4J80A

Thermus thermophilus dnaj
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
271
structure length
271
Chain Sequence
AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVMSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGKGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRMPPGVREGSVIRVPGMGGQGNPPGDLLLVVRMLPHPVFRLEGQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKMRLKGGGFPGPAGRGDLYLEVRITIPERLTPEEEALWKKLAEAYYAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining crystallography and EPR: crystal and solution structures of the multidomain cochaperone DnaJ.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein DnaJ 2
total genus 62
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF01556 DnaJ_C DnaJ C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4j80A01
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A02
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A03
1GH6A 2LO1A 1BQZA 3LZ8A 3BVOA 3UO2A 3TJAA 2L6LA 1EARA 2QWRB 3LA0A 3TJ8A 2LGWA 3NXZA 2CTQA 2OCHA 1GMWA 3TJ9A 3UO3A 2M6YA 2Y4TA 4IT5A 2Q2GA 2QWPB 2CTRA 4J80A 3APQA 2QLDA 1GMWD 1NZ6A 4J7ZA 1BQ0A 1IURA 1FPOA 2Y4UA 2YS8A 1N4CA 1WJZA 4L3KA 1C3GA 1GMVA 1FAFA 2N05A 2CTWA 2GUZB 2QWNB 4RWUA 3AGXA 2CTPA 2GUZA 2PF4E 3APOA 3UCSC 2DMXA 2KQXA 2YUAA 1HDJA 1XAOA 3AG7A 3NY0A 1GMUA 2EJ7A 2QWOB 1NLTA 2DN9A 3AGZA 3AGYA 3L9ZA 2CUGA 1EB0A 2QWQB 2N04A 3I38A 1XBLA 2QSAA 2B26A
chains in the Genus database with same CATH superfamily
3DXRA 2ITCC 2P06A 4DV6O 2M6YA 4L87A 2UUAO 2O57A 3JSLA 4I55A 4DW0A 4OX9O 4DR4O 5B3SB 4BW9A 1A32A 2RNBA 1I94O 4ZKIA 4JPRA 3LSQA 2ZIMA 1K97A 4JAVA 4JGSA 2QWOB 3MAQA 1AB3A 4PA9A 2ODMA 1MZFA 1K4CC 3OMIB 3KZIZ 2JVMA 2X6CA 5L3CA 2F4VO 1NU1H 3SJCC 1OCRC 2WLNA 5CA0B 1K5QA 4TQFA 3X2QC 2ZXWC 4DK1A 4MTGA 4ICGA 2KKWA 3IC9A 5LP6A 1HNZO 3ABUA 1KKCA 1XNRB 4UB6Z 2R9RB 3BABA 2EZOA 4JTCB 3G4SV 3N2KB 3E83A 1QCEA 4R6ZA 5IWAB 1YJNV 3IFXA 1WA8A 4B3TB 1YTFB 3B09A 1OCOC 3A0RA 2X0LA 1LUVA 3CP1A 1WPBA 2OIGA 3CXCU 3OEHG 4TQDA 3D3IA 2BTQA 4RUFA 3AK2A 3OTFA 4NVPA 3CC4V 3HB3B 2GTSA 4LBEC 1YI2V 4NTYA 1FXVA 4X89A 5ITZB 1S77D 2QWPB 5CA1A 3K06A 2QLDA 1B6QA 1WJZA 1KP2A 3CYOA 5IYDO 4DV2B 1CXZB 4XBFA 1LNQA 5LBQA 3CEIA 3RYCA 1V55C 3M7MX 3RYFB 1GTOA 2QE7G 3SYQA 2NNUA 5C8YA 3UO2A 4CH6A 3SPJA 1EM1A 3MHHC 2H8PC 5LHIA 4I55B 1ZLZA 1SS3A 1FKAO 3RWRD 4AQYB 2EJ7A 1IDSA 3CSXA 4DXWA 4C7UA 3I5DA 4PA6A 2ZCEA 4J80A 2YC0A 1ZL8B 1B06A 3LDDA 5IDJA 4B3RB 5EC1C 3A0BZ 1AJNA 2E3CA 4MW8A 5KHHA 4PJ0Z 3CJHB 5CB4B 1L1FA 1GM9A 1FJGO 2F43G 2P90A 3RYFA 1JJOA 4TWKA 4DR2O 2QGNA 1YTFD 1S3JA 5LGUA 4DR6B 1S76D 1BHBA 5D5QA 3K08A 4DV4B 3K5LA 3A8TA 3ZHRA 1C3GA 5JWPA 3QO8A 1R6KA 3APOA 3QTCA 2GBOA 4NTXA 3PN1A 3B2EE 1FFXB 1AR4A 1Q8IA 1D5AA 1SQQH 3W7TA 2DE0X 1OJHA 1XL6A 4MS2A 5J2UA 3F5TA 5EIBD 1SETA 1NS1A 5IJ0A 2ZE6A 2XOKG 4WFGA 3CXHF 1VQ9V 2ZDIC 2QDOA 3L71H 4JASA 3N2GB 2W0FC 2OIEA 4UVCA 4JI6B 4TV9B 2R9AA 1AROP 1U97A 4X88A 4HZ3A 3NR7A 4FFBA 4FLXA 3RYCB 2IJIA 2PI4A 3U11A 3OGIB 1FFXA 3K0DA 4JF3A 1N34O 5JCOC 5EIBC 3M8AA 1Y4MA 2UXBO 1Y66A 4JI8B 1EB0A 3MHSC 1R3LC 1MSDA 3K57A 1SZTA 4DR2B 5GTHZ 2PUSA 3WFVA 4DV5B 4OXSA 1BZKA 1WLEA 1W2BU 3TK1A 1VQ4V 4I0XB 2CGOA 2EIKB 1WB7A 3VQVA 1P7GA 2GV9A 4FK5C 4B08A 2UU9O 5KHGA 4HYOA 4F4LA 4JV5O 4AILC 2JRIA 4EFBA 2CTPA 2DMXA 2HVKC 3SGIA 3RYIB 2KSDA 3BHPA 4QGPA 1ZL8A 2YI9A 2VRZA 3KKYA 5L3DA 4DO2A 4LNUA 4QE7A 4XDJA 2DQ0A 3ZEDA 5LP6B 1AR1B 2VWKA 1P4RA 1Z5WA 3N27A 3BPZA 2DJVA 1XREA 1RM1C 3UQ8A 1FXKC 3I55V 4K3AA 2WSSG 4LF6O 4OPHA 3N2KA 2N74A 1FXHA 5EC2C 1NT2B 4OPAA 2ZR3A 5KUMA 3AG3B 1R3KC 3ASOB 1BGYH 4E2LA 2Y4TA 1NR1A 2EIJC 3R66A 4JI5B 3OR7C 4JZGA 2XAHA 3O9OA 3ABLB 2JS3A 4JZ2A 5FLXN 1QR9A 4I4TA 4JI8O 3H9VA 5IYZB 2XAQA 2IH3C 3DTUB 4P9OA 1GN6A 2YIAA 2LGQA 2JZ8A 4N21A 4PA4A 2W6IG 4KL1A 2IH1C 4X65B 3CCMV 5BR8B 4LF8O 4CH4A 4J7ZA 2BOCC 2YIBD 4I50B 1X59A 4KFMA 2GUZB 3AGXA 3B40A 4X66O 2ZQMA 3QVNA 5FPRA 4RQEA 2B1IA 5K1XA 1VQ5V 2EINB 3WU2Z 4XDLA 3TJTA 2LW1A 3CPWU 2JJ2G 4MVSA 2ZNIA 1F4MA 1VF6C 4FZ0A 1XHXA 1SESA 3BAAA 2WLLA 4QIWF 1TA8A 3AG1C 4U3JB 3A2FA 1JA8A 1TVKA 1T5EA 5TISZ 4LFAB 4I7ZB 4I5SA 5EYPB 5IYCO 2IU0A 1GK9A 4J42A 5CBGA 4J7JA 4IIJA 