZ3A 5I7FA 1VPDA 1UZNA 1JW9B 2GPTA 5H82A 4J49A 2D1YA 2J5KA 1E7SA 3B1JA 3K5PA 4BV9A 3QY9A 2AXQA 3INRA 1B7GO 2JD1A 3VVCA 1VL0A 4DLBA 3GHYA 3ZW9A 2PTGA 4TROA 4YB8A 2EKQA 1P1JA 1H2BA 1HYHA 3ICPA 1P3DA 3MWDB 3WSWA 4CMHA 5CG1A 1OFGA 1YOVB 3U4HA 2FR0A 4YJGA 2EJWA 4D3DA 2WEKA 1KC3A 2DLDA 5KWEA 1VC2A 1A72A 3FNGA 2HJRA 3HADA 3KO8A 4MIYA 1IE3A 4MVJH 1H6CA 2DBVO 4DVJA 4MVJD 1HSOA 2Y05A 1B8PA 1Q7GA 4GMFA 2EG9A 4BQPA 5ICSA 2OP0A 1GZ4A 2HMWA 4CPDA 1OZAA 1CDOA 4CLRB 3K2EA 4E5KA 1WZIA 3DZJA 4R69A 1O0SA 4LCEA 1VI2A 1U3VA 1IPEA 1LSOA 2EKLA 2J3HA 3I3OA 2W2LA 1YDEA 3ZWPA 1N2SA 4CV1A 2OL4A 2PZKA 1DFIA 1ONNA 5T67A 1YWGO 2O3JA 3I6IA 1LC3A 3TN7A 4PLHA 2Y1EA 2JFHA 2CSUA 5COAA 2PGDA 4K6CA 4PVCA 3L07A 3S1LA 4BHTA 2NU7A 4H15A 4OXYA 3GDFA 1AHHA 2ZB3A 1LDEA 3GF4A 1MP0A 1ENOA 1ISIA 4WECA 4MVJA 1ZK4A 3NX4A 3C24A 1ISMA 2C0CA 1BW9A 2ZTVA 3H9UA 3LLVA 2VNAA 3C85A 4GX1A 1DHTA 1D3AA 4OXNA 5L3ZA 5B4UA 2YFHA 5ENDA 3PJFA 1ZK1A 4TKMA 4FW8A 3PVZA 1V6AA 4QX6A 4A5OA 3WBBA 4BNTA 4JNKA 4BMNA 1I30A 2Q2VA 4BMVA 1SMKA 1UXHA 1LI4A 1OAAA 3VPHA 3L4BC 2B36A 4NNJA 4UUMA 1ZVMA 1BRMA 4E33A 3TL3A 3D4PA 3TWOA 1DHRA 4XIYA 1PL8A 2VTDA 1ZSYA 4KP7A 2UUOA 5H81A 2X22A 1CETA 5G0TA 3RFTA 4L4RA 4YR9A 2UUPA 4G65A 5BSHA 3E8XA 3D4NA 3E18A 5JCXA 2HRZA 3PK0A 3AI1A 3AUUA 4CR6A 4R68A 2B4QA 1LDYA 3JQBC 3TJRA 2CD9A 3NYWA 2FMUA 1PJ4A 2RCYA 2EP5A 3K2BA 4LVCA 3RAJA 3ASUA 2PK3A 1V0JA 1SEVA 1U1IA 2HMTA 3JQ8B 1ZSVA 3H65A 1YQDA 3ANNA 3NTOA 1GL3A 3TZCA 3O8QB 3V2HA 2DM6A 3D3WB 1I3LA 3UICA 1E1MA 1HZZA 4J90A 5EN4A 1ZO8A 2DBRA 5DF1A 1UXKA 2Q49A 4J4TA 1F12A 3F4BA 1MFPA 4N18A 2YDYA 4LRTB 1TT5A 1EVJA 5JDIC 1PJ2A 4W82A 4PLCA 1DC5A 4DWVA 5FI3A 2Y1GA 3INGA 1Z74A 2PGJA 3MJTA 2YHUA 2GF2A 4NJMA 3ADOA 3WIDA 5ITVA 2W90A 4BNNA 1RYEA 1T2AA 4FC6A 1TLTA 3T7EA 1DRVA 4JCOA 1YDWA 2VQ3A 2EXXA 5DOVA 1ML3A 1GD1O 1ZMTA 3BMOA 3S2IA 3A4VA 4XWYA 4W4TA 1N1GA 2W2KA 4HXYA 4BGEA 2D0IA 3GA0A 2WD7B 1LX6A 4J6FA 1GUYA 1R6DA 4UVHA 2G76A 3LF1A 3IP1A 1HE5A 4XEHA 3MJ4A 2J5QA 4WOJA 3PHIA 4BIIA 4YPOA 1ENZA 4HNHA 4UVDA 3IUPA 4L4XA 1T4DA 3WG9A 2NVUB 4MO2A 4TRRA 1IL0A 3AUAA 3RU7A 1B8VA 1MLDA 4N7RA 5COQA 1QYCA 5FF9A 1W4ZA 3G0OA 2IEBA 1YJ8A 4RPLA 3P2YA 3WGHA 1SAYA 3X2FA 3FRJA 4PZDA 3Q9UA 1I3MA 4J7UA 4BO0A 3E1KA 4ZICA 1Q0QA 3MEQA 3C7AA 3FSRA 4KQXA 1LU9A 2BELA 4CLOB 3V1YA 4YRAA 5TSDA 2I6TA 1HSZA 3W6ZA 4Z9XA 2EKPA 1GV0A 3V1TC 2C59A 4UVIA 3DAGA 4BNZA 3Q0EA 1IYZA 1RM3A 4E5MA 4YAGA 1ZXLA 2H5LA 2NLOA 3AM3A 3K31A 4DLLA 2XXJA 2IXBA 2ZTLA 3RC9A 1XSEA 4KUHA 3R6DA 2EIHA 4XDZA 2P5UA 4Y8VA 1HDYA 1JAXA 2NWQA 3ENNA 4G81A 3U4DA 3TFQA 1EVIA 3GN1A 1V35A 4EUEA 1B3RA 1LLDA 2YZ7A 1LDGA 3I52A 1N9GB 4QUKA 4A03A 1U28A 8ADHA 3EHEA 1H6BA 4MVJP 4JLWA 4BOYA 3VKUA 4HFNA 2OOSA 1KIFA 1P31A 1V3TA 4BB5A 2FSSA 1K6IA 3JD2A 1EDOA 3IKTA 4PFJA 4AJIA 2ZYAA 2D8AA 4BMSA 1FF9A 5U4QA 5LDGA 4NFYA 4IDBA 3CIFA 3D7LA 1ISJA 4CM3A 1U2DA 1PJBA 1I24A 4L9RA 4EJMA 3AWDA 3ANMA 1PL7A 1OBFO 3PTZA 3VDQA 4PLYA 1YB5A 4PG7A 3VC7A 3OIFA 4M55A 3BAZA 2E82A 1FDTA 1BGVA 2EGGA 4IM7A 4TKLA 5AQ1A 5G4LA 3ROQA 3TFOA 2QX7A 1QYDA 2Y99A 3JV7A 2I3GA 4KZPA 4OHUA 4BNWA 3KYCA 5F3RA 3H2SA 2VHWA 2QW8A 1BXZA 2QYTA 2Z5LA 4LGVA 3ABIA 4JBIA 1O8CA 3G17A 4WCFA 2CDCA 2WE8A 1VJ0A 2ZK7A 5JC1A 1J49A 1E3EA 3BHJA 3AI2A 2A94A 5F5LA 3CE6A 3WICA 3JD3A 1P9LA 1E7MA 5A9SA 4JN6B 1C0IA 5T57A 4A10A 3OJLA 2DAPA 1PS8A 4M54A 4O6VA 3BTOA 3L9WA 4FC7A 4OKIA 4FBGA 4E2XA 5CAEA 2YYYA 4NIMA 1HXHA 1PTJA 3FPCA 4RVSA 4YA6A 3DMTA 2AQIA 3OF2A 4E5PA 1VSVA 2Z1NA 3OICA 2UVDA 5A05A 3VH3A 3WWYA 4KQWA 5ES3A 2NQTA 3BYZA 4WJZA 1PGOA 4HP8A 4LVUA 2VWQA 2DKNA 3VPGA 4YRBA 4R4JA 1C1DB 2HCTA 3JYNA 4RL6A 5A4DA 2AE2A 1LA2A 2B37A 1KS9A 1GAEO 3IIEA 1NQ5A 2C2YA 2BHLA 3JD0A 5TT1A 3PYLA 4LMRA 4BNMA 3ONEA 4CLRA 3ZU3A 2CVOA 1WLYA 2Z95A 4J3FA 1GYQA 2X5JO 1OI7A 1VE9A 1ZFNA 1OOEA 4GX5A 3HDJA 4Z0TA 3W8FA 1MV8A 3RSHA 1YGYA 1Z75A 3PDUA 4A7PA 1ZIDA 1W8DA 3DFZA 4TZTA 3K8ZA 1SB8A 3MWEB 3F5QA 2Q46A 4YWJA 2FZWA 4OSPA 2ZB4A 3L77A 4FN4A 5C7OO 3HDYA 3P2OA 4M89A 4GH5A 1TVEA 4M49A 4BNLA 4C7JA 2DBQA 1KEUA 3WNQA 4J2OA 1M67A 3DZBA 3GGPA 1E3SA 2DBZA 1RPNA 1LRJA 2R6JA 3ETDA 4XYBA 1JVSA 4N5MA 4R1UA 4A73A 3M2PA 3B20A 4WLEA 2YFQA 4Q3NA 3W8EA 1Y81A 4M8SA 5JW6A 2FSVA 2NNLD 3I9NA 3T4EA 1JU9A 1EUDA 3FCOA 4IXWA 3G49A 5JE8A 2PZJA 4CQLB 3TL2A 3WSVA 4ZJUA 1E3WA 4EITA 1DFGA 5JPIA 1JWBB 4FD3A 4XJTA 5HTOA 3BMCB 4YXFA 3HFSA 1JQBA 2VRCD 4BKUA 3RBXA 4XGIA 2X5OA 4NH4A 2VRBA 1J4AA 1Y8QA 2O3SA 5DULA 1Y8RB 3ENKA 2C7GA 5KJ1A 1TI7A 