4J80A

Thermus thermophilus dnaj
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
271
structure length
271
Chain Sequence
AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVMSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGKGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRMPPGVREGSVIRVPGMGGQGNPPGDLLLVVRMLPHPVFRLEGQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKMRLKGGGFPGPAGRGDLYLEVRITIPERLTPEEEALWKKLAEAYYAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein DnaJ 2
publication title Combining crystallography and EPR: crystal and solution structures of the multidomain cochaperone DnaJ.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 62
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF01556 DnaJ_C DnaJ C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4j80A01
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A02
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A03
2CUGA 2PF4E 4J80A 3TJ9A 3AG7A 1GH6A 2CTQA 3NXZA 1BQ0A 3UCSC 1NZ6A 1WJZA 3LZ8A 2GUZB 2Y4TA 2QSAA 1XAOA 3NY0A 4L3KA 3APOA 1HDJA 2CTPA 2EJ7A 3L9ZA 1FPOA 2DN9A 3TJ8A 1XBLA 2YS8A 3BVOA 1GMVA 2QLDA 2KQXA 3AGXA 2N05A 2QWRB 1EARA 2GUZA 1NLTA 2CTWA 2OCHA 2B26A 2Q2GA 3LA0A 1FAFA 1IURA 2DMXA 1BQZA 2LO1A 4J7ZA 3AGZA 2QWOB 3UO2A 4RWUA 3APQA 4IT5A 2CTRA 2M6YA 1EB0A 1GMWD 3AGYA 2LGWA 2L6LA 2N04A 1N4CA 2QWQB 2QWNB 2QWPB 1C3GA 1GMWA 3UO3A 2YUAA 1GMUA 2Y4UA 3TJAA 3I38A
chains in the Genus database with same CATH superfamily
2Y69B 1N0NA 4JI4B 3EHBB 4P9PA 2UXCB 1EM1A 1DTOA 5LGTA 2PY5A 2E5LB 3TJ8A 2DYSC 1MZEA 4LF6B 1P84F 1PPJH 2NNUA 5IJ0A 1AR1B 5IWAB 3SJBC 3OTFA 1FFXA 2YC0A 1EB0A 2JEUA 4B3TO 5B3SC 2IBZH 5AG2A 1SQFA 4O4LB 4TOIA 4NXMB 5BXZA 3CMEV 3AG2B 2EIMB 4YJ3A 1MG1A 1FS0G 1V54C 3BA9A 3D8CA 3LSQA 2EULA 1AB3A 4RO2A 4GUNA 4RUEA 2YEVB 4HAMA 3F5TA 3M7MX 1EZVH 4MT8A 1Q3EA 2WAMA 1H2GA 2PI5A 2XHBA 3CRQA 4QJFB 1Q6IA 1QVGU 1N0JA 2CAZC 5LMNO 3QO7A 2Q0AA 3JALB 1OCRB 5F2VO 2F23A 4DRXB 2Q68A 2DQ3A 5B1BC 1WN7A 4IHJB 2R9RB 1SF9A 1AI4A 2UXXA 5GONB 1GMGA 2LP7A 1FFTB 4MVRA 5CMUA 1XMQB 4H0LB 1IXMA 4TSFG 3ZN1A 4PDMA 3N2KA 3RT3C 3AG4B 3RVYA 1K97A 4CZZA 1PM9A 3FX7A 4NR1A 4JTAB 4LH7A 3HKEA 3RYIB 3L71H 1W59A 2UUBB 2PUSA 5B1AC 5C93A 5IYDO 1SA0B 3SJQC 5A2QN 1LR1A 3LUTB 4I50B 5LA6B 4BIOA 5LHHA 4JI5O 5LHGA 2B5UA 1PNKA 4N21A 3K5OA 2Q9LA 1K33A 2F4VO 1L0NH 3JCUZ 4JGSA 3N2GB 3RFRA 4KL1A 2ZDIA 3ABKB 2K9PA 4JAUA 1W2BU 4WFGA 1JA8A 3ZRSA 1K92A 2W0FC 1SC5B 3CWBH 3K57A 2JGDB 4F6RA 1Y74A 1N32B 3VQWA 5KMGB 4L3KA 5IYZB 3BVOA 3JSNA 2WSSG 1TVKB 3I56V 3VQYA 1W0KG 3AG1C 3EXAA 4UV9A 3DC5A 3JSLA 1PKXA 3G6EV 2OTJV 3I55V 1Y66A 5KX5B 2EZOA 3PJSK 3F5WC 3P30A 4PA6A 3E35A 5CBFA 5IJ9B 5EIBC 4I7ZB 2B26A 2BTQB 1FJGB 4PELA 4QIWF 4DV3O 4AI8A 4F4LA 1QU7A 2JRIA 5LGNA 1VQ9V 1ZX3A 2P7TC 4DV2O 4DV5O 1SERA 3B09A 4B7EA 4P2ZA 2ZDIC 1HNXO 2FL4A 4LFCO 5J2TA 3E86A 2HJDA 4LF4O 3AK3A 3JAKA 4LF8O 3SPCA 4HNAB 2JJ1G 1HW7A 2NR5A 4FVMA 2CTRA 2ADQB 3E22B 2YICA 2OCCC 4JYAO 3ETGA 4B3MO 5FNVA 1KKCA 1QHTA 1Q5OA 4MTXA 3MHSC 3CCRV 2QM7A 4DR2B 2DWEC 3SYCA 2DWDC 1HWYA 1DK1A 2Z5UA 2BTOA 4FZ1A 3RVZA 5KHGA 1C3GA 3A2FA 2N74A 3ZHRA 3MD0A 3OEHG 4UB8Z 4JYBA 2IU0A 2AZ0A 4DV0O 1RSOA 3OR7C 3NXZA 5EYPB 3G80A 4JI3B 4B7KA 2KG7A 1ZLZA 5HFLA 4YY3O 4LF9O 1VQ5V 1E1QG 4QNHB 4B3RO 2V4DA 4DR7O 3CCMV 3OGIB 1WPBA 1NU1H 4RWUA 3WB1A 2WLJA 4Z1VA 4X1YB 3Q4HA 3T4ZA 1K5QA 1NTMH 3OMAB 3TCUA 2JDIG 3ZBHA 2ZE7A 1A32A 1SQPH 2JGUA 5L3BA 3SYPA 4EFBA 4MTGA 1K8AW 4ZI7A 3G4SV 3E89A 5L3CA 1XILA 4G28B 2EBOA 1VIBA 2ZXWB 2Q4PA 3ZCCA 4R6ZA 1V54B 1VQNV 2QWNB 5JQGA 4WBNB 2V1DA 1M9NA 2JVDA 4DXWA 3HKBA 1O9HA 1Q43A 3FYEB 5BR8O 5EBWC 5JVDB 5LMUO 2OCHA 4JI2O 3W7SA 3IAYA 1F4NA 1SZTA 1ZL8B 4J11A 2Y69C 2EILB 1P4RA 3K06A 1FKAO 1I5YA 2B9ZA 3K0DA 2UXDO 4ZHQA 5IYCO 2HVJC 4P9OA 1GAXA 2ZINA 1HNWB 4GKKO 2P4VA 2ETNA 1YTFB 5GTIZ 5IJ0B 3DXRA 1FXVA 1JQ0A 1FFXB 1ZWIC 3IGAC 3JD2A 3JCZA 1YJ9V 1THZA 1NQTA 2P90A 4MVOA 3OW2U 1GM9A 1IBLB 1ORQC 4LH6A 4DR3B 2P6JA 1Q90D 1BHBA 5B1AB 4QPJA 2OT5A 3L9ZA 2R9IA 2ARHA 1R6TA 4Z2WA 2VQFB 4DUYB 1PL0A 5FL7G 4DUZB 4PD4F 3DC6A 2GDSA 1I08A 1WA8B 1VQLV 1QBZA 5CA0A 1S5JA 4JV5B 3VQVA 4DK0A 4FLUA 2A3QA 1XI1A 