4J7ZA

Thermus thermophilus dnaj j- and g/f-domains
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein DnaJ 2
publication title Combining crystallography and EPR: crystal and solution structures of the multidomain cochaperone DnaJ.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 33
structure length 100
sequence length 100
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4j7zA00
2QWOB 2QWRB 3AG7A 1IURA 1GH6A 1XBLA 2CTWA 4J7ZA 4J80A 1N4CA 2DMXA 2N05A 2GUZB 1FAFA 2CUGA 2Y4TA 2CTPA 2QWNB 2YS8A 2Y4UA 2L6LA 2DN9A 3APQA 2LGWA 1NZ6A 3BVOA 4RWUA 2KQXA 1WJZA 2CTQA 2PF4E 3APOA 2QWPB 1HDJA 2QWQB 4IT5A 1BQ0A 2N04A 2CTRA 2LO1A 2EJ7A 2YUAA 2OCHA 2QSAA 3UCSC 3UO3A 2GUZA 2M6YA 1FPOA 1BQZA 3UO2A
chains in the Genus database with same CATH superfamily
4CH4A 5LA6A 4CS4A 3MD0A 2P4VA 3RYHA 5K1PA 4TWKA 2NNUA 1QR8A 2Y4UA 1FFTB 1VMGA 4GKJB 4CS2A 4DXWA 1OCRC 2VWKA 3HKCA 4DUYO 3OAAG 2IW5A 4B3SO 1G8MA 1WAZA 1YJWV 4GKKO 5LOVA 5LHHA 4P9PA 3JCZA 1ROPA 4ZIBA 5HFMA 5C93A 4IIJA 2H8PC 1S5LZ 1V55B 2IH1C 1MA1A 2ZT9B 1XUQA 4FPPA 2YI8A 4DR4O 4JASA 1EN5A 3P3PA 4JYBA 3QNEA 1TUBA 1WPBA 2ZR2A 2EJ7A 2IJIA 1QHTA 1R3JC 3FYIB 3QO7A 1NH2B 4EEQA 4AI8A 3HKDB 4I4TA 3FB8C 1AR1B 1KKDA 4OPAA 2A3QA 4EFBA 2EILC 1JR9A 2UXDO 1TUEB 2BSKA 3SDLA 4DO2A 1Y76A 4TV9A 4L87A 5CA1A 2QKAA 4O2AB 2JEUA 2Q5ZA 1ZAUA 5LMUO 1N8RW 4TOIA 4X89A 4B7KA 3E8FA 4WFBV 5CN0A 4J42A 4LF7B 4H44B 3X2QB 2V7QG 3TETA 1YHQV 4X64B 1K4DC 4K0KB 1ZLZA 5L3FA 1YDXA 1QLNA 2QWNB 5JCOA 1N32B 2XOKG 4LF8B 4Q20A 3SJAC 5DECA 3AG3C 2QEXV 5J2TB 4QPJA 5FLXN 4DR3O 1W0KG 1GK9A 3JD2A 3UO3A 4ZBMA 3RW0A 2F1MA 2GBOA 5H6RA 3JCUZ 5LGNA 4G27B 2KQXA 5LGTA 1US6A 4DV7O 2AHYA 5KAIZ 1ORQC 4W4LA 3UT5B 2JRIA 5KHKA 3ZBHA 4IYHA 3CHXA 2V1DA 4I55A 2WSSG 1FPOA 2K1EA 2EIMB 2EINC 1JCHA 2CAZC 4DV5O 2E74B 1NVPD 2EIJB 4DV4B 4GT1A 3D36A 4UCTA 4YJ2B 3AG4B 5BMVB 4RQEA 4DR2O 2A06H 1KYOF 4UCOA 3M8AA 4PI0A 3WG7B 2JJ1G 3LSQA 1T5EA 4HNAB 2ZDIC 5H9CA 3OD4A 4LFCO 2EJRA 2QWQB 1TA8A 2AW9A 1K5QA 1TGOA 3SGIA 1QVFU 4WFFA 1XEQA 4X62B 2F93B 4JI5B 3K3WA 4F4LA 1K7DA 1Q86W 2DWEC 5HFLA 4F6RB 1GN2A 3N27A 1OV9A 3JD0A 4UCVA 2HR3A 1RPRA 3E35A 2XAQA 1VP7A 2GSMB 1IBKO 1B6QA 5LXTA 3SPHA 3OGIB 3CCEV 3J80N 1IVSA 2QWPB 1PNLA 1UPGA 1SKVA 3B8MA 4YXWG 1EN4A 5BMVA 1R6TA 5FNVB 1RSOA 2CH7B 4RUEA 1SA0B 1Y4MA 1FJGB 2BTQB 3N2GA 4FLXA 1SQVH 2CTQA 2FL4A 1CXZB 3APOA 1DF4A 2P22C 2LO1A 3E2EA 2Q0AA 3SJBC 1J5EB 2PYJA 1VF5B 5KLVH 3FX7A 4DR1O 3KCYA 5B1AC 2C2AA 1P7BA 3UKMA 4LF8O 1FAFA 2XNDG 4H13B 2VQFB 4JYAB 3T4DA 5KMGA 2YSUB 4UFZA 4R50A 4FZ0A 5JQGA 4QIWF 1IXMA 2Y0PA 4DV3B 1FYJA 3T1HB 1XQ8A 1FXVA 3SJCC 1B06A 2KB1A 2YIBA 1CPYA 1KKCA 1XMQB 5EYPB 1F4NA 4OX9O 1YF2A 1Y74A 2X0LA 4ZOLB 1R6NA 5IJ9A 4MW3A 1GTOA 3JATB 4BIUA 1SA0A 1AI6A 5LP6C 3PN1A 4DV4O 1NTMH 3FYEB 3T1YO 3C90A 1GN4A 2NLJC 1NR1A 1WA8B 3BY6A 3VQWA 1IBLB 4B3RO 3IGAC 3DXRA 3OMIB 2QM7A 1SQBH 1R73A 3C3TA 1RFYA 1BE3H 2HFEC 4LF6B 1P4RA 1IZ3A 5KHIA 5ITZA 3QG5A 3GWOA 2HHHO 2DE0X 1JFFA 1BS3A 3L71H 1SQQH 5CB4B 4W4KA 1Q43A 4LFAO 2X6CA 1NS1A 4B08A 3S3XA 4NXMB 3AG2B 4YIPA 1N0NA 5CA0B 3NXSA 4LH6A 4QE7A 3LDEA 1MZFA 1NKDA 2UXCB 2YIBD 1S3JA 3D3QA 2GUZB 3E8HA 1V55C 2OWOA 4U7NA 2JJ2G 3FB5C 5GONA 1S77D 1JPXA 1M56B 4MVSA 2KKWA 1LR1A 2EULA 4PELA 1Q6IA 1PV0A 4U3FH 1K33A 5KA5A 1KP2A 4GYCB 3ZHTA 4DK1A 5L3EA 2F95B 2HLDG 3OMNB 4UCSA 2M7WA 3P30A 3RWRD 3JARB 3JAWB 4HAMA 5J2UB 1L1FA 4P30A 1SS3A 3F5WC 1MSDA 3CSXA 3H1JH 3JALB 2WPDG 3KZIZ 4TUYA 4DR5O 2VQFO 4JYAO 1N0JA 4O4HB 2JIZG 2PI4A 3SYPA 2R72A 1J95A 5EIBD 1NU1H 4DV3O 3T1HO 4JI2B 3TGUH 2GUZA 4JTAB 4PA6A 3HPLC 1PKXA 1L8DA 1NI8A 2CTWA 3OUSA 1AR5A 1OCZB 4CH3A 4LF4O 2A9HA 4DV1O 1VQOV 3WB0A 4MW8A 4FJCC 1BGYH 4ZHQA 5IDJA 1HNXB 4A5UB 1VQ9V 1XL6A 5BXZA 3CX5F 2WLNA 3ZMTA 1CP9A 4D7TA 1VQKV 1IXBA 4J10A 2CGNA 4J7ZA 1JMKC 2HKOA 1IBLO 4IYIA 1M90W 4DRXA 2L6LA 5JJEB 3JAWA 4DW1A 1H2GA 1FS0G 5EBWC 3OUFA 3AG4C 3OGCC 1L0LH 3L74H 2IH3C 4RQFA 4PV1B 1SQFA 1WB8A 5B66Z 2W6JG 