4J80A

Thermus thermophilus dnaj
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
271
structure length
271
Chain Sequence
AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVMSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGKGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRMPPGVREGSVIRVPGMGGQGNPPGDLLLVVRMLPHPVFRLEGQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKMRLKGGGFPGPAGRGDLYLEVRITIPERLTPEEEALWKKLAEAYYAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein DnaJ 2
publication title Combining crystallography and EPR: crystal and solution structures of the multidomain cochaperone DnaJ.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 62
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF01556 DnaJ_C DnaJ C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4j80A01
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A02
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A03
2CUGA 3UO2A 2QWPB 1GMUA 2Q2GA 1EB0A 2QWQB 1BQZA 2GUZA 2KQXA 3AG7A 4J80A 2CTPA 3I38A 1GMWA 1IURA 2DN9A 2LGWA 1N4CA 3L9ZA 2YS8A 1HDJA 2QLDA 2Y4UA 4L3KA 2DMXA 2QWOB 4IT5A 4RWUA 3UCSC 3NY0A 1GH6A 3LZ8A 3TJAA 1XBLA 1NLTA 3LA0A 2GUZB 1GMWD 1BQ0A 2QWNB 3UO3A 2EJ7A 2LO1A 2N04A 3APOA 2L6LA 3APQA 1GMVA 2CTWA 3TJ9A 2CTQA 1FPOA 3NXZA 1EARA 2OCHA 3AGZA 2N05A 2Y4TA 1NZ6A 2PF4E 2QSAA 2YUAA 4J7ZA 2QWRB 1C3GA 1WJZA 1XAOA 2B26A 3AGXA 2CTRA 2M6YA 3TJ8A 3BVOA 3AGYA 1FAFA
chains in the Genus database with same CATH superfamily
3L72H 2Y0PA 5J2TB 4MW3A 5KUKA 2P4KA 2Q7GA 5IY5B 4CH6A 1MNGA 2N04A 2A9HA 1JJ2U 5L3GA 3ASNB 5DECA 1ZL8A 2F43G 4PDVA 4JV5O 4U3FH 1BL8A 1I7FA 5CA0B 1Q8IA 5LMUB 3OGIB 1VIBA 1R6NA 4Q20A 5KHIA 3JARA 2ZNIA 5IYZA 3X2QC 1Y74B 3FFQA 2X6CA 1GMUA 5LL6Y 1YITV 4JI8B 1VQ4V 1PNKA 1E1QG 2AHYA 4JI0O 5KA5A 1TUBB 3MDSA 1GN4A 3CRAA 4JAUA 1FPOA 3DXRB 3Q4HA 2Q7EA 2GV9A 4HYOA 4DR1O 1FJGB 3ABKC 5LYJB 1FXKA 2P06A 2YS8A 3K9SA 2XAQA 1DF4A 4X64O 1P7GA 3ABLC 4DR2O 4WF9V 1HNWO 3S3WA 2VQFB 4IIJA 3NXZA 3GWKC 3B2EE 2EIKB 4WFHA 1J95A 1WPXA 4FZ1A 3HB3B 2ZKOA 3WU2Z 5KMGA 1RP3B 1ZUQA 2GTAA 4PA4A 4EB6B 3MHSC 4XBFA 2UUAO 4YIPA 3T2MA 4MS2A 4OX9B 3K79A 1RPOA 2DQ0A 4H13B 3RBZA 1AR4A 4O4HB 1P49A 1GMWD 2WLKA 4UXNA 4NTXA 1ZX3A 5FNVA 1XNRB 4CS4A 1Y6XA 3FB7C 1MZFA 2F4VB 3C3TA 1PL4A 1EB0A 1OZ0A 1D5NA 5H6QA 5EBMC 1KD1W 1IBMB 3DTUB 3AG3B 4DV1O 1YEWA 1K5SA 2ZM6O 4K0KB 1I08A 2EJ7A 1DGSA 3CB2A 2IJJA 3CC4V 1H2KA 1HNZB 1EM1A 4B3RO 1XMOB 2N74A 1NTMH 4FLTA 1N32O 2ZE8A 3H1HH 1I0HA 5HFMA 1SF9A 2YI9A 1P7BA 4CC5A 1OCOB 2XNDG 3UO3A 3B8NA 4DV4B 1S5HC 4DR7B 3ZRVA 2V4DA 5EZYA 1FD9A 1PKXA 2CH7B 1KYOF 5JQGA 3HPLC 4FM2A 4UV9A 5H2FZ 3VOUA 5J2UB 2VQEO 4MSWC 2EZPA 1VQMV 2Z3YA 3AG1C 4G27B 5DN6G 2BTQA 3ZEDA 3JSNA 4O4LB 1GK9A 3ABTA 4O2AA 4O4IA 4DRXB 2OCCC 3BFRA 1LUVA 1SQVH 3FX7A 1KBHA 5KHKA 5LXTA 1OCRC 4L3KA 3ETGA 1WA8B 1M57B 3GVMA 1GM7A 1VF6A 3A8TA 3CSXA 4GZRB 3E35A 4LP8A 2XUMA 3TJAA 2A7WA 4JV5B 1R3IC 2CUGA 1THZA 2Q2GA 1K92A 4LCUC 5ITZA 2BSKA 3RYHA 4FPPA 4FM1A 1VP7A 4BW5A 3C6EC 3HKBA 2X6BA 3TJ9A 2CTQA 1H2GA 4I50B 4JI0B 3BRCA 4U7OA 2YICA 2PI4A 1FYJA 4QJFB 2EZOA 3JATA 4C7UA 5B3SB 1DK1A 3ZHRA 3OEHG 2ZR3A 2DYRC 4X64B 2B1IA 1EN5A 4TUYB 1SQXH 2DYSC 4DR2B 5GONA 2P4VA 1HNWB 3ZMZA 4JZGA 4MVOA 2DJVA 5LHIA 4I9QA 1VEWA 1XEQA 3E83A 5JJJB 3UT5A 3ZRWA 3L75H 2UUAB 5L3FA 4F6RA 3ZIAG 4RWUA 3SJQC 1QLEC 5EYPA 4U7NA 3ZN1A 1LR1A 1YJNV 4O4JA 3W7WA 2Y0IA 3K5LA 4X62O 4UVAA 4QPKA 3E8FA 3P3PA 2WLMA 3ZS8C 2UXXA 3AG4B 3RT3C 5FPRA 3SDLA 3RFRA 4IYHA 3FAVB 4O2BB 5AG2A 5JVDA 3W7UA 4JI5O 3CCQV 3CS5A 4DV1B 1NJIW 2ZM6B 1L1FA 1E79G 1Y67A 1VQ6V 3AGZA 4JF3A 1K3EA 4MVZA 5B1AB 1AB3A 2W6IG 2R9AA 4I9WA 1N32B 4NTYA 4JASA 1KU9A 2HHHO 3ABMC 4IIJB 4JI7O 2OIEA 3QNEA 3O65A 4UCVA 4D7TA 4ZKIA 1QVFU 5KHHA 3K5OA 3LSUA 4L87A 4W4LA 5CA0A 4W4KA 4J9YB 3K3WA 4I0XA 2DWDC 1H38A 4HAMA 1EBOA 4IHJB 1IXMA 5LP6C 3VQXA 1TUBA 3OM3B 4ABMA 4LBEC 3DXRA 4X1IA 4JYYA 4J7JA 1OHHG 2KKWA 1W0KG 1S77D 2QLDA 1QU7A 2W0FC 2QE7G 1S5JA 4LF4O 4TWKA 1BMFG 2LGWA 2PI5A 2LQTA 4BIUA 3G4SV 5B1NA 1NQTA 4PA7A 4U3JA 4ZOLB 4EB6A 1VQLV 3OAAG 5BMVA 1YCIA 5KX5B 4I5SA 4UV8A 4CBCA 2DWEC 1V55C 4O4HA 3W7SA 3J80N 1NI8A 4DK0A 5KLVH 5CBGA 