3K5NA 3JD3A 5B66Z 3CRAA 3DSQA 1OCRC 2X6BA 1RFYA 1AR5A 2Q2GA 2CTWA 4WFHA 2PYLA 4AQYB 1XMOB 5EK0A 3CRRA 1CXZB 1AJPA 5BMVA 4RUFA 1FD9A 3L75H 3CC4V 2LW1A 2Q5ZA 3N2KB 3TK1A 2X6CA 2ZM6O 1IBMO 1LUWA 1HR0B 1F23A 3BRCA 4NB5A 1M90W 3HKEB 2B1IA 4U3JA 3IJ4A 3B40A 4B3SO 1BSMA 1OV9A 3C6EC 2UUAO 4JI7O 4PA7A 1K34A 1I5XA 5KUKA 1GM8A 2OIGA 2X0LA 3BAAA 4UCUA 4LF5B 1VMGA 5FPRA 2E3CA 3CCQV 1PL4A 2Y48A 1XHZA 2LFRA 2VQEB 3ZMZA 3JARA 4UXNA 3K5LA 3BABA 4J7KA 4FLXA 5CA1A 1VF7A 1PV0A 1AJNA 2WLLA 5B1NA 4YHHO 4F6RB 1Y74B 2A06H 4OPAA 2JIZG 4DK1A 2HKOA 2GBOA 2OCCB 3F7VC 1LNQA 3TJTA 4X9QA 2AZ2A 1OCZB 1US6A 2XNDG 1GMVA 3A0RA 3K79A 2RJZA 4YIOA 4LFBO 1IZ3A 3JASA 4MS2A 2Q67A 4JAVA 3H1JH 4DV1B 1KQSU 2BOCC 4L8JA 4DR5O 4GKJO 1BCCH 1QR8A 2Z3YA 3OT7A 1J5EB 1VF5B 3UQ8A 2ITDC 1YZBA 3O65A 4JYYA 4DR6B 4B08A 4DR4O 4JI0O 1NT2B 3HKCA 3SPHA 4J41A 1D5NA 2FKXA 3AGZA 1KB9F 4D7SA 5K1PA 4JF3A 5J2TB 3DGEA 4JPRA 3P3PA 3K3WA 3JAKB 2UXCO 4JZ2A 3B77A 1IBKB 4GX0A 4LF6O 2OIEA 1RM1B 3ASOB 3ZHSA 5FNVB 2JJ2G 4J9YB 4OPHA 3SPIA 1Y67A 3K08A 3RYFA 4UVBA 4UCRA 4O2AA 3JD4A 3WB2A 4DW0A 1BGYH 1Q81W 2JK5C 1EBOA 1JMKC 3SDLA 4LFAB 1E79G 1TAEA 4NXMO 2IM9A 4PHZA 1N34O 1KP3A 1R1BA 2DMXA 4X62B 2F66C 1XNRB 2MK3A 1RSOB 1Q86W 2QGNA 4CS3A 1AROP 2CH7A 2KG7B 4I0XB 2GV9A 1AI5A 4X66B 5H2FZ 1DF5A 2UXBB 4MW3A 2LO1A 1KECA 3Q4HB 1M1KW 2ZR2A 3EVKA 4TV8A 4DV4B 3A0BZ 4UVAA 4KHPB 4X8AA 4ZI7B 4RQEA 4KXRA 1SQGA 4FM0A 2R72A 1V55B 2ZXWC 4FLTA 4OX9B 3T1YB 1T5EA 2KQXA 1XMQO 1NLTA 5LXTA 3LSSA 3CCJV 1JFFA 4QGPA 1IURA 1DF4A 3K03A 2QM8A 5JQGB 2LQTA 2QR4A 1S0VA 1SESA 5JJEB 3HKBB 2XAFA 1OJHA 2QKAA 4J42A 3H1KH 1FPOA 5C8YA 3WB0A 2W0XA 1H38A 1AI6A 1EARA 1X4TA 2M7WA 2AHZA 2EILC 5E1AC 4ZHQB 3IFXA 4O4JA 3RYHA 3U10A 4JASA 2XTAA 4MVUA 3CCVV 5LL6Y 1GN4A 3DXRB 1R73A 3CMAV 3B8MA 1O9GA 2RQ6A 2F1MA 5IDJA 1N32O 2CGOA 4W4KA 1BL8A 2Y0IA 5KAFZ 4AILC 1JPXA 2IH1C 1AP5A 4X65B 3TJAA 2ZD9A 2QJ1A 2F93B 1KBHA 5D5QA 2KSDA 3PN1A 5CA0B 2H8PC 2BSKA 3ZMSA 1Z5VA 1UJWB 3D36A 2D3OW 4LWSA 1Y76A 1V9PA 3TJ9A 5LMNB 3UT5A 5JJNB 5JH7A 2DJVA 2Q0OC 3HPLC 3SJCC 2HEPA 1K4CC 3VBBA 2UU9O 1K7DA 3K0GA 3OR6C 2EIJB 1YJWV 4GYCB 1WLEA 3FB5C 4WFAV 2PGGA 2IJHA 5CB4A 1VQOV 4PA4A 1WP8A 1MMMA 2Y0PA 3OEEG 4DV6O 2JVMA 2EJRA 1S72V 3E8GA 5LOVA 2ADPA 4U3JB 1Q6UA 1NH2D 3UKMA 4D6TH 3L70H 3E8BA 2YI9A 4JZGA 3OD4A 3JYCA 2W6IG 4IYHA 3ZX6A 4IL6Z 1ZUQA 4O4IA 5FLXN 4C7UA 3CCEV 2WLHA 4GLXA 4U7NA 2CK3G 4JI5B 3STZC 1N8RW 2ZR3A 3AEIA 4ZKIA 3K5MA 1W0JG 4FM1A 4K3AA 3JAWA 1HP8A 3JARB 1VARA 2GSMB 3ICXA 1VQ6V 5CA1B 1MSWD 2WLLB 2QWOB 3P32A 1VEWA 2LFSA 1B3QA 2ZE5A 1BS3A 3H9VA 1OCZC 3QO8A 4Q6GA 1CEZA 2XAJA 2G38A 4GX5A 3JASB 1JJ2U 3I5DA 2H3OA 2B1GA 3SGIA 2HHHB 3APQA 3BA8A 2L6LA 1ZL8A 5J9PC 1D2DA 5H6RA 3M8AA 3D3IA 4LF7B 3SR2C 4OXSA 4EB6A 2IJIA 4WF9V 4X64O 3HKCB 4DV3B 4FLWA 2DE0X 4G2KA 5KA6A 4NXNB 3GWOA 1FAFA 1GTOA 1BZKA 2ODMA 3CD6V 3L74H 2CDYA 4PI0A 5DECA 4J10A 1YDXA 3K9AA 4FIPC 2YXLA 4H37A 3OGCC 4PI2A 1SS3A 4LFCB 4I4TA 3T1HO 1XEQA 4MTFA 1YVWA 3ABTA 4ZOLA 3WFVA 1BT8A 2AW9A 4LF4B 2JZ8A 3FD9A 1EFRG 4NTWA 5CN0A 4JYCA 4CH4A 1RM1C 3ASOC 4P30A 1MNGA 5EBLC 1JR9A 3RYFB 5H6QA 5L3EA 4B3MB 4O2AB 5IE9A 4TUYA 4BW5A 2PF4E 1IBLO 2XT9A 4IIJA 5LBQA 3UCSC 4MW8A 4UCVA 2Q69A 3W7UA 2WLNA 1G6UA 3SJAC 5KLVH 1VQMV 4FLYA 4XDLA 4N23A 5L3GA 3QG5A 2WLMA 4J7ZA 4I55A 2VQFO 2CH7B 1H8EG 1YI2V 1VQ4V 2M6YA 4DV0B 5KHIA 4DR1O 2ZKOA 5JJJB 3C5XC 4YY3B 1SKVA 3AG7A 2A79B 4KUMA 5GTHZ 5JCOA 1XREA 1R3KC 1VQ7V 4B3RB 4DR7B 3OFNG 1I94O 4TV8B 3CPWU 5DN6G 2UUCB 1MOFA 4AQYO 1XMOO 4H44B 1N4CA 4CH6A 4UFZA 1CP9A 3CX5F 4L87A 5EZYA 4FFBA 1K5SA 1V55C 3E8FA 3AKOB 1SQVH 2XASA 1N36B 4YJ3B 2KKWA 2XOKG 5LXTB 4JI8O 3P3NA 1JFFB 1NTZH 2EZPA 3QTCA 3SPJA 3LDEA 1NBMG 1QLEB 3VQXA 2IH3C 5D5PA 2Y4UA 1K73W 3C90A 3OTOB 3WG7B 5B1OA 5C8YB 4PDVA 5LMUB 3BY6A 4UUJC 4JI2B 4X1KA 1SRYA 3BHPA 5CBGA 2HVKC 2QWRB 2EIKB 2W6JG 2GUZA 3JD0A 5L3DA 4JI1O 3RWRD 4O4JB 3RYHB 1BQZA 1U97A 3ML0A 1DGSA 2JEXA 1NTKH 2UXDB 2WWWA 1COWG 3CHXA 4LC1A 3IC9A 2BOBC 2F95B 1L0LH 4H13B 3CJHA 4AHCA 5KUMA 3APOA 3S3XA 2EJ7A 4NYKA 3CS5A 2JS3A 2JGDA 4UCSA 5KMGA 4XDJA 2NLJC 2EX3A 1RP3B 4TV9A 3CXHF 2O57A 4PV1B 1R3IC 1ENVA 3ZRVA 3U0ZA 3AG3B 4Q20A 4X1IA 3W7TA 2BSKB 1J5EO 3CE2A 