4NKGB 4YY3B 2Q7HA 4LNUA 1N33B 3ABMC 1F51A 5KX5A 5TISZ 5LA6B 4JF3A 3O9OA 3RYHB 3OEEG 2CTRA 1GAXA 3G71V 2Y48A 3A0HZ 2F43G 2E76B 2QKCA 2Q7GA 3HKEA 3HKCB 5B1OA 4Z1MG 5IYZA 4PD4F 1QCEA 5IJ0A 2P6JA 2DMXA 5LOVB 4TSFG 3P32A 2LGWA 5L3GA 2QM8A 3H1KH 3RYIA 1AP6A 1RM1B 4XDLA 3JASA 3ETGA 2IJHA 4GX2A 4JTCB 4E2LA 4JTDB 3ABTA 1JVMA 1TUBB 2Z3YA 3ZMVA 4PJ0Z 2F4VO 2PUSA 4QPKA 2NR5A 1BMFG 2KSDA 4LF9B 4I4TB 4NTWA 1N36B 5LMNB 1NVPB 1NBMG 1DF5A 2UU9B 2BSKB 1Y76B 4TV9B 5CA1B 2YEVA 2GV9A 3LNMB 2WLJA 4KFMA 3CXCU 3HR0A 4UB6Z 2IU3A 3R66A 3RYFA 2UXXA 2Q67A 3THOA 5L3BA 4X88A 5KA6A 3G80A 4FLVA 2JS3A 3H9VA 3T2MA 5J9PC 1KU9A 4F6EA 3CPWU 2XAGA 5F2VO 3K08A 1HR0B 2OIEA 5CBGA 4KHPO 3G6BA 5K1XA 3ZIAG 3W7UA 5BR8B 2ZIOA 3CB2A 4LR3A 4JI0B 2QJ1A 3ZRWA 3D3IA 1HNZB 1HNXO 2Z5UA 3BAAA 3CS5A 5B5EZ 4J9YB 1WP7A 2BOCC 5DEDA 1D5AA 1R3LC 2B1GA 4X65O 1IBMB 2VRZA 2FB5A 3SPGA 4J7KA 3WB1A 1KB9F 4U3JA 1QVGU 1GMGA 1PNMA 4I55B 2XUMA 4BAYA 3FAVA 3DSQA 1M57B 2HJFC 1VF6A 4DR7O 3VQXA 2AXTZ 3PJSK 5H2FZ 2DYRB 1U96A 2O57A 1AROP 3ZN0A 4B3TB 3BRCA 2Q6AA 1OCCC 3CMEV 1N33O 3EFFK 4X8AA 2CK3G 3LDCA 1F4MA 3IFXA 3MAQA 1N34O 5GTIZ 3ZHQA 3B8NA 2E5LO 1UJWB 3EXAA 1SETA 4YHHO 4OXSA 3JAMN 1WPXA 2X7RB 2F66C 2ZNJA 1IURA 1Q3EA 4X1IA 3E8BA 2DYSB 3T4ZA 4WF9V 4MVMA 2ZM6B 4WCEV 2UUAB 5IE9A 5IY5B 2BOBC 1XMOB 2L35A 5FPRA 4JI6B 2VQEO 3JAKA 3SYOA 2ATKC 2JK5C 2DOSA 3RGBA 4DW0A 4MVOA 1KBHA 5LXTB 2K9PA 1MOFA 2JGDA 2WLMA 2GTAA 2UXNA 2YDEA 2D3OW 2OIGA 5E79Z 2Y4TA 3ASNB 3IJ4A 5EBMC 2JS5A 2ZCEA 3LSSA 3RFRA 5LMNO 4KUMA 3KG2A 2X6AA 1E79G 1RSOB 1R6KA 3JSLA 3L75H 3TCUA 5LL6Y 3N2GB 3CXHF 4X20A 4AHCA 3JD3A 3A0BZ 4X66B 1I08A 3AK2A 3ETDA 3FFQA 4GKJO 1HR0O 1MABG 4BR6A 5C8YB 4PDMA 2NN4A 2B5UA 4FM2A 2ZE5A 1YSCA 5LHGA 3ABLB 3ASOB 4RAIA 4XDJA 3ZHSA 2Q7EA 2QWRB 3ZMUA 1SQPH 5KMGB 2Q9LA 4GX0A 5JQGB 4I0XA 1P7GA 2YS8A 1S5JA 1O9GA 3DGEA 3APQA 4MTXA 2UUCB 2IU0A 5JVDA 3OMAB 4UVCA 2G38A 4DV2B 2XAHA 3K9SA 4GLXA 1S0VA 4FFBA 1Y74B 3L70H 1NQTA 5EZYA 4MVQA 2IM9A 2LW7A 1D2DA 3DTUB 3ZCCA 5IJ9B 4WFAV 2GHYA 3OT7A 3CWBH 4WFGA 1HNWB 2CGOA 1QLEB 4R7CA 3JD4A 4QGPA 4LF7O 1KD1W 2D2CB 4DUZB 3UCSC 2XHBA 2P4KA 1YJ9V 3DXRB 4X64O 3UO2A 2P67A 3OTFA 4K0KO 4MSWC 5C8YA 3OR6C 3SJQC 4O4JA 1V54C 4NYKA 1RPOA 3VQYA 1Q7YW 1N32O 5ITZB 3F7YC 2ZQMA 1ZTEA 3O65A 3DC6A 3F5TA 4H0LB 1NTKH 2DW4A 1W59A 1JFFB 2ZKOA 1EN6A 4J41A 4JAAA 4OGQB 1WB7A 2UUAO 3K0DA 2XAFA 4X9QA 4J80A 1H2NA 3ZX6A 1OCRB 4L8JA 4PDVA 1ZSPA 3K9AA 4JAVA 1ZWIC 3E83A 4IHJA 1VARA 3STZC 1FXKC 5GONB 1AB3A 1GKFA 1IDSA 4UB8Z 1R3KC 2CUGA 1K9MW 2ITCC 3OTOB 4LC1A 1PL4A 2QE7G 3K5LA 4G28B 3H1HH 1FFXA 2YC0A 3CRMA 3U11A 3ETQA 3RT3C 2QSAA 1OZ0A 1YJNV 2QKSA 3ZRXA 4LF5B 3QVNA 4I50B 1EZVH 4P9OA 4JI1B 5JJJB 1NZ6A 1XI1A 1W2BU 5LYJA 4ICGA 1A32A 4TUYB 4X62O 3QO5A 4JI5O 2BCCH 1O9HA 2BE3A 2P90A 5FPOA 4PI2A 4ASUG 1K97A 5LGUA 1AI5A 4NVPA 3K5OA 1XBLA 4CC5A 1AVMA 1QBZA 2ODMA 1N4CA 2AGAA 2UUCO 2VWJA 2A7WA 1COWG 3KCXA 4FLTA 2A79B 1UFIA 4DV2O 3FKSG 2WLLB 3LDDA 1G6UA 2Y0IA 2B9ZA 2ZIMA 4GX5A 5B1NA 1Q8IA 4CH5A 1MZEA 4ZHQB 4MVUA 3BEHA 1FJGO 3TJTA 1HNWO 4IL6Z 1TVKB 1M5IA 4U7OA 1J5EO 5A2QN 4I50A 2YICA 5CBFA 4DRXB 2EX3A 4Q6GA 4H33A 1NR7A 2XTAA 3BA8A 4BIOA 5IWAB 1XNRB 1K73W 4MVZA 4DV6B 4G2KA 1SESA 3X2QC 1XHZA 5KHGA 1OCOB 1VQNV 1PNKA 2ITDC 3U10A 5L3DA 4RWUA 1DTOA 1KP3A 4YJ3A 4WBNA 1ZL8A 2LFRA 1QQCA 5EK0A 1PD3A 1BQ0A 2N04A 1VQLV 4PDRA 3G67A 3BFRA 3TK1A 1GM9A 1Y67A 4LNUB 1VQPV 1DLBA 5E1AC 3LNNA 5KX5B 4I5SA 4ZI7B 1XMQO 4E4EA 2WLLA 4J7JA 4ABMA 1AI7A 1DK1A 3HKEB 2YI9A 5IY5C 1VQ4V 5IYZB 1BL8A 3CE2A 5IJ0B 2EZPA 1ZX3A 3IAYA 1HP8A 4B3SB 3ICXA 2ZNIA 3RYIB 3KKYA 4PDLA 5D5QA 2YXLA 3JASB 4NB5A 1TVKA 2EIMC 4B7EA 4JYCA 3ZMZA 1XL4A 3OTOO 1OJHA 2E75B 1BSMA 5B1BB 1D5NA 3ZRVA 4DR4B 2EIJC 2ZXWB 2IBZH 4CS3A 1HDJA 1B3QA 2QDOA 4EKWA 2LJ2A 4DYLA 4LF6O 4LP8A 4LF5O 1I0HA 2QTSA 1H2LA 4JZGA 1THZA 4LCUC 4JI1O 5JH7A 2ADQB 2P06A 3B77A 3AG7A 4X1KA 2QGNA 4KL1A 3WG7C 2YEVB 2LFSA 1VQ8V 4BW5A 2RCVA 3RYFB 1SQXH 4TV8A 5LMUB 