3JCZA 5GONA 2YXLA 2QA4V 2V4DA 1PL4A 1GAXA 2YDEA 3TGUH 2BSKA 1MABG 4O2BB 1NLTA 1P49A 4Z1MG 2ZE5A 3H01A 4UFZA 1XMOB 1IVSA 4TUYA 5L3EA 4G2KA 3TJAA 1WN7A 1KYOF 1H2KA 2NR5A 2OCHA 2XASA 2YEVA 1BSMA 1ZTEA 1YF2A 3A0HZ 1QQCA 3SJAC 1EN4A 1JCHA 2QKCA 5E79Z 3UM7A 4A5UB 4DUZO 3HKCA 4WBNB 2L6LA 2DQ3A 1IBMO 4JI4O 2H3OA 1SQVH 5FPOA 1XEQA 3L75H 3ZMVA 4R7CA 1TUEB 3BA9A 1H38A 3E86A 2XT9A 1M56C 4TV9A 1MSWD 1I08A 4DV0O 3ZRXA 2UUCB 2CUGA 1NH2B 3SYAA 1IBLO 2DWEC 2B26A 3OT7A 5KX5A 3O65A 1KU9A 3J7AU 2CH7B 1D5NA 4MVUA 2AZ0A 3B8MA 1B04A 2OCCB 1H8EG 4PA3A 5H6QA 4JI0O 4DV7B 2N05A 2PF4E 2LFRA 4E4EA 2H94A 2WLLB 5KHJA 1RSOB 2UXBB 2HR3A 4GKKB 1GN3A 4NKGB 2HKOA 1VMGA 2EJRA 2BCCH 1BCCH 2EIKC 5J9PC 5IYBO 5B3SC 4H13B 3K59A 1Q86W 2Y4UA 1VQOV 2WLIA 1M90W 4CS2A 4ZI7A 4H0LB 4BIUA 2UXCB 2KB1A 4UCVA 2Q0AA 3FFQA 3JYCA 5LMUB 4D7SA 2A3QA 1IBMB 1PD3A 1SQBH 4FIPC 5JJJB 1EARA 2QWRB 3OMNB 1GMWA 1BE3H 2EILB 4LF4O 5DECA 2XTAA 1VIBA 3C3SA 3J80N 2CGNA 3CMEV 4H33A 3RVYA 1XI1A 3OAAG 1AR5A 3CCSV 4DR1O 5IY5B 1SQGA 3RT3C 5DEDA 3QG5A 4BAYA 4QE9A 4D7TA 3P30A 4MW3A 1IX9A 4DV3B 2HFEC 4LNUB 4U7OA 1LR1A 3T2MA 3G67A 3M99B 4UCOA 3BEHA 4AI8A 2YS8A 1JFFB 2EX3A 3JASA 1AI5A 4DR7B 4X64O 4TUYB 4NXNO 2HLDG 3SJQC 5B1BC 2JK5C 1YZBA 3VQWA 5JVDB 3CRAA 4O2BA 3MD0A 3FB7C 5KX5B 4P2ZA 2YXYA 5LXTB 1UFIA 3FAVA 5J2TB 4MSWC 1N0JA 1AVMA 2ZM6O 4PDRA 4PI2A 3H1HH 5CA3A 3ZRVA 3OEEG 5FL7G 2YXHA 4TSFG 4TT3G 1P84F 3E8GA 5KMGA 4X8AA 4DYLA 1XMOO 3D36C 4Z2WA 2Q4PA 4I0XA 1EBOA 5B1AC 3JAWB 2AGAA 1TVKB 4BIZA 1BS3A 3AKOB 1MOFA 3CCRV 1XMQO 3D3QA 1L0LH 5KA6A 4O4IA 1AI6A 2QKSA 2EZPA 3QO7A 4DR1B 2EULA 4BWAA 1N36B 4R8CA 4JYCA 3OMAB 2P4KA 5H2FZ 3CC7V 3NY0A 2UXXA 1WAZA 2FL4A 2EBOA 2XUMA 3K79A 4QJFB 3AGZA 5EYPA 1CPYA 2R9IA 2ZE7A 1E1QG 2DW4A 4KXRA 4GX2A 1PV0A 1ORQC 4J7KA 3H1KH 4JI4B 1N0NA 1FXKA 1AI4A 4LP8A 1I5XA 1Q3EA 3LUTB 1F7YA 2IU3A 1KECA 4YIOA 4DR7O 5LA6A 4DR3B 1QNMA 4AHCA 2YUAA 3AG7A 3EXAA 3OR6C 4NB5A 3JCUZ 4UV9A 2WLHA 3G71V 1QLNA 3K5OA 4Q20A 5LL6Y 3RYIA 1HWYA 4LH6A 3QNEA 2JGDA 3RYHB 1YVWA 1H2LA 1NTMH 2WPDG 3OTOO 3SDLA 2EINC 3VQYA 2BTOA 5KA5A 1SRYA 1Y67A 3K0GA 1JPXA 1XUQA 4GKKO 4W4KA 2A7WA 3JD0A 4TOIA 2JGUA 2QEXV 4QNHB 1O9GA 2OCCC 2WLKA 1N32O 4JI3O 1M4UA 4KUMA 4MVOA 3L70H 1YSCA 4CH5A 3LSUA 1PM9A 1IBLB 4NXMB 4GT1A 2BTQB 1M56B 2JEXA 2RJZA 2PGGA 5B1NA 5B66Z 1O9HA 4PDLA 4I4TB 1KC8W 1IURA 3SYPA 1GKFA 5LMNB 2FMLA 1GM7A 3ASOC 2QM7A 2JJ1G 1ZWIC 1F23A 2Z0AA 1RPOA 2JIZG 1THZA 1PNKA 1ZSPA 2ODXA 1WP8A 4I9WA 4FFKA 2WLMA 1RM1B 3E8HA 3UO3A 3CCJV 4IT5A 3CE2A 5C8YB 5FNVA 4U3FH 5IY5C 5F2VO 5LHGA 1HNZB 1MA1A 1NI8A 4JI7B 2IW5A 4X64B 2JVDA 2QTOA 1R6NA 2YI8A 5HFMA 2P6JA 2E75B 4PV1B 2B5UA 5EZYA 5GW7A 1MMMA 1VF7A 1D2DA 1Q6UA 2GUZA 1Q90D 2P7TC 5AG2A 3G6EV 1DLBA 5JH7A 3EFFK 2Q6AA 3IGAC 1US6A 1I7FA 2CH7A 1QVFU 3DC6A 5LHHA 2CK3G 5KHIA 2RCVA 1IXMA 1JMKC 3GVMA 5KAFZ 2RDCA 3LNNA 3OGCC 1HNWO 3ZMUA 1IZ3A 2A9HA 3GB7C 4F6EA 4DV2O 3CCLV 4LFAO 4CBCA 4NR1A 5CA0A 5JJEB 4B3MO 1V54B 4JYYA 1UJWB 2PTMA 4YXWG 3JD4A 3ZRWA 2YSUB 1VF6A 3CRQA 2XAFA 2E76B 3CCUV 4JAUA 1JR9A 2Y48A 5DM6V 1XAOA 3JAMN 4JYAO 4DR3O 3P3PA 4X1YA 2YIBA 4O4HA 4X20A 2C2AA 4FFBB 3P3NA 3B4SA 1NBMG 1X4TA 3CCQV 3CCEV 4LC1A 1K4DC 3H1IH 2DOSA 1AJQA 1KKDA 3RFRA 1SQFA 3BA8A 5CBHA 3AG3C 5CN0A 2UXNA 3SYCA 2KQXA 3D36A 4PI0A 1G8MA 4Q6GA 2BE3A 3ETDA 4LFBO 3ZRWB 1L8DA 3EHBB 1PPJH 1Z5VA 4YJ3B 1DF4A 2Q2GA 5BMVA 1MG1A 3DGEA 1Q6IA 1QR8A 4NYKA 5LP6C 4RWUA 4JI3B 5LYJB 4L8JA 2HJFC 3HKDA 3N2GA 1XDCA 1HNXO 2QWQB 3W7UA 2QM4A 4JTAB 1SERA 2XNDG 3DXRB 1HR0B 3SPCA 3E2EA 5D5PA 3SYOA 3T1YB 2Q9LA 5JQGB 1SQXH 1WA8B 4IL6Z 3JASB 4PHZA 5KAIZ 2ZIOA 3WG7B 1Q7YW 4LWSA 1YEWA 1SA0A 2ZDIA 2Y0PA 4CS4A 3CMAV 3ZIAG 1DF5A 4X1KB 5BR8O 4ZHQB 1GRJA 2Y0IA 4GCZA 4B3TO 4GKJO 2BOBC 3ZHQA 3E8FA 1HDJA 3ZN1A 1MZEA 4J41A 3ASNB 2HEPA 3ZHUA 1RPRA 1H8HG 4PA7A 4LF7B 3K9AA 3F7YC 4LF4B 3RBZA 2B1GA 4JYBA 4BW5A 4YHHO 4PELA 1R73A 1H2MA 3ABLC 4IYHA 5JVDA 4DRXB 1DTOA 1COWG 3AGYA 4JTDB 4O2AB 3AK1A 4WFBV 2ARHA 3D8CA 2Y69B 1KMIZ 2G38A 2B9ZA 4GLXA 4LR3A 1UPGA 3F7VC 1FXKB 2MW2B 2UUBO 2IJHA 3K3WA 4K8ZA 2QWNB 3HKBA 1VQMV 2JEUA 3LNMB 3ZMZA 3FYIB 2K9PA 1Q81W 3L9ZA 4AQYO 4LF6B 4W4LA 3ABKC 1BQZA 1SC5B 3JALB 3P32A 1YJ9V 3CRRA 