2GGSA 1LQUA 3MZ0A 4CV3A 3O03A 2Y1CA 5TT0A 1PSDA 3DC2A 2P4HX 1DJQA 5CDYA 4F6LA 2Q1SA 1LTHR 1DC3A 3BHIA 3C7DB 2JFGA 1YKFA 2DT5A 3G79A 3UN1A 4KTVE 3OM9A 3WIEA 3FR7A 3SVTA 3W6UA 2VNSA 5MGBA 1A27A 4KDEA 2I65A 2QRKA 1X15A 5CPBA 1A5ZA 4R3NA 3JQEA 4CMBA 4Q9NA 3GR6A 3PWKA 3UHAA 2FPGA 4QTZA 1Y5RA 1SB9A 2C20A 4WLUA 3QVSA 4IDFA 4K26A 3EZLA 4GQAA 1E1KA 3OEWA 1NVTA 1I5RA 1E0DA 1Q1NA 1T1SA 4WEOA 4E2ZA 5KKCA 1H9BA 3GRPA 2B5WA 4HFRA 4CMGA 1DIAA 3FTPA 1GTMA 2C29D 3D64A 1DC4A 1DLIA 3L9XA 2EF1A 3OSUA 4OQYA 4UUPA 4GGOA 1A7AA 1QYVA 2DQ4A 5J23A 3I83A 1KVQA 4ONEA 1NAIA 2O7SA 4UVGA 3ZH2A 2JD2A 3TF5A 4TRNA 1NHGA 3EMKA 3FBTA 4YT4A 4RDIA 3QWAA 4ZRNA 3ZI0A 1JWAB 5L95A 4XB1A 2EW8A 1TT5B 5T8KC 2OO5A 4CM4B 3GG2A 2QRJA 1LLQA 1I8TA 1NPDA 4F45A 3KBOA 1X0XA 3PZRA 2CF6A 2E6UX 1Z45A 4RLHA 1ENPA 2ZQZA 1U3UA 3WGYA 1G0NA 1SZJG 2VUTA 2P2SA 3HUDA 1T25A 1U4SA 2X0NA 1JN0A 1EBFA 4KDFA 1ORRA 1P45A 1P0CA 1I2BA 1ZBQA 4ZQFA 1WAMA 3RKRA 3RUHA 4GAEA 2AQKA 2V65A 1SOWA 4XQCA 1ADBA 3OEYA 5B4VA 1K6JA 4BO4A 4DIFA 1PL6A 1VL8A 1DJNA 1DB3A 3G1UA 1C0LA 4PLPA 5IDXA 1VJTA 3PI7A 2XAAA 4WASA 4RVDA 2B69A 4UEKA 1CQIA 5BNFA 3RFVA 3GNSA 2FWMX 5IZ4A 4I1IA 3JYPA 3LT4A 4IDGA 3BMQA 2PLAA 4CLOA 4NMHA 5AVOA 4EW6A 4II3A 2I67A 4XRRA 1D7OA 3WDSA 3JD4A 3SLGA 3ZWVA 4DL9A 4U5QA 4UEOA 4DQXA 2PWZA 3I9JA 5FYDA 1IY8A 1TEHA 5GZ6A 3MTGA 5K6AA 3DB2A 1VKOA 4R54A 3I23A 4JJFA 4CQMA 5JAMA 1K5HA 2PZLA 2ZQYA 4YVFA 3LC1O 4R16A 1PGQA 2VYVD 2VWHA 4OQZA 5JYDA 4OH1A 2V7PA 4BNVA 3WXBA 3FI9A 3GGOA 3ROKA 3D5TA 5C3MA 4B4WA 1L7EA 3SXPA 2D4AA 2DU8A 4AJEA 3O38A 3WB9A 1H93A 3MJCA 5F1KA 1LJ8A 1QRRA 1EK6A 2E4AA 3RWBA 5TJ9A 2OFPA 5TGDA 5B37A 3A14A 4FFOA 1XR3A 3HE3A 1GCOA 1XCBA 3QJ5A 4FQ8A 3WYEA 1ID1A 1DRUA 3RROA 1Y9AA 1N9GA 7ADHA 1NVGA 2DPGA 2C07A 3I4CA 4MINA 2QHXA 4YAEA 4PG5A 4H16A 3ROPA 4IGFA 3TSCA 2Q1UA 3KYBA 1KERA 1HDGO 4XD2A 3ZNNA 2QZ9A 4Z0HO 4R41A 3QRWA 3KYCB 1M6WA 4WCFC 1UDAA 5THQA 2FR1A 3ZWAA 3DBRB 1E92A 4WCFB 2HMSA 3LK7A 3H2ZA 1P44A 2AE1A 3LSYA 1P1FA 4WLFA 3M1LA 3CKYA 4J1NA 3KYDB 1JLLA 3OH8A 3B1FA 3GEGA 3EC7A 3UH1A 3DMYA 2Q45A 4FGWA 4RVHA 4RCVA 2V6GA 3OQBA 3E48A 4K1LA 1I3KA 5H83A 8LDHA 5ADHA 2GRAA 2VZ8A 4JIGA 1E3IA 4MPDA 1SNYA 3RUDA 3IAHA 3CMMA 4LSWA 5I7EA 2B83A 4M1QA 1E7WA 3VH1A 4CMKA 2F00A 4MJLA 5B12A 1X0VA 1Z7EA 1ISFA 1EFKA 1R0LA 1EMDA 3HFGA 3WMWA 4OGWA 2POQX 3JQ6A 1U4OA 1LRKA 2I66A 3GNTA 4PCVA 4AJ1A 1QLJA 1XELA 4O63O 1HETA 4CM9D 3Q1LA 4NU6A 4A0SA 4GBJA 2X9GA 5DCUA 3DQPA 3U9LA 4INAA 1HT0A 3RI3A 4PLFA 3PWSA 4WLOA 2HK8A 3L6EA 3WYBA 5TNXA 5KKAA 4PVDA 4Y98A 1DRWA 4ALMA 3DL2A 5A04A 5TC4A 3V8BA 4BV8A 1JKFA 4BO8A 4ND2A 3WX0A 1ZCJA 1T2EA 2NVBA 3N74A 3GFGA 2VOEA 3QP9A 1C1DA 3F47A 1F17A 2ZATA 4FJ2A 4RPJA 3GQVA 4AJOA 2VOJA 4R51A 1BMDA 3GFBA 1LRLA 4BUCA 3NTQA 1PJLA 3MJSA 2Q2WA 2FZEA 5I7SA 3WS7A 1W6UA 4YEDA 2OBYA 1K6XA 1P1RA 1YH3A 1Z73A 5A02A 2PZMA 1LSUA 1ADGA 3S8MA 1Y9EA 3D3EA 4DYVA 1A7KA 5EL0A 1E5QA 1Q0HA 1NP3A 1C1XA 2GASA 4I5EA 5KOIA 4PIVA 3GAZA 3VZPA 4HY3A 1T4BA 4OM8A 1QYWA 4LCJA 4BNXA 1AHIA 4X54A 1ZK0A 3PLNA 1O95A 3JQ9C 2CZCA 2ZTUA 2XPCA 2AEMA 1W73A 1ISHA 1HL3A 4D45A 1WXDA 3TQHA 5JSFA 1DPGA 4MIOA 2YW9A 3CINA 3DDNA 5JDCA 1KOLA 4JGBA 1HF3A 4LW8A 2D5CA 4HX5A 4WGGA 3RJ9A 4OXKA 4UEJA 5TLSA 1R4NB 4MP3A 2Q4EA 4KTTE 1O9BA 4J1SA 5JDIA 2WE7A 1DIGA 3K9QO 1ZH8A 1T1RA 3FTNA 5AXDA 1LSSA 3GC6A 4XA8A 5LC1A 5C5IA 1XWFA 1HYGA 2B0JA 1ZEMA 2O4UX 1DBVO 2RBEA 3GZNB 4FGSA 3S2FA 1Y6JA 3U0BA 2O48X 3I6QA 2WTBA 1PZHA 4JJGA 4GMGA 4DRYA 1VLLA 2JCXA 1IULA 4NG5A 2I9PA 4NI5A 3S2GA 4DA9A 2GN4A 1XGKA 2C54A 2BD0A 3GVPA 4Y6SA 4BO2A 4AFNA 4CLDA 1DLJA 2JHGA 3ONFA 1RM0A 2GD1O 1AXEA 1NHWA 4D46A 3VZQA 1J5PA 5DT9A 3CTMA 3H9GA 4TRMA 3QHAA 3INTA 1CQJA 2NTJA 4D3SA 1C3VA 4MVJG 3X2EA 1M76A 2G17A 1BWSA 2VYND 3BTUA 3E9NA 4WE3A 3L4BA 4IMRA 4UULA 4DPKA 4E31A 3WQSB 2ZTMA 5A5EA 2IDZA 5EQDA 5BSGA 3FNHA 1V3VA 5L7WA 3F46A 3TZQA 2NTVA 3T7CA 2G5CA 1MG5A 1K89A 1PWZA 4K28A 3ZZNA 3BMNA 1UJMA 2GN9A 5GZ1A 3ETEA 3ZU5A 2ZIZA 1FXSA 2GDZA 4CUZA 2X7HA 1HLDA 3JQGA 1WMBA 3UXYA 4CM7A 2BGKA 4URFA 1ARZA 2CF5A 3EYWA 5IZCC 3C7CB 3QE3A 4CJXA 1ZW1A 4OL9A 4KMSA 2HKIA 3HNPA 3LDHA 4RGBA 1GDHA 5JC8A 3WQRA 1NFRA 4BKOA 1DSSG 3NGXA 3IS3A 4F3YA 2Q1WA 4BNUA 4IJKA 5DCWA 4PZCA 1I2ZA 2Y68A 5COBA 1UDCA 1I32A 4BKRA 3VPFA 5CDUA 1NNUA 2JCYA 1ONOA 3BIOA 5F5NA 2Y1FA 3FNFA 4CQLA 4MDHA 4CUKA 4B4VA 4JROA 1KEPA 3F1KA 4EBFA 4YJDA 1QSGA 3PQDA 4JXKA 3U49A 3JQFC 1S7CA 3OIDA 2JFFA 3ZDFA 3H6KA 3ROMA 1K0UA 2YJZA 2P4QA 3DBLA 3LC7O 