4NXMO 1YZBA 1AILA 1H2MA 3I5DA 2ZDIA 2WA3A 4EFEA 1BCCH 4O2BA 1EZJA 1XILA 3SYAA 4ZI7A 1Y6XA 5B1AB 3EHBB 3QTCA 4PA3A 4B3MB 2UXCO 3GWKC 3ASOC 2RNBA 2Q4PA 3EVKA 2UUBB 2R9AA 4MTOA 3SR2C 3BVOA 3SYQA 3BABA 3IC9A 4QNHB 3ZRWB 4WFEA 1YCIA 1I5XA 3E8GA 4LWSA 2ARHA 2Y69B 1SZTA 4JYYA 3AEIA 3K79A 5BY1A 1XNQB 2DQ0A 5KUKA 3UM7A 2VS0A 1VEWA 1F23A 2H3OA 1NT2B 2OCCB 4D7SA 4UXNA 3CCRV 1WP8A 4U3JB 1GRJA 2B1IA 1F7YA 3CCJV 1PM9A 1QLEC 1WN7A 3FAVB 5IWAO 1XDCA 4GX1A 4DV6O 4FZ1A 3Q4HA 4RO2A 1MG1A 1XREA 2PTMA 1MSWD 4DV5B 4HBNA 3ZRSA 1LUVA 1I94B 3CEIA 4IT5A 2CE4A 1G4YB 1K92A 2BTOA 2ZD9A 4JI2O 4C7UA 4P2ZA 1QNMA 2PY5A 2HEPA 3E86A 1SERA 3B2EE 3RYCA 4J11A 1KC8W 3HKBA 4X1YA 5B3SB 3LSUA 4BW9A 1G1XB 1M1KW 2F23A 1AR4A 3A8TA 3ZS8C 4GCZA 2IJJA 4HYOA 5EIBC 1Z2GA 3W7TA 1H8HG 1R3IC 2EZOA 4X1IB 4LFCB 4GZRB 2WLHA 4TQDA 2R9IA 3N2KA 1BT8A 3MHHC 4PA9A 2LP7A 1IX9A 3JAKB 1JOYA 1P84F 3B40A 3HB3B 3CCMV 1FXKA 4MVRA 1BHAA 4EB6A 5LP6A 1IBKB 3FD9A 1JJ2U 3NR7A 1BZKA 1EM1A 2JGDB 4UVBA 3OEHG 3I55V 4XDKA 2XAJA 4TT3G 2QM4A 4O4IA 1H38A 5CMUA 2QR4A 1GH6A 4YY3O 2JVDA 3CCUV 2EIKB 4X20B 2FYUH 1KQSU 1KUQA 1PL0A 2WLIA 3K5NA 2WWWA 1U97A 3CC7V 3F7VC 5A9GA 3TXSA 1S72V 3OW2U 1YXBA 2Q69A 3ZJZA 5IYDO 2OYQA 3IC7A 4B3MO 4FLWA 2HP8A 3AG2C 4N23A 3FB6C 4DR1B 2UUBO 1YTFD 3VQVA 1MNGA 4PHZA 4Z1VA 3BPZA 4IGGA 3ZMSA 1WLEA 2ZR3A 3GB7C 5IT9N 4I0XB 2RQ6A 1BHBA 1KMIZ 1GM7A 3K57A 4FM0A 1X4TA 1XNQO 3GVMA 4BWAA 4JI3B 1I5YA 1M56C 5JVDB 2HG5C 4J9ZB 2PI5A 4LF9O 4HZ3A 4FFBB 1N36O 4JI7B 5EZYB 1HW7A 3JYCA 4OX9B 3HKDA 2UU9O 1M93A 2Q0OC 4DV0B 1AJQA 3AG1B 3W7WA 1H8EG 3AK3A 1GN6A 3CCQV 2GDSA 5DN6G 3OM3B 4O2AA 4FLYA 1GM8A 3H01A 2R70A 3CRRA 3BHPA 5L3CA 3K5MA 3CRAA 3I56V 5LBQA 5IYBO 2E3CA 3T1YB 1OCOC 3A2FA 1I94O 2DJVA 3ETEA 2WA4A 1H2KA 4B3RB 1X59A 3RVYA 4O4JB 4K35A 4FK5C 1EBOA 5BR8O 2HJDA 2W0XA 2ZE7A 5GW7A 2EBOA 4JI0O 1YIJV 2LGQA 1YEWA 1HNZO 5J2TA 2HHHB 3ABMB 1YITV 2P7TC 1GO3F 1AP5A 2RJZA 1WJZA 1OCZC 3G4SV 5KAFZ 4LFAB 5KUMA 3K03A 4DR6B 3WU2Z 2OCHA 3MHSC 5CBHA 3P3NA 1IBMO 4FM1A 2OT5A 4UV9A 2ZINA 3K0GA 5LHIA 3ABUA 4IHJB 3UT5A 3J81N 3CD6V 1AI4A 1Q90D 1HWYA 4MS2A 1NH2D 4LFBB 2HVJC 3ABKB 1YI2V 2MK3A 5B1BC 1SZXA 2ZXWC 1E1RG 4B3TO 3TXQA 4AQYB 2Z0AA 4YJ2A 4I9WA 4R6ZA 4JI8B 1S76D 1FFXB 2RDCA 3CCVV 1K8AW 5EC2C 5JWPA 1VQ7V 4O4LB 5GTHZ 4D6TH 1Q81W 3B09A 3RVZA 2RMKB 1SQGA 2PYLA 3SPCA 1SC5B 2A0LA 1VQ6V 1TAEA 1XHXA 2GTSA 3BCCH 1GN3A 4HNAA 3E22B 4LBEC 1K5SA 4QE9A 5LYJB 3G6EV 2ZM6O 1Q5OA 1SF9A 3ZHUA 4MT8A 1XMOO 2CTPA 4JI6O 4DR5B 1QR9A 2ETNA 2Q68A 4KP4A 4F6RA 4ZKIA 1H2SB 1RM1C 2YUAA 1DGSA 3L73H 4JI3O 5AG2A 2RN9A 2AZ2A 4JV5B 3CYOA 5JJNB 2Y69C 4JI4B 4K8ZA 4WFHA 3OR7C 4XBFA 5BZBA 3CRCA 3DC5A 4JI7O 2LW1A 2MW2B 2DN9A 1VIBA 1VF7A 2QTOA 1Q82W 4NXNB 4DV0O 4LF4B 4DV1B 2OCCC 2Q8VA 5H6QA 1LNQA 2V4DA 5FNVA 2ZE6A 2WAMA 2CH7A 3WFVA 3CC2V 3R65A 3K04A 4O4LA 2BTQA 2EILB 4X66O 1Q6HA 3ZHRA 1VF6C 3J7AU 5DM6V 1LUWA 3RBZA 2YIDA 3E22A 4UCRA 2PF4E 2UXBB 2WLKA 5CA3A 4K8XA 4OPHA 1NTZH 3ZEDA 4JGSA 2FMLA 1OCCB 5EC1C 1JQ0A 1BQZA 3ZHVA 4YJ3B 4WBNB 1ZL8B 3OFNG 5JCOC 3BA9A 3VBBA 4JZ2A 3OE7G 5B3SC 3AG3B 5H5NA 4CH6A 4DR6O 3ZN1A 2XASA 4QJFB 3JSNA 3E89A 5EYPA 3W7SA 3LUTB 2CDYA 3WB2A 1FD9A 3D8CA 2YIAA 4MTFA 4LFBO 2JGUA 4ZOLA 1EFRG 3T1CA 3JATA 4I9QA 3M7MX 3C3SA 4Z2WA 3SPJA 1M57C 3H1LH 4DUZO 4AQYO 2EINB 1RP3B 1E1QG 2W0FC 3K59A 4JI8O 1WA8A 1I7FA 3D36C 3UQ8A 2DYRC 2F4VB 3SPIA 1AJPA 4CZZA 3RN4A 1VQMV 2EIKC 5JH7B 4X1KB 3K58A 4PA7A 2X6BA 1Q6UA 4GUNA 2P5OA 2JDIG 3CP1A 5CB4A 3CCSV 2AHZA 4TV8B 4LH7A 4JPRA 3L9DA 1XOUA 4NTYA 1M9NA 1P49A 3M99B 4O2BB 1M4UA 2DYSC 2KG7B 5CA0A 2DWDC 1L0NH 3A0RA 5IYCO 4RUFA 2FKXA 4JV5O 1K3EA 1JA8A 4DUYB 4KHPB 4JI4O 2M6YA 4GKKB 4R8CA 1OHHG 4PA4A 3CC4V 1KECA 2N05A 4LWSB 4NXNO 1K4CC 2OTJV 3L72H 4FFKA 2PZSA 3CCLV 3AK1A 4YIOA 3ASNC 4UVAA 3CJHB 3CRQA 4UUJC 1V9PA 1WNSA 4BIZA 3AG1C 4CC6A 2IJKA 2Q73A 1B04A 4N21A 4NR1A 3H1IH 1AJNA 4X65B 3JARA 3CMAV 3U0ZA 4KXRA 1VQ5V 5J2UA 4DK0A 3VOUA 2UXDB 3Q4HB 3SYCA 2UXBO 