2A7WA 1VQKV 1YF2A 4E4EA 1F4MA 3RYCA 5LHIA 5IJ9A 3O9OA 1Y76B 2GHYA 2IJKA 4QE7A 1GM7A 4EKWA 3D3QA 2RNBA 2IJJA 3UT5B 2ODXA 5JH7B 3FYIB 3I38A 3MHHC 1NKDA 1NJIW 1EN6A 3IC7A 2DN9A 3ABMB 3H1IH 2EIJC 1IDSA 3ZRXA 4DV7B 3LDDA 2FYUH 2VRZA 4J9ZB 4X20A 5CB4B 2DW4A 5IYBO 3ZN0A 2CGNA 1KMIZ 5LOVB 2ZM6B 2QA4V 1G4YB 3E83A 2LGQA 1P7BA 1XL6A 1TA8A 1SETA 4GCZA 3OAAG 3JATA 2X6AA 4YIPA 5K1XA 4JI7B 4LFAO 4BWAA 4O4IB 1I7FA 4GZRB 1CPYA 2N04A 4X62O 3FAVA 3NR7A 3VOUA 2PYJA 1QQCA 4FLVA 3JAWB 2RCVA 3CYOA 3G6BA 2P06A 1NH2B 3LZ8A 1NVPD 4DW1A 4JI4O 5BY1A 2QEXV 1IX9A 5LP6A 2DYRC 3K04A 3BPZA 2E5LO 4EEQA 1AR4A 2HP8A 1URFA 4FFKA 5IWAO 4UCTA 4IYIA 4BIZA 2C2AA 5IT9N 3SYOA 4X89A 3GB7C 3OMIB 3QNEA 4DV4O 1Z5WA 3FFQA 2JRRA 2YXYA 4MVMA 4HYOA 4PDLA 1ROPA 4KHPO 3L9DA 4I9WA 4LFBB 1B6QA 1KUQA 3A0HZ 4ABMA 3RGBA 4OX9O 2KB1A 4HBNA 4O2BA 5JWPA 4DYLA 5ITZA 4JI6B 2D2CB 4CBCA 4BAYA 1XL4A 1XUQA 5CBHA 2ZE8A 3TETA 1BHAA 1XOUA 1N33B 5B5EZ 1MSDA 2VS0A 1QVFU 1GH6A 3CB2A 3FKSG 1S77D 1GN3A 4DR4B 1YHQV 2P5OA 1K3EA 5J2UA 2Q73A 3ABLC 4LCUC 2MW2B 1J95A 3KCXA 2YDEA 1SQBH 5HFMA 5KAIZ 1AILA 1S5LZ 4Z1MG 4I4TB 4JAAA 1F51A 3GWKC 4ZOLB 1B06A 5DEDA 5LP6C 2QKSA 4X88A 3G71V 4W4LA 4H33A 1H2NA 1FXKA 1JX9A 1YEWA 4K0KB 3ZHVA 3CRCA 3ZMVA 3BCCH 1GN6A 3CEIA 1SQXH 4NKGB 1PP9H 2LW7A 4FLZA 4TUYB 2QDOA 3CCUV 2K1EA 3ZMUA 1XNQB 4MTOA 1KD1W 4IIJB 3THOA 4CH3A 1H2SB 4FK5C 4FJCC 2UUBO 4X65O 4ZBMA 1N34B 4RQFA 3TXQA 1WB8A 2CE4A 2FB5A 1JJOA 1M57C 1WPXA 4A5UB 4I55B 1YCIA 3SYQA 1HNZB 2JS5A 2XAQA 2VWJA 1M5IA 3E8HA 2F43G 2UXNA 1WA8A 1LUVA 2IW5A 2WLKA 1WNSA 1X59A 3CSXA 2LJ2A 2ZIOA 3ZRWA 1R6NA 3CRMA 3HKDA 2YIBD 1MZFA 2AXTZ 3MDSA 4B3TB 5EZYB 4FFBB 1FXKC 4OGQB 2LGWA 5EIBD 2OTLV 1OCCB 3ZHUA 4YJ2A 3C3SA 5L3FA 2OWOA 5FPOA 1QNMA 1BMFG 1PNMA 3SPGA 4LR3A 1OCOC 3BEHA 4CC5A 1Q8IA 1WB7A 4LNUA 2YIBA 5KA5A 1QLEC 2R9AA 1D5AA 4EFEA 5TISZ 3ZHQA 2QE7G 4I9QA 1EN4A 3LA0A 1FJGO 2QWPB 3WG7C 2P67A 3ETEA 2ITCC 2ILMA 2HR3A 4GX1A 4X1KB 4R50A 2WLIA 3KG2A 2GUZB 4NVPA 4CC6A 2EIKC 2WA4A 4TQDA 1Q7YW 1NR7A 4JTCB 1NS1A 2QTOA 5BMVB 3QF7A 4IT5A 1XQ8A 5H5NA 2QTSA 3CCSV 3CJHB 2PZSA 4TQFA 2VWKA 3UM7A 3S3WA 1WAZA 1M93A 2AGAA 1EN5A 4K8XA 4XBFA 4TV9B 2R70A 4WFBV 2V7QG 5BZBA 2EINC 2ZE6A 1XHXA 4CS4A 4DR2O 2ZIMA 1QCEA 3T1CA 2HHHO 3AG3C 4X1IB 2A9HA 1SQQH 1F7YA 3H01A 2GTSA 3RYCB 4MVSA 4LF7O 2YXHA 4JI3O 4BW9A 3D36C 2F4VB 3T4DA 2PI4A 4YXWG 2DYRB 2FMLA 4NXNO 3ASNB 3J80N 2XAGA 4LP8A 1SZXA 3UO3A 5KHKA 1KC8W 3L73H 3L72H 4J80A 3ABUA 3JD1A 1H8HG 5IY5C 2Q6AA 3LNNA 2Q8VA 3ABMC 3G67A 2QSAA 2BCCH 2DOSA 2UU9B 3WU2Z 4X20B 2HFEC 1DLBA 1S3JA 1Y4MA 3M99B 3TGUH 4K8ZA 3MAQA 2ZNIA 3NXSA 3X2QB 4HZ3A 1S76D 4DV6B 4FMTA 2QKCA 2HG5C 2P22C 3JATB 1NZ6A 1TUBA 3BFRA 1YITV 1M56B 3RN4A 4XDKA 4E2LA 1E1RG 3FAVB 1XDCA 2YIDA 3ABLB 4TT3G 3SYAA 4ASUG 3CC7V 1H2KA 2QWQB 4O4HA 4DV2B 4DV5B 2YUAA 2HLDG 5LYJA 4K35A 1S5HC 2E74B 1HNXB 5EBMC 5LP6B 3H1HH 3CCLV 4I0XA 1HNWO 4LF8B 2IU3A 3OMNB 2P4KA 3OE7G 2DYSB 3ETQA 5E79Z 4JYAB 2UUCO 1AJQA 1R3LC 1NI8A 1VF6A 1GMUA 4MVQA 1NVPB 3HB3B 4WFFA 5B3SB 3J81N 1RPRA 4DR3O 1VQ8V 3H1LH 1N36O 4O4LA 4G27B 4UCOA 4O2BB 4GX2A 1P7GA 5ITZB 1OHHG 1Q6HA 1G8MA 1IXBA 1M4UA 1M57B 2Z0AA 4DUYO 3STLC 1YSCA 2GTAA 4F6EA 4DUZO 3GVMA 1GN2A 2WPDG 5H9CA 4JV5O 2YEVA 5J2UB 4X64B 4LF9B 3AK1A 1BE3H 2RN9A 3OTOO 1EZJA 4CH5A 1FXHA 2XUMA 1WP7A 2E76B 1QLNA 4QPKA 1G1XB 1YXBA 2HJFC 1Z2GA 3JALA 3T1HB 2E75B 1YIJV 4DRXA 1GKFA 5B1BB 2CUGA 1FXKB 2RMKB 4IHJA 1TUEB 4FZ0A 1B04A 5GONA 1AVMA 4R8CA 3FB7C 1VF6C 2FTKA 3AGXA 2N05A 3QO5A 3KKYA 4PA9A 1OCOB 1HR0O 2H94A 3R66A 3B2EE 3KZIZ 2QM4A 3FB6C 2Q7GA 1JVMA 3K59A 1YJNV 3RYIA 4PJ0Z 3AG2C 2EIMC 5BR8B 3LNMB 5KHJA 3OUFA 3CC2V 4ZIBA 1MABG 1SA0A 4I50A 5LA6A 4LF5O 3KCYA 3E2EA 1UFIA 3UO2A 4DR1B 1VP7A 5JCOC 3B4SA 2VQEO 1K4DC 4GKKB 2BE3A 3N2GA 4I5SA 1H2LA 3ZRWB 1Y6XA 3OM3B 1PD3A 3HKDB 5EC1C 4D7TA 1I94B 2NN4A 3NY0A 1L1FA 4R7CA 1R6KA 4DO2A 2YS8A 1JOYA 3J7AU 5IYZA 4U3FH 1TVKA 3AG1B 4DV7O 1Q82W 4YJ2B 1GMWD 1OCCC 3LSUA 4PDRA 2EINB 4KFMA 4JI8B 1GRJA 4DV1O 1BQ0A 4LNUB 3U11A 3AG4C 3K9SA 4NTXA 5KX5A 3ZS8C 2CTPA 2YSUB 5GW7A 3JAMN 1ZSPA 2RDCA 2QLDA 4TWKA 1KYOF 1RPOA 5KHHA 4J7JA 5A9GA 1AI7A 1OZ0A 2WA3A 3R65A 4LWSB 2A0LA 4DR6O 1TGOA 2BTQA 1GMWA 2WLIB 