1JJ2U 2EIMB 4CS3A 1K3EA 1XOUA 3CD6V 1V54C 5FNVB 2RMKB 4GKJB 4UUJC 4G27B 5E1AC 3ZN0A 2LJ2A 4DR5O 3JATA 1K5SA 2AHYA 2ZINA 4LF7O 4GX0A 1R1BA 3DSQA 5IT9N 4LF9B 2UUAB 1EN5A 3FB6C 4OX9B 4DR4B 1QBZA 1I94B 4LF8B 4RQFA 2GSMB 1N32B 1OCCB 2RN9A 3BY6A 1EZJA 2WLIB 3E22B 2N04A 1V55B 1AI7A 3H1JH 4LFCB 4GUNA 1GH6A 1OCCC 1JFFA 2QTSA 5CB4A 3ZHTA 4O4HB 4X20B 5LOVA 1NTZH 5BZBA 3ZJZA 5LGNA 4YIPA 4U7NA 1XNRO 2P4VA 1FAFA 3JD1A 1W59A 1WP7A 2Q7GA 5LA6B 1Y76B 2OYQA 3DC5A 1XL4A 3T1CA 2L35A 2Q7EA 2QKAA 1ZX3A 2FTKA 1FYJA 3K5MA 2CDYA 3QO5A 1OCOB 1WPXA 1VQKV 2ZNJA 1DK1A 1E1RG 3VBBA 1N34B 4ASUG 1SZXA 3BCCH 4DR5B 2GHYA 4WFAV 2QSAA 2AHZA 3IAYA 3E8BA 5BMVB 1N33B 1NQTA 2Q73A 3JALA 4ZOLA 4JV5B 3G6BA 1BQ0A 1VARA 1W0JG 4MVRA 3I56V 2Y69C 4DUYO 3UCSC 3WB2A 4I50A 5A9GA 1KB9F 4R50A 1XBLA 3WB1A 1TGOA 4FVMA 4CC5A 3T4DA 2PY5A 1I5YA 1GO3F 1G1XB 3IC7A 3CRCA 4DV6B 2GDSA 5IYZA 1GMWD 1OV9A 4HNAB 2Q69A 1GMVA 5K1PA 5KMGB 2LW7A 4FPPA 4FLVA 2ADQB 3CRMA 5CA1B 4NTWA 2ETNA 4UCUA 3FB8C 3CJHA 2VQFB 1M93A 5IJ9A 3ETQA 3FX7A 3NXZA 5HFLA 4JAAA 2EILC 1RFYA 2HVJC 4GX1A 3K5NA 2F4VB 3C6EC 1KBHA 1VQLV 1LUWA 3JAKB 3RYHA 1M1KW 3BFRA 2KG7A 1FD9A 3AG2C 3W7XA 1Y6XA 4JI1O 4JI7O 1Q5OA 1FJGB 4DV7O 1NKDA 4PD4F 2DYRC 1P7BA 1PKXA 4JYAB 3WG7C 4ABMA 2ATKC 4YJ3A 3F5WC 4P9PA 2JS5A 4X65O 3STLC 2Q8VA 5IE9A 1VQ7V 4YJ2B 3AG1B 2XAJA 4FJCC 4EKWA 1NTKH 3OUSA 1QVGU 1B3QA 2XHBA 1N36O 3ZX6A 3L73H 2UXDB 1AILA 4X66B 4X9QA 1K7DA 3ZBHA 1SKVA 1DGSA 2EIMC 5LOVB 1QLEC 4H44B 5DN6G 3W7SA 5L3BA 3LA0A 5B5EZ 2W0XA 1H2NA 4O4IB 3ETGA 3SR2C 5A2QN 3LSSA 1NVPB 1S5LZ 1RP3B 4LWSB 3CS5A 4EB6A 4FM0A 5KLVH 4LH7A 4K0KO 4XDKA 1E79G 2NLJC 3CWBH 3ABKB 4LF5O 3R65A 1M9NA 1YCIA 3ZMTA 3NXSA 5B1OA 3AK3A 5L3GA 1OCZC 2R70A 2CTQA 4EEQA 5H5NA 2ZXWB 1NZ6A 1Q6HA 2JDIG 3OTOB 4JI1B 1KUQA 5BY1A 4RAIA 4MTFA 1VEWA 4J11A 2EIJB 4DV5O 2F93B 2ZR2A 4G28B 3JARB 4MVZA 3J81N 2UU9B 1VQNV 3ASNC 4X1YB 5EZYB 2E5LO 1TUBB 3FD9A 3QF7A 1HW7A 3ZS8C 3JD2A 4J9YB 1EZVH 4O2AA 2M7WA 2ILMA 2IBZH 1J5EO 2WAMA 3ML0A 4H37A 4DUZB 1F4NA 4I9QA 3TJ9A 1XQ8A 1K8AW 3JATB 4UVAA 4WFHA 1WNSA 1ENVA 1PNMA 4O4JA 1AP6A 4UV8A 1V9PA 2UUCO 1U96A 1HNXB 4UVBA 2OT5A 2DYSC 2JGDB 4FMTA 2Q68A 3ZCCA 3TETA 1NH2D 1K9MW 3ABMB 3C3TA 1K33A 3T1YO 3TJ8A 4FM2A 3UKMA 1YJWV 1G6UA 2HP8A 2FKXA 2DWDC 2OTJV 5JCOA 3JAKA 5EBMC 4ZI7B 3S3WA 2HJDA 4LCUC 3BRCA 4FLWA 4IHJA 2PZSA 2YIDA 1ZAUA 4UXNA 3KG2A 1FS0G 2F23A 2LP7A 2YEVB 3WB0A 3BVOA 4HAMA 2LGWA 4BR6A 4PDMA 1XHZA 3HKEA 5EK0A 3FYEB 1SA0B 1IBKB 3AG4B 2F66C 5H6RA 1M57C 2X6AA 2UXCO 1J5EB 3ABTA 3EVKA 1OZ0A 4IIJB 3SPIA 2RQ6A 1S5JA 3JAWA 1YIJV 1RSOA 4YHHB 2AXTZ 4RO2A 2QJ1A 3H1LH 1NJIW 5L3FA 5LGTA 2UXDO 4D6TH 2A0LA 5EBWC 5LXTA 4TV8B 2Q7HA 4DV3O 3L74H 4F6RA 4DV1B 4NXMO 2XAGA 3ETEA 4CZZA 2D2CB 4LFCO 4X1IB 2P22C 2VQEB 3B77A 1S72V 4UCSA 5J2TA 4RUEA 1SQPH 2QM8A 3L72H 2PI5A 1N4CA 1ZUQA 2V1DA 2WA4A 3SPHA 1GN4A 1GN2A 4LF5B 3I38A 4YJ2A 4B7KA 3CHXA 3VOUA 3L9DA 4GZRB 4PDVA 3UT5B 4ZBMA 2P5OA 1IXBA 3RGBA 4QPJA 2VWJA 1EFRG 1GMGA 3U0ZA 3OW2U 2ZM6B 3HKDB 3K9SA 3THOA 3SJBC 3ZHVA 4ZIBA 1JVMA 4B3RO 1F51A 3FB5C 3B8NA 3LDCA 1GM8A 4LFBB 3K58A 5BXZA 2FB5A 2YICA 1N8RW 3C90A 2PYJA 4B3SO 1XNQB 4TV8A 4FLUA 3K03A 1TAEA 3RN4A 5JQGA 3LZ8A 2W6JG 3OFNG 3RW0A 1WB8A 3JD3A 1AP5A 4CH3A 1XMQB 1VQ8V 4O4LB 3PJSK 1L0NH 2VS0A 2ZE8A 1Y76A 4X1KA 2E5LB 5JJNB 1YDXA 3HR0A 4DV0B 4DUYB 2NN4A 3G80A 1FFTB 4IYIA 1YHQV 3RVZA 4IGGA 1K73W 1HR0O 3UT5A 4FZ1A 4X62B 3T1HB 2GTAA 1R3JC 4MT8A 3CC2V 4JI0B 4ZOLB 4FLZA 1S0VA 2BSKB 3K04A 5JH7B 4L3KA 2ZD9A 1Q43A 3HKBB 1K92A 1Y74A 1BL8A 2CE4A 2HHHO 2IJJA 3U10A 1HNWB 1AJPA 1BMFG 1URFA 2Q67A 2V7QG 3MDSA 3CX5F 4B7EA 3TXSA 4BIOA 4K8XA 1OCZB 3AG4C 2QR4A 2OTLV 2JRRA 3GWOA 3C5XC 3ICXA 3STZC 4JI2B 4DW1A 2D3OW 3HKCB 4KHPO 1GMUA 2DN9A 3W7WA 1OCRB 4K35A 1OHHG 3S3XA 3ZHSA 2R72A 2Q0OC 1R6TA 3ZRSA 1KD1W 5LYJA 1S5HC 5KUKA 2ZKOA 4GX5A 2X6BA 4MVQA 4ZHQA 1IBKO 4N23A 2WA3A 1HP8A 1Y74B 1QU7A 3E22A 3OD4A 2ZT9B 2DYRB 3FAVB 4KP4A 1NR7A 1YXBA 2DYSB 1CEZA 3KCYA 4X62O 4WF9V 3T1HO 2E74B 5H9CA 3HPLC 1VQPV 4MTXA 2A06H 3LDEA 3Q4HB 1VF5B 2IJKA 1VQ6V 4DRXA 4P30A 3E35A 3HKEB 2F95B 2HHHB 5LMNO 3ZMSA 3SPGA 2Z5UA 2VQFO 3OUFA 1I0HA 4UB8Z 3KCXA 4DV1O 5IWAO 2WWWA 1J95A 1Q82W 1K34A 5C93A 