3K06A 1Y66A 2H94A 5FL7G 3JALA 2FTKA 3QF7A 4DR7B 1W0JG 1V54B 4UV8A 2KG7A 4O4HA 3ABLC 2DQ3A 2LQTA 2QA4V 1ZUQA 3RYCB 4TQFA 4FIPC 3MDSA 3HKBB 4X1YB 1K34A 1N34B 1SRYA 4NTXA 4FVMA 1YTFB 1CEZA 2W6IG 2ILMA 2E5LB 3B4SA 1YVWA 4FLUA 4YHHB 4H37A 4DR3B 2QWOB 3STLC 3N2KB 5EBLC 2AZ0A 2OTLV 2YXYA 3CJHA 2PGGA 1ENVA 5KHHA 2ADPA 4I7ZB 4IIJB 5D5PA 2R9RB 1PP9H 4K3AA 5KHJA 2VQEB 1PPJH 1JJOA 3W7XA 4DV7B 3ABKC 1FXHA 1FXKB 2JEXA 4EB6B 4UCUA 5LP6B 1XNRO 3QO8A 4FLZA 3JD1A 4AILC 1Z5WA 4CBCA 1R1BA 4JAUA 1URFA 4O4IB 1NJIW 1MMMA 3FB7C 2N74A 1JX9A 2XT9A 2HVKC 1QU7A 3ML0A 1FKAO 2WLIB 2YXHA 4MTGA 4DR2B 2ZE8A 1S5HC 4FMTA 3S3WA 1Z5VA
chains in the Genus database with same CATH topology
2QWOB 2QWRB 3AG7A 1IURA 1GH6A 1XBLA 2CTWA 4J7ZA 4J80A 1N4CA 2DMXA 2N05A 2GUZB 1FAFA 2CUGA 2Y4TA 2CTPA 2QWNB 2YS8A 2Y4UA 2L6LA 2DN9A 3APQA 2LGWA 1NZ6A 3BVOA 4RWUA 2KQXA 1WJZA 2CTQA 2PF4E 3APOA 2QWPB 1HDJA 2QWQB 4IT5A 1BQ0A 2N04A 2CTRA 2LO1A 2EJ7A 2YUAA 2OCHA 2QSAA 3UCSC 3UO3A 2GUZA 2M6YA 1FPOA 1BQZA 3UO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWO B;  2QWR B;  3AG7 A;  1IUR A;  1GH6 A;  1XBL A;  2CTW A;  4J7Z A;  4J80 A;  1N4C A;  2DMX A;  2N05 A;  2GUZ B;  1FAF A;  2CUG A;  2Y4T A;  2CTP A;  2QWN B;  2YS8 A;  2Y4U A;  2L6L A;  2DN9 A;  3APQ A;  2LGW A;  1NZ6 A;  3BVO A;  4RWU A;  2KQX A;  1WJZ A;  2CTQ A;  2PF4 E;  3APO A;  2QWP B;  1HDJ A;  2QWQ B;  4IT5 A;  1BQ0 A;  2N04 A;  2CTR A;  2LO1 A;  2EJ7 A;  2YUA A;  2OCH A;  2QSA A;  3UCS C;  3UO3 A;  2GUZ A;  2M6Y A;  1FPO A;  1BQZ A;  3UO2 A; 
#chains in the Genus database with same CATH topology
 4CH4 A;  5LA6 A;  4CS4 A;  3MD0 A;  2P4V A;  3RYH A;  5K1P A;  4TWK A;  2NNU A;  1QR8 A;  2Y4U A;  1FFT B;  1VMG A;  4GKJ B;  4CS2 A;  4DXW A;  1OCR C;  2VWK A;  3HKC A;  4DUY O;  3OAA G;  2IW5 A;  4B3S O;  1G8M A;  1WAZ A;  1YJW V;  4GKK O;  5LOV A;  5LHH A;  4P9P A;  3JCZ A;  1ROP A;  4ZIB A;  5HFM A;  5C93 A;  4IIJ A;  2H8P C;  1S5L Z;  1V55 B;  2IH1 C;  1MA1 A;  2ZT9 B;  1XUQ A;  4FPP A;  2YI8 A;  4DR4 O;  4JAS A;  1EN5 A;  3P3P A;  4JYB A;  3QNE A;  1TUB A;  1WPB A;  2ZR2 A;  2EJ7 A;  2IJI A;  1QHT A;  1R3J C;  3FYI B;  3QO7 A;  1NH2 B;  4EEQ A;  4AI8 A;  3HKD B;  4I4T A;  3FB8 C;  1AR1 B;  1KKD A;  4OPA A;  2A3Q A;  4EFB A;  2EIL C;  1JR9 A;  2UXD O;  1TUE B;  2BSK A;  3SDL A;  4DO2 A;  1Y76 A;  4TV9 A;  4L87 A;  5CA1 A;  2QKA A;  4O2A B;  2JEU A;  2Q5Z A;  1ZAU A;  5LMU O;  1N8R W;  4TOI A;  4X89 A;  4B7K A;  3E8F A;  4WFB V;  5CN0 A;  4J42 A;  4LF7 B;  4H44 B;  3X2Q B;  2V7Q G;  3TET A;  1YHQ V;  4X64 B;  1K4D C;  4K0K B;  1ZLZ A;  5L3F A;  1YDX A;  1QLN A;  2QWN B;  5JCO A;  1N32 B;  2XOK G;  4LF8 B;  4Q20 A;  3SJA C;  5DEC A;  3AG3 C;  2QEX V;  5J2T B;  4QPJ A;  5FLX N;  4DR3 O;  1W0K G;  1GK9 A;  3JD2 A;  3UO3 A;  4ZBM A;  3RW0 A;  2F1M A;  2GBO A;  5H6R A;  3JCU Z;  5LGN A;  4G27 B;  2KQX A;  5LGT A;  1US6 A;  4DV7 O;  2AHY A;  5KAI Z;  1ORQ C;  4W4L A;  3UT5 B;  2JRI A;  5KHK A;  3ZBH A;  4IYH A;  3CHX A;  2V1D A;  4I55 A;  2WSS G;  1FPO A;  2K1E A;  2EIM B;  2EIN C;  1JCH A;  2CAZ C;  4DV5 O;  2E74 B;  1NVP D;  2EIJ B;  4DV4 B;  4GT1 A;  3D36 A;  4UCT A;  4YJ2 B;  3AG4 B;  5BMV B;  4RQE A;  4DR2 O;  2A06 H;  1KYO F;  4UCO A;  3M8A A;  4PI0 A;  3WG7 B;  2JJ1 G;  3LSQ A;  1T5E A;  4HNA B;  2ZDI C;  5H9C A;  3OD4 A;  4LFC O;  2EJR A;  2QWQ B;  1TA8 A;  2AW9 A;  1K5Q A;  1TGO A;  3SGI A;  1QVF U;  4WFF A;  1XEQ A;  4X62 B;  2F93 B;  4JI5 B;  3K3W A;  4F4L A;  1K7D A;  1Q86 W;  2DWE C;  5HFL A;  4F6R B;  1GN2 A;  3N27 A;  1OV9 A;  3JD0 A;  4UCV A;  2HR3 A;  1RPR A;  3E35 A;  2XAQ A;  1VP7 A;  2GSM B;  1IBK O;  1B6Q A;  5LXT A;  3SPH A;  3OGI B;  3CCE V;  3J80 N;  1IVS A;  2QWP B;  1PNL A;  1UPG A;  1SKV A;  3B8M A;  4YXW G;  1EN4 A;  5BMV A;  1R6T A;  5FNV B;  1RSO A;  2CH7 B;  4RUE A;  1SA0 B;  1Y4M A;  1FJG B;  2BTQ B;  3N2G A;  4FLX A;  1SQV H;  2CTQ A;  2FL4 A;  1CXZ B;  3APO A;  1DF4 A;  2P22 C;  2LO1 A;  3E2E A;  2Q0A A;  3SJB C;  1J5E B;  2PYJ A;  1VF5 B;  5KLV H;  3FX7 A;  4DR1 O;  3KCY A;  5B1A C;  2C2A A;  1P7B A;  3UKM A;  4LF8 O;  1FAF A;  2XND G;  4H13 B;  2VQF B;  4JYA B;  3T4D A;  5KMG A;  2YSU B;  4UFZ A;  4R50 A;  4FZ0 A;  5JQG A;  4QIW F;  1IXM A;  2Y0P A;  4DV3 B;  1FYJ A;  3T1H B;  1XQ8 A;  1FXV A;  3SJC C;  1B06 A;  2KB1 A;  2YIB A;  1CPY A;  1KKC A;  1XMQ B;  5EYP B;  1F4N A;  4OX9 O;  1YF2 A;  1Y74 A;  2X0L A;  4ZOL B;  1R6N A;  5IJ9 A;  4MW3 A;  1GTO A;  3JAT B;  4BIU A;  1SA0 A;  1AI6 A;  5LP6 C;  3PN1 A;  4DV4 O;  1NTM H;  3FYE B;  3T1Y O;  3C90 A;  1GN4 A;  2NLJ C;  1NR1 A;  1WA8 B;  3BY6 A;  3VQW A;  1IBL B;  4B3R O;  3IGA C;  3DXR A;  3OMI B;  2QM7 A;  1SQB H;  1R73 A;  3C3T A;  1RFY A;  1BE3 H;  2HFE C;  4LF6 B;  1P4R A;  1IZ3 A;  5KHI A;  5ITZ A;  3QG5 A;  3GWO A;  2HHH O;  2DE0 X;  1JFF A;  1BS3 A;  3L71 H;  1SQQ H;  5CB4 B;  4W4K A;  1Q43 A;  4LFA O;  2X6C A;  1NS1 A;  4B08 A;  3S3X A;  4NXM B;  3AG2 B;  4YIP A;  1N0N A;  5CA0 B;  3NXS A;  4LH6 A;  4QE7 A;  3LDE A;  1MZF A;  1NKD A;  2UXC B;  2YIB D;  1S3J A;  3D3Q A;  2GUZ B;  3E8H A;  1V55 C;  2OWO A;  4U7N A;  2JJ2 G;  3FB5 C;  5GON A;  1S77 D;  1JPX A;  1M56 B;  4MVS A;  2KKW A;  1LR1 A;  2EUL A;  4PEL A;  1Q6I A;  1PV0 A;  4U3F H;  1K33 A;  5KA5 A;  1KP2 A;  4GYC B;  3ZHT A;  4DK1 A;  5L3E A;  2F95 B;  2HLD G;  3OMN B;  4UCS A;  2M7W A;  3P30 A;  3RWR D;  3JAR B;  3JAW B;  4HAM A;  5J2U B;  1L1F A;  4P30 A;  1SS3 A;  3F5W C;  1MSD A;  3CSX A;  3H1J H;  3JAL B;  2WPD G;  3KZI Z;  4TUY A;  4DR5 O;  2VQF O;  4JYA O;  1N0J A;  4O4H B;  2JIZ G;  2PI4 A;  3SYP A;  2R72 A;  1J95 A;  5EIB D;  1NU1 H;  4DV3 O;  3T1H O;  4JI2 B;  3TGU H;  2GUZ A;  4JTA B;  4PA6 A;  3HPL C;  1PKX A;  1L8D A;  1NI8 A;  2CTW A;  3OUS A;  1AR5 A;  1OCZ B;  4CH3 A;  4LF4 O;  2A9H A;  4DV1 O;  1VQO V;  3WB0 A;  4MW8 A;  4FJC C;  1BGY H;  4ZHQ A;  5IDJ A;  1HNX B;  4A5U B;  1VQ9 V;  1XL6 A;  5BXZ A;  3CX5 F;  2WLN A;  3ZMT A;  1CP9 A;  4D7T A;  1VQK V;  1IXB A;  4J10 A;  2CGN A;  4J7Z A;  1JMK C;  2HKO A;  1IBL O;  4IYI A;  1M90 W;  4DRX A;  2L6L A;  5JJE B;  3JAW A;  4DW1 A;  1H2G A;  1FS0 G;  5EBW C;  3OUF A;  3AG4 C;  3OGC C;  1L0L H;  3L74 H;  2IH3 C;  4RQF A;  4PV1 B;  1SQF A;  1WB8 A;  5B66 Z;  2W6J G;  4NKG B;  4YY3 B;  2Q7H A;  4LNU A;  1N33 B;  3ABM C;  1F51 A;  5KX5 A;  5TIS Z;  5LA6 B;  4JF3 A;  3O9O A;  3RYH B;  3OEE G;  2CTR A;  1GAX A;  3G71 V;  2Y48 A;  3A0H Z;  2F43 G;  2E76 B;  2QKC A;  2Q7G A;  3HKE A;  3HKC B;  5B1O A;  4Z1M G;  5IYZ A;  4PD4 F;  1QCE A;  5IJ0 A;  2P6J A;  2DMX A;  5LOV B;  4TSF G;  3P32 A;  2LGW A;  5L3G A;  2QM8 A;  3H1K H;  3RYI A;  1AP6 A;  1RM1 B;  4XDL A;  3JAS A;  3ETG A;  2IJH A;  4GX2 A;  4JTC B;  4E2L A;  4JTD B;  3ABT A;  1JVM A;  1TUB B;  2Z3Y A;  3ZMV A;  4PJ0 Z;  2F4V O;  2PUS A;  4QPK A;  2NR5 A;  1BMF G;  2KSD A;  4LF9 B;  4I4T B;  4NTW A;  1N36 B;  5LMN B;  1NVP B;  1NBM G;  1DF5 A;  2UU9 B;  2BSK B;  1Y76 B;  4TV9 B;  5CA1 B;  2YEV A;  2GV9 A;  3LNM B;  2WLJ A;  4KFM A;  3CXC U;  3HR0 A;  4UB6 Z;  2IU3 A;  3R66 A;  3RYF A;  2UXX A;  2Q67 A;  3THO A;  5L3B A;  4X88 A;  5KA6 A;  3G80 A;  4FLV A;  2JS3 A;  3H9V A;  3T2M A;  5J9P C;  1KU9 A;  4F6E A;  3CPW U;  2XAG A;  5F2V O;  3K08 A;  1HR0 B;  2OIE A;  5CBG A;  4KHP O;  3G6B A;  5K1X A;  3ZIA G;  3W7U A;  5BR8 B;  2ZIO A;  3CB2 A;  4LR3 A;  4JI0 B;  2QJ1 A;  3ZRW A;  3D3I A;  1HNZ B;  1HNX O;  2Z5U A;  3BAA A;  3CS5 A;  5B5E Z;  4J9Y B;  1WP7 A;  2BOC C;  5DED A;  1D5A A;  1R3L C;  2B1G A;  4X65 O;  1IBM B;  2VRZ A;  2FB5 A;  3SPG A;  4J7K A;  3WB1 A;  1KB9 F;  4U3J A;  1QVG U;  1GMG A;  1PNM A;  4I55 B;  2XUM A;  4BAY A;  3FAV A;  3DSQ A;  1M57 B;  2HJF C;  1VF6 A;  4DR7 O;  3VQX A;  2AXT Z;  3PJS K;  5H2F Z;  2DYR B;  1U96 A;  2O57 A;  1ARO P;  3ZN0 