4J7ZA

Thermus thermophilus dnaj j- and g/f-domains
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining crystallography and EPR: crystal and solution structures of the multidomain cochaperone DnaJ.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein DnaJ 2
total genus 33
structure length 100
sequence length 100
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4j7zA00
2L6LA 2N05A 2DN9A 2YUAA 1HDJA 2Y4TA 1XBLA 2QWRB 2DMXA 1WJZA 2M6YA 2CUGA 2OCHA 4J7ZA 2LO1A 2QWNB 3APOA 4IT5A 2PF4E 2EJ7A 2QWQB 3UO2A 3UCSC 1BQ0A 2QWOB 3BVOA 2CTRA 2GUZA 1IURA 2CTPA 3UO3A 2CTQA 3AG7A 2GUZB 2QSAA 3APQA 2N04A 4RWUA 1N4CA 1FPOA 2KQXA 2CTWA 2Y4UA 1NZ6A 2LGWA 2QWPB 1BQZA 4J80A 2YS8A 1GH6A 1FAFA
chains in the Genus database with same CATH superfamily
4DR1B 5DN6G 2R9IA 4NTYA 3K5MA 2XAFA 3RN4A 3JAWA 3CEIA 1M5IA 5CBHA 1ZX3A 4QIWF 4O4IB 1SZXA 1W0JG 1N32B 3A8TA 1Q43A 4E4EA 1M9NA 4N23A 3IGAC 4LR3A 3RYHA 5KHKA 3I55V 4JI2B 5FLXN 4I50B 3RGBA 2Q67A 3FYIB 4CH5A 4MTXA 5IJ9B 2UXDO 3HR0A 1NR7A 2ZNJA 4DK1A 1AVMA 3OAAG 3E2EA 1XMOO 2A79B 4BAYA 1NVPB 3LSQA 2B9ZA 3C3TA 1F4MA 1GKFA 4LFBO 1GM8A 5B1AC 1DGSA 4NKGB 1EM1A 1P7GA 2B1IA 1COWG 1AI4A 2EILB 4PA6A 5EBLC 4YJ2A 1UJWB 1RFYA 4DV0B 4JZGA 2Q0OC 1TUBA 3E22B 1M1KW 1AILA 2DOSA 4JI3B 2B1GA 3OM3B 2EZPA 3JD2A 2QWNB 4LF7O 3LUTB 4KXRA 1VF6A 3CC2V 2OWOA 1TUEB 5LGTA 1NBMG 5ITZA 2H94A 1K4DC 3UM7A 2AHYA 1NJIW 2OCCB 2EIKB 1QNMA 1FXKC 1UFIA 1IVSA 3JALB 4GYCB 1QLNA 2Y4UA 1KKCA 3DTUB 2CGOA 4H44B 3SYAA 2YDEA 2P22C 3ZMZA 3H1LH 1BT8A 1NT2B 1QLEB 3ZMUA 5IY5C 3AG3B 5B1OA 3CRQA 3ZN1A 1GM9A 4X1IB 3DSQA 5JQGA 4MVZA 2QE7G 3LSUA 2RNBA 1WPBA 3HKDB 3TCUA 3T4DA 3T2MA 4I0XA 2OCCC 3BY6A 1QU7A 3IAYA 2ODMA 1H2LA 4UCVA 4EB6A 3SR2C 1Q6UA 4EFEA 3ASOB 4DR6B 1NI8A 4WCEV 4DR7O 2JRIA 3ZBHA 1FJGB 1R3KC 1OJHA 3HKDA 3JD0A 1MMMA 3STLC 2ZE7A 4DR4B 2EILC 3C90A 4L8JA 1GRJA 3JCZA 3SPJA 4JI1O 1ZTEA 3RWRD 4X20B 5KLVH 5L3DA 1RSOA 4WFHA 2LGQA 3OD4A 3ZEDA 4LP8A 2UXNA 2PY5A 4Z1VA 4HYOA 4FIPC 2JEXA 2O57A 5KMGB 3TETA 1BE3H 3K9SA 3AK3A 1SA0B 4PA7A 3B8MA 4B3MO 1B04A 2UUBB 2RJZA 3E22A 1JJ2U 1VQ8V 3ZIAG 2Q7EA 4BIUA 3UO2A 2YIBD 1IBLB 2JGDB 4B3SO 1VQPV 3K5NA 4QPKA 2AHZA 5L3BA 2E76B 3I5DA 2VWKA 1NR1A 1F23A 4GKKB 5IYDO 2CDYA 4A5UB 1IBKB 3RYHB 5KMGA 1NTMH 1HNZB 4JI0B 2R70A 1JA8A 4O2BA 4OX9O 3CSXA 3W7SA 5EZYB 3D36A 1YJNV 1J5EO 4TUYB 2UXXA 4X20A 3ETQA 3G80A 4B3MB 1K34A 3JASB 3U11A 2GTSA 3T1HB 3OTOB 1Y66A 5FNVB 3ZHUA 4JTDB 1IBLO 3E8HA 1V55B 2HJFC 2UXCB 2DN9A 2H8PC 4UCTA 1L1FA 3IC7A 4UCRA 1K7DA 2VWJA 5JVDA 2WLHA 1L0LH 4I0XB 4FLTA 2ZE8A 4R50A 1XMOB 3DC5A 2EIJC 4FM0A 1OCRB 1N4CA 1N0NA 5BMVB 4RUFA 4YJ3B 3M99B 2QTOA 1NU1H 4U7OA 2X7RB 5JQGB 4FLUA 4KP4A 2N05A 4FLXA 1VF5B 4LFCO 3KCXA 2M6YA 4DR3O 4LF4B 1J5EB 1MSWD 3CJHB 3ZCCA 1Z5VA 2PYJA 4DUYO 3BHPA 3ZHVA 4IGGA 3T1YB 4DV2O 4DRXB 5ITZB 4X66O 4UCUA 2WLJA 4X65O 2WWWA 3JAKB 2LGWA 1MNGA 1US6A 2XTAA 3KZIZ 4QE9A 3SYCA 1YJWV 1M90W 1BHBA 4ASUG 2GBOA 3B77A 2ATKC 1VIBA 2WAMA 1W0KG 3CCRV 3QG5A 5LMNB 2ZE5A 2WLMA 1M57B 1FXVA 3ZRXA 1VQMV 4TSFG 1I7FA 1DF4A 3QNEA 3FAVA 1EZVH 1NTKH 5LL6Y 2IJHA 4LF9B 2ILMA 5GONA 2WLIB 1Y67A 4UVCA 4EEQA 1Q5OA 3JSLA 5L3EA 1EN4A 5CA0A 3HKEA 4ICGA 4JI8B 4DR6O 2QA4V 3CE2A 1WB8A 4IIJB 3NR7A 3JAWB 1MABG 1KKDA 1XMQO 2EINC 2OIEA 1K73W 3GVMA 5CB4A 1EZJA 2PYLA 2HEPA 2F43G 3F7YC 1TVKB 3KCYA 2JGUA 4G27B 3A2FA 3KKYA 4RAIA 4K0KO 5DECA 1HW7A 1ZUQA 3IFXA 2WSSG 3ZHTA 4YIOA 1OCRC 3FYEB 5LMNO 5IJ0B 3BABA 1X59A 2N74A 1KP2A 4X8AA 3UKMA 2A06H 1VQOV 3ZS8C 1THZA 4LF7B 3K0GA 2V4DA 5IYZB 2CTRA 4MVRA 3G4SV 3FB8C 1XEQA 3AG1B 3PJSK 2GUZB 1VQ6V 4P30A 4JI8O 3GB7C 1AR5A 1Y76A 4DR2B 2XAGA 5IE9A 3FX7A 4GZRB 4PI2A 4PDRA 1FXKA 1KB9F 1WA8B 3ABLC 4LBEC 2CH7B 1K33A 2F4VB 4XDLA 4GLXA 3CMEV 5LMUO 3CCSV 2XAHA 5KAFZ 3W7XA 1K4CC 2X6BA 4O4LB 4OX9B 1SKVA 2ZM6O 2IM9A 5C8YB 3ABTA 2YI9A 2JIZG 4MVMA 2ADQB 3VQVA 3L9DA 2ZR2A 3E8GA 2AXTZ 1ZL8B 5JCOA 1GMGA 1G4YB 3QO5A 1FXHA 4B08A 4LFAO 2Q9LA 5KHJA 1KUQA 