1KU9A 1IVSA 1VQPV 4IGGA 4PA3A 3T2MA 3CXCU 4JI1B 5IY5B 4FPPA 3ABKC 3RW0A 3F7YC 1UPGA 3HR0A 1FYJA 2ZT9B 2L35A 3W7WA 1IBKO 3RBZA 4HNAA 1L8DA 3CP1A 1NR1A 2AHYA 1AP6A 1IBMB 3E22A 5DM6V 1R3JC 2DQ0A 3QVNA 1ZTEA 3DTUB 1H2MA 4B3SB 1KP2A 4JTDB 5EC2C 3ZEDA 4UB6Z 2UUAB 2ZQMA 5CA3A 1GK9A 2YI8A 4MVZA 3ZIAG 1XNRO 2ZCEA 4BIUA 3OUSA 1P49A 4JI6O 2CTQA 3AK2A 3N27A 1GO3F 2OYQA 1N33O 1XAOA 2Y4TA 5EYPA 1XBLA 1JCHA 4FM2A 4RAIA 4X66O 1K9MW 1KKDA 3ASNC 1PNLA 2UXBO 3ETDA 4YHHB 4BR6A 1QR9A 4NTYA 3ZHTA 3W7XA 4X1YA 4GT1A 2XAHA 4CS2A 4UV8A 1I0HA 2PTMA 3X2QC 1U96A 4K0KO 3T1YO 5LGUA 3C3TA 4ICGA 4MSWC 2YIAA 4DR5B 3AGYA 4GKJB 3ZMTA 2ZNJA 1TUBB 1XNQO 3EFFK 1ZAUA 3LDCA 4LBEC 4EB6B 2ATKC 2Q7EA 4WBNA 1WJZA 1M56C 1HDJA 4JI0B 4WFEA 2Q7HA 1YTFD 3FB8C 3TXSA 4UVCA 4O4HB 5JVDA 5LYJB 3A8TA 4QE9A 3ZJZA 2X7RB 3B8NA 4KP4A 4WCEV 1HNZO 3K58A 1MA1A 4U7OA
chains in the Genus database with same CATH topology
2CUGA 2PF4E 4J80A 3TJ9A 3AG7A 1GH6A 2CTQA 3NXZA 1BQ0A 3UCSC 1NZ6A 1WJZA 3LZ8A 2GUZB 2Y4TA 2QSAA 1XAOA 3NY0A 4L3KA 3APOA 1HDJA 2CTPA 2EJ7A 3L9ZA 1FPOA 2DN9A 3TJ8A 1XBLA 2YS8A 3BVOA 1GMVA 2QLDA 2KQXA 3AGXA 2N05A 2QWRB 1EARA 2GUZA 1NLTA 2CTWA 2OCHA 2B26A 2Q2GA 3LA0A 1FAFA 1IURA 2DMXA 1BQZA 2LO1A 4J7ZA 3AGZA 2QWOB 3UO2A 4RWUA 3APQA 4IT5A 2CTRA 2M6YA 1EB0A 1GMWD 3AGYA 2LGWA 2L6LA 2N04A 1N4CA 2QWQB 2QWNB 2QWPB 1C3GA 1GMWA 3UO3A 2YUAA 1GMUA 2Y4UA 3TJAA 3I38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUG A;  2PF4 E;  4J80 A;  3TJ9 A;  3AG7 A;  1GH6 A;  2CTQ A;  3NXZ A;  1BQ0 A;  3UCS C;  1NZ6 A;  1WJZ A;  3LZ8 A;  2GUZ B;  2Y4T A;  2QSA A;  1XAO A;  3NY0 A;  4L3K A;  3APO A;  1HDJ A;  2CTP A;  2EJ7 A;  3L9Z A;  1FPO A;  2DN9 A;  3TJ8 A;  1XBL A;  2YS8 A;  3BVO A;  1GMV A;  2QLD A;  2KQX A;  3AGX A;  2N05 A;  2QWR B;  1EAR A;  2GUZ A;  1NLT A;  2CTW A;  2OCH A;  2B26 A;  2Q2G A;  3LA0 A;  1FAF A;  1IUR A;  2DMX A;  1BQZ A;  2LO1 A;  4J7Z A;  3AGZ A;  2QWO B;  3UO2 A;  4RWU A;  3APQ A;  4IT5 A;  2CTR A;  2M6Y A;  1EB0 A;  1GMW D;  3AGY A;  2LGW A;  2L6L A;  2N04 A;  1N4C A;  2QWQ B;  2QWN B;  2QWP B;  1C3G A;  1GMW A;  3UO3 A;  2YUA A;  1GMU A;  2Y4U A;  3TJA A;  3I38 A; 
#chains in the Genus database with same CATH topology
 2Y69 B;  1N0N A;  4JI4 B;  3EHB B;  4P9P A;  2UXC B;  1EM1 A;  1DTO A;  5LGT A;  2PY5 A;  2E5L B;  3TJ8 A;  2DYS C;  1MZE A;  4LF6 B;  1P84 F;  1PPJ H;  2NNU A;  5IJ0 A;  1AR1 B;  5IWA B;  3SJB C;  3OTF A;  1FFX A;  2YC0 A;  1EB0 A;  2JEU A;  4B3T O;  5B3S C;  2IBZ H;  5AG2 A;  1SQF A;  4O4L B;  4TOI A;  4NXM B;  5BXZ A;  3CME V;  3AG2 B;  2EIM B;  4YJ3 A;  1MG1 A;  1FS0 G;  1V54 C;  3BA9 A;  3D8C A;  3LSQ A;  2EUL A;  1AB3 A;  4RO2 A;  4GUN A;  4RUE A;  2YEV B;  4HAM A;  3F5T A;  3M7M X;  1EZV H;  4MT8 A;  1Q3E A;  2WAM A;  1H2G A;  2PI5 A;  2XHB A;  3CRQ A;  4QJF B;  1Q6I A;  1QVG U;  1N0J A;  2CAZ C;  5LMN O;  3QO7 A;  2Q0A A;  3JAL B;  1OCR B;  5F2V O;  2F23 A;  4DRX B;  2Q68 A;  2DQ3 A;  5B1B C;  1WN7 A;  4IHJ B;  2R9R B;  1SF9 A;  1AI4 A;  2UXX A;  5GON B;  1GMG A;  2LP7 A;  1FFT B;  4MVR A;  5CMU A;  1XMQ B;  4H0L B;  1IXM A;  4TSF G;  3ZN1 A;  4PDM A;  3N2K A;  3RT3 C;  3AG4 B;  3RVY A;  1K97 A;  4CZZ A;  1PM9 A;  3FX7 A;  4NR1 A;  4JTA B;  4LH7 A;  3HKE A;  3RYI B;  3L71 H;  1W59 A;  2UUB B;  2PUS A;  5B1A C;  5C93 A;  5IYD O;  1SA0 B;  3SJQ C;  5A2Q N;  1LR1 A;  3LUT B;  4I50 B;  5LA6 B;  4BIO A;  5LHH A;  4JI5 O;  5LHG A;  2B5U A;  1PNK A;  4N21 A;  3K5O A;  2Q9L A;  1K33 A;  2F4V O;  1L0N H;  3JCU Z;  4JGS A;  3N2G B;  3RFR A;  4KL1 A;  2ZDI A;  3ABK B;  2K9P A;  4JAU A;  1W2B U;  4WFG A;  1JA8 A;  3ZRS A;  1K92 A;  2W0F C;  1SC5 B;  3CWB H;  3K57 A;  2JGD B;  4F6R A;  1Y74 A;  1N32 B;  3VQW A;  5KMG B;  4L3K A;  5IYZ B;  3BVO A;  3JSN A;  2WSS G;  1TVK B;  3I56 V;  3VQY A;  1W0K G;  3AG1 C;  3EXA A;  4UV9 A;  3DC5 A;  3JSL A;  1PKX A;  3G6E V;  2OTJ V;  3I55 V;  1Y66 A;  5KX5 B;  2EZO A;  3PJS K;  3F5W C;  3P30 A;  4PA6 A;  3E35 A;  5CBF A;  5IJ9 B;  5EIB C;  4I7Z B;  2B26 A;  2BTQ B;  1FJG B;  4PEL A;  4QIW F;  4DV3 O;  4AI8 A;  4F4L A;  1QU7 A;  2JRI A;  5LGN A;  1VQ9 V;  1ZX3 A;  2P7T