2VQEO 2Q5ZA 3T4ZA 4JI5O 3TCUA 1JOYA 4WCEV 5CMUA 2AW9A 3OM3B 4UCRA 4KHPB 2K1EA 1CP9A 3GWKC 2LFSA 1VP7A 4J10A 2PYLA 3CB2A 4LF9O 3VQXA 1Z2GA 2LO1A 2AZ2A 2P67A 2F1MA 5GTIZ 2CTRA 4J9ZB 1PL0A 2A79B 4EFEA 2Z3YA 1KQSU 5CBFA 1NVPD 1BT8A 5B1AB 2CTWA 1SF9A 2X7RB 2FYUH 1KP3A 4DK0A 4OGQB 4YY3O 5LMUO 1EN6A 4WFFA 1M5IA 4WBNA 4B3SB 1ROPA 3X2QB 1QHTA 1XILA 3OE7G 3JSNA 1M57B 2IM9A 4CC6A 5B1BB 3CCVV 3APQA 5ITZA 5IJ0B 2LQTA 4IHJB 4O4JB 5IJ9B 4MTOA 1QLEB 4K0KB 2ITDC 1MNGA 3JARA 5KHKA 1PNLA 3ABMC 2CAZC 3IJ4A 3AEIA 4EB6B 1H2SB 4Z1VA 4HBNA 1R3IC 4B3MB 3E89A 5EBLC 4UCTA 1JX9A 2KG7B 4QPKA 4MVMA 4O4LA 2UUBB 2ADPA 1PP9H 1W0KG 4WFEA 1JQ0A 1XNQO 1BHAA 3Q4HA 1H2GA 4NXNB 4FM1A 1N33O 5J2UB 4JI6O 4U3JA 4DR6O 4HNAA 3AG2B 4DV4O 2MK3A 1FPOA 3TXQA 3FKSG 4JI2O 5GONB 4YY3B 4F6RB 4FLTA 2OWOA 1YITV 1G4YB 2HG5C 4GYCB 4FLYA 1TUBA 4X1IA 2WLJA
chains in the Genus database with same CATH topology
1GH6A 2LO1A 1BQZA 3LZ8A 3BVOA 3UO2A 3TJAA 2L6LA 1EARA 2QWRB 3LA0A 3TJ8A 2LGWA 3NXZA 2CTQA 2OCHA 1GMWA 3TJ9A 3UO3A 2M6YA 2Y4TA 4IT5A 2Q2GA 2QWPB 2CTRA 4J80A 3APQA 2QLDA 1GMWD 1NZ6A 4J7ZA 1BQ0A 1IURA 1FPOA 2Y4UA 2YS8A 1N4CA 1WJZA 4L3KA 1C3GA 1GMVA 1FAFA 2N05A 2CTWA 2GUZB 2QWNB 4RWUA 3AGXA 2CTPA 2GUZA 2PF4E 3APOA 3UCSC 2DMXA 2KQXA 2YUAA 1HDJA 1XAOA 3AG7A 3NY0A 1GMUA 2EJ7A 2QWOB 1NLTA 2DN9A 3AGZA 3AGYA 3L9ZA 2CUGA 1EB0A 2QWQB 2N04A 3I38A 1XBLA 2QSAA 2B26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH6 A;  2LO1 A;  1BQZ A;  3LZ8 A;  3BVO A;  3UO2 A;  3TJA A;  2L6L A;  1EAR A;  2QWR B;  3LA0 A;  3TJ8 A;  2LGW A;  3NXZ A;  2CTQ A;  2OCH A;  1GMW A;  3TJ9 A;  3UO3 A;  2M6Y A;  2Y4T A;  4IT5 A;  2Q2G A;  2QWP B;  2CTR A;  4J80 A;  3APQ A;  2QLD A;  1GMW D;  1NZ6 A;  4J7Z A;  1BQ0 A;  1IUR A;  1FPO A;  2Y4U A;  2YS8 A;  1N4C A;  1WJZ A;  4L3K A;  1C3G A;  1GMV A;  1FAF A;  2N05 A;  2CTW A;  2GUZ B;  2QWN B;  4RWU A;  3AGX A;  2CTP A;  2GUZ A;  2PF4 E;  3APO A;  3UCS C;  2DMX A;  2KQX A;  2YUA A;  1HDJ A;  1XAO A;  3AG7 A;  3NY0 A;  1GMU A;  2EJ7 A;  2QWO B;  1NLT A;  2DN9 A;  3AGZ A;  3AGY A;  3L9Z A;  2CUG A;  1EB0 A;  2QWQ B;  2N04 A;  3I38 A;  1XBL A;  2QSA A;  2B26 A; 
#chains in the Genus database with same CATH topology
 3DXR A;  2ITC C;  2P06 A;  4DV6 O;  2M6Y A;  4L87 A;  2UUA O;  2O57 A;  3JSL A;  4I55 A;  4DW0 A;  4OX9 O;  4DR4 O;  5B3S B;  4BW9 A;  1A32 A;  2RNB A;  1I94 O;  4ZKI A;  4JPR A;  3LSQ A;  2ZIM A;  1K97 A;  4JAV A;  4JGS A;  2QWO B;  3MAQ A;  1AB3 A;  4PA9 A;  2ODM A;  1MZF A;  1K4C C;  3OMI B;  3KZI Z;  2JVM A;  2X6C A;  5L3C A;  2F4V O;  1NU1 H;  3SJC C;  1OCR C;  2WLN A;  5CA0 B;  1K5Q A;  4TQF A;  3X2Q C;  2ZXW C;  4DK1 A;  4MTG A;  4ICG A;  2KKW A;  3IC9 A;  5LP6 A;  1HNZ O;  3ABU A;  1KKC A;  1XNR B;  4UB6 Z;  2R9R B;  3BAB A;  2EZO A;  4JTC B;  3G4S V;  3N2K B;  3E83 A;  1QCE A;  4R6Z A;  5IWA B;  1YJN V;  3IFX A;  1WA8 A;  4B3T B;  1YTF B;  3B09 A;  1OCO C;  3A0R A;  2X0L A;  1LUV A;  3CP1 A;  1WPB A;  2OIG A;  3CXC U;  3OEH G;  4TQD A;  3D3I A;  2BTQ A;  4RUF A;  3AK2 A;  3OTF A;  4NVP A;  3CC4 V;  3HB3 B;  2GTS A;  4LBE C;  1YI2 V;  4NTY A;  1FXV A;  4X89 A;  5ITZ B;  1S77 D;  2QWP B;  5CA1 A;  3K06 A;  2QLD A;  1B6Q A;  1WJZ A;  1KP2 A;  3CYO A;  5IYD O;  4DV2 B;  1CXZ B;  4XBF A;  1LNQ A;  5LBQ A;  3CEI A;  3RYC A;  1V55 C;  3M7M X;  3RYF B;  1GTO A;  2QE7 G;  3SYQ A;  2NNU A;  5C8Y A;  3UO2 A;  4CH6 A;  3SPJ A;  1EM1 A;  3MHH C;  2H8P C;  5LHI A;  4I55 B;  1ZLZ A;  1SS3 A;  1FKA O;  3RWR D;  4AQY B;  2EJ7 A;  1IDS A;  3CSX A;  4DXW A;  4C7U A;  3I5D A;  4PA6 A;  2ZCE A;  4J80 A;  2YC0 A;  1ZL8 B;  1B06 A;  3LDD A;  5IDJ A;  4B3R B;  5EC1 C;  3A0B Z;  1AJN A;  2E3C A;  4MW8 A;  5KHH A;  4PJ0 Z;  3CJH B;  5CB4 B;  1L1F A;  1GM9 A;  1FJG O;  2F43 G;  2P90 A;  3RYF A;  1JJO A;  4TWK A;  4DR2 O;  2QGN A;  1YTF D;  1S3J A;  5LGU A;  4DR6 B;  1S76 D;  1BHB A;  5D5Q A;  3K08 A;  4DV4 B;  3K5L A;  3A8T A;  3ZHR A;  1C3G A;  5JWP A;  3QO8 A;  1R6K A;  3APO A;  3QTC A;  2GBO A;  4NTX A;  3PN1 A;  3B2E E;  1FFX B;  1AR4 A;  1Q8I A;  1D5A A;  1SQQ H;  3W7T A;  2DE0 X;  1OJH A;  1XL6 A;  4MS2 A;  5J2U A;  