3A0HZ 3LDDA 4N23A 4NXMO 2AHZA 5JCOA 3TGUH 1IZ3A 3WFVA 4BIZA 3ZHUA 3EHBB 2X6AA 4PJ0Z 4JI8O 2CGNA 4QGPA 3CHXA 4HBNA 1Y76B 4MVMA 1IBLO 2E75B 2ZR2A 4O4IB 5IJ9A 1O9GA 2JJ2G 3K58A 1Q43A 2EIJB 3P30A 1NBMG 1YVWA 3QF7A 2XAJA 2GDSA 2JK5C 2X0LA 4MVRA 2VQFO 5LXTB 4TT3G 5C93A 1UFIA 4B3MO 4R7CA 4I7ZB 1XMQO 3WB0A 3N2GB 1WB8A 1KUQA 3SPIA 5D5PA 3H1KH 4QNHB 4KHPO 3EVKA 2H8PC 4LNUA 2QM8A 4WFBV 1MZEA 2VRZA 3JAWB 2CH7A 2YIAA 2H3OA 1N36O 4JTAB 4FIPC 4JZ2A 3LNNA 3D36C 1C3GA 4LFCO 3K03A 2JJ1G 4BW9A 2GTSA 5J2UA 3CE2A 3K0GA 4ZIBA 2Q8VA 2LGQA 3SYOA 4JPRA 3CCUV 4GX5A 4X8AA 4P9PA 4H44B 1V54C 1XOUA 3B4SA 4X1KB 3RYIA 4FLWA 4O4LA 4JI5B 1BT8A 4K8XA 3D3IA 3NXSA 4GT1A 4RQEA 1RM1C 2EILB 2EINB 3CJHB 1LNQA 2Q69A 2XHBA 4JI4O 1WA8A 3JYCA 3D3QA 2OT5A 2HHHB 4JI7B 3SJAC 1S5LZ 4FFBB 3NY0A 1GH6A 5KHGA 4KFMA 3ZJZA 1FXKC 3ZCCA 4Z1MG 4B3SO 4LF8O 4LH7A 2LJ2A 2JVDA 2ADPA 1QVGU 1KP2A 2M7WA 3T4ZA 3F7YC 3CD6V 2OTJV 4WBNB 5EIBD 3J81N 1SZXA 2E5LO 4JTDB 2WLIB 4BWAA 2ZE5A 3SYCA 1Q6UA 4PDMA 4R50A 2ZD9A 2AXTZ 2RNBA 2YXLA 2IJKA 2ILMA 4DV2O 1WN7A 4TUYA 4LF4B 1GMGA 2FTKA 3C90A 3K0DA 5IYCO 4KXRA 1XNQO 4IT5A 1SERA 3OR6C 2XT9A 2CK3G 3FB8C 3BAAA 2KSDA 2ZIMA 4J7ZA 3KZIZ 3HR0A 2M6YA 2OIGA 2HKOA 4X9QA 1BGYH 1I5YA 2RMKB 1KKDA 3E8GA 2BOCC 1IURA 4DK1A 4I0XB 4NXMB 2YDEA 4YXWG 4MVSA 4YIOA 4MTOA 4G2KA 5EIBC 3H1IH 4UVBA 2LW1A 3FAVA 4O2BA 4UCUA 4TOIA 1EN6A 5FL7G 4PELA 1TVKA 1FS0G 4X1IB 1IBLB 3TK1A 4DR6O 2JDIG 2AW9A 2YI8A 4IL6Z 2Q68A 3SPHA 5B1BC 3J7AU 2QM4A 2E3CA 1OV9A 2F95B 1EZJA 4B3MB 1BS3A 1XMQB 5GW7A 3CRQA 1Z5WA 3ASOB 5A9GA 1BZKA 2QWPB 4KL1A 4U3JB 2QTSA 3I38A 2AZ2A 2JZ8A 1H2SB 2F93B 5BMVB 4KHPB 4YJ2B 1FKAO 3DSQA 2EIMC 1JVMA 1RSOB 3AG2B 2HFEC 2Z5UA 2Q67A 4R6ZA 4JI3O 2P5OA 1N36B 1VQPV 1NT2B 1KP3A 5B1OA 4IHJA 1JX9A 4LFCB 3OMAB 1WNSA 1AROP 1VARA 4FJCC 1N34O 1YTFD 2B1GA 1OCCC 2IM9A 2NLJC 3FYEB 1OCZC 3K59A 4JI6O 4E4EA 3ETDA 1K97A 3APOA 5CA1B 5IJ9B 3CX5F 2QEXV 4X65O 1XHXA 3ZMTA 4JI4B 3U0ZA 3HKCB 4JYCA 5TISZ 2DE0X 4ZOLA 1NR7A 2DQ3A 4P2ZA 1NVPD 3CYOA 5CA3A 2P67A 3U10A 5C8YB 5KX5A 5LGUA 4MW8A 2JEXA 4LF5O 3CC7V 4B3SB 4LF8B 1Q7YW 5JWPA 1NZ6A 4LNUB 2QWRB 2ZXWB 3OD4A 3OW2U 4JGSA 3JCUZ 3VQYA 3ZN0A 4LR3A 3THOA 1GTOA 2HR3A 1Y76A 2P7TC 5KAFZ 2O57A 1BQ0A 1ZAUA 2E5LB 1M9NA 1AJNA 3RYIB 3ZMVA 3FKSG 2QA4V 3VBBA 2OYQA 1IBKO 2B5UA 3UO2A 4DV2B 3VQWA 4PA6A 5BZBA 2DN9A 2NN4A 3ABUA 1XNQB 1QR8A 3N2GA 2GUZB 4EFEA 3LDCA 3ZRXA 2WPDG 1R3JC 1JA8A 1AI7A 2LFRA 1H2LA 2ZINA 1L8DA 1TAEA 4OPHA 3OFNG 2PGGA 2UXBO 3JAWA 1UJWB 1SQPH 3E2EA 1T5EA 2W0XA 5IY5C 2EULA 4OGQB 3CC2V 5CMUA 2R70A 4ZI7A 5IE9A 2LO1A 4TQDA 4X89A 1NR1A 4JYAO 3ASNC 2XASA 4JYBA 1JQ0A 2WLNA 2WLJA 4X1KA 5LGTA 4BR6A 2C2AA 4F6EA 2A3QA 4DW1A 4DR6B 5FPOA 1H8HG 3ZHTA 3G67A 3KCXA 1ZLZA 2Y48A 3CJHA 4J42A 1BCCH 1KMIZ 3B40A 1BHBA 3R66A 4TV9B 4DO2A 5CB4A 3IGAC 1PNLA 2Q0OC 2F1MA 3I5DA 1V9PA 3WG7B 5DEDA 2FL4A 2HVJC 2ODMA 4FFBA 3JD2A 2LFSA 1JMKC 1WAZA 1SETA 1GMWA 3F5WC 3OGCC 4NR1A 1AVMA 3H1LH 1K9MW 2Q0AA 4J7KA 3K08A 2FB5A 3RYFA 1R6KA 4RAIA 3E86A 2VWKA 4Z1VA 1M1KW 1RPRA 1QLNA 4JI3B 3FYIB 3ICXA 2JGDB 1SZTA 2EIKC 3OMIB 4AQYO 3K5NA 5EC2C 5LHHA 4DR4O 3G6BA 4WFFA 4J9ZB 2PTMA 1SA0B 1YDXA 4WBNA 1P84F 4FM0A 2HVKC 4ICGA 1R6TA 2QKSA 2WLIA 1N34B 1JFFB 2DMXA 4JI6B 1TVKB 2ITDC 3TETA 3A2FA 1QQCA 4J11A 1RM1B 4ZBMA 1PV0A 3RVYA 1F4MA 2F23A 1O9HA 4PA3A 4X65B 3CCMV 3SPCA 5JCOC 4WFGA 3CXCU 1AP5A 2GBOA 4GX0A 1R3KC 4DR5O 4PV1B 2Z0AA 3AG3C 1XREA 3RWRD 1KQSU 3T4DA 1TGOA 1WP8A 4LF5B 4DYLA 1MA1A 4UB8Z 1NTKH 3UQ8A 3BVOA 4PA9A 3BPZA 2ZT9B 3OMNB 1K4CC 4Q6GA 2OWOA 2QKCA 1M56B 4WCEV 3OTOB 1CPYA 1OCOC 1VQOV 2UXCO 3CP1A 2XOKG 4LC1A 2Y69B 3CWBH 3K9AA 4I4TA 3M99B 3MHHC 1IBKB 1HW7A 2IH3C 1GN2A 4PDRA 1W2BU 2OTLV 2DW4A 1LUWA 3CMAV 1Q90D 1QCEA 1ZWIC 3JCZA 1ROPA 3OR7C 4YHHO 4JAVA 3NR7A 4DV6O 4PD4F 2PF4E 4YJ2A 2EJRA 2V7QG 4BAYA 1RSOA 1MOFA 2VWJA 3AEIA 3DGEA 3SPJA 2UXBB 4QPJA 3LSSA 4DV0B 3O9OA 1AJQA 1HDJA 3H9VA 1E1RG 1G1XB 3UM7A 1I94O 1M57C 4I55A 1JR9A 3X2QB 1AJPA 1SQBH 2ADQB 1OJHA 3APQA 3EFFK 4JYAB 2IW5A 5LMNO 3ZHQA 3OEEG 4LFBO 2QGNA 5BR8O 1XQ8A 2IU3A 2ARHA 1NH2B 3JSLA 3ABKB 1G8MA 4KP4A 5CA1A 1Q82W 3BA8A 1PNMA 4AHCA 3ABLB 3EXAA 1X4TA 3CCRV 3HKCA 1Q86W 1SKVA 3K06A 3L70H 5KA6A 2V1DA 