C;  4DV2 O;  4DV5 O;  1SER A;  3B09 A;  4B7E A;  4P2Z A;  2ZDI C;  1HNX O;  2FL4 A;  4LFC O;  5J2T A;  3E86 A;  2HJD A;  4LF4 O;  3AK3 A;  3JAK A;  4LF8 O;  3SPC A;  4HNA B;  2JJ1 G;  1HW7 A;  2NR5 A;  4FVM A;  2CTR A;  2ADQ B;  3E22 B;  2YIC A;  2OCC C;  4JYA O;  3ETG A;  4B3M O;  5FNV A;  1KKC A;  1QHT A;  1Q5O A;  4MTX A;  3MHS C;  3CCR V;  2QM7 A;  4DR2 B;  2DWE C;  3SYC A;  2DWD C;  1HWY A;  1DK1 A;  2Z5U A;  2BTO A;  4FZ1 A;  3RVZ A;  5KHG A;  1C3G A;  3A2F A;  2N74 A;  3ZHR A;  3MD0 A;  3OEH G;  4UB8 Z;  4JYB A;  2IU0 A;  2AZ0 A;  4DV0 O;  1RSO A;  3OR7 C;  3NXZ A;  5EYP B;  3G80 A;  4JI3 B;  4B7K A;  2KG7 A;  1ZLZ A;  5HFL A;  4YY3 O;  4LF9 O;  1VQ5 V;  1E1Q G;  4QNH B;  4B3R O;  2V4D A;  4DR7 O;  3CCM V;  3OGI B;  1WPB A;  1NU1 H;  4RWU A;  3WB1 A;  2WLJ A;  4Z1V A;  4X1Y B;  3Q4H A;  3T4Z A;  1K5Q A;  1NTM H;  3OMA B;  3TCU A;  2JDI G;  3ZBH A;  2ZE7 A;  1A32 A;  1SQP H;  2JGU A;  5L3B A;  3SYP A;  4EFB A;  4MTG A;  1K8A W;  4ZI7 A;  3G4S V;  3E89 A;  5L3C A;  1XIL A;  4G28 B;  2EBO A;  1VIB A;  2ZXW B;  2Q4P A;  3ZCC A;  4R6Z A;  1V54 B;  1VQN V;  2QWN B;  5JQG A;  4WBN B;  2V1D A;  1M9N A;  2JVD A;  4DXW A;  3HKB A;  1O9H A;  1Q43 A;  3FYE B;  5BR8 O;  5EBW C;  5JVD B;  5LMU O;  2OCH A;  4JI2 O;  3W7S A;  3IAY A;  1F4N A;  1SZT A;  1ZL8 B;  4J11 A;  2Y69 C;  2EIL B;  1P4R A;  3K06 A;  1FKA O;  1I5Y A;  2B9Z A;  3K0D A;  2UXD O;  4ZHQ A;  5IYC O;  2HVJ C;  4P9O A;  1GAX A;  2ZIN A;  1HNW B;  4GKK O;  2P4V A;  2ETN A;  1YTF B;  5GTI Z;  5IJ0 B;  3DXR A;  1FXV A;  1JQ0 A;  1FFX B;  1ZWI C;  3IGA C;  3JD2 A;  3JCZ A;  1YJ9 V;  1THZ A;  1NQT A;  2P90 A;  4MVO A;  3OW2 U;  1GM9 A;  1IBL B;  1ORQ C;  4LH6 A;  4DR3 B;  2P6J A;  1Q90 D;  1BHB A;  5B1A B;  4QPJ A;  2OT5 A;  3L9Z A;  2R9I A;  2ARH A;  1R6T A;  4Z2W A;  2VQF B;  4DUY B;  1PL0 A;  5FL7 G;  4DUZ B;  4PD4 F;  3DC6 A;  2GDS A;  1I08 A;  1WA8 B;  1VQL V;  1QBZ A;  5CA0 A;  1S5J A;  4JV5 B;  3VQV A;  4DK0 A;  4FLU A;  2A3Q A;  1XI1 A;  3K5N A;  3JD3 A;  5B66 Z;  3CRA A;  3DSQ A;  1OCR C;  2X6B A;  1RFY A;  1AR5 A;  2Q2G A;  2CTW A;  4WFH A;  2PYL A;  4AQY B;  1XMO B;  5EK0 A;  3CRR A;  1CXZ B;  1AJP A;  5BMV A;  4RUF A;  1FD9 A;  3L75 H;  3CC4 V;  2LW1 A;  2Q5Z A;  3N2K B;  3TK1 A;  2X6C A;  2ZM6 O;  1IBM O;  1LUW A;  1HR0 B;  1F23 A;  3BRC A;  4NB5 A;  1M90 W;  3HKE B;  2B1I A;  4U3J A;  3IJ4 A;  3B40 A;  4B3S O;  1BSM A;  1OV9 A;  3C6E C;  2UUA O;  4JI7 O;  4PA7 A;  1K34 A;  1I5X A;  5KUK A;  1GM8 A;  2OIG A;  2X0L A;  3BAA A;  4UCU A;  4LF5 B;  1VMG A;  5FPR A;  2E3C A;  3CCQ V;  1PL4 A;  2Y48 A;  1XHZ A;  2LFR A;  2VQE B;  3ZMZ A;  3JAR A;  4UXN A;  3K5L A;  3BAB A;  4J7K A;  4FLX A;  5CA1 A;  1VF7 A;  1PV0 A;  1AJN A;  2WLL A;  5B1N A;  4YHH O;  4F6R B;  1Y74 B;  2A06 H;  4OPA A;  2JIZ G;  4DK1 A;  2HKO A;  2GBO A;  2OCC B;  3F7V C;  1LNQ A;  3TJT A;  4X9Q A;  2AZ2 A;  1OCZ B;  1US6 A;  2XND G;  1GMV A;  3A0R A;  3K79 A;  2RJZ A;  4YIO A;  4LFB O;  1IZ3 A;  3JAS A;  4MS2 A;  2Q67 A;  4JAV A;  3H1J H;  4DV1 B;  1KQS U;  2BOC C;  4L8J A;  4DR5 O;  4GKJ O;  1BCC H;  1QR8 A;  2Z3Y A;  3OT7 A;  1J5E B;  1VF5 B;  3UQ8 A;  2ITD C;  1YZB A;  3O65 A;  4JYY A;  4DR6 B;  4B08 A;  4DR4 O;  4JI0 O;  1NT2 B;  3HKC A;  3SPH A;  4J41 A;  1D5N A;  2FKX A;  3AGZ A;  1KB9 F;  4D7S A;  5K1P A;  4JF3 A;  5J2T B;  3DGE A;  4JPR A;  3P3P A;  3K3W A;  3JAK B;  2UXC O;  4JZ2 A;  3B77 A;  1IBK B;  4GX0 A;  4LF6 O;  2OIE A;  1RM1 B;  3ASO B;  3ZHS A;  5FNV B;  2JJ2 G;  4J9Y B;  4OPH A;  3SPI A;  1Y67 A;  3K08 A;  3RYF A;  4UVB A;  4UCR A;  4O2A A;  3JD4 A;  3WB2 A;  4DW0 A;  1BGY H;  1Q81 W;  2JK5 C;  1EBO A;  1JMK C;  3SDL A;  4LFA B;  1E79 G;  1TAE A;  4NXM O;  2IM9 A;  4PHZ A;  1N34 O;  1KP3 A;  1R1B A;  2DMX A;  4X62 B;  2F66 C;  1XNR B;  2MK3 A;  1RSO B;  1Q86 W;  2QGN A;  4CS3 A;  1ARO P;  2CH7 A;  2KG7 B;  4I0X B;  2GV9 A;  1AI5 A;  4X66 B;  5H2F Z;  1DF5 A;  2UXB B;  4MW3 A;  2LO1 A;  1KEC A;  3Q4H B;  1M1K W;  2ZR2 A;  3EVK A;  4TV8 A;  4DV4 B;  3A0B Z;  4UVA A;  4KHP B;  4X8A A;  4ZI7 B;  4RQE A;  4KXR A;  1SQG A;  4FM0 A;  