3F5T A;  5EIB D;  1SET A;  1NS1 A;  5IJ0 A;  2ZE6 A;  2XOK G;  4WFG A;  3CXH F;  1VQ9 V;  2ZDI C;  2QDO A;  3L71 H;  4JAS A;  3N2G B;  2W0F C;  2OIE A;  4UVC A;  4JI6 B;  4TV9 B;  2R9A A;  1ARO P;  1U97 A;  4X88 A;  4HZ3 A;  3NR7 A;  4FFB A;  4FLX A;  3RYC B;  2IJI A;  2PI4 A;  3U11 A;  3OGI B;  1FFX A;  3K0D A;  4JF3 A;  1N34 O;  5JCO C;  5EIB C;  3M8A A;  1Y4M A;  2UXB O;  1Y66 A;  4JI8 B;  1EB0 A;  3MHS C;  1R3L C;  1MSD A;  3K57 A;  1SZT A;  4DR2 B;  5GTH Z;  2PUS A;  3WFV A;  4DV5 B;  4OXS A;  1BZK A;  1WLE A;  1W2B U;  3TK1 A;  1VQ4 V;  4I0X B;  2CGO A;  2EIK B;  1WB7 A;  3VQV A;  1P7G A;  2GV9 A;  4FK5 C;  4B08 A;  2UU9 O;  5KHG A;  4HYO A;  4F4L A;  4JV5 O;  4AIL C;  2JRI A;  4EFB A;  2CTP A;  2DMX A;  2HVK C;  3SGI A;  3RYI B;  2KSD A;  3BHP A;  4QGP A;  1ZL8 A;  2YI9 A;  2VRZ A;  3KKY A;  5L3D A;  4DO2 A;  4LNU A;  4QE7 A;  4XDJ A;  2DQ0 A;  3ZED A;  5LP6 B;  1AR1 B;  2VWK A;  1P4R A;  1Z5W A;  3N27 A;  3BPZ A;  2DJV A;  1XRE A;  1RM1 C;  3UQ8 A;  1FXK C;  3I55 V;  4K3A A;  2WSS G;  4LF6 O;  4OPH A;  3N2K A;  2N74 A;  1FXH A;  5EC2 C;  1NT2 B;  4OPA A;  2ZR3 A;  5KUM A;  3AG3 B;  1R3K C;  3ASO B;  1BGY H;  4E2L A;  2Y4T A;  1NR1 A;  2EIJ C;  3R66 A;  4JI5 B;  3OR7 C;  4JZG A;  2XAH A;  3O9O A;  3ABL B;  2JS3 A;  4JZ2 A;  5FLX N;  1QR9 A;  4I4T A;  4JI8 O;  3H9V A;  5IYZ B;  2XAQ A;  2IH3 C;  3DTU B;  4P9O A;  1GN6 A;  2YIA A;  2LGQ A;  2JZ8 A;  4N21 A;  4PA4 A;  2W6I G;  4KL1 A;  2IH1 C;  4X65 B;  3CCM V;  5BR8 B;  4LF8 O;  4CH4 A;  4J7Z A;  2BOC C;  2YIB D;  4I50 B;  1X59 A;  4KFM A;  2GUZ B;  3AGX A;  3B40 A;  4X66 O;  2ZQM A;  3QVN A;  5FPR A;  4RQE A;  2B1I A;  5K1X A;  1VQ5 V;  2EIN B;  3WU2 Z;  4XDL A;  3TJT A;  2LW1 A;  3CPW U;  2JJ2 G;  4MVS A;  2ZNI A;  1F4M A;  1VF6 C;  4FZ0 A;  1XHX A;  1SES A;  3BAA A;  2WLL A;  4QIW F;  1TA8 A;  3AG1 C;  4U3J B;  3A2F A;  1JA8 A;  1TVK A;  1T5E A;  5TIS Z;  4LFA B;  4I7Z B;  4I5S A;  5EYP B;  5IYC O;  2IU0 A;  1GK9 A;  4J42 A;  5CBG A;  4J7J A;  4IIJ A;  3JCZ A;  5GON A;  2YXL A;  2QA4 V;  2V4D A;  1PL4 A;  1GAX A;  2YDE A;  3TGU H;  2BSK A;  1MAB G;  4O2B B;  1NLT A;  1P49 A;  4Z1M G;  2ZE5 A;  3H01 A;  4UFZ A;  1XMO B;  1IVS A;  4TUY A;  5L3E A;  4G2K A;  3TJA A;  1WN7 A;  1KYO F;  1H2K A;  2NR5 A;  2OCH A;  2XAS A;  2YEV A;  1BSM A;  1ZTE A;  1YF2 A;  3A0H Z;  1QQC A;  3SJA C;  1EN4 A;  1JCH A;  2QKC A;  5E79 Z;  3UM7 A;  4A5U B;  4DUZ O;  3HKC A;  4WBN B;  2L6L A;  2DQ3 A;  1IBM O;  4JI4 O;  2H3O A;  1SQV H;  5FPO A;  1XEQ A;  3L75 H;  3ZMV A;  4R7C A;  1TUE B;  3BA9 A;  1H38 A;  3E86 A;  2XT9 A;  1M56 C;  4TV9 A;  1MSW D;  1I08 A;  4DV0 O;  3ZRX A;  2UUC B;  2CUG A;  1NH2 B;  3SYA A;  1IBL O;  2DWE C;  2B26 A;  3OT7 A;  5KX5 A;  3O65 A;  1KU9 A;  3J7A U;  2CH7 B;  1D5N A;  4MVU A;  2AZ0 A;  3B8M A;  1B04 A;  2OCC B;  1H8E G;  4PA3 A;  5H6Q A;  4JI0 O;  4DV7 B;  2N05 A;  2PF4 E;  2LFR A;  4E4E A;  2H94 A;  2WLL B;  5KHJ A;  1RSO B;  2UXB B;  2HR3 A;  4GKK B;  1GN3 A;  4NKG B;  2HKO A;  1VMG A;  2EJR A;  2BCC H;  1BCC H;  2EIK C;  5J9P C;  5IYB O;  5B3S C;  4H13 B;  3K59 A;  1Q86 W;  2Y4U A;  1VQO V;  2WLI A;  1M90 W;  4CS2 A;  4ZI7 A;  4H0L B;  4BIU A;  2UXC B;  2KB1 A;  4UCV A;  2Q0A A;  3FFQ A;  3JYC A;  5LMU B;  4D7S A;  2A3Q A;  1IBM B;  1PD3 A;  1SQB H;  4FIP C;  5JJJ B;  1EAR A;  2QWR B;  3OMN B;  1GMW A;  1BE3 H;  2EIL B;  4LF4 O;  5DEC A;  2XTA A;  1VIB A;  3C3S A;  3J80 N;  2CGN A;  3CME V;  4H33 A;  3RVY A;  1XI1 A;  3OAA G;  1AR5 A;  3CCS V;  4DR1 O;  5IY5 B;  1SQG A;  3RT3 C;  5DED A;  3QG5 A;  4BAY A;  4QE9 A;  4D7T A;  3P30 A;  4MW3 A;  1IX9 A;  4DV3 B;  2HFE C;  4LNU B;  4U7O A;  1LR1 A;  3T2M A;  3G67 A;  3M99 B;  4UCO A;  3BEH A;  4AI8 A;  2YS8 A;  1JFF B;  2EX3 A;  3JAS A;  1AI5 A;  4DR7 B;  4X64 O;  4TUY B;  4NXN O;  2HLD G;  3SJQ C;  5B1B C;  2JK5 C;  1YZB A;  3VQW A;  5JVD B;  3CRA A;  4O2B A;  3MD0 A;  3FB7 C;  5KX5 B;  4P2Z A;  2YXY A;  5LXT B;  1UFI A;  3FAV A;  5J2T B;  4MSW C;  1N0J A;  1AVM A;  2ZM6 O;  4PDR A;  4PI2 A;  3H1H H;  5CA3 A;  3ZRV A;  3OEE G;  5FL7 G;  2YXH A;  4TSF G;  4TT3 