A;  4B3T B;  3BRC A;  2Q6A A;  1OCC C;  3CME V;  1N33 O;  3EFF K;  4X8A A;  2CK3 G;  3LDC A;  1F4M A;  3IFX A;  3MAQ A;  1N34 O;  5GTI Z;  3ZHQ A;  3B8N A;  2E5L O;  1UJW B;  3EXA A;  1SET A;  4YHH O;  4OXS A;  3JAM N;  1WPX A;  2X7R B;  2F66 C;  2ZNJ A;  1IUR A;  1Q3E A;  4X1I A;  3E8B A;  2DYS B;  3T4Z A;  4WF9 V;  4MVM A;  2ZM6 B;  4WCE V;  2UUA B;  5IE9 A;  5IY5 B;  2BOB C;  1XMO B;  2L35 A;  5FPR A;  4JI6 B;  2VQE O;  3JAK A;  3SYO A;  2ATK C;  2JK5 C;  2DOS A;  3RGB A;  4DW0 A;  4MVO A;  1KBH A;  5LXT B;  2K9P A;  1MOF A;  2JGD A;  2WLM A;  2GTA A;  2UXN A;  2YDE A;  2D3O W;  2OIG A;  5E79 Z;  2Y4T A;  3ASN B;  3IJ4 A;  5EBM C;  2JS5 A;  2ZCE A;  3LSS A;  3RFR A;  5LMN O;  4KUM A;  3KG2 A;  2X6A A;  1E79 G;  1RSO B;  1R6K A;  3JSL A;  3L75 H;  3TCU A;  5LL6 Y;  3N2G B;  3CXH F;  4X20 A;  4AHC A;  3JD3 A;  3A0B Z;  4X66 B;  1I08 A;  3AK2 A;  3ETD A;  3FFQ A;  4GKJ O;  1HR0 O;  1MAB G;  4BR6 A;  5C8Y B;  4PDM A;  2NN4 A;  2B5U A;  4FM2 A;  2ZE5 A;  1YSC A;  5LHG A;  3ABL B;  3ASO B;  4RAI A;  4XDJ A;  3ZHS A;  2Q7E A;  2QWR B;  3ZMU A;  1SQP H;  5KMG B;  2Q9L A;  4GX0 A;  5JQG B;  4I0X A;  1P7G A;  2YS8 A;  1S5J A;  1O9G A;  3DGE A;  3APQ A;  4MTX A;  2UUC B;  2IU0 A;  5JVD A;  3OMA B;  4UVC A;  2G38 A;  4DV2 B;  2XAH A;  3K9S A;  4GLX A;  1S0V A;  4FFB A;  1Y74 B;  3L70 H;  1NQT A;  5EZY A;  4MVQ A;  2IM9 A;  2LW7 A;  1D2D A;  3DTU B;  3ZCC A;  5IJ9 B;  4WFA V;  2GHY A;  3OT7 A;  3CWB H;  4WFG A;  1HNW B;  2CGO A;  1QLE B;  4R7C A;  3JD4 A;  4QGP A;  4LF7 O;  1KD1 W;  2D2C B;  4DUZ B;  3UCS C;  2XHB A;  2P4K A;  1YJ9 V;  3DXR B;  4X64 O;  3UO2 A;  2P67 A;  3OTF A;  4K0K O;  4MSW C;  5C8Y A;  3OR6 C;  3SJQ C;  4O4J A;  1V54 C;  4NYK A;  1RPO A;  3VQY A;  1Q7Y W;  1N32 O;  5ITZ B;  3F7Y C;  2ZQM A;  1ZTE A;  3O65 A;  3DC6 A;  3F5T A;  4H0L B;  1NTK H;  2DW4 A;  1W59 A;  1JFF B;  2ZKO A;  1EN6 A;  4J41 A;  4JAA A;  4OGQ B;  1WB7 A;  2UUA O;  3K0D A;  2XAF A;  4X9Q A;  4J80 A;  1H2N A;  3ZX6 A;  1OCR B;  4L8J A;  4PDV A;  1ZSP A;  3K9A A;  4JAV A;  1ZWI C;  3E83 A;  4IHJ A;  1VAR A;  3STZ C;  1FXK C;  5GON B;  1AB3 A;  1GKF A;  1IDS A;  4UB8 Z;  1R3K C;  2CUG A;  1K9M W;  2ITC C;  3OTO B;  4LC1 A;  1PL4 A;  2QE7 G;  3K5L A;  4G28 B;  3H1H H;  1FFX A;  2YC0 A;  3CRM A;  3U11 A;  3ETQ A;  3RT3 C;  2QSA A;  1OZ0 A;  1YJN V;  2QKS A;  3ZRX A;  4LF5 B;  3QVN A;  4I50 B;  1EZV H;  4P9O A;  4JI1 B;  5JJJ B;  1NZ6 A;  1XI1 A;  1W2B U;  5LYJ A;  4ICG A;  1A32 A;  4TUY B;  4X62 O;  3QO5 A;  4JI5 O;  2BCC H;  1O9H A;  2BE3 A;  2P90 A;  5FPO A;  4PI2 A;  4ASU G;  1K97 A;  5LGU A;  1AI5 A;  4NVP A;  3K5O A;  1XBL A;  4CC5 A;  1AVM A;  1QBZ A;  2ODM A;  1N4C A;  2AGA A;  2UUC O;  2VWJ A;  2A7W A;  1COW G;  3KCX A;  4FLT A;  2A79 B;  1UFI A;  4DV2 O;  3FKS G;  2WLL B;  3LDD A;  1G6U A;  2Y0I A;  2B9Z A;  2ZIM A;  4GX5 A;  5B1N A;  1Q8I A;  4CH5 A;  1MZE A;  4ZHQ B;  4MVU A;  3BEH A;  1FJG O;  3TJT A;  1HNW O;  4IL6 Z;  1TVK B;  1M5I A;  4U7O A;  1J5E O;  5A2Q N;  4I50 A;  2YIC A;  5CBF A;  4DRX B;  2EX3 A;  4Q6G A;  4H33 A;  1NR7 A;  2XTA A;  3BA8 A;  4BIO A;  5IWA B;  1XNR B;  1K73 W;  4MVZ A;  4DV6 B;  4G2K A;  1SES A;  3X2Q C;  1XHZ A;  5KHG A;  1OCO B;  1VQN V;  1PNK A;  2ITD C;  3U10 A;  5L3D A;  4RWU A;  1DTO A;  1KP3 A;  4YJ3 A;  4WBN A;  1ZL8 A;  2LFR A;  1QQC A;  5EK0 A;  1PD3 A;  1BQ0 A;  2N04 A;  1VQL V;  4PDR A;  3G67 A;  3BFR A;  3TK1 A;  1GM9 A;  1Y67 A;  4LNU B;  1VQP V;  1DLB A;  5E1A C;  3LNN A;  5KX5 B;  4I5S A;  4ZI7 B;  1XMQ O;  4E4E A;  2WLL A;  4J7J A;  4ABM A;  1AI7 A;  1DK1 A;  3HKE B;  2YI9 A;  5IY5 C;  1VQ4 V;  5IYZ B;  1BL8 A;  3CE2 A;  5IJ0 B;  2EZP A;  1ZX3 A;  3IAY A;  1HP8 A;  4B3S B;  3ICX A;  2ZNI A;  3RYI B;  3KKY A;  4PDL A;  5D5Q A;  2YXL A;  3JAS B;  4NB5 A;  1TVK A;  2EIM C;  4B7E A;  4JYC A;  3ZMZ A;  1XL4 A;  3OTO O;  1OJH A;  2E75 