2R72 A;  1V55 B;  2ZXW C;  4FLT A;  4OX9 B;  3T1Y B;  1T5E A;  2KQX A;  1XMQ O;  1NLT A;  5LXT A;  3LSS A;  3CCJ V;  1JFF A;  4QGP A;  1IUR A;  1DF4 A;  3K03 A;  2QM8 A;  5JQG B;  2LQT A;  2QR4 A;  1S0V A;  1SES A;  5JJE B;  3HKB B;  2XAF A;  1OJH A;  2QKA A;  4J42 A;  3H1K H;  1FPO A;  5C8Y A;  3WB0 A;  2W0X A;  1H38 A;  1AI6 A;  1EAR A;  1X4T A;  2M7W A;  2AHZ A;  2EIL C;  5E1A C;  4ZHQ B;  3IFX A;  4O4J A;  3RYH A;  3U10 A;  4JAS A;  2XTA A;  4MVU A;  3CCV V;  5LL6 Y;  1GN4 A;  3DXR B;  1R73 A;  3CMA V;  3B8M A;  1O9G A;  2RQ6 A;  2F1M A;  5IDJ A;  1N32 O;  2CGO A;  4W4K A;  1BL8 A;  2Y0I A;  5KAF Z;  4AIL C;  1JPX A;  2IH1 C;  1AP5 A;  4X65 B;  3TJA A;  2ZD9 A;  2QJ1 A;  2F93 B;  1KBH A;  5D5Q A;  2KSD A;  3PN1 A;  5CA0 B;  2H8P C;  2BSK A;  3ZMS A;  1Z5V A;  1UJW B;  3D36 A;  2D3O W;  4LWS A;  1Y76 A;  1V9P A;  3TJ9 A;  5LMN B;  3UT5 A;  5JJN B;  5JH7 A;  2DJV A;  2Q0O C;  3HPL C;  3SJC C;  2HEP A;  1K4C C;  3VBB A;  2UU9 O;  1K7D A;  3K0G A;  3OR6 C;  2EIJ B;  1YJW V;  4GYC B;  1WLE A;  3FB5 C;  4WFA V;  2PGG A;  2IJH A;  5CB4 A;  1VQO V;  4PA4 A;  1WP8 A;  1MMM A;  2Y0P A;  3OEE G;  4DV6 O;  2JVM A;  2EJR A;  1S72 V;  3E8G A;  5LOV A;  2ADP A;  4U3J B;  1Q6U A;  1NH2 D;  3UKM A;  4D6T H;  3L70 H;  3E8B A;  2YI9 A;  4JZG A;  3OD4 A;  3JYC A;  2W6I G;  4IYH A;  3ZX6 A;  4IL6 Z;  1ZUQ A;  4O4I A;  5FLX N;  4C7U A;  3CCE V;  2WLH A;  4GLX A;  4U7N A;  2CK3 G;  4JI5 B;  3STZ C;  1N8R W;  2ZR3 A;  3AEI A;  4ZKI A;  3K5M A;  1W0J G;  4FM1 A;  4K3A A;  3JAW A;  1HP8 A;  3JAR B;  1VAR A;  2GSM B;  3ICX A;  1VQ6 V;  5CA1 B;  1MSW D;  2WLL B;  2QWO B;  3P32 A;  1VEW A;  2LFS A;  1B3Q A;  2ZE5 A;  1BS3 A;  3H9V A;  1OCZ C;  3QO8 A;  4Q6G A;  1CEZ A;  2XAJ A;  2G38 A;  4GX5 A;  3JAS B;  1JJ2 U;  3I5D A;  2H3O A;  2B1G A;  3SGI A;  2HHH B;  3APQ A;  3BA8 A;  2L6L A;  1ZL8 A;  5J9P C;  1D2D A;  5H6R A;  3M8A A;  3D3I A;  4LF7 B;  3SR2 C;  4OXS A;  4EB6 A;  2IJI A;  4WF9 V;  4X64 O;  3HKC B;  4DV3 B;  4FLW A;  2DE0 X;  4G2K A;  5KA6 A;  4NXN B;  3GWO A;  1FAF A;  1GTO A;  1BZK A;  2ODM A;  3CD6 V;  3L74 H;  2CDY A;  4PI0 A;  5DEC A;  4J10 A;  1YDX A;  3K9A A;  4FIP C;  2YXL A;  4H37 A;  3OGC C;  4PI2 A;  1SS3 A;  4LFC B;  4I4T A;  3T1H O;  1XEQ A;  4MTF A;  1YVW A;  3ABT A;  4ZOL A;  3WFV A;  1BT8 A;  2AW9 A;  4LF4 B;  2JZ8 A;  3FD9 A;  1EFR G;  4NTW A;  5CN0 A;  4JYC A;  4CH4 A;  1RM1 C;  3ASO C;  4P30 A;  1MNG A;  5EBL C;  1JR9 A;  3RYF B;  5H6Q A;  5L3E A;  4B3M B;  4O2A B;  5IE9 A;  4TUY A;  4BW5 A;  2PF4 E;  1IBL O;  2XT9 A;  4IIJ A;  5LBQ A;  3UCS C;  4MW8 A;  4UCV A;  2Q69 A;  3W7U A;  2WLN A;  1G6U A;  3SJA C;  5KLV H;  1VQM V;  4FLY A;  4XDL A;  4N23 A;  5L3G A;  3QG5 A;  2WLM A;  4J7Z A;  4I55 A;  2VQF O;  2CH7 B;  1H8E G;  1YI2 V;  1VQ4 V;  2M6Y A;  4DV0 B;  5KHI A;  4DR1 O;  2ZKO A;  5JJJ B;  3C5X C;  4YY3 B;  1SKV A;  3AG7 A;  2A79 B;  4KUM A;  5GTH Z;  5JCO A;  1XRE A;  1R3K C;  1VQ7 V;  4B3R B;  4DR7 B;  3OFN G;  1I94 O;  4TV8 B;  3CPW U;  5DN6 G;  2UUC B;  1MOF A;  4AQY O;  1XMO O;  4H44 B;  1N4C A;  4CH6 A;  4UFZ A;  1CP9 A;  3CX5 F;  4L87 A;  5EZY A;  4FFB A;  1K5S A;  1V55 C;  3E8F A;  3AKO B;  1SQV H;  2XAS A;  1N36 B;  4YJ3 B;  2KKW A;  2XOK G;  5LXT B;  4JI8 O;  3P3N A;  1JFF B;  1NTZ H;  2EZP A;  3QTC A;  3SPJ A;  3LDE A;  1NBM G;  1QLE B;  3VQX A;  2IH3 C;  5D5P A;  2Y4U A;  1K73 W;  3C90 A;  3OTO B;  3WG7 B;  5B1O A;  5C8Y B;  4PDV A;  5LMU B;  3BY6 A;  4UUJ C;  4JI2 B;  4X1K A;  1SRY A;  3BHP A;  5CBG A;  2HVK C;  2QWR B;  2EIK B;  2W6J G;  2GUZ A;  3JD0 A;  5L3D A;  4JI1 O;  3RWR D;  4O4J B;  3RYH B;  1BQZ A;  1U97 A;  3ML0 A;  1DGS A;  2JEX A;  1NTK H;  2UXD B;  2WWW A;  1COW G;  3CHX A;  4LC1 A;  3IC9 A;  2BOB C;  2F95 B;  1L0L H;  4H13 B;  3CJH A;  4AHC A;  5KUM A;  3APO A;  3S3X A;  2EJ7 A;  4NYK A;  3CS5 A;  2JS3 A;  2JGD A;  4UCS A;  5KMG A;  4XDJ A;  2NLJ C;  2EX3 A;  1RP3 B;  4TV9 A;  3CXH F;  2O57 A;  4PV1 B;  1R3I C;  1ENV A;  3ZRV A;  3U0Z A;  3AG3 B;  4Q20 A;  4X1I A;  3W7T A;  2BSK B;  1J5E O;  3CE2 A;  2A7W A;  1VQK V;  1YF2 A;  4E4E A;  1F4M