4GGPA 2R00A 4J1QA 2A92A 3RC2A 4YT8A 4GWKA 5CG2A 5I8ZA 3RCBA 3HJAA 4CMIA 1C0KA 4D7AA 1YVEI 1X13A 3AJRA 4YJHB 3DHYA 1C14A 4PLTA 5JAQA 1JKIA 2EEZA 4BGIA 4PG4A 1SPXA 2I3AA 5KJFA 4L73A 4BKQA 3E5MA 4EJ0A 3VPXA 1EDZA 3ZWCA 3EK2A 3DOJA 4B3IA 3ZWWA 4I9NA 1H6AA 3GUYA 4UREA 1U8FO 4M87A 4R1SA 3VAZA 4E5YA 1QKIA 3PQEA 1EZ4A 4I08A 1U9JA 3H9JA 3FWNA 3HDQA 3AU8A 3C1TA 2D2IA 3KVOA 3SBOA 4ROSA 4OOEA 3WGGA 4BNGA 4QFDA 1AXGA 1NR7A 3A1NA 4RF3A 4YDRA 5FI5A 3H7AA 3WTBA 4CM8A 4ZN6A 4BNYA 5HWSA 1X1EA 3CUKA 3LF2A 1KC1A 5JMPA 5BNIA 1GUFA 4RPKA 2HSDA 1O89A 3DBRA 4CV2A 3W1VA 4CMEC 1ISGA 5G0UA 4AJKA 4W9NC 1MXFA 1O94A 3OFSA 4E4YA 5ER9A 2O3UA 2VZ9A 1R4NA 1QMGA 3H9EO 4H3VA 1T2CA 4P4GA 3LQFA 3UCXA 1T2FA 2VRCA 3GVCA 5L40A 4OAQA 1B15A 4AG3A 2X0JA 2NV6A 3DFUA 4LK3A 5DZSA 1H94A 4IS3A 3AY3A 4QSMA 4E2WA 4C7KA 1HE4A 1YQGA 2SCUA 3U4CA 3QVOA 3U09A 1V9LA 1IZ9A 2YV2A 1PZEA 4UUNA 3ORFA 3JYLA 5G0WA 2HO5A 3NTRA 1E77A 2UDPA 3TZHA 4R01A 4BO5A 3PPIA 5L7YA 4UVEA 5ILOA 1XEAA 4QO7A 3DR3A 1FDWA 2JD0A 3W8DA 1UP6A 4RF2A 1G1AA 3E6AA 1KYQA 4CM4A 4BNIA 1LNQA 3ITDA 1IHYA 4Z9YA 4ALJA 2BGMA 1JVBA 1A4UA 3QWIA 4J7XA 1I33A 1I3NA 3ZGYA 5IDQA 5BNTA 1Z7BA 4U0KA 3ICCA 2JHFA 2VHXA 2NU9A 2W2LD 4J9VA 3MJVA 2Q99A 1E7YA 2GR9A 1X14A 1R66A 2GN8A 2R2GA 2ZCVA 1AGNA 1KVRA 2AHRA 4ZQBA 3EDMA 1P0FA 3AOGA 3HDHA 4MVJF 2IE0A 4ID9A 5CEFA 2QZZA 4CR8A 2W98A 3LYLA 5A3JA 2VUUA 1MA0A 3E82A 3JYQA 5DP2A 3ZNQA 1YL6A 3DHNA 1FDVA 3E5RA 4LRSB 4BS9A 2IODA 1U3TA 1VRWA 3KHUA 3VTFA 1GEEA 5T5QA 5KCZA 5A9TA 2JKVA 1HDXA 1M2WA 1UXJA 2GZ1A 3GPDG 3ON5A 1BVUA 3AOEA 1YB4A 3M6IA 2JL1A 2F1KA 3RBVA 1UP7A 3BA1A 3JQAA 3V1UA 3IL2A 2O3TA 1GPJA 3NGLA 1E7QA 7MDHA 5TIIA 4TVBA 2EGHA 4BO1A 1LDNA 3ZNPA 4YYZA 1MC5A 2ZYDA 3OJ0A 1R4MA 4G5HA 2HU2A 3WJ7A 4P4NA 5IFLA 4B7UA 1SCUA 1EEHA 1A71A 1N1EA 1HEUA 3IQDB 3C1OA 4XX0A 3WGTA 3PLRA 4J91A 3GK3A 2DTDA 4Y6PA 1KBZA 1OMOA 1TT7A 4ZA2A 2G1UA 1WMAA 2C2XA 4DC1A 2NADA 4ZQHA 2EWMA 4R1TA 5A3VA 4YT5A 3ADPA 4J16A 1EVYA 4GLOA 5JBIA 2A4KA 4WLVA 1GCUA 4R9SA 4DC0A 1O6ZA 2OBNA 4BO7A 4RLSA 3U4IA 1A9ZA 3EZYA 3I5MA 4Z9FA 5I9LA 1HDOA 3AUSA 3FD8A 4MOWA 2HDHA 4W6ZA 4FFNA 1HE2A 2QIOA 3ZCXA 4D3FA 3U5TA 3TNLA 5I9MA 1K2WA 4DBVO 1X1TA 5L4NA 1VM6A 4O59O 2GSDA 3GVIA 1VL6A 5IG2A 1YL5A 2NACA 3PRJA 3QVTA 4MVJM 4W9NA 4I9HA 1PR3A 5CP8A 1QLHA 3MCVA 1WDMA 5F1OA 1W0CA 2NU8A 3AI3A 3EW7A 3P19A 1GADO 4FFRA 4B4OA 3OQ6A 5B4TA 2WYVA 4QO8A 2WWRA 3AFMA 3LVFO 4EI2A 1GZ6A 5ICMA 3RUFA 4ZVVA 3DXFA 4Z6KA 4IDCA 3AM4A 4XJSA 3UW3A 3DONA 3QWHA 2NUAA 3S2EA 1E7RA 5DBGA 4HWKA 1WPQA 2IYPA 1M6HA 2E48A 2H9IA 3GOHA 4O0LA 3GDGA 4XQ9A 3RU9A 4DREA 2Q50A 4RQUA 2CNBA 2TMDA 4YJGB 3KB6A 3TOZA 4XYMA 2PV7A 1MGOA 1UAYA 2ZJ1A 3ZWOA 3GNQA 4AICA 1UZLA 2DTEA 2VWGA 4U6SA 2Y93A 5AOVA 2AG5A 2B5VA 3P7MA 4FPXA 5F1PA 2AG8A 3ITKA 5DBIA 2GNAA 2VT3A 3EVNA 2PY6A 4YQZA 1E6EA 3QSGA 1YBAA 4W7IA 3LC2O 2HJSA 3C3XA 3DTTA 4LN1A 3FHLA 4ITUA 1AE1A 1G0OA 3BXXA 2BF7A 1NX6A 4IIVA 4EYEA 4RVUA 1KY5A 4ILKA 1PWXA 1R12A 3UKOA 4KWHA 4RF4A 1XHLA 3HN2A 2Q2QA 1E6WA 4YJFA 3F5SA 5CDTA 4P8RA 1PJ3A 2I76A 5ENVA 3L0DA 4ZD6A 3GY0A 1A4IA 3MOGA 1B16A 2WYUA 4II2A 5JAZA 5BQFA 2RIRA 1LBEA 2ZJ0A 3IMFA 4FOSA 2Y0EA 5DP1A 5G0VA 3VTZA 4DPLA 3QIVA 5DOZA 4FFPA 4XZ3A 4BB6A 3AU9A 1PJCA 4MVJE 1BW9B 3GGGA 4P4LA 4CMIB 4TWRA 5C37A 1YL7A 4NBVA 3AOEC 4JP2A 1KVTA 1XQ1A 2Q3EA 1ZSNA 4O5OA 1AN9A 1BHSA 1PGNA 1YQXA 1DFHA 3VH4A 2PKQP 4NQZA 4PLWA 4IIUA 2GERA 2Y67A 3COSA 4KUEA 2HK7A 4O1MA 4JK3A 3WGOA 3NEPX 4IJWA 3Q2IA 5DBFA 4MKXA 2ILTA 1ZMOA 3GAFA 4BNKA 1ONPA 3UVEA 2PFGA 4CL3A 3OECA 1GUZA 1ULSA 1KEWA 3GMDA 2GYYA 3JQCA 9LDTA 3L6DA 2GLXA 3ULKA 1S6YA 3O26A 1EE2A 3IOYA 1Q7BA 2VT2A 3OIGA 4DIBA 2P9EA 1DIRA 1SEPA 2C5EA 2GZ2A 3LT0A 4PZEA 4XGNA 4W99A 3OJFA 1NBOA 3F4LA 3RBZA 1QYXA 3PFFA 4BL5A 3WYCA 1WVGA 5ILGA 5I7VA 6ADHA 4ALKA 3SJ7A 1R37A 1M75A 1LUAA 1HRDA 2H6EA 2O3RA 3DZGA 3OMLA 2FPIA 2HRBA 1RYDA 3I9KA 1SO8A 4R3WA 3VDRA 3BMCA 4Q3BA 4XDYA 5KVCA 5BR7A 2BI8A 4HV4A 1CIVA 1JAYA 4JP3A 4R9RA 4E21A 4WLNA 1HDRA 1ZKMA 3UOGA 1QP8A 1DC6A 2GO1A 4BKPA 1NPTO 2FPPA 3RJ5A 1FMCA 3RD5A 4FFMA 2P9GA 3RUIA 2FY8A 3KUXA 3NDJA 2YQ5A 2AQ8A 4B7XA 4BGUA 3SLKA 1LXCA 2E49A 2FHSA 4IGEA 1Y1PA 3PWZA 2AMFA 2O7QA 4FS3A 1H5QA 4FJ1A 5KVQA 3UCFA 3PYXA 1GR0A 2J5RA 1QV7A 1WZEA 4EUHA 1XG5A 3PJGA 2O2SA 2YDXA 2EW2A 4L0QA 1LDMA 2PH3A 4KWIA 4NJMB 4DXHA 4CL8A 4L76A 1EUZA 5L7TA 9LDBA 2B35A 4B8ZA 1BXKA 4TVOA 2IXAA 4OOFA 1HZJA 3ZHBA 4XIJA 3WGQA 4ND5A 4TQGA 3V5NA 5B1YA 4I5DA 2GZ3A 3D0OA 3PYMA 3PJEA 