4FK5C 5CBFA 2B26A 1GAXA 3TJ8A 3JASA 1XUQA 5J9PC 3UKMA 2HJFC 5C8YA 3QO5A 2UXDO 5B3SC 2YC0A 4LFAO 4NXNO 4X1YB 2UUCO 3OUFA 2JGUA 1S3JA 1YI2V 2K9PA 3CCLV 1QR9A 3OT7A 2WAMA 3OUSA 3LDEA 4B7EA 3P3NA 2ODXA 4AQYB 2Q4PA 5JJNB 4NVPA 4DR4B 2MW2B 2ZDIA 4ZI7B 2EBOA 2NNUA 3CXHF 4J80A 3M8AA 1JPXA 3I55V 4B7KA 4CC6A 4IGGA 1EFRG 1YIJV 4UCSA 1GO3F 4JI2O 3QO7A 3HKEB 3GB7C 2GSMB 1FFTB 1KKCA 3AG4C 3K5MA 2GUZA 4UCRA 5CB4B 2EX3A 3ZRSA 4L8JA 4NKGB 1F23A 1N4CA 4DR5B 4MT8A 5IYDO 2QWOB 1AR1B 2ZE6A 3CCJV 4D6TH 1J5EO 3C3SA 4QIWF 1VMGA 4K35A 4LF6O 1K33A 2A0LA 5B1AC 3RYFB 5L3BA 3MAQA 1IX9A 2WLHA 1EN4A 2JIZG 2XAHA 2CAZC 1QHTA 1G4YB 1YTFB 5LGNA 2IJHA 3LZ8A 1JCHA 4UVCA 3SJCC 3C5XC 2UXCB 1XI1A 1GMVA 1ORQC 3AG1B 2ZQMA 1AP6A 3D8CA 4TV8B 2A79B 3BEHA 3KCYA 2OCCB 4XDKA 2HJDA 2R9RB 3B77A 3E89A 4GKKO 3CCEV 3KG2A 1BE3H 3OE7G 2F66C 1Q6IA 2FYUH 1R73A 2WLLB 4TV9A 1F4NA 5K1XA 1JOYA 3L9ZA 1OCRB 3OTFA 2JVMA 2YIDA 3B09A 4YHHB 4DUYO 2E74B 4N21A 2B9ZA 4UUJC 3I56V 3VQVA 1H2NA 3F7VC 4DV6B 4H37A 4TQFA 2BCCH 5A2QN 1FAFA 1DF5A 3ETEA 2A06H 3BCCH 1SQFA 2RQ6A 2MK3A 2JGDA 3B8MA 3D36A 1CXZB 1I94B 4HZ3A 1HNXO 1QBZA 4ZHQB 1SA0A 2L6LA 4LWSB 4TSFG 1EARA 2KG7B 2L35A 5LMNB 3BY6A 3AKOB 4LFBB 5BR8B 1JFFA 3T1CA 5B66Z 1BSMA 5EC1C 1SQQH 1PD3A 2K1EA 4YJ3B 2PUSA 4I4TB 1DTOA 2DYRB 4X66O 4GYCB 4P9OA 3SYQA 2DOSA 2DYSB 1X59A 4D7SA 5H5NA 2CTWA 4OXSA 2YIBA 1Y4MA 2YEVB 1KECA 2OCHA 5LOVB 1GM8A 3E8HA 5IWAO 3JALB 1ZSPA 2VS0A 3LUTB 4LF9O 4OPAA 2ZNJA 1GKFA 2UXDB 2ITCC 4LFAB 4NXNB 2JRRA 4WFAV 5KHJA 1BHAA 1TA8A 3RYCB 4DUZO 2UUCB 2EIJC 3H1JH 2E76B 1B3QA 1K5QA 1QLEB 1U96A 1PL0A 4K8ZA 2Q73A 4XDLA 1S76D 1MSDA 4DV7O 3ML0A 4J10A 1GRJA 4MTFA 5IDJA 5LA6B 4FMTA 4UCTA 1MMMA 3AGXA 4I55B 1VF6C 3U11A 2YSUB 3LSQA 2YXYA 2QWQB 3QG5A 1SRYA 1MG1A 1WP7A 3T1HO 5IYBO 1IXBA 3JD0A 4HNAB 4JI2B 3DC5A 2D3OW 3CMEV 3JAMN 1VQ9V 1FFXB 2BE3A 3ABMB 2XAGA 5K1PA 2RJZA 1Y66A 2X7RB 1SC5B 3JASB 4NTWA 4JAAA 1Z2GA 1J5EB 1VQ8V 1PP9H 5L3CA 3ZMUA 4NYKA 1YXBA 1AILA 2EILC 2EINC 3PJSK 4FFKA 3JD4A 4LF6B 1K34A 3ZHVA 1XHZA 1N33O 4DW0A 1U97A 5KAIZ 2BOBC 3PN1A 4MVQA 5LP6B 5CN0A 5JH7B 3SPGA 2Y4UA 3JAKB 1D5AA 3OTOO 3CRMA 4YY3O 4AI8A 1Q5OA 3W7XA 3E22B 2QWNB 3CRCA 2P90A 4FLYA 2P22C 3N27A 4RQFA 3TXQA 4GKKB 4DR3O 5BXZA 1ENVA 4XDJA 5GTIZ 2Q6AA 5EBWC 3N2KB 1WPBA 5JJEB 2IU0A 3K04A 2PYJA 1S0VA 1XDCA 4DUYB 3G80A 3FB5C 1B6QA 2CDYA 1WLEA 2QSAA 4X1YA 4EEQA 3IC7A 4EFBA 4FLVA 3SYAA 1KB9F 4DV5O 1V55B 1BQZA 3G6EV 1H2MA 4DV0O 5D5QA 1ZTEA 4PHZA 2P6JA 2R72A 2BTOA 1HNXB 5GTHZ 4X20B 4PDLA 3L73H 4GKJO 1YJ9V 5LBQA 3M7MX 2UU9O 2UXNA 2JRIA 5IJ0B 4IYIA 2ZE7A 3WB2A 3HKEA 4MTXA 3S3XA 4X66B 3T1YO 1N0JA 4JTCB 4DV3O 3L74H 3KKYA 5IWAB 4F4LA 5BY1A 4DR1B 4LF9B 1HWYA 2PZSA 3AK2A 1B04A 4DUZB 3K57A 1H8EG 3HKDA 1XBLA 2HEPA 4NB5A 1CP9A 2LW7A 5FLXN 4KUMA 4DV7B 4GUNA 3BA9A 1K8AW 3ASOC 5LHGA 2CTPA 5B5EZ 1ZL8B 3IC9A 1M93A 1V54B 4GX1A 4TV8A 3T1HB 3AG2C 3UCSC 2JS3A 4LF7O 2XAFA 3H01A 2IBZH 5EBLC 1AI5A 2WLLA 3JARB 1VQ7V 5IYZB 4R8CA 1IDSA 4GLXA 2AGAA 4RUFA 1L0NH 1VQ5V 4CH4A 1YSCA 3AK1A 3Q4HB 4B3TO 4EKWA 1K7DA 1HP8A 1FXKB 4Z2WA 5H9CA 1SESA 3AK3A 1MABG 2CE4A 4X88A 4B3RB 1N33B 5J2TA 1XAOA 2ATKC 4DXWA 1B06A 4G28B 3E8BA 1QNMA 3DC6A 4JI1O 4CS3A 4ZHQA 1R1BA 1W0JG 3IAYA 4LWSA 2KG7A 4CH5A 5KMGB 4YY3B 1NLTA 5DM6V 4RO2A 4H33A 3A0BZ 3QO8A 2GHYA 2UUBO 5CBHA 4YJ3A 2ZXWC 3CPWU 1HR0O 3LNMB 1R3LC 1Y74A 3CCVV 3SR2C 1S72V 5E79Z 1COWG 3IJ4A 4DR3B 4BIOA 3P32A 4CH3A 1D2DA 5FNVB 1AI6A 3A0RA 2YEVA 2VQEB 1NTZH 5LOVA 2ZDIC 1YZBA 1VQKV 3JALA 3SGIA 4MTGA 5LYJA 2JS5A 3R65A 2AZ0A 3RYCA 1XL6A 2G38A 1P4RA 2WWWA 4UFZA 1YHQV 4DV5B 1YJWV 1GM9A 1F51A 4WFEA 1M4UA 4RUEA 4UCOA 2JEUA 1SQGA 1NS1A 2XTAA 1URFA 5LA6A 2PYLA 4FLZA 3TCUA 1TUEB 3LA0A 4LH6A 3F5TA 2ZIOA 1Q81W 2FMLA 4E2LA 1N0NA 3G71V 2PY5A 2N05A 4UB6Z 4GKJB 2QM7A 1N8RW 3TJTA 2UU9B 3WB1A 5LMUO 1IVSA 3AG7A 1VF5B 2WA4A 4HNAA 5EZYB 4PI2A 5KUMA 3RW0A 2Q5ZA 3GWOA 5JQGB 1WB7A 1FXVA 5B1BB 1I5XA 2HLDG 4CS2A 3T1YB 1FFXA 2IH1C 3QTCA 2HG5C 4FZ0A 2Y4TA 2QR4A 4DV3B 1RFYA 4GCZA 1US6A 3STLC 2ZCEA 2BTQB 5E1AC 1DLBA 1FJGO 1CEZA 4O2AB 3CRRA 4CZZA 3ZX6A 2EIMB 5EK0A 1MSWD 1Q6HA 1NU1H 1K73W 4J41A 2QTOA 2HP8A 5L3DA 1PM9A 2QDOA 2YUAA 3WG7C 5LP6A 5HFLA 5JH7A 2CGOA 3JAKA 