A;  3RYC A;  5LHI A;  5IJ9 A;  3O9O A;  1Y76 B;  2GHY A;  2IJK A;  4QE7 A;  1GM7 A;  4EKW A;  3D3Q A;  2RNB A;  2IJJ A;  3UT5 B;  2ODX A;  5JH7 B;  3FYI B;  3I38 A;  3MHH C;  1NKD A;  1NJI W;  1EN6 A;  3IC7 A;  2DN9 A;  3ABM B;  3H1I H;  2EIJ C;  1IDS A;  3ZRX A;  4DV7 B;  3LDD A;  2FYU H;  2VRZ A;  4J9Z B;  4X20 A;  5CB4 B;  2DW4 A;  5IYB O;  3ZN0 A;  2CGN A;  1KMI Z;  5LOV B;  2ZM6 B;  2QA4 V;  1G4Y B;  3E83 A;  2LGQ A;  1P7B A;  1XL6 A;  1TA8 A;  1SET A;  4GCZ A;  3OAA G;  3JAT A;  2X6A A;  4YIP A;  5K1X A;  4JI7 B;  4LFA O;  4BWA A;  4O4I B;  1I7F A;  4GZR B;  1CPY A;  2N04 A;  4X62 O;  3FAV A;  3NR7 A;  3VOU A;  2PYJ A;  1QQC A;  4FLV A;  3JAW B;  2RCV A;  3CYO A;  3G6B A;  2P06 A;  1NH2 B;  3LZ8 A;  1NVP D;  4DW1 A;  4JI4 O;  5BY1 A;  2QEX V;  1IX9 A;  5LP6 A;  2DYR C;  3K04 A;  3BPZ A;  2E5L O;  4EEQ A;  1AR4 A;  2HP8 A;  1URF A;  4FFK A;  5IWA O;  4UCT A;  4IYI A;  4BIZ A;  2C2A A;  5IT9 N;  3SYO A;  4X89 A;  3GB7 C;  3OMI B;  3QNE A;  4DV4 O;  1Z5W A;  3FFQ A;  2JRR A;  2YXY A;  4MVM A;  4HYO A;  4PDL A;  1ROP A;  4KHP O;  3L9D A;  4I9W A;  4LFB B;  1B6Q A;  1KUQ A;  3A0H Z;  4ABM A;  3RGB A;  4OX9 O;  2KB1 A;  4HBN A;  4O2B A;  5JWP A;  4DYL A;  5ITZ A;  4JI6 B;  2D2C B;  4CBC A;  4BAY A;  1XL4 A;  1XUQ A;  5CBH A;  2ZE8 A;  3TET A;  1BHA A;  1XOU A;  1N33 B;  5B5E Z;  1MSD A;  2VS0 A;  1QVF U;  1GH6 A;  3CB2 A;  3FKS G;  1S77 D;  1GN3 A;  4DR4 B;  1YHQ V;  2P5O A;  1K3E A;  5J2U A;  2Q73 A;  3ABL C;  4LCU C;  2MW2 B;  1J95 A;  3KCX A;  2YDE A;  1SQB H;  5HFM A;  5KAI Z;  1AIL A;  1S5L Z;  4Z1M G;  4I4T B;  4JAA A;  1F51 A;  3GWK C;  4ZOL B;  1B06 A;  5DED A;  5LP6 C;  2QKS A;  4X88 A;  3G71 V;  4W4L A;  4H33 A;  1H2N A;  1FXK A;  1JX9 A;  1YEW A;  4K0K B;  3ZHV A;  3CRC A;  3ZMV A;  3BCC H;  1GN6 A;  3CEI A;  1SQX H;  4NKG B;  1PP9 H;  2LW7 A;  4FLZ A;  4TUY B;  2QDO A;  3CCU V;  2K1E A;  3ZMU A;  1XNQ B;  4MTO A;  1KD1 W;  4IIJ B;  3THO A;  4CH3 A;  1H2S B;  4FK5 C;  4FJC C;  2UUB O;  4X65 O;  4ZBM A;  1N34 B;  4RQF A;  3TXQ A;  1WB8 A;  2CE4 A;  2FB5 A;  1JJO A;  1M57 C;  1WPX A;  4A5U B;  4I55 B;  1YCI A;  3SYQ A;  1HNZ B;  2JS5 A;  2XAQ A;  2VWJ A;  1M5I A;  3E8H A;  2F43 G;  2UXN A;  1WA8 A;  1LUV A;  2IW5 A;  2WLK A;  1WNS A;  1X59 A;  3CSX A;  2LJ2 A;  2ZIO A;  3ZRW A;  1R6N A;  3CRM A;  3HKD A;  2YIB D;  1MZF A;  2AXT Z;  3MDS A;  4B3T B;  5EZY B;  4FFB B;  1FXK C;  4OGQ B;  2LGW A;  5EIB D;  2OTL V;  1OCC B;  3ZHU A;  4YJ2 A;  3C3S A;  5L3F A;  2OWO A;  5FPO A;  1QNM A;  1BMF G;  1PNM A;  3SPG A;  4LR3 A;  1OCO C;  3BEH A;  4CC5 A;  1Q8I A;  1WB7 A;  4LNU A;  2YIB A;  5KA5 A;  1QLE C;  2R9A A;  1D5A A;  4EFE A;  5TIS Z;  3ZHQ A;  2QE7 G;  4I9Q A;  1EN4 A;  3LA0 A;  1FJG O;  2QWP B;  3WG7 C;  2P67 A;  3ETE A;  2ITC C;  2ILM A;  2HR3 A;  4GX1 A;  4X1K B;  4R50 A;  2WLI A;  3KG2 A;  2GUZ B;  4NVP A;  4CC6 A;  2EIK C;  2WA4 A;  4TQD A;  1Q7Y W;  1NR7 A;  4JTC B;  1NS1 A;  2QTO A;  5BMV B;  3QF7 A;  4IT5 A;  1XQ8 A;  5H5N A;  2QTS A;  3CCS V;  3CJH B;  2PZS A;  4TQF A;  2VWK A;  3UM7 A;  3S3W A;  1WAZ A;  1M93 A;  2AGA A;  1EN5 A;  4K8X A;  4XBF A;  4TV9 B;  2R70 A;  4WFB V;  2V7Q G;  5BZB A;  2EIN C;  2ZE6 A;  1XHX A;  4CS4 A;  4DR2 O;  2ZIM A;  1QCE A;  3T1C A;  2HHH O;  3AG3 C;  4X1I B;  2A9H A;  1SQQ H;  1F7Y A;  3H01 A;  2GTS A;  3RYC B;  4MVS A;  4LF7 O;  2YXH A;  4JI3 O;  4BW9 A;  3D36 C;  2F4V B;  3T4D A;  2PI4 A;  4YXW G;  2DYR B;  2FML A;  4NXN O;  3ASN B;  3J80 N;  2XAG A;  4LP8 A;  1SZX A;  3UO3 A;  5KHK A;  1KC8 W;  3L73 H;  3L72 H;  4J80 A;  3ABU A;  3JD1 A;  1H8H G;  5IY5 C;  2Q6A A;  3LNN A;  2Q8V A;  3ABM C;  3G67 A;  2QSA A;  2BCC H;  2DOS A;  2UU9 B;  3WU2 Z;  4X20 B;  2HFE C;  1DLB A;  1S3J A;  1Y4M A;  3M99 B;  3TGU H;  4K8Z A;  3MAQ A;  2ZNI A;  3NXS A;  3X2Q B;  4HZ3 A;  1S76 D;  4DV6 B;  4FMT A;  2QKC A;  2HG5 C;  2P22 C;  3JAT B;  1NZ6 A;  1TUB A;  3BFR A;  1YIT V;  1M56 B;  3RN4 A;  4XDK A;  4E2L A;  1E1R G;  3FAV B;  1XDC A;  2YID A;  3ABL B;  4TT3 G;  3SYA A;  4ASU G;  3CC7 V;  1H2K A;  2QWQ B;  4O4H A;  4DV2 B;  4DV5 B;  2YUA A;  