4TWKA 1KD1W 2QR4A 3J7AU 3E83A 3U10A 2UXBB 4D7TA 2ZR3A 2YI8A 2QEXV 3SYPA 5KX5B 3OR7C 2XASA 1VF6C 3KG2A 2VQEB 5IWAO 2F23A 2QKSA 1AI6A 3BEHA 5KUKA 5B1NA 5B1BB 1BHAA 2JDIG 4LNUA 4LF5O 4E2LA 1RM1C 1N0JA 2OCHA 1VQKV 3JATA 1I0HA 2OIGA 4MW8A 5EIBC 1AI5A 1YTFD 2ZXWB 5CA1B 3ZHRA 2HHHO 3CB2A 4ZOLB 4CC6A 5BY1A 1OHHG 1CXZB 3JATB 3OEHG 5DM6V 4JI2O 2FKXA 3BRCA 4ZIBA 2BSKB 1GM7A 3MHSC 3WG7B 4BIZA 5F2VO 3QVNA 1ZAUA 2CAZC 4YXWG 2ZKOA 1T5EA 2V7QG 4UB6Z 5CBGA 1KYOF 3W7UA 1K5QA 1IXMA 2Y0IA 3K03A 5J2TB 1YI2V 1GK9A 3BPZA 5H9CA 1EBOA 2CE4A 1XNRO 4TT3G 4JV5B 3E8FA 3CCQV 1W2BU 4LF9O 4RQEA 3O65A 3HPLC 1SQQH 4B3TO 4UB8Z 1VQLV 1ZL8A 3OTOO 5BR8B 4DV1B 5B66Z 4JYAO 4FPPA 4DW1A 1NZ6A 2FTKA 4I4TA 2BOBC 3CRRA 1BMFG 1SC5B 3QO8A 5EYPB 3OW2U 1F7YA 5D5QA 3N2GB 1N36O 3VOUA 1V54C 1XMQB 2F66C 2QM8A 4HNAA 4YY3B 5LXTB 5LA6B 3CRAA 1OCCB 5IYCO 3MDSA 2YC0A 1HP8A 1M57C 3RYIA 4BIOA 3HB3B 1XILA 4JI6O 1WA8A 3PN1A 4R6ZA 5LP6C 1FXKB 5H5NA 1H8HG 4L87A 3K3WA 3DC6A 2FYUH 1XL6A 1FS0G 5JJJB 3CC4V 1XBLA 2DMXA 1HNWO 1R73A 2UU9O 3H01A 2LQTA 4OPHA 4FVMA 2Y0PA 1CPYA 1WN7A 1XNRB 3TXQA 4C7UA 2Q8VA 1MA1A 4I55A 4FLYA 1FJGO 3ABLB 4G2KA 2Z3YA 1DF5A 2B5UA 1JQ0A 2ZT9B 2VS0A 4JI5B 5A2QN 4F4LA 2YS8A 1Y6XA 4IYHA 3CX5F 1KMIZ 3ZHQA 2E5LB 4X88A 5LOVA 4PDVA 1N36B 1N8RW 5LHGA 2IU3A 1MG1A 4YY3O 2CTQA 2W0XA 2ADPA 5LGNA 1XOUA 1H2SB 2Q69A 1Y74B 2JS3A 4HAMA 4OPAA 2OT5A 2CK3G 4TV9B 1Y74A 3ICXA 4D6TH 4B7KA 4UFZA 1QBZA 4WFFA 2Q73A 4DV3O 4J41A 2EBOA 2RCVA 2P06A 3F5WC 1VARA 4J7KA 4X1KA 1JFFB 3OTFA 3GWOA 4ZHQB 4TQFA 1FKAO 1R1BA 4F6RB 1VMGA 4I9QA 1JCHA 5B3SC 4I55B 3K5LA 2VRZA 3DGEA 4DV5O 3G6BA 1GN6A 1M4UA 2P4KA 4DR5B 2JJ1G 1JVMA 3LSSA 5LP6B 5JH7B 1AR4A 1VQ5V 3TK1A 1H2KA 2PI4A 3WU2Z 4DR1O 4O4HB 1YTFB 4MW3A 4JAVA 4X64B 5JJNB 2BE3A 1HNXO 4DR4O 4X1YB 4KFMA 4JI4O 3G67A 4LWSB 3CCUV 2AW9A 3A0HZ 2EIJB 3LDDA 4IHJA 5FL7G 3K06A 3CJHA 2NLJC 5LA6A 1K3EA 1V9PA 5LXTA 4HNAB 4AQYB 1KC8W 1GAXA 1EFRG 1RPOA 4DV7B 2HFEC 4TV8B 4I5SA 2W6IG 2E74B 1IURA 2C2AA 2PUSA 4DV4O 1I08A 2N04A 1PNLA 5J2UB 2UUCB 3D3QA 4LC1A 3OMIB 5JVDB 3OUSA 5LMUB 5GW7A 4JYBA 1RM1B 2Q4PA 4UUJC 3P30A 5B1BC 3SPCA 2ITDC 1I94B 2EIMC 3K79A 4XBFA 4FZ1A 4UV8A 4B3SB 1SESA 5FNVA 4RUEA 1VQ7V 2LJ2A 4X64O 3JD4A 4GKJB 4DUZO 4LFAB 1YJ9V 2G38A 4J9ZB 3OR6C 4MT8A 5L3FA 4X62B 2YUAA 2ZNIA 3M7MX 5IY5B 1NTZH 5CMUA 4O2BB 1M93A 4ZOLA 5H2FZ 4DV7O 1PKXA 3G6EV 2YICA 3HKBB 4U3FH 4FM2A 1EN5A 2Y69B 2Q0AA 4I7ZB 4LH6A 3ZRSA 2DWEC 4DV4B 2RQ6A 1URFA 1N34O 4UV9A 4JI6B 3ETDA 1E79G 2ZE6A 1AJNA 2X0LA 5FPOA 2OTLV 1WJZA 5IDJA 4PA9A 1S3JA 3ZJZA 2QJ1A 2WLLA 5DEDA 2DYSB 1HNWB 5KX5A 1YEWA 4AILC 1H8EG 1YIJV 1U97A 1XREA 4LCUC 3RT3C 2YXHA 3OUFA 2HKOA 3RYFB 3RW0A 4PDMA 1AP6A 3FB5C 4JI5O 2XT9A 3K5OA 1SA0A 1TGOA 4ABMA 1XI1A 3JAMN 2DW4A 3RYCB 2JEUA 2GSMB 1H2MA 3AK1A 4DV6O 1Q7YW 1S72V 4PELA 2HVKC 2Q68A 3STZC 1JOYA 4LF4O 1JMKC 1R6NA 4PHZA 3P3PA 1SETA 3CRMA 3QO7A 4DR7B 4FJCC 4JTAB 2A7WA 2IH3C 3K08A 1D5AA 1BCCH 1WLEA 2CH7A 2KB1A 2FMLA 2YIAA 1Z5WA 5BR8O 4YHHO 4DV1O 2NR5A 2QM7A 3IC9A 1QR9A 1PNMA 4CS2A 3VQWA 1R6TA 4LF8B 4MTOA 1Y76B 2ZINA 1OCOB 4NYKA 1Z2GA 4WBNA 4R8CA 2QWOB 4QNHB 1KQSU 2DYRC 2Y48A 4DK0A 1AROP 5IYZA 2Y69C 1K9MW 1H38A 4UCSA 1TAEA 2D3OW 4X1IA 3JSNA 3CCEV 2RN9A 1YVWA 3L71H 2EX3A 2DQ0A 2ZM6B 1JPXA 3RBZA 1JR9A 4NXNO 3BA9A 2KSDA 5IJ0A 2UU9B 5CBFA 4ZI7A 3ABMC 3RFRA 2YIBA 3UCSC 2AZ2A 4AHCA 4UVBA 1ROPA 3CCMV 5EC2C 1QR8A 2QKCA 1JJOA 2GTAA 2X6AA 2P6JA 1Q82W 3APQA 2PZSA 2PTMA 2EIKC 1LUVA 1TVKA 1L0NH 3CHXA 2XAQA 4KHPB 2QWRB 3B4SA 2A3QA 5EIBD 4J7ZA 4BR6A 4NVPA 4YJ2B 2YEVA 4LF8O 1NH2B 4IIJA 1PP9H 3B40A 5IT9N 1RPRA 4MVSA 2FL4A 1KBHA 2IU0A 5LYJB 4JI7B 3CXHF 4GX5A 3T1CA 1PM9A 3ASOC 5IJ9A 1WB7A 3T4ZA 4H37A 3FD9A 4I50A 2ZDIC 4LFCB 1KECA 2BOCC 2QWQB 3T1HO 3JARB 2WPDG 1TA8A 3ZX6A 3CD6V 4JI1B 3AG7A 1Q8IA 4MTGA 4U7NA 3OMAB 4DUYB 4J9YB 1OV9A 2HR3A 1GN4A 2QWPB 3WB1A 4UCOA 3TGUH 3S3XA 4XDJA 3CS5A 2Q7HA 3L75H 2VQFB 3JAKA 4Z2WA 2W6JG 2Z5UA 3ZRWA 1NS1A 3UT5A 1S5HC 4LFBB 