2YIBD 2FKXA 4MVUA 2IJIA 2WSSG 2YXHA 2KQXA 3E22A 4OX9O 1XL4A 3L9DA 4FVMA 1G6UA 4GX2A 1GN3A 3ZBHA 5F2VO 1OCCB 1OCZB 2RCVA 4LF7B 2RN9A 1UPGA 2QKAA 4FLXA 4X62B 5ITZB 2BSKB 2R9IA 3W7TA 3RYHB 3HKBB 3N2KA 1XNRO 2CTRA 1F7YA 4QE9A 2F4VO 3QVNA 1A32A 1XILA 1W59A 3TXSA 1NKDA 2QJ1A 1GN6A 4DRXA 3ZMSA 4B08A 1IBMO 3SJBC 4AILC 1FXHA 4B3TB 1AR5A 4QE7A 5H6RA 3JATB 3JD1A 1K4DC 4K0KO 1M5IA 3FD9A 3RN4A 1HNZO 1XMOO 2KB1A 3HKDB 4PI0A 5GONB 3CEIA 4JI1B 2WA3A 3L71H 3BHPA 3CCSV 4X20A 1SS3A 2NR5A 3UT5B 3ZRWB 3STZC 4H0LB 1VF7A 4F6RB 3JD3A 3RVZA 3SYPA 1PPJH 4ASUG 5IJ0A 4DV4O 1EZVH 2UUBB 1L0LH 1YF2A 4DR7O 1WJZA 5EYPB 2D2CB 3ZHSA 1HR0B 3AGYA 1Z5VA 4O4JB 5L3EA 2ETNA 2LP7A 1JJOA 3IFXA 1M90W 3MD0A 1M56C 4I50A 3RGBA 4P30A 1VQNV 2W6JG 4K3AA 2H94A 1NVPB 1Q3EA 2Y69C 2Q7HA 4FLUA 5JVDB 3ETQA 1AI4A 3BABA 3FB6C 4A5UB 1KC8W 5IT9N 2RDCA 1NH2D 2Q9LA
chains in the Genus database with same CATH topology
2CUGA 3UO2A 2QWPB 1GMUA 2Q2GA 1EB0A 2QWQB 1BQZA 2GUZA 2KQXA 3AG7A 4J80A 2CTPA 3I38A 1GMWA 1IURA 2DN9A 2LGWA 1N4CA 3L9ZA 2YS8A 1HDJA 2QLDA 2Y4UA 4L3KA 2DMXA 2QWOB 4IT5A 4RWUA 3UCSC 3NY0A 1GH6A 3LZ8A 3TJAA 1XBLA 1NLTA 3LA0A 2GUZB 1GMWD 1BQ0A 2QWNB 3UO3A 2EJ7A 2LO1A 2N04A 3APOA 2L6LA 3APQA 1GMVA 2CTWA 3TJ9A 2CTQA 1FPOA 3NXZA 1EARA 2OCHA 3AGZA 2N05A 2Y4TA 1NZ6A 2PF4E 2QSAA 2YUAA 4J7ZA 2QWRB 1C3GA 1WJZA 1XAOA 2B26A 3AGXA 2CTRA 2M6YA 3TJ8A 3BVOA 3AGYA 1FAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUG A;  3UO2 A;  2QWP B;  1GMU A;  2Q2G A;  1EB0 A;  2QWQ B;  1BQZ A;  2GUZ A;  2KQX A;  3AG7 A;  4J80 A;  2CTP A;  3I38 A;  1GMW A;  1IUR A;  2DN9 A;  2LGW A;  1N4C A;  3L9Z A;  2YS8 A;  1HDJ A;  2QLD A;  2Y4U A;  4L3K A;  2DMX A;  2QWO B;  4IT5 A;  4RWU A;  3UCS C;  3NY0 A;  1GH6 A;  3LZ8 A;  3TJA A;  1XBL A;  1NLT A;  3LA0 A;  2GUZ B;  1GMW D;  1BQ0 A;  2QWN B;  3UO3 A;  2EJ7 A;  2LO1 A;  2N04 A;  3APO A;  2L6L A;  3APQ A;  1GMV A;  2CTW A;  3TJ9 A;  2CTQ A;  1FPO A;  3NXZ A;  1EAR A;  2OCH A;  3AGZ A;  2N05 A;  2Y4T A;  1NZ6 A;  2PF4 E;  2QSA A;  2YUA A;  4J7Z A;  2QWR B;  1C3G A;  1WJZ A;  1XAO A;  2B26 A;  3AGX A;  2CTR A;  2M6Y A;  3TJ8 A;  3BVO A;  3AGY A;  1FAF A; 
#chains in the Genus database with same CATH topology
 3L72 H;  2Y0P A;  5J2T B;  4MW3 A;  5KUK A;  2P4K A;  2Q7G A;  5IY5 B;  4CH6 A;  1MNG A;  2N04 A;  2A9H A;  1JJ2 U;  5L3G A;  3ASN B;  5DEC A;  1ZL8 A;  2F43 G;  4PDV A;  4JV5 O;  4U3F H;  1BL8 A;  1I7F A;  5CA0 B;  1Q8I A;  5LMU B;  3OGI B;  1VIB A;  1R6N A;  4Q20 A;  5KHI A;  3JAR A;  2ZNI A;  5IYZ A;  3X2Q C;  1Y74 B;  3FFQ A;  2X6C A;  1GMU A;  5LL6 Y;  1YIT V;  4JI8 B;  1VQ4 V;  1PNK A;  1E1Q G;  2AHY A;  4JI0 O;  5KA5 A;  1TUB B;  3MDS A;  1GN4 A;  3CRA A;  4JAU A;  1FPO A;  3DXR B;  3Q4H A;  2Q7E A;  2GV9 A;  4HYO A;  4DR1 O;  1FJG B;  3ABK C;  5LYJ B;  1FXK A;  2P06 A;  2YS8 A;  3K9S A;  2XAQ A;  1DF4 A;  4X64 O;  1P7G A;  3ABL C;  4DR2 O;  4WF9 V;  1HNW O;  3S3W A;  2VQF B;  4IIJ A;  3NXZ A;  3GWK C;  3B2E E;  2EIK B;  4WFH A;  1J95 A;  1WPX A;  4FZ1 A;  3HB3 B;  2ZKO A;  3WU2 Z;  5KMG A;  1RP3 B;  1ZUQ A;  2GTA A;  4PA4 A;  4EB6 B;  3MHS C;  4XBF A;  2UUA O;  4YIP A;  3T2M A;  4MS2 A;  4OX9 B;  3K79 A;  1RPO A;  2DQ0 A;  4H13 B;  3RBZ A;  1AR4 A;  4O4H B;  1P49 A;  1GMW D;  2WLK A;  4UXN A;  4NTX A;  1ZX3 A;  5FNV A;  1XNR B;  4CS4 A;  1Y6X A;  3FB7 C;  1MZF A;  2F4V B;  3C3T A;  1PL4 A;  1EB0 A;  1OZ0 A;  1D5N A;  5H6Q A;  5EBM C;  1KD1 W;  1IBM B;  3DTU B;  3AG3 B;  4DV1 O;  1YEW A;  1K5S A;  2ZM6 O;  4K0K B;  1I08 A;  2EJ7 A;  1DGS A;  3CB2 A;  2IJJ A;  3CC4 V;  1H2K A;  1HNZ B;  1EM1 A;  4B3R O;  1XMO B;  2N74 A;  1NTM H;  4FLT A;  1N32 O;  2ZE8 A;  3H1H H;  1I0H A;  5HFM A;  1SF9 A;  2YI9 A;  1P7B A;  4CC5 A;  1OCO B;  2XND G;  3UO3 A;  3B8N A;  4DV4 B;  1S5H C;  4DR7 B;  3ZRV A;  2V4D A;  5EZY A;  1FD9 A;  1PKX A;  2CH7 B;  1KYO F;  5JQG A;  3HPL C;  4FM2 A;  4UV9 A;  5H2F Z;  3VOU A;  5J2U B;  2VQE O;  4MSW C;  2EZP A;  1VQM V;  2Z3Y A;  3AG1 C;  4G27 B;  5DN6 G;  2BTQ A;  3ZED A;  3JSN A;  4O4L B;  1GK9 A;  3ABT A;  4O2A A;  4O4I A;  4DRX B;  2OCC C;  3BFR A;  1LUV A;  1SQV H;  3FX7 