B;  1BSM A;  5B1B B;  1D5N A;  3ZRV A;  4DR4 B;  2EIJ C;  2ZXW B;  2IBZ H;  4CS3 A;  1HDJ A;  1B3Q A;  2QDO A;  4EKW A;  2LJ2 A;  4DYL A;  4LF6 O;  4LP8 A;  4LF5 O;  1I0H A;  2QTS A;  1H2L A;  4JZG A;  1THZ A;  4LCU C;  4JI1 O;  5JH7 A;  2ADQ B;  2P06 A;  3B77 A;  3AG7 A;  4X1K A;  2QGN A;  4KL1 A;  3WG7 C;  2YEV B;  2LFS A;  1VQ8 V;  4BW5 A;  2RCV A;  3RYF B;  1SQX H;  4TV8 A;  5LMU B;  4NXM O;  1YZB A;  1AIL A;  1H2M A;  3I5D A;  2ZDI A;  2WA3 A;  4EFE A;  1BCC H;  4O2B A;  1EZJ A;  1XIL A;  3SYA A;  4ZI7 A;  1Y6X A;  5B1A B;  3EHB B;  3QTC A;  4PA3 A;  4B3M B;  2UXC O;  3GWK C;  3ASO C;  2RNB A;  2Q4P A;  3EVK A;  2UUB B;  2R9A A;  4MTO A;  3SR2 C;  3BVO A;  3SYQ A;  3BAB A;  3IC9 A;  4QNH B;  3ZRW B;  4WFE A;  1YCI A;  1I5X A;  3E8G A;  4LWS A;  2ARH A;  2Y69 B;  1SZT A;  4JYY A;  3AEI A;  3K79 A;  5BY1 A;  1XNQ B;  2DQ0 A;  5KUK A;  3UM7 A;  2VS0 A;  1VEW A;  1F23 A;  2H3O A;  1NT2 B;  2OCC B;  4D7S A;  4UXN A;  3CCR V;  1WP8 A;  4U3J B;  1GRJ A;  2B1I A;  1F7Y A;  3CCJ V;  1PM9 A;  1QLE C;  1WN7 A;  3FAV B;  5IWA O;  1XDC A;  4GX1 A;  4DV6 O;  4FZ1 A;  3Q4H A;  4RO2 A;  1MG1 A;  1XRE A;  2PTM A;  1MSW D;  4DV5 B;  4HBN A;  3ZRS A;  1LUV A;  1I94 B;  3CEI A;  4IT5 A;  2CE4 A;  1G4Y B;  1K92 A;  2BTO A;  2ZD9 A;  4JI2 O;  4C7U A;  4P2Z A;  1QNM A;  2PY5 A;  2HEP A;  3E86 A;  1SER A;  3B2E E;  3RYC A;  4J11 A;  1KC8 W;  3HKB A;  4X1Y A;  5B3S B;  3LSU A;  4BW9 A;  1G1X B;  1M1K W;  2F23 A;  1AR4 A;  3A8T A;  3ZS8 C;  4GCZ A;  2IJJ A;  4HYO A;  5EIB C;  1Z2G A;  3W7T A;  1H8H G;  1R3I C;  2EZO A;  4X1I B;  4LFC B;  4GZR B;  2WLH A;  4TQD A;  2R9I A;  3N2K A;  1BT8 A;  3MHH C;  4PA9 A;  2LP7 A;  1IX9 A;  3JAK B;  1JOY A;  1P84 F;  3B40 A;  3HB3 B;  3CCM V;  1FXK A;  4MVR A;  1BHA A;  4EB6 A;  5LP6 A;  1IBK B;  3FD9 A;  1JJ2 U;  3NR7 A;  1BZK A;  1EM1 A;  2JGD B;  4UVB A;  3OEH G;  3I55 V;  4XDK A;  2XAJ A;  4TT3 G;  2QM4 A;  4O4I A;  1H38 A;  5CMU A;  2QR4 A;  1GH6 A;  4YY3 O;  2JVD A;  3CCU V;  2EIK B;  4X20 B;  2FYU H;  1KQS U;  1KUQ A;  1PL0 A;  2WLI A;  3K5N A;  2WWW A;  1U97 A;  3CC7 V;  3F7V C;  5A9G A;  3TXS A;  1S72 V;  3OW2 U;  1YXB A;  2Q69 A;  3ZJZ A;  5IYD O;  2OYQ A;  3IC7 A;  4B3M O;  4FLW A;  2HP8 A;  3AG2 C;  4N23 A;  3FB6 C;  4DR1 B;  2UUB O;  1YTF D;  3VQV A;  1MNG A;  4PHZ A;  4Z1V A;  3BPZ A;  4IGG A;  3ZMS A;  1WLE A;  2ZR3 A;  3GB7 C;  5IT9 N;  4I0X B;  2RQ6 A;  1BHB A;  1KMI Z;  1GM7 A;  3K57 A;  4FM0 A;  1X4T A;  1XNQ O;  3GVM A;  4BWA A;  4JI3 B;  1I5Y A;  1M56 C;  5JVD B;  2HG5 C;  4J9Z B;  2PI5 A;  4LF9 O;  4HZ3 A;  4FFB B;  1N36 O;  4JI7 B;  5EZY B;  1HW7 A;  3JYC A;  4OX9 B;  3HKD A;  2UU9 O;  1M93 A;  2Q0O C;  4DV0 B;  1AJQ A;  3AG1 B;  3W7W A;  1H8E G;  3AK3 A;  1GN6 A;  3CCQ V;  2GDS A;  5DN6 G;  3OM3 B;  4O2A A;  4FLY A;  1GM8 A;  3H01 A;  2R70 A;  3CRR A;  3BHP A;  5L3C A;  3K5M A;  3CRA A;  3I56 V;  5LBQ A;  5IYB O;  2E3C A;  3T1Y B;  1OCO C;  3A2F A;  1I94 O;  2DJV A;  3ETE A;  2WA4 A;  1H2K A;  4B3R B;  1X59 A;  3RVY A;  4O4J B;  4K35 A;  4FK5 C;  1EBO A;  5BR8 O;  2HJD A;  2W0X A;  2ZE7 A;  5GW7 A;  2EBO A;  4JI0 O;  1YIJ V;  2LGQ A;  1YEW A;  1HNZ O;  5J2T A;  2HHH B;  3ABM B;  1YIT V;  2P7T C;  1GO3 F;  1AP5 A;  2RJZ A;  1WJZ A;  1OCZ C;  3G4S V;  5KAF Z;  4LFA B;  5KUM A;  3K03 A;  4DR6 B;  3WU2 Z;  2OCH A;  3MHS C;  5CBH A;  3P3N A;  1IBM O;  4FM1 A;  2OT5 A;  4UV9 A;  2ZIN A;  3K0G A;  5LHI A;  3ABU A;  4IHJ B;  3UT5 A;  3J81 N;  3CD6 V;  1AI4 A;  1Q90 D;  1HWY A;  4MS2 A;  1NH2 D;  4LFB B;  2HVJ C;  3ABK B;  1YI2 V;  2MK3 A;  5B1B C;  1SZX A;  2ZXW C;  1E1R G;  4B3T O;  3TXQ A;  4AQY B;  2Z0A A;  4YJ2 A;  4I9W A;  4R6Z A;  4JI8 B;  1S76 D;  1FFX B;  2RDC A;  3CCV V;  1K8A W;  5EC2 C;  5JWP A;  1VQ7 V;  4O4L B;  5GTH Z;  4D6T H;  1Q81 W;  3B09 A;  3RVZ A;  2RMK B;  1SQG A;  2PYL A;  3SPC A;  1SC5 B;  2A0L A;  1VQ6 