1N7GA 4CM1A 4A27A 1GFSA 1K3TA 2H63A 4BQRA 4DQUA 1F06A 4AL4A 4ESOA 3QQPA 4TZKA 3DHEA 3DBLB 2DUWA 4IZIA 3AUTA 3A28A 2VYNA 3NT4A 4B8WA 1DAOA 2JAHA 4W7HA 5I9NA 3WFIA 4PRLA 4J9UE 1YRLA 1LC0A 1PIWA 1WDLA 2NVUA 2X9VA 3GHHA 1V8BA 2IZZA 2RHCA 1UAGA 2QRLA 5TJHA 3VZSA 5DNAA 1HKUA 2A35A 1CERA 2QG4A 3CH6A 3EY4A 3NDRA 4FSHA 3OQ1A 4L74A 3P5SA 5AYVA 1BVRA 1XKQA 4CM6A 3HG7A 2BFMA 3Q9NA 5HM8A 4Q3DA 3UCEA 3WWZA 2AEFA 4ND4A 1QG6A 1RM5A 4GL4A 1N7HA 3I9LA 3SEFA 5JCJA 1RKXA 1P1IA 3VKVA 3F1LA 3IJPA 4LSMA 2X23A 3TRIA 4Y6RA 4RQTA 2QQ5A 3H3FA 3W4JA 2VHZA 2Q1TA 2RH8A 4J4BA 2IEDA 3QLJA 1NVMB 3I9OA 3ZW8A 4FFLA 1GEGA 4DIOA 4H7PA 4HFMA 4BO6A 2WJPA 3FNEA 4GKBA 4E5NA 2DTXA 4GSKA 1GYPA 1D4FA 3TOXA 2VCYA 5G0SA 1GZ3A 5CEJA 1XIVA 1TXGA 4U0JA 1GQQA 1JTVA 2NTNA 3I1JA 4AVYA 2VTEA 3BZUA 3PP8A 1JKJA 2Y0CA 2J8ZA 2W4QA 2CVZA 4I5GA 4XQEA 1D1TA 4IQGA 3NJ8A 2EP7A 5TRTA 1YJQA 4FDAA 1Y8RA 4HNGA 5JCJD 1WW8A 1J6UA 3HN7A 1H2HA 1U7HA 4EEZA 3K6JA 2DC1A 3ZWNA 3PHHA 2OP1A 4RVGA 3L6OO 4IPTA 2X8LA 4E3ZA 2V6BA 3SJUA 4EDFA 3WR5A 4GVXA 1NTOA 3DOCA 5JYEA 3PXXA 4BGVA 2VWPA 1YS4A 4ND1A 4CMEA 5EPOA 3NRCA 1NPYA 1TA4A 5DDIP 5G2OA 5JNLA 1UH5A 1QV6A 1ZK3A 3CZMA 1XA0A 3DO5A 4HKTA 4P22A 3EGOA 3STHA 4D79A 2X0RA 4OMUA 2O50A 1VKNA 5THKA 4A2CA 5C7IO 4JX8A 1NQAO 3ZV4A 2HQ1A 3LU1A 3L4SO 2LDXA 3HZZA 3S55A 1YB1A 3CEAA 3FN4A 5L45A 1UXGA 3IKVA 1JA9A 2J6IA 3DZKA 4ZU3A 2YV3A 1LDBA 4GWGA 2EHDA 2BMAA 1UZMA 5U1PA 4NFSA 1H9AA 2DUUA 4TSKA 4Z0PA 1U2GA 4S3MA 5G4KB 3QVWA 1PR9A 5I8WA 3VZRA 3BTVA 4CODB 4RV9A 1IB6A 3IDSA 4FR5A 3RUEA 4YAIA 2NSDA 3JCZA 1EUCA 4NBWA 3PHJA 3KSZO 4I8XA 1R0SA 4OO3A 3ST7A 1XDWA 1B14A 4D43A 2XF8A 4NPCA 1RJWA 3E03A 5L4LA 1ZUD1 3DBHB 1NFFA 3JQAB 3PGXA 5KJ6A 1LLUA 4QQRA 5HS6A 4NJOA 1MG0A 1DDOA 3D4OA 1VJ1A 4J43A 2RHRA 1BG6A 2UYYA 3K30A 1BDMA 4TMFA 3NV9A 4WK6A 4KUGA 5KVSA 4YACA 1NM5A 4N5NA 1IPFA 3KTDA 2VYVA 1N5DA 1EVZA 3VVBA 4DLAA 5A5FA 3F3SA 4FB5A 3GPIA 3FR8A 5JO0A 4XYGA 1RWBA 1U5CA 3JSAA 1PGJA 4XB2A 3ZWBA 3ZNOA 1ADFA 5TS3A 2DVMA 3A06A 5AXAA 1R0KA 2NM0A 1Y8QB 2DPHA 4XRGA 1R4MB 3BHMA 4PG8A 2B4TO 4MP8A 3VOSA 4CLHA 2Y1DA 1WNTA 3I4FA 4GX0A 2GCGA 3ETGA 4IXTA 4AJJA 5KIAA 5KNLA 2VZ0A 2ZYGA 5FFFA 4CMJA 1MXHA 2PD3A 3RC7A 5IXSA 4IJUA 3KV3O 2J3KA 1CEQA 3WBFA 3WMXA 1E1LA 4CUJA 1DIBA 1ZZEA 1T2DA 3K96A 3JQ7A 4DUPA 4GPD1 4DBZA 4Y67A 5JAIA 4QECA 4PRKA 2CDBA 4JQCA 3V2GA 1PJSA 1I36A 3ZV5A 5IF3A 3AK4A 3WQQA 5K0ZA 1ADCA 1G6KA 4XGKA 4EUFA 5DN9A 1O5IA 3DEYX 4IQ8A 1IHXA 2WD8A 3R3SA 3RIHA 3K73O 2OZPA 4N5LA 3B1KA 5HBRA 1ZJZA 3HQ4O 4TRJA 3UF0A 4MP6A 1DXYA 4ALNA 1GV1A 4AJHA 2Q4BA 4WNCA 1JDJA 4OKNA 4J2HA 2NVWA 4JBGA 4E2YA 2V6FA 4NZ9A 3GDOA 5BT9A 3QW2A 1Q0LA 3WJAA 4NK4A 3O9ZA 3BTSA 3C8MA 2OORA 3LZ6A 4A26A 3GRKA 4PLGA 3PIIA 3QVXA 1Z82A 4UAGA 4CM9A 2D3TA 4PN3A 2P68A 4L75A 4RVFA 4AJLA 4BVAA 4DYDA 2BKAA 4RPHA 2D59A 3ZWYA 1L7DA 3AFNA 5JDCC 1PX0A 3KXDA 3WNVA
chains in the Genus database with same CATH superfamily
4TUYA 4WXPA 5CURA 4WK2B 5EKXA 2GBCA 3SOZA 2XCRB 1UZAA 4GG1A 2FJUA 4ARZB 4H0CA 2ZYHA 4HZIA 4MQFB 3R20A 1RAEA 2HY7A 3LY9A 3CUTA 1DQPA 4K81B 1IBRA 2Y92A 2BN4A 1O94D 3OUZA 4YCDA 5GOZA 1LEHA 1BSVA 3LRPA 3ASVA 1R16A 3NWPA 3OU6A 2O0HA 2OFWA 1ULUA 5IN4A 1D2NA 3VUEA 3PJDA 3O90A 3WBJA 4Z7QB 1KMCA 1ST2A 2NZWA 2XEDA 1R0CA 2OHXA 3JQFA 4E51A 3UKDA 3U1BA 1DX4A 4BZPA 2JCVA 1NF9A 2PXXA 3O1JC 1XXHE 2FZLA 3FBGA 2RB4A 2CVFA 2PGLA 1IK6A 1O3YA 3LCCA 3O4RA 1A9RA 4KXWA 3UFBA 4JBNA 5KVVA 4CVNA 1NRXA 2CFCA 4XXHA 3GRUA 3HB4X 4KK3A 5DE3A 3PRHA 2I4OA 5IBPA 5J43A 4KOEC 5I4CA 2XIJA 1E8NA 2ZE6A 3KKOA 2OYSA 2YUTA 3GH1A 3PQFA 4W5JA 1BXGA 2VI5A 1EVLA 4KITB 4Q93A 3AKEA 5JAPA 1P8AA 3IB6A 4QBIA 5BQOA 1YK0A 2JF0A 3B1WA 4GXNA 3I5XA 3T35A 3ZCRA 3IV9A 2W6ZA 1RRCA 2CJXA 4LVNA 5C8XA 4EI7A 3HBMA 2G5TA 4JI7B 1TAQA 2HA2A 2R97A 3E9QA 3QNMA 4HBGA 5HZKA 3ZOKA 2WF6A 1MAHA 3BMNB 4Z4FA 2GJ4A 2Q28A 4EY5A 4G36A 3RRJA 5FTWA 3E7DA 2GEUA 2ZRMA 3SCZA 2P91A 5FQOA 1JIJA 1S7GA 1YS7A 1DS6A 4ZOAA 3VR3D 1M1YB 3DNFA 3HU2A 2DFKB 4D0SA 2I1LA 4YN3A 1Y63A 4PPYA 4QQFA 2DFVA 2GRJA 5KX5B 4LXHA 4MDEA 3OT4A 1Y7TA 5CM9C 1PTJC 3NVMB 4I66A 2GA9A 4MX8A 3F8WA 3C3CA 3GJ3A 1XTSA 3NS7A 3ZHOA 1G8AA 3N8NA 5DLPA 2Q5EA 4IGKA 4OATA 4HTFA 4YP1A 4DA6A 1NBIA 4K3UA 2C1EA 1SIWA 2HGSA 3FDZB 1NE2A 5EIAA 3W5SA 5A4KA 1SXJE 1GNQA 3ZK9A 1JSCA 1W581 4BNFA 5GMOA 1JR4A 2IH2A 3QUCA 2WM3A 4J4HA 5AW7A 1QG4A 1VHJA 4WH0A 3UT6A 1POWA 3H3JA 2IPXA 4G09A 4Q7LA 1WP9A 2AZXA 3LW7A 3DAFA 3IIJA 1FRVA 3P9CA 1QKKA 2YJ3A 3ZWXA 4BLRA 