A;  1KBH A;  5KHK A;  5LXT A;  1OCR C;  4L3K A;  3ETG A;  1WA8 B;  1M57 B;  3GVM A;  1GM7 A;  1VF6 A;  3A8T A;  3CSX A;  4GZR B;  3E35 A;  4LP8 A;  2XUM A;  3TJA A;  2A7W A;  4JV5 B;  1R3I C;  2CUG A;  1THZ A;  2Q2G A;  1K92 A;  4LCU C;  5ITZ A;  2BSK A;  3RYH A;  4FPP A;  4FM1 A;  1VP7 A;  4BW5 A;  3C6E C;  3HKB A;  2X6B A;  3TJ9 A;  2CTQ A;  1H2G A;  4I50 B;  4JI0 B;  3BRC A;  4U7O A;  2YIC A;  2PI4 A;  1FYJ A;  4QJF B;  2EZO A;  3JAT A;  4C7U A;  5B3S B;  1DK1 A;  3ZHR A;  3OEH G;  2ZR3 A;  2DYR C;  4X64 B;  2B1I A;  1EN5 A;  4TUY B;  1SQX H;  2DYS C;  4DR2 B;  5GON A;  2P4V A;  1HNW B;  3ZMZ A;  4JZG A;  4MVO A;  2DJV A;  5LHI A;  4I9Q A;  1VEW A;  1XEQ A;  3E83 A;  5JJJ B;  3UT5 A;  3ZRW A;  3L75 H;  2UUA B;  5L3F A;  4F6R A;  3ZIA G;  4RWU A;  3SJQ C;  1QLE C;  5EYP A;  4U7N A;  3ZN1 A;  1LR1 A;  1YJN V;  4O4J A;  3W7W A;  2Y0I A;  3K5L A;  4X62 O;  4UVA A;  4QPK A;  3E8F A;  3P3P A;  2WLM A;  3ZS8 C;  2UXX A;  3AG4 B;  3RT3 C;  5FPR A;  3SDL A;  3RFR A;  4IYH A;  3FAV B;  4O2B B;  5AG2 A;  5JVD A;  3W7U A;  4JI5 O;  3CCQ V;  3CS5 A;  4DV1 B;  1NJI W;  2ZM6 B;  1L1F A;  1E79 G;  1Y67 A;  1VQ6 V;  3AGZ A;  4JF3 A;  1K3E A;  4MVZ A;  5B1A B;  1AB3 A;  2W6I G;  2R9A A;  4I9W A;  1N32 B;  4NTY A;  4JAS A;  1KU9 A;  2HHH O;  3ABM C;  4IIJ B;  4JI7 O;  2OIE A;  3QNE A;  3O65 A;  4UCV A;  4D7T A;  4ZKI A;  1QVF U;  5KHH A;  3K5O A;  3LSU A;  4L87 A;  4W4L A;  5CA0 A;  4W4K A;  4J9Y B;  3K3W A;  4I0X A;  2DWD C;  1H38 A;  4HAM A;  1EBO A;  4IHJ B;  1IXM A;  5LP6 C;  3VQX A;  1TUB A;  3OM3 B;  4ABM A;  4LBE C;  3DXR A;  4X1I A;  4JYY A;  4J7J A;  1OHH G;  2KKW A;  1W0K G;  1S77 D;  2QLD A;  1QU7 A;  2W0F C;  2QE7 G;  1S5J A;  4LF4 O;  4TWK A;  1BMF G;  2LGW A;  2PI5 A;  2LQT A;  4BIU A;  3G4S V;  5B1N A;  1NQT A;  4PA7 A;  4U3J A;  4ZOL B;  4EB6 A;  1VQL V;  3OAA G;  5BMV A;  1YCI A;  5KX5 B;  4I5S A;  4UV8 A;  4CBC A;  2DWE C;  1V55 C;  4O4H A;  3W7S A;  3J80 N;  1NI8 A;  4DK0 A;  5KLV H;  5CBG A;  3A0H Z;  3LDD A;  4N23 A;  4NXM O;  2AHZ A;  5JCO A;  3TGU H;  1IZ3 A;  3WFV A;  4BIZ A;  3ZHU A;  3EHB B;  2X6A A;  4PJ0 Z;  4JI8 O;  2CGN A;  4QGP A;  3CHX A;  4HBN A;  1Y76 B;  4MVM A;  1IBL O;  2E75 B;  2ZR2 A;  4O4I B;  5IJ9 A;  1O9G A;  2JJ2 G;  3K58 A;  1Q43 A;  2EIJ B;  3P30 A;  1NBM G;  1YVW A;  3QF7 A;  2XAJ A;  2GDS A;  2JK5 C;  2X0L A;  4MVR A;  2VQF O;  5LXT B;  4TT3 G;  5C93 A;  1UFI A;  4B3M O;  4R7C A;  4I7Z B;  1XMQ O;  3WB0 A;  3N2G B;  1WB8 A;  1KUQ A;  3SPI A;  5D5P A;  3H1K H;  4QNH B;  4KHP O;  3EVK A;  2H8P C;  4LNU A;  2QM8 A;  4WFB V;  1MZE A;  2VRZ A;  3JAW B;  2CH7 A;  2YIA A;  2H3O A;  1N36 O;  4JTA B;  4FIP C;  4JZ2 A;  3LNN A;  3D36 C;  1C3G A;  4LFC O;  3K03 A;  2JJ1 G;  4BW9 A;  2GTS A;  5J2U A;  3CE2 A;  3K0G A;  4ZIB A;  2Q8V A;  2LGQ A;  3SYO A;  4JPR A;  3CCU V;  4GX5 A;  4X8A A;  4P9P A;  4H44 B;  1V54 C;  1XOU A;  3B4S A;  4X1K B;  3RYI A;  4FLW A;  4O4L A;  4JI5 B;  1BT8 A;  4K8X A;  3D3I A;  3NXS A;  4GT1 A;  4RQE A;  1RM1 C;  2EIL B;  2EIN B;  3CJH B;  1LNQ A;  2Q69 A;  2XHB A;  4JI4 O;  1WA8 A;  3JYC A;  3D3Q A;  2OT5 A;  2HHH B;  4JI7 B;  3SJA C;  1S5L Z;  4FFB B;  3NY0 A;  1GH6 A;  5KHG A;  4KFM A;  3ZJZ A;  1FXK C;  3ZCC A;  4Z1M G;  4B3S O;  4LF8 O;  4LH7 A;  2LJ2 A;  2JVD A;  2ADP A;  1QVG U;  1KP2 A;  2M7W A;  3T4Z A;  3F7Y C;  3CD6 V;  2OTJ V;  4WBN B;  5EIB D;  3J81 N;  1SZX A;  2E5L O;  4JTD B;  2WLI B;  4BWA A;  2ZE5 A;  3SYC A;  1Q6U A;  4PDM A;  4R50 A;  2ZD9 A;  2AXT Z;  2RNB A;  2YXL A;  2IJK A;  2ILM A;  4DV2 O;  1WN7 A;  4TUY A;  4LF4 B;  1GMG A;  2FTK A;  3C90 A;  3K0D A;  5IYC O;  4KXR A;  1XNQ O;  4IT5 A;  1SER A;  3OR6 C;  2XT9 A;  2CK3 G;  3FB8 C;  3BAA A;  2KSD A;  2ZIM A;  4J7Z A;  3KZI Z;  3HR0 A;  2M6Y A;  2OIG A;  2HKO A;  4X9Q A;  1BGY H;  1I5Y A;  2RMK B;  1KKD A;  3E8G A;  2BOC C;  1IUR A;  4DK1 A;  4I0X B;  4NXM B;  2YDE A;  4YXW G;  4MVS A;  4YIO A;  4MTO A;  4G2K A;  5EIB C;  3H1I H;  4UVB A;  2LW1 A;  3FAV A;  4O2B A;  4UCU A;  4TOI A;  1EN6 A;  5FL7 G;  4PEL A;  1TVK A;  1FS0 G;  4X1I B;  1IBL B;  3TK1 A;  