1SF9A 3VQYA 3B2EE 2KG7B 3K9AA 1BL8A 1M56B 2QKAA 2EINB 2K9PA 5EBWC 1XDCA 1B06A 3EVKA 1ENVA 4G28B 3D36C 5H6RA 1UPGA 4NB5A 1YXBA 4MVUA 4IT5A 1V54B 1XHZA 3K57A 2QTSA 1DLBA 5J9PC 4WFAV 4WBNB 1FPOA 4FLVA 2UXDB 4FFBB 4B3RB 1SQFA 2MK3A 3JYCA 5KAIZ 1YCIA 1GN2A 2AZ0A 3J80N 1GO3F 2LW1A 3R65A 4KUMA 3C3SA 3X2QB 2KG7A 2VQFO 1IBKO 2PI5A 4DV0O 3ZRWB 1Y4MA 4OXSA 4GT1A 3JD3A 4QJFB 1QQCA 4P9OA 1R3JC 1NQTA 3JASA 4R7CA 5FPRA 4LF5B 1ZLZA 4WF9V 3N27A 4TUYA 3L73H 2P90A 4I9WA 5EZYA 1PL0A 2P5OA 3ABMB 4GX2A 1DTOA 5B1AB 4GCZA 3OMNB 1GTOA 3JARA 2JK5C 4JGSA 3WFVA 4EKWA 2EZOA 1CP9A 1M56C 1B3QA 2ZDIA 4J42A 1XNQO 4X62O 3RYFA 5LYJA 1KP3A 2ZIMA 4P9PA 4JYCA 3CYOA 3B8NA 3L74H 2ZD9A 2CTPA 1BGYH 2JGDA 5LHHA 3CWBH 3MD0A 4DYLA 4NR1A 5B3SB 1K5SA 2QDOA 1D2DA 2YEVB 3OE7G 4CS3A 3A0BZ 3A0RA 1GN3A 5JWPA 2CUGA 3T1YO 4JZ2A 3DXRB 4NTWA 1WAZA 4PJ0Z 3K58A 3JD1A 2ETNA 3HKBA 1YITV 3QTCA 4ZI7B 1OCZB 5EBMC 1I5XA 4K35A 1RSOB 5TISZ 1D5NA 2P4VA 4PI0A 2LO1A 3ZMTA 3CMAV 1FFXA 1W59A 3Q4HA 2BTQB 5KUMA 2HLDG 3W7WA 4JI0O 4MS2A 3SJQC 2QSAA 2UUAB 4JTCB 1S5JA 1G8MA 3K0DA 1U96A 2E3CA 5C93A 4ZKIA 3O9OA 3THOA 2Q7GA 5LHIA 4EB6B 2IW5A 1A32A 4PA3A 1VQ9V 1MZFA 3F5TA 1LUWA 2IJJA 1Q90D 1P49A 3P3NA 3H1IH 1OCCC 1R3IC 3BVOA 2ZQMA 1H2GA 1MZEA 4JAAA 4GKKO 3B09A 5A9GA 4MSWC 3D8CA 4GX0A 4CH3A 3ASNB 2NN4A 1HNZO 1DK1A 2JS5A 1AR1B 5JJEB 4FMTA 3JALA 1B6QA 4J10A 4LWSA 1O9GA 4NTXA 2D2CB 3UO3A 2F1MA 3CP1A 4K0KB 1PPJH 3RYCA 3AG4C 1P7BA 3L70H 4DW0A 2CGNA 4X9QA 4O4HA 5CA3A 3NXSA 1FYJA 1BQZA 1NVPD 4UVAA 3SGIA 2XNDG 4YIPA 1TUBB 5JH7A 5LP6A 5E1AC 3JCUZ 4DR3B 1ZSPA 4DXWA 4W4KA 4CBCA 3WB0A 3SPIA 4H13B 1N32O 1SQGA 1YSCA 2ZIOA 2FB5A 1BS3A 2WLLB 5LBQA 4X65B 2HVJC 4ZHQA 1X4TA 1WP8A 3CCJV 3AG2B 1JFFA 2YXYA 4K3AA 3ZRVA 4F6EA 4JYYA 2RDCA 4Z1MG 2RMKB 5BZBA 2F4VO 1P4RA 5IYBO 1CEZA 1NH2D 2YXLA 4O4IA 4DV5B 3OFNG 4BW5A 1AI7A 4BWAA 3EXAA 3S3WA 2P7TC 1SQXH 3ZHSA 2UUBO 3J81N 1Q6HA 3ETGA 3BA8A 4X66B 4DO2A 1HR0B 3VBBA 1BQ0A 3CRCA 4W4LA 2IJIA 3N2KB 1IX9A 3E86A 4IYIA 3MAQA 4GUNA 5D5PA 4QGPA 1KU9A 1SS3A 4HZ3A 4FLZA 3RVZA 4NXMB 5E79Z 3SYQA 2NNUA 1XNQB 4TOIA 5J2UA 1F4NA 2VQEO 2GDSA 2E5LO 1PD3A 1G6UA 1R3LC 1VF7A 3I56V 2CTWA 3E8BA 3FB7C 4TV8A 1BSMA 2IJKA 1GH6A 4WFBV 3ABKB 1S76D 2R9AA 5IWAB 2L35A 1HDJA 5GTHZ 3SJBC 1LR1A 3UQ8A 2WA4A 4O2AA 3OEEG 1NKDA 1QVGU 3ZMSA 4U3JB 2WLNA 4IHJB 4X1YA 3RYIB 1HR0O 3CCVV 4U3JA 4CS4A 4YHHB 3F7VC 5HFLA 4CH6A 4BW9A 1E1QG 4PV1B 1QCEA 5BXZA 1SQBH 1AJPA 2HP8A 4I4TB 2OTJV 2LP7A 3IJ4A 4J11A 3CPWU 4NXMO 2F93B 2ITCC 1OCZC 4F6RA 1O9HA 3W7TA 4FLWA 2DE0X 1XHXA 4RO2A 5GTIZ 1S77D 3LDEA 4K8ZA 4X1KB 3R66A 2Y4TA 3L72H 3VQXA 1P84F 2JVDA 2PF4E 4CH4A 3BCCH 2DYRB 4JV5O 5J2TA 2BTOA 2ZCEA 1Q81W 4DV2B 2DYSC 4DV3B 5L3GA 1G1XB 1V55C 1XUQA 4MVQA 3H9VA 4LF6O 1E1RG 2R72A 3GWKC 3SDLA 2QM4A 4TV9A 5H6QA 4CC5A 2EJRA 1VP7A 1Q86W 2HJDA 3G71V 1RP3B 2LW7A 5HFMA 5EK0A 3E89A 1Q6IA 3LDCA 4H0LB 1FFTB 1YZBA 5KHGA 5LOVB 3U0ZA 4O4JB 5EC1C 3HKCA 2L6LA 2KKWA 3OT7A 3MHHC 4P2ZA 1XL4A 2GHYA 3SPGA 5B5EZ 3ABUA 3WB2A 2P67A 3P32A 3QF7A 1N33O 4RQFA 4OGQB 2HHHB 3FB6C 3LNNA 2UXCO 3FKSG 4QE7A 2YIDA 1FAFA 3CC7V 2F95B 4X89A 4LF6B 2UXBO 1S5LZ 4DUZB 4WFGA 3ASNC 1OCOC 2IH1C 3EHBB 4CZZA 1SZTA 4HBNA 4K8XA 4FFKA 2YSUB 5AG2A 5CN0A 2QGNA 3CCLV 4XDKA 1K97A 4Q20A 1PNKA 3H1JH 5L3CA 1SQPH 3N2GA 4O4LA 4NXNB 5EYPA 3SYOA 1I94O 5K1XA 2Z0AA 4FM1A 3EFFK 2Q6AA 4GX1A 2WA3A 1MSDA 2A9HA 4B3TB 4J7JA 3CXCU 2DJVA 1XQ8A 1H2NA 4DR2O 1AB3A 4D7SA 1LNQA 1QLEC 2A0LA 2LFSA 3H1HH 1MOFA 2EIMB 2GUZA 2BTQA 3Q4HB 1ZWIC 1FFXB 2X6CA 4JI3O 1N34B 4N21A 1HWYA 1JX9A 5KA6A 1S0VA 2BSKA 1AJQA 3K59A 1HNXB 3HKCB 3X2QC 4O4JA 4PD4F 2EULA 1WNSA 1IDSA 4PA4A 1I5YA 2GV9A 3OGCC 4JF3A 5CA1A 1L8DA 4TQDA 3TJTA 4JASA 1ORQC 3DXRA 1J95A 5CB4B 1WPXA 2MW2B 4LNUB 4UXNA 2ARHA 4AQYO 4JPRA 3SJCC 2EJ7A 1R6KA 2R9RB 2ZXWC 3BFRA 3ZMVA 2W0FC 2IBZH 3E35A 4WFEA 4RWUA 3HKEB 3SJAC 1YF2A 2Q5ZA 5CA0B 1K8AW 1IBMB 2WLIA 5GONB 3ML0A 2E75B 2UUCO 3AK2A 4ZBMA 3AG2C 1K92A 4AI8A 3FAVB 3TXSA 