2JJ2A 4M0CA 2WA2A 2FCRA 2H1RA 3AVPA 1X42A 3G7UA 1D03A 4OIMA 2JFPA 4X95A 4N0PA 4XTCS 5TPZA 3Q3CA 3TZKA 2UYHA 3KD2A 4YJHA 4HN2A 2R48A 3D4LA 3L5OA 3GD5A 3OKAA 4YRCA 4CQNA 3IBYA 3BKXA 1VIYA 3T38A 4RJTA 3KETA 5ISMA 1KF0A 4E4RA 3CLSC 3UGQA 4YLYA 4MVJI 1JHRA 1UT6A 2WB2A 1UBCA 2AOUA 4G9EA 3L0YA 2HJVA 2KE5A 3CCBA 3KQSA 1NY5A 1PT6A 3ZWMA 2AUMA 1SQ6A 3H1AA 1K98A 3N8HA 2JW5A 4E12A 2FRDA 2IV3A 1IU9A 3B6JA 2BEVB 4JLKA 5EVJA 4BXOA 1EWQA 1TPZA 3F3KA 1BVYF 3L8YA 1XXHB 3DGFC 4JYAB 2J4DA 2Y0DA 1FMJA 5AM5A 2NUTA 1FFSA 3RLFA 1GN9A 4XJVA 5C8YB 2P5YA 3PUYA 4M7WA 2WKQA 2JI8A 3TZEA 1JHDA 3R8CA 1DAPA 3TSOA 1XMQB 1Q2XA 4S12A 5EPUA 1G59A 2Y1WA 5HKLA 4NC9A 1Q7CA 4OQXA 1N32B 2WNSA 5LQSA 4LJ8A 3I53A 4BX8A 4FP9A 1W25A 3AIMA 1G5HA 1SCQA 1JLSA 3K9NA 2O0MA 3P52A 1E2LA 1DP4A 4D0GA 3U44B 2XHZA 3RHZA 2HUNA 4RHYA 1H2FA 1YI8A 3QUQA 4EPTA 4LF5B 5KJEA 5JRZA 2QXUA 2P4EA 3AUFA 3B2NA 2BTQB 2JJQA 1QTQA 4Q9IA 1TUIA 3RV4A 2AR7A 5ALEA 2AR0A 2AC4A 2BM8A 4NU8X 1MAVA 3WGJA 2C2WA 3SKXA 1EE9A 1OC4A 1QTNA 3DBVO 4LZAA 4AZTA 3JARA 2RHOA 3FKSD 1NW6A 3DL4A 3F49S 4EG4A 2PV0A 5FL7D 1GSOA 1XVTA 2FEPA 4D4LA 5K6AC 3G82C 1UADA 3L79A 4MA5A 1F5NA 1KJ9A 4IHJB 5G53C 1M1NA 2KWIA 4OB8A 1SXJA 4D5GA 4TVSA 5IAOA 1BU8A 4ZOLB 3TJMA 5LB4A 4ER6A 4DSAA 4JZKA 2PBRA 3D3WA 5JY1A 3GJZA 4URHA 1LS1A 4YCAA 1LBSA 4OY3A 1JIKA 2G1JA 1EGVB 3BJZA 3NQ41 2E89A 2P9CA 3QV1A 2F3RA 1R5OA 1VG8A 1DKOA 4S1PA 1RR6A 4CCYB 1A8UA 3UIEA 2VRNA 1YZ3A 1AHPA 2IOFA 4IDDA 4JT4A 1N2EA 4FKMA 1FU7A 5DTRA 1KMNA 1WCWA 1WP4A 2O4CA 4OJNA 5JNSA 4XWWA 3LQ2A 2CL5A 4M9RA 1PHRA 2PS9A 4TKVB 4HUJA 2WF7A 1O7JA 2NXWA 4XGQA 2QZ4A 4MYRA 2BFBA 1QR6A 3G2LA 3H86A 4DV1B 4MJ7A 3TTWA 2PWYA 1PR6A 2FLVA 4YQFA 2DLNA 3ZTTA 1E4EA 2AZMA 3AJDA 3LY7A 1EQ2A 1URPA 3PE3A 4ALLA 1CP3A 2NP7A 2QJWA 1P9NA 2X0IA 3AYZB 3CSDA 3RREA 4EJ6A 4YMTA 1Q12A 5TV2A 5KOJB 1TK3A 1NP7A 1U2PA 2IGBA 4HJXA 2OHVA 3GWGA 3IEKA 4BAGA 1SXJD 1IJFA 2ZWMA 2QRMA 4G5YA 1FUUA 3AY6A 4JFAA 3AQ4A 4LJSA 3T9AA 1HE3A 2ZROA 5DGDA 5CA1F 4RTOA 2UZ3A 3ELUA 1XB2A 3AEYA 3OT1A 1C3EA 1DTWA 3MS4A 4DJFC 4FKBA 4OSOA 1HYEA 1M10A 4F6RA 2PRKA 2FKNA 4JJ7A 5TVGA 3PR2B 5LL6P 3KEOA 4BPRA 1G3QA 3TI9A 4ZDJA 1CYDA 3CNBA 2ZSHA 5JHGB 1Q1GA 3E23A 5FLKA 3RAGA 2Q4TA 1LPMA 5T6BA 2Y1OA 5LD2C 1TC1A 4C0QC 3ACBA 1N25A 3DLHA 3R1IA 3ZN2A 4A0RA 4JC0A 2C57A 5FOUA 1UDBA 4MI3A 3T0GA 2HN9A 5FULA 3SMQA 1A9OA 3NKLA 2QRGA 4KREA 1LW7A 4KPGA 5EZQA 2AMJA 2CL6X 2OMEA 4L3VA 2QRZA 3FMFA 3BL5A 1U0OC 4N9WA 4LJ4A 2IV7A 1JWLA 1JFRA 2BFFA 4BTVA 3UWKA 3WLNA 3I32A 1FP4B 1KEVA 2VK1A 1F9EA 3MTIA 1OGJA 4KYIB 2I4NA 3RASA 3RAEC 3PXGA 1NVKA 4YJ3F 3DE5X 4ZZ0A 1IOLA 3MJEA 2I03A 2QY6A 1EE1A 2HHLA 3K35A 1M74A 2IOQA 4UPDA 2GAIA 3JAKA 1AIPA 1EFLA 1LBHA 2BFPA 2UU9B 3JQ8A 5IDWA 3CH7A 4QFMA 1RYNA 1KZ6A 2G1AA 4WWHA 5EQFA 5CVDA 4P53A 3AL3A 1PK9A 3OTWA 3VU9B 3QFRA 1WU8A 1R9JA 3F6BX 4V24A 1XZIA 1NLUA 4ZWNA 3F6YA 4QOFA 1EK2A 4YXWA 4D02A 4BGDA 1J33A 3GLKA 4PYOA 4JEHA 1B8UA 4GOLD 2QXYA 2ODAA 5LOVA 2E5WA 1TZCA 1E2HA 2QIPA 2WSBA 3OJEA 4FOOA 1EG7A 4JP5A 2MSCB 3FX2A 2R1TB 1FFXA 4QT0A 3ZIDA 3W3AH 4DT1B 3DFIA 1YMUA 4QQKA 4G1FA 5CBKA 3CEHA 2QTRA 4XJXA 1XYGA 3SIWA 1FDSA 2VNKA 4AF6A 3O8QA 1KAQA 1QO9A 3TBFA 2FEAA 5CVEA 4DSUA 2YQ4A 3GZJA 5B53A 3CRVA 2ZSBA 1Z9BA 2CLEB 2QP3A 3L7JA 3WB1A 3ZHZA 1VPLA 1T29A 3PDCA 4K9KA 4Y2YA 4YBZA 1TRHA 5H0IA 3IELA 3OP4A 4E11A 5DKFA 4NABA 4AP5A 3GJ8A 2N46A 3AR7A 1EPUA 3GLGA 1GGNA 1KS2A 4MLPA 3K0CA 5L53A 4LKOA 2B2NA 1T0JB 2QLNA 4BRZA 1P61B 3ZH9B 3ILYA 3KQHA 2QM8A 3NEAA 1NZDA 3GJRA 3H97A 2IYZA 2QD1A 3CZ4A 3PPXA 4TWZA 1H9CA 4FGUA 2VPZA 1G5FA 2VH5R 4H7HA 3G7SA 2AV6A 5HFJA 1W94A 4IP0A 1PGPA 3S28A 1VJ5A 5AJXA 4B4UA 1JG2A 2ODTX 4B40A 3IIIA 1OLUA 3P0RA 1W0KA 5FWNA 2WW8A 2M6KA 4DM3A 3V34A 4DVGA 3U56A 3ED1A 1Q19A 1KI3A 1ZEJA 3ZXYA 4C30A 1K66A 4IIHA 1KARA 2V59A 5L3RA 5JD5A 5CX4A 2QUJA 2FLKA 2FDCA 2JZCA 3LRTA 4BO3A 3GWZA 2WWHA 4R8LA 5IMSA 1FS5A 4DLUA 4BV2A 1R18A 4F6CA 4YRDA 2XGJA 4PXSA 5JCPA 4ZOLA 4OA8A 1N2OA 4G4GA 1QQTA 4B79A 3AUXA 3VJMA 3DV0B 4JOSA 4ZHQA 3VJLA 4CT4B 3TM5A 2Q5LA 3DKVA 2C8JA 2CCKA 3ZQ4A 3PNQA 3H1EA 1T4CB 3IEPA 1Z5NA 3B9PA 4XYLA 4DWOA 2NZJA 4HNSA 5FBLB 4DCSA 2VJKA 4RDHA 3EG9B 4R84A 1U0EA 2P7IA 4XKJA 2NPIA 3HWSA 4A3SA 2NP6A 3UAGA 3UB2A 1JIQA 4DQDA 4TLBA 2PT5A 5HS4A 3UT5A 1MC4A 1G7TA 3KK0A 1TRKA 3BL8A 4GOJA 4GXTA 1IZ0A 2XODA 1V5GA 4UDYX 4YP9A 4S2UA 3RT9A 1ESEA 1IUKA 1WB4A 2I5PO 4RGQA 5K9ZA 5KTRA 1DGQA 3RFXA 1Q20A 4RK5A 2X6TA 3ACCA 1MDFA 2SECE 4Q15A 4C2AA 3GPLA 