4DR6 O;  2JDI G;  2AW9 A;  2YI8 A;  4IL6 Z;  2Q68 A;  3SPH A;  5B1B C;  3J7A U;  2QM4 A;  2E3C A;  1OV9 A;  2F95 B;  1EZJ A;  4B3M B;  1BS3 A;  1XMQ B;  5GW7 A;  3CRQ A;  1Z5W A;  3ASO B;  5A9G A;  1BZK A;  2QWP B;  4KL1 A;  4U3J B;  2QTS A;  3I38 A;  2AZ2 A;  2JZ8 A;  1H2S B;  2F93 B;  5BMV B;  4KHP B;  4YJ2 B;  1FKA O;  3DSQ A;  2EIM C;  1JVM A;  1RSO B;  3AG2 B;  2HFE C;  2Z5U A;  2Q67 A;  4R6Z A;  4JI3 O;  2P5O A;  1N36 B;  1VQP V;  1NT2 B;  1KP3 A;  5B1O A;  4IHJ A;  1JX9 A;  4LFC B;  3OMA B;  1WNS A;  1ARO P;  1VAR A;  4FJC C;  1N34 O;  1YTF D;  2B1G A;  1OCC C;  2IM9 A;  2NLJ C;  3FYE B;  1OCZ C;  3K59 A;  4JI6 O;  4E4E A;  3ETD A;  1K97 A;  3APO A;  5CA1 B;  5IJ9 B;  3CX5 F;  2QEX V;  4X65 O;  1XHX A;  3ZMT A;  4JI4 B;  3U0Z A;  3HKC B;  4JYC A;  5TIS Z;  2DE0 X;  4ZOL A;  1NR7 A;  2DQ3 A;  4P2Z A;  1NVP D;  3CYO A;  5CA3 A;  2P67 A;  3U10 A;  5C8Y B;  5KX5 A;  5LGU A;  4MW8 A;  2JEX A;  4LF5 O;  3CC7 V;  4B3S B;  4LF8 B;  1Q7Y W;  5JWP A;  1NZ6 A;  4LNU B;  2QWR B;  2ZXW B;  3OD4 A;  3OW2 U;  4JGS A;  3JCU Z;  3VQY A;  3ZN0 A;  4LR3 A;  3THO A;  1GTO A;  2HR3 A;  1Y76 A;  2P7T C;  5KAF Z;  2O57 A;  1BQ0 A;  1ZAU A;  2E5L B;  1M9N A;  1AJN A;  3RYI B;  3ZMV A;  3FKS G;  2QA4 V;  3VBB A;  2OYQ A;  1IBK O;  2B5U A;  3UO2 A;  4DV2 B;  3VQW A;  4PA6 A;  5BZB A;  2DN9 A;  2NN4 A;  3ABU A;  1XNQ B;  1QR8 A;  3N2G A;  2GUZ B;  4EFE A;  3LDC A;  3ZRX A;  2WPD G;  1R3J C;  1JA8 A;  1AI7 A;  2LFR A;  1H2L A;  2ZIN A;  1L8D A;  1TAE A;  4OPH A;  3OFN G;  2PGG A;  2UXB O;  3JAW A;  1UJW B;  1SQP H;  3E2E A;  1T5E A;  2W0X A;  5IY5 C;  2EUL A;  4OGQ B;  3CC2 V;  5CMU A;  2R70 A;  4ZI7 A;  5IE9 A;  2LO1 A;  4TQD A;  4X89 A;  1NR1 A;  4JYA O;  3ASN C;  2XAS A;  4JYB A;  1JQ0 A;  2WLN A;  2WLJ A;  4X1K A;  5LGT A;  4BR6 A;  2C2A A;  4F6E A;  2A3Q A;  4DW1 A;  4DR6 B;  5FPO A;  1H8H G;  3ZHT A;  3G67 A;  3KCX A;  1ZLZ A;  2Y48 A;  3CJH A;  4J42 A;  1BCC H;  1KMI Z;  3B40 A;  1BHB A;  3R66 A;  4TV9 B;  4DO2 A;  5CB4 A;  3IGA C;  1PNL A;  2Q0O C;  2F1M A;  3I5D A;  1V9P A;  3WG7 B;  5DED A;  2FL4 A;  2HVJ C;  2ODM A;  4FFB A;  3JD2 A;  2LFS A;  1JMK C;  1WAZ A;  1SET A;  1GMW A;  3F5W C;  3OGC C;  4NR1 A;  1AVM A;  3H1L H;  1K9M W;  2Q0A A;  4J7K A;  3K08 A;  2FB5 A;  3RYF A;  1R6K A;  4RAI A;  3E86 A;  2VWK A;  4Z1V A;  1M1K W;  1RPR A;  1QLN A;  4JI3 B;  3FYI B;  3ICX A;  2JGD B;  1SZT A;  2EIK C;  3OMI B;  4AQY O;  3K5N A;  5EC2 C;  5LHH A;  4DR4 O;  3G6B A;  4WFF A;  4J9Z B;  2PTM A;  1SA0 B;  1YDX A;  4WBN A;  1P84 F;  4FM0 A;  2HVK C;  4ICG A;  1R6T A;  2QKS A;  2WLI A;  1N34 B;  1JFF B;  2DMX A;  4JI6 B;  1TVK B;  2ITD C;  3TET A;  3A2F A;  1QQC A;  4J11 A;  1RM1 B;  4ZBM A;  1PV0 A;  3RVY A;  1F4M A;  2F23 A;  1O9H A;  4PA3 A;  4X65 B;  3CCM V;  3SPC A;  5JCO C;  4WFG A;  3CXC U;  1AP5 A;  2GBO A;  4GX0 A;  1R3K C;  4DR5 O;  4PV1 B;  2Z0A A;  3AG3 C;  1XRE A;  3RWR D;  1KQS U;  3T4D A;  1TGO A;  1WP8 A;  4LF5 B;  4DYL A;  1MA1 A;  4UB8 Z;  1NTK H;  3UQ8 A;  3BVO A;  4PA9 A;  3BPZ A;  2ZT9 B;  3OMN B;  1K4C C;  4Q6G A;  2OWO A;  2QKC A;  1M56 B;  4WCE V;  3OTO B;  1CPY A;  1OCO C;  1VQO V;  2UXC O;  3CP1 A;  2XOK G;  4LC1 A;  2Y69 B;  3CWB H;  3K9A A;  4I4T A;  3M99 B;  3MHH C;  1IBK B;  1HW7 A;  2IH3 C;  1GN2 A;  4PDR A;  1W2B U;  2OTL V;  2DW4 A;  1LUW A;  3CMA V;  1Q90 D;  1QCE A;  1ZWI C;  3JCZ A;  1ROP A;  3OR7 C;  4YHH O;  4JAV A;  3NR7 A;  4DV6 O;  4PD4 F;  2PF4 E;  4YJ2 A;  2EJR A;  2V7Q G;  4BAY A;  1RSO A;  1MOF A;  2VWJ A;  3AEI A;  3DGE A;  3SPJ A;  2UXB B;  4QPJ A;  3LSS A;  4DV0 B;  3O9O A;  1AJQ A;  1HDJ A;  3H9V A;  1E1R G;  1G1X B;  3UM7 A;  1I94 O;  1M57 C;  4I55 A;  1JR9 A;  3X2Q B;  1AJP A;  1SQB H;  2ADQ B;  1OJH A;  3APQ A;  3EFF K;  4JYA B;  2IW5 A;  5LMN O;  3ZHQ A;  3OEE G;  4LFB O;  2QGN A;  5BR8 O;  1XQ8 A;  2IU3 A;  2ARH A;  1NH2 B;  3JSL A;  3ABK B;  1G8M A;  4KP4 A;  5CA1 A;  1Q82 W;  3BA8 A;  1PNM A;  4AHC A;  3ABL B;  3EXA A;  1X4T A;  3CCR V;  3HKC A;  1Q86 W;  1SKV A;  3K06 A;  3L70 H;  5KA6 A;  2V1D A;  4FK5 C;  5CBF A;  2B26 A;  1GAX A;  3TJ8 