2HLD G;  5LYJ A;  4K35 A;  1S5H C;  2E74 B;  1HNX B;  5EBM C;  5LP6 B;  3H1H H;  3CCL V;  4I0X A;  1HNW O;  4LF8 B;  2IU3 A;  3OMN B;  2P4K A;  3OE7 G;  2DYS B;  3ETQ A;  5E79 Z;  4JYA B;  2UUC O;  1AJQ A;  1R3L C;  1NI8 A;  1VF6 A;  1GMU A;  4MVQ A;  1NVP B;  3HB3 B;  4WFF A;  5B3S B;  3J81 N;  1RPR A;  4DR3 O;  1VQ8 V;  3H1L H;  1N36 O;  4O4L A;  4G27 B;  4UCO A;  4O2B B;  4GX2 A;  1P7G A;  5ITZ B;  1OHH G;  1Q6H A;  1G8M A;  1IXB A;  1M4U A;  1M57 B;  2Z0A A;  4DUY O;  3STL C;  1YSC A;  2GTA A;  4F6E A;  4DUZ O;  3GVM A;  1GN2 A;  2WPD G;  5H9C A;  4JV5 O;  2YEV A;  5J2U B;  4X64 B;  4LF9 B;  3AK1 A;  1BE3 H;  2RN9 A;  3OTO O;  1EZJ A;  4CH5 A;  1FXH A;  2XUM A;  1WP7 A;  2E76 B;  1QLN A;  4QPK A;  1G1X B;  1YXB A;  2HJF C;  1Z2G A;  3JAL A;  3T1H B;  2E75 B;  1YIJ V;  4DRX A;  1GKF A;  5B1B B;  2CUG A;  1FXK B;  2RMK B;  4IHJ A;  1TUE B;  4FZ0 A;  1B04 A;  5GON A;  1AVM A;  4R8C A;  3FB7 C;  1VF6 C;  2FTK A;  3AGX A;  2N05 A;  3QO5 A;  3KKY A;  4PA9 A;  1OCO B;  1HR0 O;  2H94 A;  3R66 A;  3B2E E;  3KZI Z;  2QM4 A;  3FB6 C;  2Q7G A;  1JVM A;  3K59 A;  1YJN V;  3RYI A;  4PJ0 Z;  3AG2 C;  2EIM C;  5BR8 B;  3LNM B;  5KHJ A;  3OUF A;  3CC2 V;  4ZIB A;  1MAB G;  1SA0 A;  4I50 A;  5LA6 A;  4LF5 O;  3KCY A;  3E2E A;  1UFI A;  3UO2 A;  4DR1 B;  1VP7 A;  5JCO C;  3B4S A;  2VQE O;  1K4D C;  4GKK B;  2BE3 A;  3N2G A;  4I5S A;  1H2L A;  3ZRW B;  1Y6X A;  3OM3 B;  1PD3 A;  3HKD B;  5EC1 C;  4D7T A;  1I94 B;  2NN4 A;  3NY0 A;  1L1F A;  4R7C A;  1R6K A;  4DO2 A;  2YS8 A;  1JOY A;  3J7A U;  5IYZ A;  4U3F H;  1TVK A;  3AG1 B;  4DV7 O;  1Q82 W;  4YJ2 B;  1GMW D;  1OCC C;  3LSU A;  4PDR A;  2EIN B;  4KFM A;  4JI8 B;  1GRJ A;  4DV1 O;  1BQ0 A;  4LNU B;  3U11 A;  3AG4 C;  3K9S A;  4NTX A;  5KX5 A;  3ZS8 C;  2CTP A;  2YSU B;  5GW7 A;  3JAM N;  1ZSP A;  2RDC A;  2QLD A;  4TWK A;  1KYO F;  1RPO A;  5KHH A;  4J7J A;  5A9G A;  1AI7 A;  1OZ0 A;  2WA3 A;  3R65 A;  4LWS B;  2A0L A;  4DR6 O;  1TGO A;  2BTQ A;  1GMW A;  2WLI B;  1KU9 A;  1IVS A;  1VQP V;  4IGG A;  4PA3 A;  3T2M A;  3CXC U;  4JI1 B;  5IY5 B;  4FPP A;  3ABK C;  3RW0 A;  3F7Y C;  1UPG A;  3HR0 A;  1FYJ A;  2ZT9 B;  2L35 A;  3W7W A;  1IBK O;  3RBZ A;  4HNA A;  1L8D A;  3CP1 A;  1NR1 A;  2AHY A;  1AP6 A;  1IBM B;  3E22 A;  5DM6 V;  1R3J C;  2DQ0 A;  3QVN A;  1ZTE A;  3DTU B;  1H2M A;  4B3S B;  1KP2 A;  4JTD B;  5EC2 C;  3ZED A;  4UB6 Z;  2UUA B;  2ZQM A;  5CA3 A;  1GK9 A;  2YI8 A;  4MVZ A;  3ZIA G;  1XNR O;  2ZCE A;  4BIU A;  3OUS A;  1P49 A;  4JI6 O;  2CTQ A;  3AK2 A;  3N27 A;  1GO3 F;  2OYQ A;  1N33 O;  1XAO A;  2Y4T A;  5EYP A;  1XBL A;  1JCH A;  4FM2 A;  4RAI A;  4X66 O;  1K9M W;  1KKD A;  3ASN C;  1PNL A;  2UXB O;  3ETD A;  4YHH B;  4BR6 A;  1QR9 A;  4NTY A;  3ZHT A;  3W7X A;  4X1Y A;  4GT1 A;  2XAH A;  4CS2 A;  4UV8 A;  1I0H A;  2PTM A;  3X2Q C;  1U96 A;  4K0K O;  3T1Y O;  5LGU A;  3C3T A;  4ICG A;  4MSW C;  2YIA A;  4DR5 B;  3AGY A;  4GKJ B;  3ZMT A;  2ZNJ A;  1TUB B;  1XNQ O;  3EFF K;  1ZAU A;  3LDC A;  4LBE C;  4EB6 B;  2ATK C;  2Q7E A;  4WBN A;  1WJZ A;  1M56 C;  1HDJ A;  4JI0 B;  4WFE A;  2Q7H A;  1YTF D;  3FB8 C;  3TXS A;  4UVC A;  4O4H B;  5JVD A;  5LYJ B;  3A8T A;  4QE9 A;  3ZJZ A;  2X7R B;  3B8N A;  4KP4 A;  4WCE V;  1HNZ O;  3K58 A;  1MA1 A;  4U7O A; 
#chains in the Genus database with same CATH homology
 2CUG A;  2PF4 E;  4J80 A;  3TJ9 A;  3AG7 A;  1GH6 A;  2CTQ A;  3NXZ A;  1BQ0 A;  3UCS C;  1NZ6 A;  1WJZ A;  3LZ8 A;  2GUZ B;  2Y4T A;  2QSA A;  1XAO A;  3NY0 A;  4L3K A;  3APO A;  1HDJ A;  2CTP A;  2EJ7 A;  3L9Z A;  1FPO A;  2DN9 A;  3TJ8 A;  1XBL A;  2YS8 A;  3BVO A;  1GMV A;  2QLD A;  2KQX A;  3AGX A;  2N05 A;  2QWR B;  1EAR A;  2GUZ A;  1NLT A;  2CTW A;  2OCH A;  2B26 A;  2Q2G A;  3LA0 A;  1FAF A;  1IUR A;  2DMX A;  1BQZ A;  2LO1 A;  4J7Z A;  3AGZ A;  2QWO B;  3UO2 A;  4RWU A;  3APQ A;  4IT5 A;  2CTR A;  2M6Y A;  1EB0 A;  1GMW D;  3AGY A;  2LGW A;  2L6L A;  2N04 A;  1N4C A;  2QWQ B;  2QWN B;  2QWP B;  1C3G A;  1GMW A;  3UO3 A;  2YUA A;  1GMU A;  2Y4U A;  3TJA A;  3I38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...