G;  1P84 F;  3E8G A;  5KMG A;  4X8A A;  4DYL A;  1XMO O;  3D36 C;  4Z2W A;  2Q4P A;  4I0X A;  1EBO A;  5B1A C;  3JAW B;  2AGA A;  1TVK B;  4BIZ A;  1BS3 A;  3AKO B;  1MOF A;  3CCR V;  1XMQ O;  3D3Q A;  1L0L H;  5KA6 A;  4O4I A;  1AI6 A;  2QKS A;  2EZP A;  3QO7 A;  4DR1 B;  2EUL A;  4BWA A;  1N36 B;  4R8C A;  4JYC A;  3OMA B;  2P4K A;  5H2F Z;  3CC7 V;  3NY0 A;  2UXX A;  1WAZ A;  2FL4 A;  2EBO A;  2XUM A;  3K79 A;  4QJF B;  3AGZ A;  5EYP A;  1CPY A;  2R9I A;  2ZE7 A;  1E1Q G;  2DW4 A;  4KXR A;  4GX2 A;  1PV0 A;  1ORQ C;  4J7K A;  3H1K H;  4JI4 B;  1N0N A;  1FXK A;  1AI4 A;  4LP8 A;  1I5X A;  1Q3E A;  3LUT B;  1F7Y A;  2IU3 A;  1KEC A;  4YIO A;  4DR7 O;  5LA6 A;  4DR3 B;  1QNM A;  4AHC A;  2YUA A;  3AG7 A;  3EXA A;  3OR6 C;  4NB5 A;  3JCU Z;  4UV9 A;  2WLH A;  3G71 V;  1QLN A;  3K5O A;  4Q20 A;  5LL6 Y;  3RYI A;  1HWY A;  4LH6 A;  3QNE A;  2JGD A;  3RYH B;  1YVW A;  1H2L A;  1NTM H;  2WPD G;  3OTO O;  3SDL A;  2EIN C;  3VQY A;  2BTO A;  5KA5 A;  1SRY A;  1Y67 A;  3K0G A;  1JPX A;  1XUQ A;  4GKK O;  4W4K A;  2A7W A;  3JD0 A;  4TOI A;  2JGU A;  2QEX V;  4QNH B;  1O9G A;  2OCC C;  2WLK A;  1N32 O;  4JI3 O;  1M4U A;  4KUM A;  4MVO A;  3L70 H;  1YSC A;  4CH5 A;  3LSU A;  1PM9 A;  1IBL B;  4NXM B;  4GT1 A;  2BTQ B;  1M56 B;  2JEX A;  2RJZ A;  2PGG A;  5B1N A;  5B66 Z;  1O9H A;  4PDL A;  4I4T B;  1KC8 W;  1IUR A;  3SYP A;  1GKF A;  5LMN B;  2FML A;  1GM7 A;  3ASO C;  2QM7 A;  2JJ1 G;  1ZWI C;  1F23 A;  2Z0A A;  1RPO A;  2JIZ G;  1THZ A;  1PNK A;  1ZSP A;  2ODX A;  1WP8 A;  4I9W A;  4FFK A;  2WLM A;  1RM1 B;  3E8H A;  3UO3 A;  3CCJ V;  4IT5 A;  3CE2 A;  5C8Y B;  5FNV A;  4U3F H;  5IY5 C;  5F2V O;  5LHG A;  1HNZ B;  1MA1 A;  1NI8 A;  4JI7 B;  2IW5 A;  4X64 B;  2JVD A;  2QTO A;  1R6N A;  2YI8 A;  5HFM A;  2P6J A;  2E75 B;  4PV1 B;  2B5U A;  5EZY A;  5GW7 A;  1MMM A;  1VF7 A;  1D2D A;  1Q6U A;  2GUZ A;  1Q90 D;  2P7T C;  5AG2 A;  3G6E V;  1DLB A;  5JH7 A;  3EFF K;  2Q6A A;  3IGA C;  1US6 A;  1I7F A;  2CH7 A;  1QVF U;  3DC6 A;  5LHH A;  2CK3 G;  5KHI A;  2RCV A;  1IXM A;  1JMK C;  3GVM A;  5KAF Z;  2RDC A;  3LNN A;  3OGC C;  1HNW O;  3ZMU A;  1IZ3 A;  2A9H A;  3GB7 C;  4F6E A;  4DV2 O;  3CCL V;  4LFA O;  4CBC A;  4NR1 A;  5CA0 A;  5JJE B;  4B3M O;  1V54 B;  4JYY A;  1UJW B;  2PTM A;  4YXW G;  3JD4 A;  3ZRW A;  2YSU B;  1VF6 A;  3CRQ A;  2XAF A;  2E76 B;  3CCU V;  4JAU A;  1JR9 A;  2Y48 A;  5DM6 V;  1XAO A;  3JAM N;  4JYA O;  4DR3 O;  3P3P A;  4X1Y A;  2YIB A;  4O4H A;  4X20 A;  2C2A A;  4FFB B;  3P3N A;  3B4S A;  1NBM G;  1X4T A;  3CCQ V;  3CCE V;  4LC1 A;  1K4D C;  3H1I H;  2DOS A;  1AJQ A;  1KKD A;  3RFR A;  1SQF A;  3BA8 A;  5CBH A;  3AG3 C;  5CN0 A;  2UXN A;  3SYC A;  2KQX A;  3D36 A;  4PI0 A;  1G8M A;  4Q6G A;  2BE3 A;  3ETD A;  4LFB O;  3ZRW B;  1L8D A;  3EHB B;  1PPJ H;  1Z5V A;  4YJ3 B;  1DF4 A;  2Q2G A;  5BMV A;  1MG1 A;  3DGE A;  1Q6I A;  1QR8 A;  4NYK A;  5LP6 C;  4RWU A;  4JI3 B;  5LYJ B;  4L8J A;  2HJF C;  3HKD A;  3N2G A;  1XDC A;  1HNX O;  2QWQ B;  3W7U A;  2QM4 A;  4JTA B;  1SER A;  2XND G;  3DXR B;  1HR0 B;  3SPC A;  3E2E A;  5D5P A;  3SYO A;  3T1Y B;  2Q9L A;  5JQG B;  1SQX H;  1WA8 B;  4IL6 Z;  3JAS B;  4PHZ A;  5KAI Z;  2ZIO A;  3WG7 B;  1Q7Y W;  4LWS A;  1YEW A;  1SA0 A;  2ZDI A;  2Y0P A;  4CS4 A;  3CMA V;  3ZIA G;  1DF5 A;  4X1K B;  5BR8 O;  4ZHQ B;  1GRJ A;  2Y0I A;  4GCZ A;  4B3T O;  4GKJ O;  2BOB C;  3ZHQ A;  3E8F A;  1HDJ A;  3ZN1 A;  1MZE A;  4J41 A;  3ASN B;  2HEP A;  3ZHU A;  1RPR A;  1H8H G;  4PA7 A;  4LF7 B;  3K9A A;  3F7Y C;  4LF4 B;  3RBZ A;  2B1G A;  4JYB A;  4BW5 A;  4YHH O;  4PEL A;  1R73 A;  1H2M A;  3ABL C;  4IYH A;  5JVD A;  4DRX B;  1DTO A;  1COW G;  3AGY A;  4JTD B;  4O2A B;  3AK1 A;  4WFB V;  2ARH A;  3D8C A;  2Y69 B;  1KMI Z;  2G38 A;  2B9Z A;  4GLX A;  4LR3 A;  1UPG A;  3F7V C;  1FXK B;  2MW2 B;  2UUB O;  2IJH A;  3K3W A;  4K8Z A;  2QWN B;  3HKB A;  1VQM V;  2JEU A;  3LNM B;  3ZMZ A;  3FYI B;  2K9P A;  1Q81 W;  3L9Z A;  4AQY O;  4LF6 B;  4W4L A;  3ABK C;  1BQZ A;  1SC5 B;  3JAL B;  3P32 A;  1YJ9 V;  3CRR A;  1JJ2 U;  2EIM B;  4CS3 A;  1K3E A;  