3H8VA 4MUIA 2D1FA 4Y2JA 1G2IA 1QHEA 3KS9A 4RK7A 3CLSD 1QHSA 2R1VA 4K9SA 4R1NA 1CB7A 4EUNA 1LLCA 3DDSA 4F3RA 5HKOA 5C31A 1NR5A 4O3MA 2JVJA 2BEWB 1D9XA 3CURA 4KQEA 4D44A 3L8DA 1LSJA 4MKRA 5CIWA 5FBQB 4AZ0A 2XTZA 1BWQA 1DAKA 2R8ZA 3AEUB 3B82A 1CE8B 3E3AA 3NAQA 4R2MA 4WNIA 5DHQA 5JFOA 4PG6A 3LDAA 4FXOA 2PQ2A 3G1TA 4MQ4A 2H2HA 4MUXA 4ZQEA 4IFTA 1VMDA 5C53B 2GILA 2IIQA 3TX2A 3D1LA 1N2ZA 5KTKA 4WACA 1L5MA 2Q3CA 4KI0A 3GZ4A 2QGZA 2XAUA 2L17A 3IBCA 3ZR4B 4QARA 2HA3A 2GPJA 1V8OA 1RI2A 1XKTA 2CDRA 3NU1A 4CR7A 3R75A 1T2VA 1WXHA 3OA2A 3N2NA 1T1IA 1EIZA 1A77A 3F73A 2HBRA 3H1TA 3B9BA 1Y4AE 3NBXX 3HUFA 1SH7A 5EKTA 1PJAA 1ZCAA 3WI7A 3TLXA 2FQQA 4UMEA 5LZ8A 4Q24A 1PU2A 3RC1A 4RLQA 4X5OA 1THTA 5EWJB 4FHDA 4ECEA 4GX2A 1NYLA 5T4BA 1F14A 4GZMA 2X58A 3DXYA 3UJ7A 5AVVA 3KXIA 4ZCIA 1CZNA 1KVSA 1Z2EA 1AUPA 1TIBA 1E6CA 2XQIA 3DL7A 1O94C 1P75A 4TL8A 3BB4A 2OO3A 2ZM6B 2BI7A 2D5IA 2PUEA 1NU8A 1Y3AA 2HWXA 4DTIA 2O8BA 4N6OA 4HO1X 4RA9A 2WPNA 3PPVA 1QH1B 2VPIA 3E5HA 2QTVB 3QA9A 1C9KA 4H60A 3H5TA 3PZBA 3SG0A 3GMSA 1CHNA 1ZJYA 4I5IA 4JL6A 4JOQA 5LQRA 3DEZA 4RTNA 2WPDD 4MQEB 4EGFA 5BWLA 1NJ5A 3ZZMA 4B2IA 1QF6A 5I7FA 1UKZA 1SHJA 3EDQA 3ZZ0A 3FBWA 3FG9A 2YWBA 2H2FA 2QD4A 2J5KA 1XEWX 1Z26A 3K5WA 3B1JA 3RK0A 3RTBA 5A3RA 4D3XA 2FWJA 2AXQA 3INRA 4EF4A 5E9WA 4I1PA 1C5KA 2JD1A 2V74B 3ETJA 2XGSA 1NUAA 3T5BA 2CN1A 3A2KA 3GHYA 3CLVA 2PTGA 2QRVB 5AK5A 3SKYA 4CMHA 1P3DA 2ZIEA 3WSWA 2WFLB 3B1XA 2C95A 1MOPA 1ZI6A 1YOVB 3B3JA 3IQIX 4HGQA 4UAJA 3EJWA 4XVHA 4ZPXA 4MR9A 4D3DA 1KC3A 2JJMA 2R6HA 3EBLA 1XKLA 4GDMA 5KWEA 1A72A 4TZ0A 1T34A 5K8LA 2DWUA 1QE0A 2W70A 2ADFA 2B3TA 1Y5IA 1UKCA 3AV0B 4I50A 1P8JA 4LXQA 2I6XA 4Q9LA 1JX6A 2K6GA 1B8PA 1Q7GA 4KODA 5ADWA 4HTFB 4ITVA 5ICSA 2OP0A 3I28A 4BQQA 3PI6A 3CUWA 4CPDA 1SQSA 3NPMA 5M2QA 4ZVQA 5C8ZA 3K2EA 4PTYA 1O0SA 3LY8A 1ULBA 1VI2A 1Y7LA 1U3GA 2A5DA 3PA8A 4LCEA 4M1SA 5D85A 5EXTA 1YCFA 2J3HA 3OQOA 4Q01A 5LZ5A 5CT6A 1E20A 1KK2A 2QM7A 5BO5A 3THOA 3S7ZA 1V48A 1D2MA 5B3LA 4IKPA 2DFLA 3II6X 1UKVY 1DFIA 4PZZA 2ISQA 4P6VF 5DSXA 4QHTA 4FTWA 1HFWA 3EH2A 2A0FA 1LC3A 1AKRA 2DKFA 2Q5FA 3AGQA 4HDNB 5J9FA 3N2KA 4GM4A 4CTKA 4JFRA 4GPZA 4B9EA 5AVYA 4JI0B 4K6CA 3L07A 4ESVA 3LKBA 5ESWA 4YAUA 2NU7A 2P6MA 3SHVA 3UV6A 1RTTA 1TJNA 4TT3D 1KYXA 1T6BY 2F6RA 4RH3A 3FYCA 1ENOA 1F5SA 4G24A 4IYJA 2QLFA 3JRNA 1M54A 3TO5A 3LLVA 4BMOB 2ROQA 1ML4A 2C5BA 4HCJA 3OTIA 4LWZA 2IA5A 2KQUA 4FYVA 4OD0A 3D7MA 5L3ZA 2HT1A 4DV7B 2OCAA 2YFHA 4DAEA 5ENDA 5DSTA 1KGSA 3BH6A 4AUNA 4TKMA 2RD2A 2O2DA 1KAGA 2P75A 2WUFA 3MJHA 4AW9A 4DDUA 2WSYB 3VU0A 5BN4A 2B8JA 1RWWA 2OG1A 3A04A 5SICE 3EXEA 3R7SA 4BMNA 4BMVA 3GYBA 1UC9A 1I1HA 1LI4A 3M6FA 3H5OA 4MICA 3VHXB 2B36A 2A9JA 2XQFA 5K8VA 4Z7NB 4BZWA 2H7YA 4XD7D 1N8TA 2X3FA 1VECA 4Q4LA 4YI3A 3TLGB 3WHKA 4ZK6A 5ED4A 4MLDA 3KXKA 4AYXA 4Z4GA 4PIMA 1WVMA 1PNRA 3PFBA 2QDXA 2FGJA 3C8HA 5KQGA 1VTKA 4FMPA 3W2IA 3RFTA 2UUPA 1O5OA 4G0MA 4BQFA 1JPVA 3P8ZA 1SU7A 4RXTA 3E18A 3BXEA 1EJBA 5JCXA 3O0TA 3AUUA 4UD6A 3FWHA 4RPIA 3W04A 4B4DA 1PRYA 1LDYA 3ILSA 2IXGA 3NYWA 2RCYA 3RSSA 2PGXA 3L1VA 7AT1A 3BXHA 1Q7TA 1HRKA 2IW1A 4OI4A 1YJBA 5JJKA 2HMTA 4D26A 2VDNB 1SC1A 1ZSVA 3DBOB 1YQDA 1Z6AA 3DDUA 1GL3A 3NTOA 3PB3A 5BN1A 4MUGA 2JATA 2W6QA 1L2TA 4Q48A 4O2BA 2JANA 2Q5QA 3DNMA 1UK9A 2G09A 4PONA 2IP2A 3FYUC 3EEIA 4Q6BA 1E1MA 2JZNA 1D0VA 1HZZA 2ZFUA 3D2CA 4HK4A 5EN4A 1Z6QA 3I42A 2MSKA 3AP2A 3REFA 2KJQA 2VJAA 5LU9A 5AP9A 3F4BA 1MFPA 5GINE 1JJBA 1F2UA 4V39A 5HRCA 3MBIA 4C76A 3HPRA 1PLKA 1Q92A 4ZT2A 1I7DA 2AN5A 2FMFA 3ELYA 5HE8A 3AVYA 5FI3A 1HO3A 4X90A 2Y1GA 3INGA 4JBWA 1E5VA 3IRVA 1UIRA 1AQIA 3WIDA 4EB3A 5HQ3B 1LFAA 5JQGA 2IHUA 2I6FA 3DE0X 3K3PA 1RKVA 5AO9A 3MD0A 1CRPA 4KX5A 5BSWA 4M99A 1E2IA 1TLTA 3IQWA 1WOMA 1KFKB 2IHYA 4M98A 3WHIA 5BUCA 4IV0A 4C3VA 2C1XA 4LMBA 3A6FA 4XWYA 3WRXA 1XK7A 4ECAA 3R40A 2I3BA 3IHTA 1J22A 3RNOA 1VA4A 4BGEA 4FZ3A 1FYEA 3QUSA 3ROXA 1GUYA 2VP4A 1O4WA 5KEIA 1EFAA 5LWQA 2G76A 3GRFA 3LF1A 3PC4A 4PU0A 1Z8NA 3T52A 3HYLA 1J8VA 4N7BA 4BY9E 4WOJA 1J0DA 4MR7B 5K0CA 3ZE8A 3ZGVA 4MITA 1K4YA 4MWSA 5DLYA 3K0HA 3UG6A 1IC6A 2WOOA 1T4DA 2VTVA 4BQEA 4TRRA 2I78A 2P9JA 3A0UA 3FCUB 4YRSA 4QE3A 4JBXA 3F9RA 4N76A 3CJQA 2PVPA 1REQA 4N7RA 5COQA 4RSHA 1HH4A 4MCJA 1QHFA 2IEBA 4G4IA 4NZNA 2Q9AA 5J2UF 1UJNA 1YIDA 2NV2B 2VO1A 3C16C 3K0FB 2OT3B 3BSYA 2OD7A 1R0WA 3Q9UA 4J7UA 5EFZA 1B2RA 4RMNA 4BQNA 1T0PA 1SOUA 2FX2A 2Q41A 2Z9CA 4ZVLA 4A8JC 4UTNA 1XTKA 4RE5A 2VAMA 5TSDA 5LYJB 4JGIA 3V1TC 