A;  3JAS A;  1XUQ A;  5J9P C;  3UKM A;  2HJF C;  5C8Y A;  3QO5 A;  2UXD O;  5B3S C;  2YC0 A;  4LFA O;  4NXN O;  4X1Y B;  2UUC O;  3OUF A;  2JGU A;  1S3J A;  1YI2 V;  2K9P A;  3CCL V;  1QR9 A;  3OT7 A;  2WAM A;  3OUS A;  3LDE A;  4B7E A;  3P3N A;  2ODX A;  4AQY B;  2Q4P A;  5JJN B;  4NVP A;  4DR4 B;  2MW2 B;  2ZDI A;  4ZI7 B;  2EBO A;  2NNU A;  3CXH F;  4J80 A;  3M8A A;  1JPX A;  3I55 V;  4B7K A;  4CC6 A;  4IGG A;  1EFR G;  1YIJ V;  4UCS A;  1GO3 F;  4JI2 O;  3QO7 A;  3HKE B;  3GB7 C;  2GSM B;  1FFT B;  1KKC A;  3AG4 C;  3K5M A;  2GUZ A;  4UCR A;  5CB4 B;  2EX3 A;  3ZRS A;  4L8J A;  4NKG B;  1F23 A;  1N4C A;  4DR5 B;  4MT8 A;  5IYD O;  2QWO B;  1AR1 B;  2ZE6 A;  3CCJ V;  4D6T H;  1J5E O;  3C3S A;  4QIW F;  1VMG A;  4K35 A;  4LF6 O;  1K33 A;  2A0L A;  5B1A C;  3RYF B;  5L3B A;  3MAQ A;  1IX9 A;  2WLH A;  1EN4 A;  2JIZ G;  2XAH A;  2CAZ C;  1QHT A;  1G4Y B;  1YTF B;  5LGN A;  2IJH A;  3LZ8 A;  1JCH A;  4UVC A;  3SJC C;  3C5X C;  2UXC B;  1XI1 A;  1GMV A;  1ORQ C;  3AG1 B;  2ZQM A;  1AP6 A;  3D8C A;  4TV8 B;  2A79 B;  3BEH A;  3KCY A;  2OCC B;  4XDK A;  2HJD A;  2R9R B;  3B77 A;  3E89 A;  4GKK O;  3CCE V;  3KG2 A;  1BE3 H;  3OE7 G;  2F66 C;  1Q6I A;  2FYU H;  1R73 A;  2WLL B;  4TV9 A;  1F4N A;  5K1X A;  1JOY A;  3L9Z A;  1OCR B;  3OTF A;  2JVM A;  2YID A;  3B09 A;  4YHH B;  4DUY O;  2E74 B;  4N21 A;  2B9Z A;  4UUJ C;  3I56 V;  3VQV A;  1H2N A;  3F7V C;  4DV6 B;  4H37 A;  4TQF A;  2BCC H;  5A2Q N;  1FAF A;  1DF5 A;  3ETE A;  2A06 H;  3BCC H;  1SQF A;  2RQ6 A;  2MK3 A;  2JGD A;  3B8M A;  3D36 A;  1CXZ B;  1I94 B;  4HZ3 A;  1HNX O;  1QBZ A;  4ZHQ B;  1SA0 A;  2L6L A;  4LWS B;  4TSF G;  1EAR A;  2KG7 B;  2L35 A;  5LMN B;  3BY6 A;  3AKO B;  4LFB B;  5BR8 B;  1JFF A;  3T1C A;  5B66 Z;  1BSM A;  5EC1 C;  1SQQ H;  1PD3 A;  2K1E A;  4YJ3 B;  2PUS A;  4I4T B;  1DTO A;  2DYR B;  4X66 O;  4GYC B;  4P9O A;  3SYQ A;  2DOS A;  2DYS B;  1X59 A;  4D7S A;  5H5N A;  2CTW A;  4OXS A;  2YIB A;  1Y4M A;  2YEV B;  1KEC A;  2OCH A;  5LOV B;  1GM8 A;  3E8H A;  5IWA O;  3JAL B;  1ZSP A;  2VS0 A;  3LUT B;  4LF9 O;  4OPA A;  2ZNJ A;  1GKF A;  2UXD B;  2ITC C;  4LFA B;  4NXN B;  2JRR A;  4WFA V;  5KHJ A;  1BHA A;  1TA8 A;  3RYC B;  4DUZ O;  2UUC B;  2EIJ C;  3H1J H;  2E76 B;  1B3Q A;  1K5Q A;  1QLE B;  1U96 A;  1PL0 A;  4K8Z A;  2Q73 A;  4XDL A;  1S76 D;  1MSD A;  4DV7 O;  3ML0 A;  4J10 A;  1GRJ A;  4MTF A;  5IDJ A;  5LA6 B;  4FMT A;  4UCT A;  1MMM A;  3AGX A;  4I55 B;  1VF6 C;  3U11 A;  2YSU B;  3LSQ A;  2YXY A;  2QWQ B;  3QG5 A;  1SRY A;  1MG1 A;  1WP7 A;  3T1H O;  5IYB O;  1IXB A;  3JD0 A;  4HNA B;  4JI2 B;  3DC5 A;  2D3O W;  3CME V;  3JAM N;  1VQ9 V;  1FFX B;  2BE3 A;  3ABM B;  2XAG A;  5K1P A;  2RJZ A;  1Y66 A;  2X7R B;  1SC5 B;  3JAS B;  4NTW A;  4JAA A;  1Z2G A;  1J5E B;  1VQ8 V;  1PP9 H;  5L3C A;  3ZMU A;  4NYK A;  1YXB A;  1AIL A;  2EIL C;  2EIN C;  3PJS K;  4FFK A;  3JD4 A;  4LF6 B;  1K34 A;  3ZHV A;  1XHZ A;  1N33 O;  4DW0 A;  1U97 A;  5KAI Z;  2BOB C;  3PN1 A;  4MVQ A;  5LP6 B;  5CN0 A;  5JH7 B;  3SPG A;  2Y4U A;  3JAK B;  1D5A A;  3OTO O;  3CRM A;  4YY3 O;  4AI8 A;  1Q5O A;  3W7X A;  3E22 B;  2QWN B;  3CRC A;  2P90 A;  4FLY A;  2P22 C;  3N27 A;  4RQF A;  3TXQ A;  4GKK B;  4DR3 O;  5BXZ A;  1ENV A;  4XDJ A;  5GTI Z;  2Q6A A;  5EBW C;  3N2K B;  1WPB A;  5JJE B;  2IU0 A;  3K04 A;  2PYJ A;  1S0V A;  1XDC A;  4DUY B;  3G80 A;  3FB5 C;  1B6Q A;  2CDY A;  1WLE A;  2QSA A;  4X1Y A;  4EEQ A;  3IC7 A;  4EFB A;  4FLV A;  3SYA A;  1KB9 F;  4DV5 O;  1V55 B;  1BQZ A;  3G6E V;  1H2M A;  4DV0 O;  5D5Q A;  1ZTE A;  4PHZ A;  2P6J A;  2R72 A;  2BTO A;  1HNX B;  5GTH Z;  4X20 B;  4PDL A;  3L73 H;  4GKJ O;  1YJ9 V;  5LBQ A;  3M7M X;  2UU9 O;  2UXN A;  2JRI A;  5IJ0 B;  4IYI A;  2ZE7 A;  3WB2 A;  3HKE A;  4MTX A;  3S3X A;  4X66 B;  3T1Y O;  1N0J A;  4JTC B;  4DV3 O;  3L74 H;  3KKY A;  5IWA B;  4F4L A;  5BY1 A;  4DR1 B;  4LF9 B;  1HWY A;  2PZS A;  3AK2 A;  1B04 A;  4DUZ B;  3K57 A;  1H8E G;  3HKD A;  1XBL A;  2HEP A;  4NB5 A;  1CP9 A;  2LW7 A;  5FLX N;  4KUM A;  4DV7 B;  4GUN A;  3BA9 A;  1K8A W;  3ASO C;  5LHG A;  