1XOU A;  3CD6 V;  1V54 C;  5FNV B;  2RMK B;  4GKJ B;  4UUJ C;  4G27 B;  5E1A C;  3ZN0 A;  2LJ2 A;  4DR5 O;  3JAT A;  1K5S A;  2AHY A;  2ZIN A;  4LF7 O;  4GX0 A;  1R1B A;  3DSQ A;  5IT9 N;  4LF9 B;  2UUA B;  1EN5 A;  3FB6 C;  4OX9 B;  4DR4 B;  1QBZ A;  1I94 B;  4LF8 B;  4RQF A;  2GSM B;  1N32 B;  1OCC B;  2RN9 A;  3BY6 A;  1EZJ A;  2WLI B;  3E22 B;  2N04 A;  1V55 B;  1AI7 A;  3H1J H;  4LFC B;  4GUN A;  1GH6 A;  1OCC C;  1JFF A;  2QTS A;  5CB4 A;  3ZHT A;  4O4H B;  4X20 B;  5LOV A;  1NTZ H;  5BZB A;  3ZJZ A;  5LGN A;  4YIP A;  4U7N A;  1XNR O;  2P4V A;  1FAF A;  3JD1 A;  1W59 A;  1WP7 A;  2Q7G A;  5LA6 B;  1Y76 B;  2OYQ A;  3DC5 A;  1XL4 A;  3T1C A;  2L35 A;  2Q7E A;  2QKA A;  1ZX3 A;  2FTK A;  1FYJ A;  3K5M A;  2CDY A;  3QO5 A;  1OCO B;  1WPX A;  1VQK V;  2ZNJ A;  1DK1 A;  1E1R G;  3VBB A;  1N34 B;  4ASU G;  1SZX A;  3BCC H;  4DR5 B;  2GHY A;  4WFA V;  2QSA A;  2AHZ A;  3IAY A;  3E8B A;  5BMV B;  1N33 B;  1NQT A;  2Q73 A;  3JAL A;  4ZOL A;  4JV5 B;  3G6B A;  1BQ0 A;  1VAR A;  1W0J G;  4MVR A;  3I56 V;  2Y69 C;  4DUY O;  3UCS C;  3WB2 A;  4I50 A;  5A9G A;  1KB9 F;  4R50 A;  1XBL A;  3WB1 A;  1TGO A;  4FVM A;  4CC5 A;  3T4D A;  2PY5 A;  1I5Y A;  1GO3 F;  1G1X B;  3IC7 A;  3CRC A;  4DV6 B;  2GDS A;  5IYZ A;  1GMW D;  1OV9 A;  4HNA B;  2Q69 A;  1GMV A;  5K1P A;  5KMG B;  2LW7 A;  4FPP A;  4FLV A;  2ADQ B;  3CRM A;  5CA1 B;  4NTW A;  2ETN A;  4UCU A;  3FB8 C;  3CJH A;  2VQF B;  1M93 A;  5IJ9 A;  3ETQ A;  3FX7 A;  3NXZ A;  5HFL A;  4JAA A;  2EIL C;  1RFY A;  2HVJ C;  4GX1 A;  3K5N A;  2F4V B;  3C6E C;  1KBH A;  1VQL V;  1LUW A;  3JAK B;  3RYH A;  1M1K W;  3BFR A;  2KG7 A;  1FD9 A;  3AG2 C;  3W7X A;  1Y6X A;  4JI1 O;  4JI7 O;  1Q5O A;  1FJG B;  4DV7 O;  1NKD A;  4PD4 F;  2DYR C;  1P7B A;  1PKX A;  4JYA B;  3WG7 C;  4ABM A;  2ATK C;  4YJ3 A;  3F5W C;  4P9P A;  2JS5 A;  4X65 O;  3STL C;  2Q8V A;  5IE9 A;  1VQ7 V;  4YJ2 B;  3AG1 B;  2XAJ A;  4FJC C;  4EKW A;  1NTK H;  3OUS A;  1QVG U;  1B3Q A;  2XHB A;  1N36 O;  3ZX6 A;  3L73 H;  2UXD B;  1AIL A;  4X66 B;  4X9Q A;  1K7D A;  3ZBH A;  1SKV A;  1DGS A;  2EIM C;  5LOV B;  1QLE C;  4H44 B;  5DN6 G;  3W7S A;  5L3B A;  3LA0 A;  5B5E Z;  2W0X A;  1H2N A;  4O4I B;  3ETG A;  3SR2 C;  5A2Q N;  3LSS A;  1NVP B;  1S5L Z;  1RP3 B;  4LWS B;  3CS5 A;  4EB6 A;  4FM0 A;  5KLV H;  4LH7 A;  4K0K O;  4XDK A;  1E79 G;  2NLJ C;  3CWB H;  3ABK B;  4LF5 O;  3R65 A;  1M9N A;  1YCI A;  3ZMT A;  3NXS A;  5B1O A;  3AK3 A;  5L3G A;  1OCZ C;  2R70 A;  2CTQ A;  4EEQ A;  5H5N A;  2ZXW B;  1NZ6 A;  1Q6H A;  2JDI G;  3OTO B;  4JI1 B;  1KUQ A;  5BY1 A;  4RAI A;  4MTF A;  1VEW A;  4J11 A;  2EIJ B;  4DV5 O;  2F93 B;  2ZR2 A;  4G28 B;  3JAR B;  4MVZ A;  3J81 N;  2UU9 B;  1VQN V;  3ASN C;  4X1Y B;  5EZY B;  2E5L O;  1TUB B;  3FD9 A;  3QF7 A;  1HW7 A;  3ZS8 C;  3JD2 A;  4J9Y B;  1EZV H;  4O2A A;  2M7W A;  2ILM A;  2IBZ H;  1J5E O;  2WAM A;  3ML0 A;  4H37 A;  4DUZ B;  1F4N A;  4I9Q A;  3TJ9 A;  1XQ8 A;  1K8A W;  3JAT B;  4UVA A;  4WFH A;  1WNS A;  1ENV A;  1PNM A;  4O4J A;  1AP6 A;  4UV8 A;  1V9P A;  2UUC O;  1U96 A;  1HNX B;  4UVB A;  2OT5 A;  2DYS C;  2JGD B;  4FMT A;  2Q68 A;  3ZCC A;  3TET A;  1NH2 D;  1K9M W;  3ABM B;  3C3T A;  1K33 A;  3T1Y O;  3TJ8 A;  4FM2 A;  3UKM A;  1YJW V;  1G6U A;  2HP8 A;  2FKX A;  2DWD C;  2OTJ V;  5JCO A;  3JAK A;  5EBM C;  4ZI7 B;  3S3W A;  2HJD A;  4LCU C;  3BRC A;  4FLW A;  4IHJ A;  2PZS A;  2YID A;  1ZAU A;  4UXN A;  3KG2 A;  1FS0 G;  2F23 A;  2LP7 A;  2YEV B;  3WB0 A;  3BVO A;  4HAM A;  2LGW A;  4BR6 A;  4PDM A;  1XHZ A;  3HKE A;  5EK0 A;  3FYE B;  1SA0 B;  1IBK B;  3AG4 B;  2F66 C;  5H6R A;  1M57 C;  2X6A A;  2UXC O;  1J5E B;  3ABT A;  3EVK A;  1OZ0 A;  4IIJ B;  3SPI A;  2RQ6 A;  1S5J A;  3JAW A;  1YIJ V;  1RSO A;  4YHH B;  2AXT Z;  4RO2 A;  2QJ1 A;  3H1L H;  1NJI W;  5L3F A;  5LGT A;  2UXD O;  4D6T H;  2A0L A;  5EBW C;  5LXT A;  4TV8 B;  2Q7H A;  4DV3 O;  3L74 H;  4F6R A;  4DV1 B;  4NXM O;  2XAG A;  3ETE A;  4CZZ A;  2D2C B;  4LFC O;  4X1I B;  2P22 C;  2VQE B;  3B77 A;  1S72 V;  4UCS A;  5J2T A;  4RUE A;  1SQP H;  2QM8 A;  3L72 H;  2PI5 