2XUMA 1IXBA 1AP5A 4FZ0A 3AG4B 4KL1A 4GKJO 2DQ3A 1FD9A 5KHIA 4MTFA 1VQ4V 2KQXA 4B3RO 1QHTA 2AGAA 4MVOA 3M8AA 4Q6GA 3WG7C 2XOKG 3BAAA 1VQNV 3FFQA 5C8YA 2H3OA 2OYQA 2LFRA 4B7EA 1SQVH 5JCOC 4JAUA 3AG1C 4DRXA 3D3IA 2XHBA 4LH7A 2WLKA 2UUAO 3ABKC 2PGGA 1IZ3A 4O2AB 4DR5O 4FK5C 1SRYA 1YDXA 1SERA 3K04A 1IBMO 1YHQV 4JI7O 2M7WA 3ETEA 4YJ3A 4FFBA 5BMVA 1Q3EA 1F51A 3ZN0A 1VEWA 1BZKA 1PV0A 2BCCH 1EN6A 2DWDC 4JI4B 1WP7A 5K1PA 4JYAB 4J80A 1N33B 4KHPO 1OZ0A 3AG3C 3SPHA 3OGIB 5KHHA 3RVYA 4QPJA 5KA5A 2K1EA 1QVFU 3APOA 4PDLA 3H1KH 2JJ2G 4DV6B 4H33A 3N2KA 4EFBA 3UT5B 2HG5C 2V1DA 3LNMB 3AEIA 2XAJA 1PL4A 5LGUA 4IL6Z
chains in the Genus database with same CATH topology
2L6LA 2N05A 2DN9A 2YUAA 1HDJA 2Y4TA 1XBLA 2QWRB 2DMXA 1WJZA 2M6YA 2CUGA 2OCHA 4J7ZA 2LO1A 2QWNB 3APOA 4IT5A 2PF4E 2EJ7A 2QWQB 3UO2A 3UCSC 1BQ0A 2QWOB 3BVOA 2CTRA 2GUZA 1IURA 2CTPA 3UO3A 2CTQA 3AG7A 2GUZB 2QSAA 3APQA 2N04A 4RWUA 1N4CA 1FPOA 2KQXA 2CTWA 2Y4UA 1NZ6A 2LGWA 2QWPB 1BQZA 4J80A 2YS8A 1GH6A 1FAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6L A;  2N05 A;  2DN9 A;  2YUA A;  1HDJ A;  2Y4T A;  1XBL A;  2QWR B;  2DMX A;  1WJZ A;  2M6Y A;  2CUG A;  2OCH A;  4J7Z A;  2LO1 A;  2QWN B;  3APO A;  4IT5 A;  2PF4 E;  2EJ7 A;  2QWQ B;  3UO2 A;  3UCS C;  1BQ0 A;  2QWO B;  3BVO A;  2CTR A;  2GUZ A;  1IUR A;  2CTP A;  3UO3 A;  2CTQ A;  3AG7 A;  2GUZ B;  2QSA A;  3APQ A;  2N04 A;  4RWU A;  1N4C A;  1FPO A;  2KQX A;  2CTW A;  2Y4U A;  1NZ6 A;  2LGW A;  2QWP B;  1BQZ A;  4J80 A;  2YS8 A;  1GH6 A;  1FAF A; 
#chains in the Genus database with same CATH topology
 4DR1 B;  5DN6 G;  2R9I A;  4NTY A;  3K5M A;  2XAF A;  3RN4 A;  3JAW A;  3CEI A;  1M5I A;  5CBH A;  1ZX3 A;  4QIW F;  4O4I B;  1SZX A;  1W0J G;  1N32 B;  3A8T A;  1Q43 A;  4E4E A;  1M9N A;  4N23 A;  3IGA C;  4LR3 A;  3RYH A;  5KHK A;  3I55 V;  4JI2 B;  5FLX N;  4I50 B;  3RGB A;  2Q67 A;  3FYI B;  4CH5 A;  4MTX A;  5IJ9 B;  2UXD O;  3HR0 A;  1NR7 A;  2ZNJ A;  4DK1 A;  1AVM A;  3OAA G;  3E2E A;  1XMO O;  2A79 B;  4BAY A;  1NVP B;  3LSQ A;  2B9Z A;  3C3T A;  1F4M A;  1GKF A;  4LFB O;  1GM8 A;  5B1A C;  1DGS A;  4NKG B;  1EM1 A;  1P7G A;  2B1I A;  1COW G;  1AI4 A;  2EIL B;  4PA6 A;  5EBL C;  4YJ2 A;  1UJW B;  1RFY A;  4DV0 B;  4JZG A;  2Q0O C;  1TUB A;  3E22 B;  1M1K W;  1AIL A;  2DOS A;  4JI3 B;  2B1G A;  3OM3 B;  2EZP A;  3JD2 A;  2QWN B;  4LF7 O;  3LUT B;  4KXR A;  1VF6 A;  3CC2 V;  2OWO A;  1TUE B;  5LGT A;  1NBM G;  5ITZ A;  2H94 A;  1K4D C;  3UM7 A;  2AHY A;  1NJI W;  2OCC B;  2EIK B;  1QNM A;  1FXK C;  1UFI A;  1IVS A;  3JAL B;  4GYC B;  1QLN A;  2Y4U A;  1KKC A;  3DTU B;  2CGO A;  4H44 B;  3SYA A;  2YDE A;  2P22 C;  3ZMZ A;  3H1L H;  1BT8 A;  1NT2 B;  1QLE B;  3ZMU A;  5IY5 C;  3AG3 B;  5B1O A;  3CRQ A;  3ZN1 A;  1GM9 A;  4X1I B;  3DSQ A;  5JQG A;  4MVZ A;  2QE7 G;  3LSU A;  2RNB A;  1WPB A;  3HKD B;  3TCU A;  3T4D A;  3T2M A;  4I0X A;  2OCC C;  3BY6 A;  1QU7 A;  3IAY A;  2ODM A;  1H2L A;  4UCV A;  4EB6 A;  3SR2 C;  1Q6U A;  4EFE A;  3ASO B;  4DR6 B;  1NI8 A;  4WCE V;  4DR7 O;  2JRI A;  3ZBH A;  1FJG B;  1R3K C;  1OJH A;  3HKD A;  3JD0 A;  1MMM A;  3STL C;  2ZE7 A;  4DR4 B;  2EIL C;  3C90 A;  4L8J A;  1GRJ A;  3JCZ A;  3SPJ A;  4JI1 O;  1ZTE A;  3RWR D;  4X20 B;  5KLV H;  5L3D A;  1RSO A;  4WFH A;  2LGQ A;  3OD4 A;  3ZED A;  4LP8 A;  2UXN A;  2PY5 A;  4Z1V A;  4HYO A;  4FIP C;  2JEX A;  2O57 A;  5KMG B;  3TET A;  1BE3 H;  3K9S A;  3AK3 A;  1SA0 B;  4PA7 A;  3B8M A;  4B3M O;  1B04 A;  2UUB B;  2RJZ A;  3E22 A;  1JJ2 U;  1VQ8 V;  3ZIA G;  2Q7E A;  4BIU A;  3UO2 A;  2YIB D;  1IBL B;  2JGD B;  4B3S O;  1VQP V;  3K5N A;  4QPK A;  2AHZ A;  5L3B A;  2E76 B;  3I5D A;  2VWK A;  1NR1 A;  1F23 A;  4GKK B;  5IYD O;  2CDY A;  4A5U B;  1IBK B;  3RYH B;  5KMG A;  1NTM H;  1HNZ B;  4JI0 B;  2R70 A;  1JA8 A;  4O2B A;  4OX9 O;  3CSX A;  3W7S A;  5EZY B;  3D36 A;  1YJN V;  1J5E O;  