2EKPA 1GV0A 3AG5A 3IR7A 4NEHB 2C59A 5CHYA 1E1DA 3L6RA 5TR9A 4DEXA 4FZJA 3Q0EA 3EQZA 3UPDA 1RM3A 1UPBA 2H31A 4BB0A 1JFTA 3F4KA 4M8NE 4UNNA 4BWYA 1GQRA 1BN7A 1J2YA 2XITA 3IMCA 4FQ7A 3OPNA 2O05A 2XXJA 3F6EX 5AOBA 4BEVA 1GHTA 3SZLA 3TNDA 1W5AA 1U9ZA 3MMSA 2P5UA 4Y8VA 1Z4PX 1JAXA 1D2AA 3L7CA 3PFNA 4REQB 4RVOA 3U4DA 1T9ZA 3NKVA 4BLWA 3GN1A 4C3OB 3A6GA 4KO3S 2CK3D 4OJKA 2VJLA 1TOAA 1XHEA 2P4SA 5EHXA 4Q02A 4QUKA 2ZRDA 5C3UA 3SIPA 3TVYA 4A03A 1IBLB 3FRIA 1H6BA 3EG5A 3KB1A 3IH5A 5ERXA 3BXZA 4LX8A 5D1HA 3CG4A 3FETA 2BEWA 2HPAA 4FZ5A 1L5KA 1V3TA 4DJ5X 2FSSA 1D0IA 2QRQA 5HGXA 4GUDA 1HBJA 2JPDA 2W2QA 5CTAA 3QTLA 4A6PA 4NE7A 5T6MA 3HCFA 4BMSA 4DV5B 4EFMA 1FF9A 3REOA 3AHFA 4M0DA 3H2HA 4LSGA 3RJZA 5HIJA 2EZ8A 5BSUA 3DKPA 3KQUA 4LQ4A 1VE5A 2J3DA 4CM3A 3AESA 4HH0A 3DKKA 1Z7WA 5E7QA 4S0ZA 2G25A 3QEAZ 1I24A 3ORYA 1KH1A 4L9RA 4JITA 4EJMA 3AWDA 3ANMA 1PL7A 4BZQA 4D9CA 1GTZA 3MLBA 2V7VA 5GGYA 3VNRA 1PT7A 1RI1A 4PQYA 5G4LA 3ROQA 3INYA 2OY0A 3SQXA 2QX7A 1QYDA 5F76A 2D54A 5ES4B 4KIJA 3L1KA 5FPPA 4ZXPA 5ITSA 4RA9B 3WGLA 1BXZA 1RRMA 2QVCA 2QYTA 2WUDA 4FQ5A 4LGVA 3NBUA 2FX3A 1J20A 1QZXA 3I9V1 1QVVA 3G17A 4JBIA 4ZAWA 2WE8A 1IUNA 1DKMA 1VJ0A 1XRMA 2HLDD 2ORWA 1J49A 1E3EA 1VMEA 1NI4B 2A94A 2ZK7A 1X7XB 3DQZA 4KQJA 4RTSA 3I34X 4CKWA 1ACJA 3DM9B 4LJ9A 3A9UA 5J63A 1P5ZB 2C8KA 2AT1A 5CT5A 1L9KA 3L8EA 5T57A 1ZG3A 1SBHA 3OJLA 1DAEA 2Q07A 2TMYA 3FB1A 2DAPA 5LBTA 1PS8A 5WRFA 3U4GA 3ZWDA 3IQEA 3HCWA 5BR8B 3BTOA 3L9WA 4M9SA 2ZCJA 1PEYA 4JI3B 4MUMA 4DDTA 1G4UR 1JQLB 1RLOA 3A3NA 4FBGA 4D8VA 3QU7A 4FUTA 1NUUA 3G0IA 3EA4A 2YWCA 2W2MA 2Z57A 4HWRA 2IU3A 4RANA 3RE1A 1CIPA 2YYYA 3QVMA 3HKDA 2GNOA 2OEPA 1HURA 2CNNA 2QTFA 4DN6A 3IBSA 3OF2A 3N0WA 2XZDA 1BDHA 1C7EA 1VSVA 2Q6VA 3E4CA 4RMJA 4UUQA 3VH3A 2R65A 5JRJA 1EUCB 1FDOA 1IIBA 2BV3A 2OV1A 5HGJA 5B3AA 5IT5A 1UMCA 1HDIA 1YMVA 4QYSA 4MYCA 4U7GA 4B6FA 4EY6A 1UKYA 3WV5A 3KJIA 3VKHA 1GGVA 4UFOA 1CUAA 4CTJA 2C7RA 2VUHB 4M9QA 5F1YA 2YMQA 1VG9B 4ZI3A 3HNOA 4CT5A 1MT0A 3HBJA 4DANA 4J3NA 1WUYA 3U81A 1HFJA 1ORDA 5IC5A 3QX7A 3QLVC 4DCNA 2Z95A 4I1OA 2GAAA 2TRSB 3RVRA 1GYQA 4BVGA 5IXYA 4LYEA 1OI7A 4GX5A 3LKVA 3G2KA 1ZCZA 1PK7A 3HDJA 4Z0TA 3RSHA 3ZVLA 4F96A 1OJ7A 2H16A 2WG0A 4A7PA 1RNLA 3PDUA 4YQEA 3K8QA 2Y0BA 2ZOSA 1P4GA 4QU0A 1YUMA 3ZX5A 4QUEA 4LF7B 1XNQB 3F5QA 2Q46A 3OX4A 4EG5A 3I05A 2ZB4A 4YNBA 2HHJA 3LFTA 2ZI3A 1OXTA 3HDYA 2VP3A 2OAGA 1DV2A 1XQYA 1SQGA 3WLQA 3LP5A 4V0QA 1VMAA 3C8DA 1MIOB 4JR1A 4XWGA 2DBZA 1UQUA 3OY2A 1JDPA 1AGYA 1X77A 2H1WA 4R1UA 2DFNA 2YFQA 4A2PA 3MD9A 2XRMA 3CPHA 4Q3NA 1NIJA 2GJ9A 1RQ2A 4U4AA 3RB8A 3W8EA 2BGUA 1XWIA 3T4EA 1E96A 2O8CB 2R8EA 3GUVA 2TS1A 3N2EA 4U7PB 3DCYA 3RWOA 4IXWA 5IW8A 3N5CA 3PX7A 1G8KA 2R1VB 3N0TA 2GM4A 2AN1A 4EITA 4UBNA 1H1TA 4YRIA 1U0GA 3W7VA 3NHSA 5JPIA 2HH9A 2I4TA 3E0XA 3HFSA 5B1IA 2ZDGA 4KH1A 3H16A 1YT5A 2G40A 1U0TA 1NULA 3D8UA 4J0KA 1OROA 2ZRAA 3ENKA 5AICA 3C3YA 2C7GA 2NZUG 1VJRA 2ANCA 1CUDA 5LVAA 4A36A 2IU6A 2GGSA 1LQUA 4HH4A 1I9CA 4CV3A 1XTJA 2XWSA 3M5CA 5TT0A 3W06A 1OA1A 3SMVA 1UBKS 4KZKA 1L5SA 2P4HX 3A4LA 4LRUA 4CKBA 5CDYA 2QT1A 3T1VA 4PS0A 4F6LA 2Q1SA 2P6OA 3I5YA 3BHIA 3C7DB 1OI2A 1YKFA 3G79A 5HIMA 1LQ2A 3RC8A 1WABA 2I7CA 3OM9A 1K7XB 4ZQIA 4NYMQ 3T06B 1SHLA 2QE6A 3WIEA 4BJ1A 4BLUA 1MPXA 3LPNA 2YJ5A 3O7WA 5ABPA 5JNRA 1G7CA 2I8LA 2C88A 2H1HA 5FP0A 3EA5A 2AX4A 3KOXA 2GD6A 3ZJVA 5M34A 4R3NA 4UDXX 3LPLA 1D2GA 3OQIA 3HYSA 2W83A 3GR6A 1RW4A 4BKMA 2PLWA 2AFIA 3ZDRA 2JHCA 3FAKA 5GP1A 1RBZA 1SB9A 2P0AA 4AIRA 5TMDA 3RVNA 3V1LA 3WIVA 4OX9B 3MB5A 1E1KA 3MK31 3OEWA 1T1SA 3G9ZA 4E14A 1ZNZA 13PKA 2WM8A 1H9BA 3GRPA 4GUAA 3H05A 4IVPA 4RVCA 5EEHA 1JBQA 2YY6A 3BOSA 4QPCA 4QOJA 3FTPA 3K0EA 3ZGXA 4C05A 2RCNA 2C29D 3STTA 2ZR8A 1Q1BA 1DC4A 1DLIA 3SU8A 5F3WB 1JZTA 4V3BA 4OUDA 3ZE1B 1U6KA 1Y6FA 1T3ZA 3LHSA 1HGXA 1DEKA 3I83A 4N03A 4YP0A 5E3IA 3EFEA 4BFZA 2O59A 4AULA 3FJOA 4UVGA 2BGRA 2JD2A 4FFBB 4HWGA 5LNK6 1XTVA 3TUZC 1J1ZA 3FBTA 2IS4A 2EFDB 5KOHB 1HEIA 3QWAA 4EG0A 1SRRA 4L85A 5L95A 4BZXA 1TT5B 1KPIA 4JLPA 2E7ZA 3GG2A 2I54A 5FTKA 3KQWA 4LDNA 5TPWB 3LLCA 4C9BA 1NVXQ 2VQSA 4CEJB 2MOKA 4RLHA 3DOUA 3W2FA 1IFXA 5FPKA 1ENPA 1E63A 1ZJ5A 3AETB 4A2QA 1ZL2A 3MGKA 4DIMA 3HUDA 3OZUA 1U4SA 2JGEA 2PLFA 3N8DA 3QG5A 4IIFA 1XN1A 5AKEA 5A0VA 2ERCA 5I9BA 5M3BA 1ORRA 1P45A 1P0CA 1ZBQA 3A6PC 1WAMA 1I94B 3FFTA 4HF7A 3ZX4A 2AQKA 1PUJA 5AHRA 2O19A 1GL6A 3B89A 4KWEA 4LG1A 5EIBD 5HBGA 3THWB 4ZGGA 1QQAA 5DU2A 3ML1A 1VL8A 1TM4E 3IDQA 4PLPA 