A;  1N4C A;  1ZUQ A;  2V1D A;  2WA4 A;  3SPH A;  1GN4 A;  1GN2 A;  4LF5 B;  3I38 A;  4YJ2 A;  4B7K A;  3CHX A;  3VOU A;  3L9D A;  4GZR B;  4PDV A;  3UT5 B;  4ZBM A;  2P5O A;  1IXB A;  3RGB A;  4QPJ A;  2VWJ A;  1EFR G;  1GMG A;  3U0Z A;  3OW2 U;  2ZM6 B;  3HKD B;  3K9S A;  3THO A;  3SJB C;  3ZHV A;  4ZIB A;  1JVM A;  4B3R O;  1F51 A;  3FB5 C;  3B8N A;  3LDC A;  1GM8 A;  4LFB B;  3K58 A;  5BXZ A;  2FB5 A;  2YIC A;  1N8R W;  3C90 A;  2PYJ A;  4B3S O;  1XNQ B;  4TV8 A;  4FLU A;  3K03 A;  1TAE A;  3RN4 A;  5JQG A;  3LZ8 A;  2W6J G;  3OFN G;  3RW0 A;  1WB8 A;  3JD3 A;  1AP5 A;  4CH3 A;  1XMQ B;  1VQ8 V;  4O4L B;  3PJS K;  1L0N H;  2VS0 A;  2ZE8 A;  1Y76 A;  4X1K A;  2E5L B;  5JJN B;  1YDX A;  3HR0 A;  4DV0 B;  4DUY B;  2NN4 A;  3G80 A;  1FFT B;  4IYI A;  1YHQ V;  3RVZ A;  4IGG A;  1K73 W;  1HR0 O;  3UT5 A;  4FZ1 A;  4X62 B;  3T1H B;  2GTA A;  1R3J C;  4MT8 A;  3CC2 V;  4JI0 B;  4ZOL B;  4FLZ A;  1S0V A;  2BSK B;  3K04 A;  5JH7 B;  4L3K A;  2ZD9 A;  1Q43 A;  3HKB B;  1K92 A;  1Y74 A;  1BL8 A;  2CE4 A;  2HHH O;  2IJJ A;  3U10 A;  1HNW B;  1AJP A;  1BMF G;  1URF A;  2Q67 A;  2V7Q G;  3MDS A;  3CX5 F;  4B7E A;  3TXS A;  4BIO A;  4K8X A;  1OCZ B;  3AG4 C;  2QR4 A;  2OTL V;  2JRR A;  3GWO A;  3C5X C;  3ICX A;  3STZ C;  4JI2 B;  4DW1 A;  2D3O W;  3HKC B;  4KHP O;  1GMU A;  2DN9 A;  3W7W A;  1OCR B;  4K35 A;  1OHH G;  3S3X A;  3ZHS A;  2R72 A;  2Q0O C;  1R6T A;  3ZRS A;  1KD1 W;  5LYJ A;  1S5H C;  5KUK A;  2ZKO A;  4GX5 A;  2X6B A;  4MVQ A;  4ZHQ A;  1IBK O;  4N23 A;  2WA3 A;  1HP8 A;  1Y74 B;  1QU7 A;  3E22 A;  3OD4 A;  2ZT9 B;  2DYR B;  3FAV B;  4KP4 A;  1NR7 A;  1YXB A;  2DYS B;  1CEZ A;  3KCY A;  4X62 O;  4WF9 V;  3T1H O;  2E74 B;  5H9C A;  3HPL C;  1VQP V;  4MTX A;  2A06 H;  3LDE A;  3Q4H B;  1VF5 B;  2IJK A;  1VQ6 V;  4DRX A;  4P30 A;  3E35 A;  3HKE B;  2F95 B;  2HHH B;  5LMN O;  3ZMS A;  3SPG A;  2Z5U A;  2VQF O;  3OUF A;  1I0H A;  4UB8 Z;  3KCX A;  4DV1 O;  5IWA O;  2WWW A;  1J95 A;  1Q82 W;  1K34 A;  5C93 A;  2VQE O;  2Q5Z A;  3T4Z A;  4JI5 O;  3TCU A;  1JOY A;  4WCE V;  5CMU A;  2AW9 A;  3OM3 B;  4UCR A;  4KHP B;  2K1E A;  1CP9 A;  3GWK C;  2LFS A;  1VP7 A;  4J10 A;  2PYL A;  3CB2 A;  4LF9 O;  3VQX A;  1Z2G A;  2LO1 A;  2AZ2 A;  2P67 A;  2F1M A;  5GTI Z;  2CTR A;  4J9Z B;  1PL0 A;  2A79 B;  4EFE A;  2Z3Y A;  1KQS U;  5CBF A;  1NVP D;  1BT8 A;  5B1A B;  2CTW A;  1SF9 A;  2X7R B;  2FYU H;  1KP3 A;  4DK0 A;  4OGQ B;  4YY3 O;  5LMU O;  1EN6 A;  4WFF A;  1M5I A;  4WBN A;  4B3S B;  1ROP A;  3X2Q B;  1QHT A;  1XIL A;  3OE7 G;  3JSN A;  1M57 B;  2IM9 A;  4CC6 A;  5B1B B;  3CCV V;  3APQ A;  5ITZ A;  5IJ0 B;  2LQT A;  4IHJ B;  4O4J B;  5IJ9 B;  4MTO A;  1QLE B;  4K0K B;  2ITD C;  1MNG A;  3JAR A;  5KHK A;  1PNL A;  3ABM C;  2CAZ C;  3IJ4 A;  3AEI A;  4EB6 B;  1H2S B;  4Z1V A;  4HBN A;  1R3I C;  4B3M B;  3E89 A;  5EBL C;  4UCT A;  1JX9 A;  2KG7 B;  4QPK A;  4MVM A;  4O4L A;  2UUB B;  2ADP A;  1PP9 H;  1W0K G;  4WFE A;  1JQ0 A;  1XNQ O;  1BHA A;  3Q4H A;  1H2G A;  4NXN B;  4FM1 A;  1N33 O;  5J2U B;  4JI6 O;  4U3J A;  4DR6 O;  4HNA A;  3AG2 B;  4DV4 O;  2MK3 A;  1FPO A;  3TXQ A;  3FKS G;  4JI2 O;  5GON B;  4YY3 B;  4F6R B;  4FLT A;  2OWO A;  1YIT V;  1G4Y B;  2HG5 C;  4GYC B;  4FLY A;  1TUB A;  4X1I A;  2WLJ A; 
#chains in the Genus database with same CATH homology
 1GH6 A;  2LO1 A;  1BQZ A;  3LZ8 A;  3BVO A;  3UO2 A;  3TJA A;  2L6L A;  1EAR A;  2QWR B;  3LA0 A;  3TJ8 A;  2LGW A;  3NXZ A;  2CTQ A;  2OCH A;  1GMW A;  3TJ9 A;  3UO3 A;  2M6Y A;  2Y4T A;  4IT5 A;  2Q2G A;  2QWP B;  2CTR A;  4J80 A;  3APQ A;  2QLD A;  1GMW D;  1NZ6 A;  4J7Z A;  1BQ0 A;  1IUR A;  1FPO A;  2Y4U A;  2YS8 A;  1N4C A;  1WJZ A;  4L3K A;  1C3G A;  1GMV A;  1FAF A;  2N05 A;  2CTW A;  2GUZ B;  2QWN B;  4RWU A;  3AGX A;  2CTP A;  2GUZ A;  2PF4 E;  3APO A;  3UCS C;  2DMX A;  2KQX A;  2YUA A;  1HDJ A;  1XAO A;  3AG7 A;  3NY0 A;  1GMU A;  2EJ7 A;  2QWO B;  1NLT A;  2DN9 A;  3AGZ A;  3AGY A;  3L9Z A;  2CUG A;  1EB0 A;  2QWQ B;  2N04 A;  3I38 A;  1XBL A;  2QSA A;  2B26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...