4TUY B;  2UXX A;  4X20 A;  3ETQ A;  3G80 A;  4B3M B;  1K34 A;  3JAS B;  3U11 A;  2GTS A;  3T1H B;  3OTO B;  1Y66 A;  5FNV B;  3ZHU A;  4JTD B;  1IBL O;  3E8H A;  1V55 B;  2HJF C;  2UXC B;  2DN9 A;  2H8P C;  4UCT A;  1L1F A;  3IC7 A;  4UCR A;  1K7D A;  2VWJ A;  5JVD A;  2WLH A;  1L0L H;  4I0X B;  4FLT A;  2ZE8 A;  4R50 A;  1XMO B;  3DC5 A;  2EIJ C;  4FM0 A;  1OCR B;  1N4C A;  1N0N A;  5BMV B;  4RUF A;  4YJ3 B;  3M99 B;  2QTO A;  1NU1 H;  4U7O A;  2X7R B;  5JQG B;  4FLU A;  4KP4 A;  2N05 A;  4FLX A;  1VF5 B;  4LFC O;  3KCX A;  2M6Y A;  4DR3 O;  4LF4 B;  1J5E B;  1MSW D;  3CJH B;  3ZCC A;  1Z5V A;  2PYJ A;  4DUY O;  3BHP A;  3ZHV A;  4IGG A;  3T1Y B;  4DV2 O;  4DRX B;  5ITZ B;  4X66 O;  4UCU A;  2WLJ A;  4X65 O;  2WWW A;  3JAK B;  2LGW A;  1MNG A;  1US6 A;  2XTA A;  3KZI Z;  4QE9 A;  3SYC A;  1YJW V;  1M90 W;  1BHB A;  4ASU G;  2GBO A;  3B77 A;  2ATK C;  1VIB A;  2WAM A;  1W0K G;  3CCR V;  3QG5 A;  5LMN B;  2ZE5 A;  2WLM A;  1M57 B;  1FXV A;  3ZRX A;  1VQM V;  4TSF G;  1I7F A;  1DF4 A;  3QNE A;  3FAV A;  1EZV H;  1NTK H;  5LL6 Y;  2IJH A;  4LF9 B;  2ILM A;  5GON A;  2WLI B;  1Y67 A;  4UVC A;  4EEQ A;  1Q5O A;  3JSL A;  5L3E A;  1EN4 A;  5CA0 A;  3HKE A;  4ICG A;  4JI8 B;  4DR6 O;  2QA4 V;  3CE2 A;  1WB8 A;  4IIJ B;  3NR7 A;  3JAW B;  1MAB G;  1KKD A;  1XMQ O;  2EIN C;  2OIE A;  1K73 W;  3GVM A;  5CB4 A;  1EZJ A;  2PYL A;  2HEP A;  2F43 G;  3F7Y C;  1TVK B;  3KCY A;  2JGU A;  4G27 B;  3A2F A;  3KKY A;  4RAI A;  4K0K O;  5DEC A;  1HW7 A;  1ZUQ A;  3IFX A;  2WSS G;  3ZHT A;  4YIO A;  1OCR C;  3FYE B;  5LMN O;  5IJ0 B;  3BAB A;  1X59 A;  2N74 A;  1KP2 A;  4X8A A;  3UKM A;  2A06 H;  1VQO V;  3ZS8 C;  1THZ A;  4LF7 B;  3K0G A;  2V4D A;  5IYZ B;  2CTR A;  4MVR A;  3G4S V;  3FB8 C;  1XEQ A;  3AG1 B;  3PJS K;  2GUZ B;  1VQ6 V;  4P30 A;  4JI8 O;  3GB7 C;  1AR5 A;  1Y76 A;  4DR2 B;  2XAG A;  5IE9 A;  3FX7 A;  4GZR B;  4PI2 A;  4PDR A;  1FXK A;  1KB9 F;  1WA8 B;  3ABL C;  4LBE C;  2CH7 B;  1K33 A;  2F4V B;  4XDL A;  4GLX A;  3CME V;  5LMU O;  3CCS V;  2XAH A;  5KAF Z;  3W7X A;  1K4C C;  2X6B A;  4O4L B;  4OX9 B;  1SKV A;  2ZM6 O;  2IM9 A;  5C8Y B;  3ABT A;  2YI9 A;  2JIZ G;  4MVM A;  2ADQ B;  3VQV A;  3L9D A;  2ZR2 A;  3E8G A;  2AXT Z;  1ZL8 B;  5JCO A;  1GMG A;  1G4Y B;  3QO5 A;  1FXH A;  4B08 A;  4LFA O;  2Q9L A;  5KHJ A;  1KUQ A;  4TWK A;  1KD1 W;  2QR4 A;  3J7A U;  3E83 A;  3U10 A;  2UXB B;  4D7T A;  2ZR3 A;  2YI8 A;  2QEX V;  3SYP A;  5KX5 B;  3OR7 C;  2XAS A;  1VF6 C;  3KG2 A;  2VQE B;  5IWA O;  2F23 A;  2QKS A;  1AI6 A;  3BEH A;  5KUK A;  5B1N A;  5B1B B;  1BHA A;  2JDI G;  4LNU A;  4LF5 O;  4E2L A;  1RM1 C;  1N0J A;  2OCH A;  1VQK V;  3JAT A;  1I0H A;  2OIG A;  4MW8 A;  5EIB C;  1AI5 A;  1YTF D;  2ZXW B;  5CA1 B;  3ZHR A;  2HHH O;  3CB2 A;  4ZOL B;  4CC6 A;  5BY1 A;  1OHH G;  1CXZ B;  3JAT B;  3OEH G;  5DM6 V;  4JI2 O;  2FKX A;  3BRC A;  4ZIB A;  2BSK B;  1GM7 A;  3MHS C;  3WG7 B;  4BIZ A;  5F2V O;  3QVN A;  1ZAU A;  2CAZ C;  4YXW G;  2ZKO A;  1T5E A;  2V7Q G;  4UB6 Z;  5CBG A;  1KYO F;  3W7U A;  1K5Q A;  1IXM A;  2Y0I A;  3K03 A;  5J2T B;  1YI2 V;  1GK9 A;  3BPZ A;  5H9C A;  1EBO A;  2CE4 A;  1XNR O;  4TT3 G;  4JV5 B;  3E8F A;  3CCQ V;  1W2B U;  4LF9 O;  4RQE A;  3O65 A;  3HPL C;  1SQQ H;  4B3T O;  4UB8 Z;  1VQL V;  1ZL8 A;  3OTO O;  5BR8 B;  4DV1 B;  5B66 Z;  4JYA O;  4FPP A;  4DW1 A;  1NZ6 A;  2FTK A;  4I4T A;  2BOB C;  3CRR A;  1BMF G;  1SC5 B;  3QO8 A;  5EYP B;  3OW2 U;  1F7Y A;  5D5Q A;  3N2G B;  1N36 O;  3VOU A;  1V54 C;  1XMQ B;  2F66 C;  2QM8 A;  4HNA A;  4YY3 B;  5LXT B;  5LA6 B;  3CRA A;  1OCC B;  5IYC O;  3MDS A;  2YC0 A;  1HP8 A;  1M57 C;  3RYI A;  4BIO A;  3HB3 B;  1XIL A;  4JI6 O;  1WA8 A;  3PN1 A;  4R6Z A;  5LP6 C;  1FXK B;  5H5N A;  1H8H G;  4L87 A;  3K3W A;  3DC6 A;  2FYU H;  1XL6 A;  1FS0 G;  5JJJ B;  3CC4 V;  1XBL A;  2DMX A;  1HNW O;  1R73 A;  