4WASA 4K6GA 4Z9AA 3HVUA 4RVDA 2B69A 5EFOA 1C9MA 1EFTA 1FUYB 5FHQA 5BNFA 3S5JA 4F2WA 3WVNA 3MERA 5KTSA 3VO8A 1X1QA 3D1VA 5HP4A 3GLFB 4GYKA 1KIMA 4HEQA 5J59A 2P3LA 2QZJA 3JD4A 3ZWVA 4U5QA 4DQLA 4X1KB 3UMYA 5FYDA 1TJ5A 3C70A 2Z56A 3DD5A 2B7CA 3G5MA 4U39A 2UZ1B 1VSTA 5K03A 4U63A 3ZUPA 5KAMA 5JAMA 1CG6A 4G9BA 5FBWB 2JFZA 3NHJA 1Y98A 1BEEA 2ZQYA 3QXCA 3HXOA 4CFSA 1FVHA 1JQEA 1DRJA 4C01A 1H0SA 1OXMA 1D6MA 1PG5A 1R6BX 4OQZA 5EGNA 5F2EA 3S2SA 4F0JA 5JYDA 3AJ8A 2VCHA 2V7PA 4BNVA 3ROKA 1L5YA 1W6RA 1N9KA 5CLGA 4B4WA 1T35A 4FU0A 5CLFA 3AXTA 1NU6A 3WO1A 1BNCA 4NAHA 4AJEA 3VX4A 3WB9A 1CLEA 1NVAA 1P2FA 2ADMA 3LIIA 4P3YA 4Z9BA 1VIAA 1IWOA 1QF7A 2A0WA 4CGYA 3FROA 5DFAA 3RWBA 2L0XA 2WNHA 2B98A 3EF0A 4F11A 1N7IA 4AC9A 1D2RA 4HYQA 4ZYYA 1WULS 1L4HA 3RS2A 4EG7A 4ZYVA 2HCBA 5SV2A 2WTUA 5AKHA 2DPGA 3LPDA 1Z4JA 3LLUA 4PG5A 1GPUA 3ROPA 3L05A 4MR8A 3L7YA 2ATEA 1IBSA 1WW3A 1Z0DA 1U0LA 1Z39A 4IGFA 4L5BA 2GQ0A 2W58A 5BOSB 1AM4D 3K6SA 4K05A 4Q0MA 5LQKA 2QZ9A 4U02A 4NG4A 4TWIA 3SJAA 3BN3A 2AG0A 3MCAA 1OBOA 2UZAA 3OO1A 1TO1E 5F78A 1AKEA 5JJIA 2QD5A 3DBRB 4X8HA 4WCFB 2H0RA 2HMSA 3H2ZA 2AE1A 4YO8A 2SCUB 3F8TA 2EFEB 2QAGA 1U5BA 4HQNA 4ZYUA 4G63A 3LVQE 4WLFA 3M1LA 4Y7CA 3UTDA 1ZIXA 4E4TA 2WAAA 3OIVA 1GAXA 2B7BA 5KPJA 4F84A 2B82A 3B1FA 3G9QA 4XH9B 4B3SB 4U7FA 3BFJA 4DLWA 1JI3A 5EOVA 3H17A 1TW2A 2K7FA 1QP7A 1XZCA 1WVIA 5FB3A 4ZEOA 5L3VA 2CFIA 2J45A 2P90A 4D9KA 1ZVQA 1C7IA 1NJ6A 4IVNA 2BMWA 4CIAA 3N2GB 2GRAA 2C4MA 3C3KA 5H1YA 3ZHTA 4W8OA 1QHHB 3EEBA 3PC8A 3PA6A 3IAHA 4M0LA 4QPZA 3VH1A 1E7WA 3P2JA 1NW4A 3BK2A 4OJQA 4P7KA 1UBSB 5D3QA 3QUAA 4MJLA 3MC1A 4BN5A 1X74A 3SBEA 3KJNA 2HDOA 1EFKA 2PSDA 1EVEA 3UGJA 2C2MA 3G2OA 1XZLA 3D59A 3E8MA 2NX2A 2NZVG 2OB2A 3MTQA 1K7SN 1U4OA 4GI5A 2IX9A 1LRKA 2FN3A 1BE0A 4DMHA 5FOQA 1P5FA 1QLJA 4O63O 4W8GA 4HYTA 1J90A 2XNJA 5LD2B 3VNBA 2HNBA 4FZRA 4HAOA 4NU6A 1RJGA 4CM9D 4WBNB 2LCFA 5E2AA 4F8YA 2XIQA 4WXMA 2X9GA 3T99A 4INAA 4WLOA 1U80A 1KY3A 5FTNA 4UHCA 5EZ5A 1C41A 5TNXA 1CHDA 3KTAA 4JENA 4OQNA 4Y98A 1VKJA 3UA3A 3VYWA 4AQDA 5TC4A 3V8BA 2F8MA 5GPBA 4BV8A 5GJVC 4BO8A 3MMPA 4ND2A 4EGSA 4MMXB 2HC9A 4Y0AA 2O1WA 2FJPA 4M1EA 2XVMA 2REXB 1N0HA 2GEKA 3ESBA 3GFGA 3K5IA 2VOEA 4R8SA 3QP9A 1C1DA 3CWQA 4RY2A 1KEZA 1MJ5A 1Z18A 4RPJA 5P8WA 1EVQA 2ZSUA 2VOJA 1BMDA 3KR0A 1PJLA 3TQRA 3GB9A 1E4YA 1R88A 1V1JA 2Q2WA 2VXOA 3ENWA 1SXJB 3I1FA 4IIDA 3UWPA 3WS7A 4DE5A 1W6UA 3G8DA 4LOJA 1NURA 1D1PA 2OBYA 5B57C 1K6XA 2C9MA 4X7PA 2XMGA 4BP8A 3TAHA 2P7HA 2CFSA 4PRZA 1J2EA 3HLTA 1TTPB 1OZGA 2AKAB 3U4QB 3NOOA 1GRNA 2ZWAA 1LGYA 2HLNA 5AJUA 3HXMA 1YFKA 4ZYLA 3COWA 3ADKA 1Q0HA 4XX1A 4I5EA 5KOIA 3QOXA 3CNLA 4FDLA 4HY3A 4OHZA 4Y1RB 4QM7A 4K1XA 1V1MA 5ELXA 4PW0A 4G1EB 1ANKA 4BNXA 2H1FA 1MIOA 3HVKA 3CNEA 3KZ1E 3PLNA 5EKSA 5KNBD 3HN6A 3MNFA 3NHZA 4L16A 2CZCA 3KELA 1ECLA 4R83A 4EWLA 1KJ8A 1VCHA 3O1LA 1LNZA 4WFJA 1AKQA 3V4FA 4RTMA 3FGPA 4L4YA 4UU0A 4D45A 1O6BA 1WXDA 1IB0A 3TQHA 1LD3A 5JSFA 1YJXA 5JDCA 4X41A 1NW5A 2RGWA 2X9LA 1U1CA 2FFRA 2H85A 1LF5A 1HF3A 4QATA 4LW8A 3X2SA 1ND6A 1RQPA 4P4TA 2GRUA 5EMMA 3RJ9A 4UEJA 3LDFA 5TLSA 3OE1A 3PNKA 3FOBA 2W6OA 4LYHA 4L50A 4AX4A 4J1SA 4BUJA 1TVKA 3HO8A 4RHFA 3E27A 1ZNXA 2JHPA 4ZCSA 3K9QO 4K8OA 5ALHA 4GZ3A 1DV1A 3O2QB 5EIBC 4LFBB 2R11A 2GPYA 2IUYA 1QFSA 3LFHA 2OXCA 5I4KA 3UBTA 3DD1A 4D4KA 1MVOA 1GLNA 1XX6A 1KFJB 3A6JA 1P7VA 3HVJA 3QITA 4XFKA 3DT8A 2RBEA 1FVFA 3BVPA 3S2FA 3UJ6A 1VYTA 3W34A 1H1LB 4B8YA 2Q21A 4GMGA 1QB7A 3LV8A 1IULA 4P81A 3DCJA 2I9PA 1EFPB 1V5WA 2NT3A 2ECOA 2P41A 3AYXB 2OWEA 4HDAA 3S2GA 4DA9A 4DUGA 4JASB 2I1QA 4OGGA 3GIWA 1G5TA 3ZCUA 5JS8A 4MQFA 5ITZA 2BD0A 2WJ3A 2BOVA 3HA5A 4QU5A 4B32A 2BIFA 1QJ4A 2X4IA 3VX3A 1QO0A 1SWVA 4AFNA 3DF9A 1QCDA 3SM3A 1ZHOA 3B78A 1SCKA 1OD6A 4QBFA 3DPUA 3WDMA 4QDTA 2NUPB 3AT1A 4ITRC 2XUIA 4LHSA 4QXRA 3IURA 2VK2A 3M82A 2W22A 2G1PA 1AXEA 5A2QA 1QG0A 5DT9A 4U8HA 3CTMA 4HRYA 3TFWA 4NP6A 4UCFA 5E6SB 4HJRA 3K09C 5DIZA 4G1VA 1ETUA 4IJQA 2VYND 3BTUA 1WHTA 2DPMA 3L4BA 1YS6A 2PMEA 1PT8A 5CAEB 5TMPA 5DM2A 5JSUA 1KI2A 5EJAA 1KYYA 2IP1A 4NOKA 4BJ3A 1J5EB 4DPKA 4O4HA 4E31A 1M34B 3MYRA 5HIIA 3TDMA 1AZSC 5AKJA 1XZPA 3JWHA 1NRIA 2XTMA 3TTYA 1W4AA 3AQIA 3GCGA 5JADA 5BSGA 4OX9Y 3QU5A 3ICEA 5JCZA 4NZZA 3GP8A 1Q16A 3MAGA 4GQIA 2O8BB 5GQSA 4E15A 3VYUB 2J67A 4GVPA 1K89A 1JSZA 5JMOA 1K8ZB 3FDFA 2I3ZA 1XNHA 1DXQA 2D0OB 1TYAE 3BMNA 1HFEL 2HM7A 3MWEA 3C74A 2FZGA 2ZIZA 4OB7A 1FXSA 5AVXA 3H11B 3X44A 3OT5A 3G23A 1ECFA 3KYIB 3QEBZ