V;  1TAE A;  1XHX A;  2GTS A;  3BCC H;  1GN3 A;  4HNA A;  3E22 B;  4LBE C;  1K5S A;  4QE9 A;  5LYJ B;  3G6E V;  2ZM6 O;  1Q5O A;  1SF9 A;  3ZHU A;  4MT8 A;  1XMO O;  2CTP A;  4JI6 O;  4DR5 B;  1QR9 A;  2ETN A;  2Q68 A;  4KP4 A;  4F6R A;  4ZKI A;  1H2S B;  1RM1 C;  2YUA A;  1DGS A;  3L73 H;  4JI3 O;  5AG2 A;  2RN9 A;  2AZ2 A;  4JV5 B;  3CYO A;  5JJN B;  2Y69 C;  4JI4 B;  4K8Z A;  4WFH A;  3OR7 C;  4XBF A;  5BZB A;  3CRC A;  3DC5 A;  4JI7 O;  2LW1 A;  2MW2 B;  2DN9 A;  1VIB A;  1VF7 A;  2QTO A;  1Q82 W;  4NXN B;  4DV0 O;  4LF4 B;  4DV1 B;  2OCC C;  2Q8V A;  5H6Q A;  1LNQ A;  2V4D A;  5FNV A;  2ZE6 A;  2WAM A;  2CH7 A;  3WFV A;  3CC2 V;  3R65 A;  3K04 A;  4O4L A;  2BTQ A;  2EIL B;  4X66 O;  1Q6H A;  3ZHR A;  1VF6 C;  3J7A U;  5DM6 V;  1LUW A;  3RBZ A;  2YID A;  3E22 A;  4UCR A;  2PF4 E;  2UXB B;  2WLK A;  5CA3 A;  4K8X A;  4OPH A;  1NTZ H;  3ZED A;  4JGS A;  2FML A;  1OCC B;  5EC1 C;  1JQ0 A;  1BQZ A;  3ZHV A;  4YJ3 B;  4WBN B;  1ZL8 B;  3OFN G;  5JCO C;  3BA9 A;  3VBB A;  4JZ2 A;  3OE7 G;  5B3S C;  3AG3 B;  5H5N A;  4CH6 A;  4DR6 O;  3ZN1 A;  2XAS A;  4QJF B;  3JSN A;  3E89 A;  5EYP A;  3W7S A;  3LUT B;  2CDY A;  3WB2 A;  1FD9 A;  3D8C A;  2YIA A;  4MTF A;  4LFB O;  2JGU A;  4ZOL A;  1EFR G;  3T1C A;  3JAT A;  4I9Q A;  3M7M X;  3C3S A;  4Z2W A;  3SPJ A;  1M57 C;  3H1L H;  4DUZ O;  4AQY O;  2EIN B;  1RP3 B;  1E1Q G;  2W0F C;  3K59 A;  4JI8 O;  1WA8 A;  1I7F A;  3D36 C;  3UQ8 A;  2DYR C;  2F4V B;  3SPI A;  1AJP A;  4CZZ A;  3RN4 A;  1VQM V;  2EIK C;  5JH7 B;  4X1K B;  3K58 A;  4PA7 A;  2X6B A;  1Q6U A;  4GUN A;  2P5O A;  2JDI G;  3CP1 A;  5CB4 A;  3CCS V;  2AHZ A;  4TV8 B;  4LH7 A;  4JPR A;  3L9D A;  1XOU A;  4NTY A;  1M9N A;  1P49 A;  3M99 B;  4O2B B;  1M4U A;  2DYS C;  2KG7 B;  5CA0 A;  2DWD C;  1L0N H;  3A0R A;  5IYC O;  4RUF A;  2FKX A;  4JV5 O;  1K3E A;  1JA8 A;  4DUY B;  4KHP B;  4JI4 O;  2M6Y A;  4GKK B;  4R8C A;  1OHH G;  4PA4 A;  3CC4 V;  1KEC A;  2N05 A;  4LWS B;  4NXN O;  1K4C C;  2OTJ V;  3L72 H;  4FFK A;  2PZS A;  3CCL V;  3AK1 A;  4YIO A;  3ASN C;  4UVA A;  3CJH B;  3CRQ A;  4UUJ C;  1V9P A;  1WNS A;  4BIZ A;  3AG1 C;  4CC6 A;  2IJK A;  2Q73 A;  1B04 A;  4N21 A;  4NR1 A;  3H1I H;  1AJN A;  4X65 B;  3JAR A;  3CMA V;  3U0Z A;  4KXR A;  1VQ5 V;  5J2U A;  4DK0 A;  3VOU A;  2UXD B;  3Q4H B;  3SYC A;  2UXB O;  3K06 A;  1Y66 A;  2H94 A;  5FL7 G;  3JAL A;  2FTK A;  3QF7 A;  4DR7 B;  1W0J G;  1V54 B;  4UV8 A;  2KG7 A;  4O4H A;  3ABL C;  2DQ3 A;  2LQT A;  2QA4 V;  1ZUQ A;  3RYC B;  4TQF A;  4FIP C;  3MDS A;  3HKB B;  4X1Y B;  1K34 A;  1N34 B;  1SRY A;  4NTX A;  4FVM A;  1YTF B;  1CEZ A;  2W6I G;  2ILM A;  2E5L B;  3B4S A;  1YVW A;  4FLU A;  4YHH B;  4H37 A;  4DR3 B;  2QWO B;  3STL C;  3N2K B;  5EBL C;  2AZ0 A;  2OTL V;  2YXY A;  3CJH A;  2PGG A;  1ENV A;  5KHH A;  2ADP A;  4I7Z B;  4IIJ B;  5D5P A;  2R9R B;  1PP9 H;  4K3A A;  5KHJ A;  2VQE B;  1PPJ H;  1JJO A;  3W7X A;  4DV7 B;  3ABK C;  1FXH A;  1FXK B;  2JEX A;  4EB6 B;  4UCU A;  5LP6 B;  1XNR O;  3QO8 A;  4FLZ A;  3JD1 A;  4AIL C;  1Z5W A;  4CBC A;  1R1B A;  4JAU A;  1URF A;  4O4I B;  1NJI W;  1MMM A;  3FB7 C;  2N74 A;  1JX9 A;  2XT9 A;  2HVK C;  1QU7 A;  3ML0 A;  1FKA O;  2WLI B;  2YXH A;  4MTG A;  4DR2 B;  2ZE8 A;  1S5H C;  4FMT A;  3S3W A;  1Z5V A; 
#chains in the Genus database with same CATH homology
 2QWO B;  2QWR B;  3AG7 A;  1IUR A;  1GH6 A;  1XBL A;  2CTW A;  4J7Z A;  4J80 A;  1N4C A;  2DMX A;  2N05 A;  2GUZ B;  1FAF A;  2CUG A;  2Y4T A;  2CTP A;  2QWN B;  2YS8 A;  2Y4U A;  2L6L A;  2DN9 A;  3APQ A;  2LGW A;  1NZ6 A;  3BVO A;  4RWU A;  2KQX A;  1WJZ A;  2CTQ A;  2PF4 E;  3APO A;  2QWP B;  1HDJ A;  2QWQ B;  4IT5 A;  1BQ0 A;  2N04 A;  2CTR A;  2LO1 A;  2EJ7 A;  2YUA A;  2OCH A;  2QSA A;  3UCS C;  3UO3 A;  2GUZ A;  2M6Y A;  1FPO A;  1BQZ A;  3UO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...