2UU9 O;  3H01 A;  2LQT A;  4OPH A;  4FVM A;  2Y0P A;  1CPY A;  1WN7 A;  1XNR B;  3TXQ A;  4C7U A;  2Q8V A;  1MA1 A;  4I55 A;  4FLY A;  1FJG O;  3ABL B;  4G2K A;  2Z3Y A;  1DF5 A;  2B5U A;  1JQ0 A;  2ZT9 B;  2VS0 A;  4JI5 B;  5A2Q N;  4F4L A;  2YS8 A;  1Y6X A;  4IYH A;  3CX5 F;  1KMI Z;  3ZHQ A;  2E5L B;  4X88 A;  5LOV A;  4PDV A;  1N36 B;  1N8R W;  5LHG A;  2IU3 A;  1MG1 A;  4YY3 O;  2CTQ A;  2W0X A;  2ADP A;  5LGN A;  1XOU A;  1H2S B;  2Q69 A;  1Y74 B;  2JS3 A;  4HAM A;  4OPA A;  2OT5 A;  2CK3 G;  4TV9 B;  1Y74 A;  3ICX A;  4D6T H;  4B7K A;  4UFZ A;  1QBZ A;  4WFF A;  2Q73 A;  4DV3 O;  4J41 A;  2EBO A;  2RCV A;  2P06 A;  3F5W C;  1VAR A;  4J7K A;  4X1K A;  1JFF B;  3OTF A;  3GWO A;  4ZHQ B;  4TQF A;  1FKA O;  1R1B A;  4F6R B;  1VMG A;  4I9Q A;  1JCH A;  5B3S C;  4I55 B;  3K5L A;  2VRZ A;  3DGE A;  4DV5 O;  3G6B A;  1GN6 A;  1M4U A;  2P4K A;  4DR5 B;  2JJ1 G;  1JVM A;  3LSS A;  5LP6 B;  5JH7 B;  1AR4 A;  1VQ5 V;  3TK1 A;  1H2K A;  2PI4 A;  3WU2 Z;  4DR1 O;  4O4H B;  1YTF B;  4MW3 A;  4JAV A;  4X64 B;  5JJN B;  2BE3 A;  1HNX O;  4DR4 O;  4X1Y B;  4KFM A;  4JI4 O;  3G67 A;  4LWS B;  3CCU V;  2AW9 A;  3A0H Z;  2EIJ B;  3LDD A;  4IHJ A;  5FL7 G;  3K06 A;  3CJH A;  2NLJ C;  5LA6 A;  1K3E A;  1V9P A;  5LXT A;  4HNA B;  4AQY B;  1KC8 W;  1GAX A;  1EFR G;  1RPO A;  4DV7 B;  2HFE C;  4TV8 B;  4I5S A;  2W6I G;  2E74 B;  1IUR A;  2C2A A;  2PUS A;  4DV4 O;  1I08 A;  2N04 A;  1PNL A;  5J2U B;  2UUC B;  3D3Q A;  4LC1 A;  3OMI B;  5JVD B;  3OUS A;  5LMU B;  5GW7 A;  4JYB A;  1RM1 B;  2Q4P A;  4UUJ C;  3P30 A;  5B1B C;  3SPC A;  2ITD C;  1I94 B;  2EIM C;  3K79 A;  4XBF A;  4FZ1 A;  4UV8 A;  4B3S B;  1SES A;  5FNV A;  4RUE A;  1VQ7 V;  2LJ2 A;  4X64 O;  3JD4 A;  4GKJ B;  4DUZ O;  4LFA B;  1YJ9 V;  2G38 A;  4J9Z B;  3OR6 C;  4MT8 A;  5L3F A;  4X62 B;  2YUA A;  2ZNI A;  3M7M X;  5IY5 B;  1NTZ H;  5CMU A;  4O2B B;  1M93 A;  4ZOL A;  5H2F Z;  4DV7 O;  1PKX A;  3G6E V;  2YIC A;  3HKB B;  4U3F H;  4FM2 A;  1EN5 A;  2Y69 B;  2Q0A A;  4I7Z B;  4LH6 A;  3ZRS A;  2DWE C;  4DV4 B;  2RQ6 A;  1URF A;  1N34 O;  4UV9 A;  4JI6 B;  3ETD A;  1E79 G;  2ZE6 A;  1AJN A;  2X0L A;  5FPO A;  2OTL V;  1WJZ A;  5IDJ A;  4PA9 A;  1S3J A;  3ZJZ A;  2QJ1 A;  2WLL A;  5DED A;  2DYS B;  1HNW B;  5KX5 A;  1YEW A;  4AIL C;  1H8E G;  1YIJ V;  1U97 A;  1XRE A;  4LCU C;  3RT3 C;  2YXH A;  3OUF A;  2HKO A;  3RYF B;  3RW0 A;  4PDM A;  1AP6 A;  3FB5 C;  4JI5 O;  2XT9 A;  3K5O A;  1SA0 A;  1TGO A;  4ABM A;  1XI1 A;  3JAM N;  2DW4 A;  3RYC B;  2JEU A;  2GSM B;  1H2M A;  3AK1 A;  4DV6 O;  1Q7Y W;  1S72 V;  4PEL A;  2HVK C;  2Q68 A;  3STZ C;  1JOY A;  4LF4 O;  1JMK C;  1R6N A;  4PHZ A;  3P3P A;  1SET A;  3CRM A;  3QO7 A;  4DR7 B;  4FJC C;  4JTA B;  2A7W A;  2IH3 C;  3K08 A;  1D5A A;  1BCC H;  1WLE A;  2CH7 A;  2KB1 A;  2FML A;  2YIA A;  1Z5W A;  5BR8 O;  4YHH O;  4DV1 O;  2NR5 A;  2QM7 A;  3IC9 A;  1QR9 A;  1PNM A;  4CS2 A;  3VQW A;  1R6T A;  4LF8 B;  4MTO A;  1Y76 B;  2ZIN A;  1OCO B;  4NYK A;  1Z2G A;  4WBN A;  4R8C A;  2QWO B;  4QNH B;  1KQS U;  2DYR C;  2Y48 A;  4DK0 A;  1ARO P;  5IYZ A;  2Y69 C;  1K9M W;  1H38 A;  4UCS A;  1TAE A;  2D3O W;  4X1I A;  3JSN A;  3CCE V;  2RN9 A;  1YVW A;  3L71 H;  2EX3 A;  2DQ0 A;  2ZM6 B;  1JPX A;  3RBZ A;  1JR9 A;  4NXN O;  3BA9 A;  2KSD A;  5IJ0 A;  2UU9 B;  5CBF A;  4ZI7 A;  3ABM C;  3RFR A;  2YIB A;  3UCS C;  2AZ2 A;  4AHC A;  4UVB A;  1ROP A;  3CCM V;  5EC2 C;  1QR8 A;  2QKC A;  1JJO A;  2GTA A;  2X6A A;  2P6J A;  1Q82 W;  3APQ A;  2PZS A;  2PTM A;  2EIK C;  1LUV A;  1TVK A;  1L0N H;  3CHX A;  2XAQ A;  4KHP B;  2QWR B;  3B4S A;  2A3Q A;  5EIB D;  4J7Z A;  4BR6 A;  4NVP A;  4YJ2 B;  2YEV A;  4LF8 O;  1NH2 B;  4IIJ A;  1PP9 H;  3B40 A;  5IT9 N;  1RPR A;  4MVS A;  2FL4 A;  1KBH A;  2IU0 A;  5LYJ B;  4JI7 B;  3CXH F;  4GX5 A;  3T1C A;  1PM9 A;  3ASO C;  5IJ9 A;  1WB7 A;  3T4Z A;  