2CTP A;  5B5E Z;  1ZL8 B;  3IC9 A;  1M93 A;  1V54 B;  4GX1 A;  4TV8 A;  3T1H B;  3AG2 C;  3UCS C;  2JS3 A;  4LF7 O;  2XAF A;  3H01 A;  2IBZ H;  5EBL C;  1AI5 A;  2WLL A;  3JAR B;  1VQ7 V;  5IYZ B;  4R8C A;  1IDS A;  4GLX A;  2AGA A;  4RUF A;  1L0N H;  1VQ5 V;  4CH4 A;  1YSC A;  3AK1 A;  3Q4H B;  4B3T O;  4EKW A;  1K7D A;  1HP8 A;  1FXK B;  4Z2W A;  5H9C A;  1SES A;  3AK3 A;  1MAB G;  2CE4 A;  4X88 A;  4B3R B;  1N33 B;  5J2T A;  1XAO A;  2ATK C;  4DXW A;  1B06 A;  4G28 B;  3E8B A;  1QNM A;  3DC6 A;  4JI1 O;  4CS3 A;  4ZHQ A;  1R1B A;  1W0J G;  3IAY A;  4LWS A;  2KG7 A;  4CH5 A;  5KMG B;  4YY3 B;  1NLT A;  5DM6 V;  4RO2 A;  4H33 A;  3A0B Z;  3QO8 A;  2GHY A;  2UUB O;  5CBH A;  4YJ3 A;  2ZXW C;  3CPW U;  1HR0 O;  3LNM B;  1R3L C;  1Y74 A;  3CCV V;  3SR2 C;  1S72 V;  5E79 Z;  1COW G;  3IJ4 A;  4DR3 B;  4BIO A;  3P32 A;  4CH3 A;  1D2D A;  5FNV B;  1AI6 A;  3A0R A;  2YEV A;  2VQE B;  1NTZ H;  5LOV A;  2ZDI C;  1YZB A;  1VQK V;  3JAL A;  3SGI A;  4MTG A;  5LYJ A;  2JS5 A;  3R65 A;  2AZ0 A;  3RYC A;  1XL6 A;  2G38 A;  1P4R A;  2WWW A;  4UFZ A;  1YHQ V;  4DV5 B;  1YJW V;  1GM9 A;  1F51 A;  4WFE A;  1M4U A;  4RUE A;  4UCO A;  2JEU A;  1SQG A;  1NS1 A;  2XTA A;  1URF A;  5LA6 A;  2PYL A;  4FLZ A;  3TCU A;  1TUE B;  3LA0 A;  4LH6 A;  3F5T A;  2ZIO A;  1Q81 W;  2FML A;  4E2L A;  1N0N A;  3G71 V;  2PY5 A;  2N05 A;  4UB6 Z;  4GKJ B;  2QM7 A;  1N8R W;  3TJT A;  2UU9 B;  3WB1 A;  5LMU O;  1IVS A;  3AG7 A;  1VF5 B;  2WA4 A;  4HNA A;  5EZY B;  4PI2 A;  5KUM A;  3RW0 A;  2Q5Z A;  3GWO A;  5JQG B;  1WB7 A;  1FXV A;  5B1B B;  1I5X A;  2HLD G;  4CS2 A;  3T1Y B;  1FFX A;  2IH1 C;  3QTC A;  2HG5 C;  4FZ0 A;  2Y4T A;  2QR4 A;  4DV3 B;  1RFY A;  4GCZ A;  1US6 A;  3STL C;  2ZCE A;  2BTQ B;  5E1A C;  1DLB A;  1FJG O;  1CEZ A;  4O2A B;  3CRR A;  4CZZ A;  3ZX6 A;  2EIM B;  5EK0 A;  1MSW D;  1Q6H A;  1NU1 H;  1K73 W;  4J41 A;  2QTO A;  2HP8 A;  5L3D A;  1PM9 A;  2QDO A;  2YUA A;  3WG7 C;  5LP6 A;  5HFL A;  5JH7 A;  2CGO A;  3JAK A;  2YIB D;  2FKX A;  4MVU A;  2IJI A;  2WSS G;  2YXH A;  2KQX A;  3E22 A;  4OX9 O;  1XL4 A;  3L9D A;  4FVM A;  1G6U A;  4GX2 A;  1GN3 A;  3ZBH A;  5F2V O;  1OCC B;  1OCZ B;  2RCV A;  4LF7 B;  2RN9 A;  1UPG A;  2QKA A;  4FLX A;  4X62 B;  5ITZ B;  2BSK B;  2R9I A;  3W7T A;  3RYH B;  3HKB B;  3N2K A;  1XNR O;  2CTR A;  1F7Y A;  4QE9 A;  2F4V O;  3QVN A;  1A32 A;  1XIL A;  1W59 A;  3TXS A;  1NKD A;  2QJ1 A;  1GN6 A;  4DRX A;  3ZMS A;  4B08 A;  1IBM O;  3SJB C;  4AIL C;  1FXH A;  4B3T B;  1AR5 A;  4QE7 A;  5H6R A;  3JAT B;  3JD1 A;  1K4D C;  4K0K O;  1M5I A;  3FD9 A;  3RN4 A;  1HNZ O;  1XMO O;  2KB1 A;  3HKD B;  4PI0 A;  5GON B;  3CEI A;  4JI1 B;  2WA3 A;  3L71 H;  3BHP A;  3CCS V;  4X20 A;  1SS3 A;  2NR5 A;  3UT5 B;  3ZRW B;  3STZ C;  4H0L B;  1VF7 A;  4F6R B;  3JD3 A;  3RVZ A;  3SYP A;  1PPJ H;  4ASU G;  5IJ0 A;  4DV4 O;  1EZV H;  2UUB B;  1L0L H;  1YF2 A;  4DR7 O;  1WJZ A;  5EYP B;  2D2C B;  3ZHS A;  1HR0 B;  3AGY A;  1Z5V A;  4O4J B;  5L3E A;  2ETN A;  2LP7 A;  1JJO A;  3IFX A;  1M90 W;  3MD0 A;  1M56 C;  4I50 A;  3RGB A;  4P30 A;  1VQN V;  2W6J G;  4K3A A;  2H94 A;  1NVP B;  1Q3E A;  2Y69 C;  2Q7H A;  4FLU A;  5JVD B;  3ETQ A;  1AI4 A;  3BAB A;  3FB6 C;  4A5U B;  1KC8 W;  5IT9 N;  2RDC A;  1NH2 D;  2Q9L A; 
#chains in the Genus database with same CATH homology
 2CUG A;  3UO2 A;  2QWP B;  1GMU A;  2Q2G A;  1EB0 A;  2QWQ B;  1BQZ A;  2GUZ A;  2KQX A;  3AG7 A;  4J80 A;  2CTP A;  3I38 A;  1GMW A;  1IUR A;  2DN9 A;  2LGW A;  1N4C A;  3L9Z A;  2YS8 A;  1HDJ A;  2QLD A;  2Y4U A;  4L3K A;  2DMX A;  2QWO B;  4IT5 A;  4RWU A;  3UCS C;  3NY0 A;  1GH6 A;  3LZ8 A;  3TJA A;  1XBL A;  1NLT A;  3LA0 A;  2GUZ B;  1GMW D;  1BQ0 A;  2QWN B;  3UO3 A;  2EJ7 A;  2LO1 A;  2N04 A;  3APO A;  2L6L A;  3APQ A;  1GMV A;  2CTW A;  3TJ9 A;  2CTQ A;  1FPO A;  3NXZ A;  1EAR A;  2OCH A;  3AGZ A;  2N05 A;  2Y4T A;  1NZ6 A;  2PF4 E;  2QSA A;  2YUA A;  4J7Z A;  2QWR B;  1C3G A;  1WJZ A;  1XAO A;  2B26 A;  3AGX A;  2CTR A;  2M6Y A;  3TJ8 A;  3BVO A;  3AGY A;  1FAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...