4H37 A;  3FD9 A;  4I50 A;  2ZDI C;  4LFC B;  1KEC A;  2BOC C;  2QWQ B;  3T1H O;  3JAR B;  2WPD G;  1TA8 A;  3ZX6 A;  3CD6 V;  4JI1 B;  3AG7 A;  1Q8I A;  4MTG A;  4U7N A;  3OMA B;  4DUY B;  4J9Y B;  1OV9 A;  2HR3 A;  1GN4 A;  2QWP B;  3WB1 A;  4UCO A;  3TGU H;  3S3X A;  4XDJ A;  3CS5 A;  2Q7H A;  3L75 H;  2VQF B;  3JAK A;  4Z2W A;  2W6J G;  2Z5U A;  3ZRW A;  1NS1 A;  3UT5 A;  1S5H C;  4LFB B;  1SF9 A;  3VQY A;  3B2E E;  2KG7 B;  3K9A A;  1BL8 A;  1M56 B;  2QKA A;  2EIN B;  2K9P A;  5EBW C;  1XDC A;  1B06 A;  3EVK A;  1ENV A;  4G28 B;  3D36 C;  5H6R A;  1UPG A;  4NB5 A;  1YXB A;  4MVU A;  4IT5 A;  1V54 B;  1XHZ A;  3K57 A;  2QTS A;  1DLB A;  5J9P C;  4WFA V;  4WBN B;  1FPO A;  4FLV A;  2UXD B;  4FFB B;  4B3R B;  1SQF A;  2MK3 A;  3JYC A;  5KAI Z;  1YCI A;  1GN2 A;  2AZ0 A;  3J80 N;  1GO3 F;  2LW1 A;  3R65 A;  4KUM A;  3C3S A;  3X2Q B;  2KG7 A;  2VQF O;  1IBK O;  2PI5 A;  4DV0 O;  3ZRW B;  1Y4M A;  4OXS A;  4GT1 A;  3JD3 A;  4QJF B;  1QQC A;  4P9O A;  1R3J C;  1NQT A;  3JAS A;  4R7C A;  5FPR A;  4LF5 B;  1ZLZ A;  4WF9 V;  3N27 A;  4TUY A;  3L73 H;  2P90 A;  4I9W A;  5EZY A;  1PL0 A;  2P5O A;  3ABM B;  4GX2 A;  1DTO A;  5B1A B;  4GCZ A;  3OMN B;  1GTO A;  3JAR A;  2JK5 C;  4JGS A;  3WFV A;  4EKW A;  2EZO A;  1CP9 A;  1M56 C;  1B3Q A;  2ZDI A;  4J42 A;  1XNQ O;  4X62 O;  3RYF A;  5LYJ A;  1KP3 A;  2ZIM A;  4P9P A;  4JYC A;  3CYO A;  3B8N A;  3L74 H;  2ZD9 A;  2CTP A;  1BGY H;  2JGD A;  5LHH A;  3CWB H;  3MD0 A;  4DYL A;  4NR1 A;  5B3S B;  1K5S A;  2QDO A;  1D2D A;  2YEV B;  3OE7 G;  4CS3 A;  3A0B Z;  3A0R A;  1GN3 A;  5JWP A;  2CUG A;  3T1Y O;  4JZ2 A;  3DXR B;  4NTW A;  1WAZ A;  4PJ0 Z;  3K58 A;  3JD1 A;  2ETN A;  3HKB A;  1YIT V;  3QTC A;  4ZI7 B;  1OCZ B;  5EBM C;  1I5X A;  4K35 A;  1RSO B;  5TIS Z;  1D5N A;  2P4V A;  4PI0 A;  2LO1 A;  3ZMT A;  3CMA V;  1FFX A;  1W59 A;  3Q4H A;  2BTQ B;  5KUM A;  2HLD G;  3W7W A;  4JI0 O;  4MS2 A;  3SJQ C;  2QSA A;  2UUA B;  4JTC B;  1S5J A;  1G8M A;  3K0D A;  1U96 A;  2E3C A;  5C93 A;  4ZKI A;  3O9O A;  3THO A;  2Q7G A;  5LHI A;  4EB6 B;  2IW5 A;  1A32 A;  4PA3 A;  1VQ9 V;  1MZF A;  3F5T A;  1LUW A;  2IJJ A;  1Q90 D;  1P49 A;  3P3N A;  3H1I H;  1OCC C;  1R3I C;  3BVO A;  2ZQM A;  1H2G A;  1MZE A;  4JAA A;  4GKK O;  3B09 A;  5A9G A;  4MSW C;  3D8C A;  4GX0 A;  4CH3 A;  3ASN B;  2NN4 A;  1HNZ O;  1DK1 A;  2JS5 A;  1AR1 B;  5JJE B;  4FMT A;  3JAL A;  1B6Q A;  4J10 A;  4LWS A;  1O9G A;  4NTX A;  2D2C B;  3UO3 A;  2F1M A;  3CP1 A;  4K0K B;  1PPJ H;  3RYC A;  3AG4 C;  1P7B A;  3L70 H;  4DW0 A;  2CGN A;  4X9Q A;  4O4H A;  5CA3 A;  3NXS A;  1FYJ A;  1BQZ A;  1NVP D;  4UVA A;  3SGI A;  2XND G;  4YIP A;  1TUB B;  5JH7 A;  5LP6 A;  5E1A C;  3JCU Z;  4DR3 B;  1ZSP A;  4DXW A;  4W4K A;  4CBC A;  3WB0 A;  3SPI A;  4H13 B;  1N32 O;  1SQG A;  1YSC A;  2ZIO A;  2FB5 A;  1BS3 A;  2WLL B;  5LBQ A;  4X65 B;  2HVJ C;  4ZHQ A;  1X4T A;  1WP8 A;  3CCJ V;  3AG2 B;  1JFF A;  2YXY A;  4K3A A;  3ZRV A;  4F6E A;  4JYY A;  2RDC A;  4Z1M G;  2RMK B;  5BZB A;  2F4V O;  1P4R A;  5IYB O;  1CEZ A;  1NH2 D;  2YXL A;  4O4I A;  4DV5 B;  3OFN G;  4BW5 A;  1AI7 A;  4BWA A;  3EXA A;  3S3W A;  2P7T C;  1SQX H;  3ZHS A;  2UUB O;  3J81 N;  1Q6H A;  3ETG A;  3BA8 A;  4X66 B;  4DO2 A;  1HR0 B;  3VBB A;  1BQ0 A;  3CRC A;  4W4L A;  2IJI A;  3N2K B;  1IX9 A;  3E86 A;  4IYI A;  3MAQ A;  4GUN A;  5D5P A;  4QGP A;  1KU9 A;  1SS3 A;  4HZ3 A;  4FLZ A;  3RVZ A;  4NXM B;  5E79 Z;  3SYQ A;  2NNU A;  1XNQ B;  4TOI A;  5J2U A;  1F4N A;  2VQE O;  2GDS A;  2E5L O;  1PD3 A;  1G6U A;  1R3L C;  1VF7 A;  3I56 V;  2CTW A;  3E8B A;  3FB7 C;  4TV8 A;  1BSM A;  2IJK A;  1GH6 A;  4WFB V;  3ABK B;  1S76 D;  2R9A A;  5IWA B;  2L35 A;  1HDJ A;  5GTH Z;  3SJB C;  1LR1 A;  3UQ8 A;  2WA4 A;  4O2A A;  3OEE G;  1NKD A;  1QVG U;  3ZMS A;  4U3J B;  2WLN A;  4IHJ B;  4X1Y A;  3RYI B;  1HR0 O;  3CCV V;  4U3J A;  4CS4 A;  4YHH B;  3F7V C;  5HFL A;  4CH6 A;  4BW9 A;  1E1Q G;  4PV1 B;  1QCE A;  5BXZ A;  1SQB H;  1AJP A;  2HP8 A;  4I4T B;  2OTJ V;  2LP7 A;  3IJ4 A;  4J11 A;  3CPW U;  4NXM O;  2F93 B;  2ITC C;  1OCZ C;  4F6R A;  1O9H A;  3W7T A;  4FLW A;  2DE0 X;  1XHX A;  4RO2 A;  5GTI Z;  1S77 D;  3LDE A;  4K8Z A;  4X1K B;  3R66 A;  2Y4T A;  3L72 H;  3VQX A;  1P84 F;  2JVD A;  2PF4 E;  4CH4 A;  3BCC H;  2DYR B;  4JV5 O;  5J2T A;  2BTO A;  2ZCE A;  1Q81 W;  4DV2 B;  2DYS C;  4DV3 B;  5L3G A;  1G1X B;  1V55 C;  1XUQ A;  4MVQ A;  3H9V A;  4LF6 O;  1E1R G;  2R72 A;  3GWK C;  3SDL A;  2QM4 A;  4TV9 A;  5H6Q A;  4CC5 A;  2EJR A;  1VP7 A;  1Q86 W;  2HJD A;  3G71 V;  1RP3 B;  2LW7 A;  5HFM A;  5EK0 A;  3E89 A;  1Q6I A;  3LDC A;  4H0L B;  1FFT B;  1YZB A;  5KHG A;  5LOV B;  3U0Z A;  4O4J B;  5EC1 C;  3HKC A;  2L6L A;  2KKW A;  3OT7 A;  3MHH C;  4P2Z A;  1XL4 A;  2GHY A;  3SPG A;  5B5E Z;  3ABU A;  3WB2 A;  2P67 A;  3P32 A;  3QF7 A;  1N33 O;  4RQF A;  4OGQ B;  2HHH B;  3FB6 C;  3LNN A;  2UXC O;  3FKS G;  4QE7 A;  2YID A;  1FAF A;  3CC7 V;  2F95 B;  4X89 A;  4LF6 B;  2UXB O;  1S5L Z;  4DUZ B;  4WFG A;  3ASN C;  1OCO C;  2IH1 C;  3EHB B;  4CZZ A;  1SZT A;  4HBN A;  4K8X A;  4FFK A;  2YSU B;  5AG2 A;  5CN0 A;  2QGN A;  3CCL V;  4XDK A;  1K97 A;  4Q20 A;  1PNK A;  3H1J H;  5L3C A;  1SQP H;  3N2G A;  4O4L A;  4NXN B;  5EYP A;  3SYO A;  1I94 O;  5K1X A;  2Z0A A;  4FM1 A;  3EFF K;  2Q6A A;  4GX1 A;  2WA3 A;  1MSD A;  2A9H A;  4B3T B;  4J7J A;  3CXC U;  2DJV A;  1XQ8 A;  1H2N A;  4DR2 O;  1AB3 A;  4D7S A;  1LNQ A;  1QLE C;  2A0L A;  2LFS A;  3H1H H;  1MOF A;  2EIM B;  2GUZ A;  2BTQ A;  3Q4H B;  1ZWI C;  1FFX B;  2X6C A;  4JI3 O;  1N34 B;  4N21 A;  1HWY A;  1JX9 A;  5KA6 A;  1S0V A;  2BSK A;  1AJQ A;  3K59 A;  1HNX B;  3HKC B;  3X2Q C;  4O4J A;  4PD4 F;  2EUL A;  1WNS A;  1IDS A;  4PA4 A;  1I5Y A;  2GV9 A;  3OGC C;  4JF3 A;  5CA1 A;  1L8D A;  4TQD A;  3TJT A;  4JAS A;  1ORQ C;  3DXR A;  1J95 A;  5CB4 B;  1WPX A;  2MW2 B;  4LNU B;  4UXN A;  2ARH A;  4AQY O;  4JPR A;  3SJC C;  2EJ7 A;  1R6K A;  2R9R B;  2ZXW C;  3BFR A;  3ZMV A;  2W0F C;  2IBZ H;  3E35 A;  4WFE A;  4RWU A;  3HKE B;  3SJA C;  1YF2 A;  2Q5Z A;  5CA0 B;  1K8A W;  1IBM B;  2WLI A;  5GON B;  3ML0 A;  2E75 B;  2UUC O;  3AK2 A;  4ZBM A;  3AG2 C;  1K92 A;  4AI8 A;  3FAV B;  3TXS A;  2XUM A;  1IXB A;  1AP5 A;  4FZ0 A;  3AG4 B;  4KL1 A;  4GKJ O;  2DQ3 A;  1FD9 A;  5KHI A;  4MTF A;  1VQ4 V;  2KQX A;  4B3R O;  1QHT A;  2AGA A;  4MVO A;  3M8A A;  4Q6G A;  3WG7 C;  2XOK G;  3BAA A;  1VQN V;  3FFQ A;  5C8Y A;  2H3O A;  2OYQ A;  2LFR A;  4B7E A;  1SQV H;  5JCO C;  4JAU A;  3AG1 C;  4DRX A;  3D3I A;  2XHB A;  4LH7 A;  2WLK A;  2UUA O;  3ABK C;  2PGG A;  1IZ3 A;  4O2A B;  4DR5 O;  4FK5 C;  1SRY A;  1YDX A;  1SER A;  3K04 A;  1IBM O;  1YHQ V;  4JI7 O;  2M7W A;  3ETE A;  4YJ3 A;  4FFB A;  5BMV A;  1Q3E A;  1F51 A;  3ZN0 A;  1VEW A;  1BZK A;  1PV0 A;  2BCC H;  1EN6 A;  2DWD C;  4JI4 B;  1WP7 A;  5K1P A;  4JYA B;  4J80 A;  1N33 B;  4KHP O;  1OZ0 A;  3AG3 C;  3SPH A;  3OGI B;  5KHH A;  3RVY A;  4QPJ A;  5KA5 A;  2K1E A;  1QVF U;  3APO A;  4PDL A;  3H1K H;  2JJ2 G;  4DV6 B;  4H33 A;  3N2K A;  4EFB A;  3UT5 B;  2HG5 C;  2V1D A;  3LNM B;  3AEI A;  2XAJ A;  1PL4 A;  5LGU A;  4IL6 Z; 
#chains in the Genus database with same CATH homology
 2L6L A;  2N05 A;  2DN9 A;  2YUA A;  1HDJ A;  2Y4T A;  1XBL A;  2QWR B;  2DMX A;  1WJZ A;  2M6Y A;  2CUG A;  2OCH A;  4J7Z A;  2LO1 A;  2QWN B;  3APO A;  4IT5 A;  2PF4 E;  2EJ7 A;  2QWQ B;  3UO2 A;  3UCS C;  1BQ0 A;  2QWO B;  3BVO A;  2CTR A;  2GUZ A;  1IUR A;  2CTP A;  3UO3 A;  2CTQ A;  3AG7 A;  2GUZ B;  2QSA A;  3APQ A;  2N04 A;  4RWU A;  1N4C A;  1FPO A;  2KQX A;  2CTW A;  2Y4U A;  1NZ6 A;  2LGW A;  2QWP B;  1BQZ A;  4J80 A;  2YS8 A;  1GH6 A;  1FAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...