4J80A

Thermus thermophilus dnaj
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
271
structure length
271
Chain Sequence
AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVMSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGKGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRMPPGVREGSVIRVPGMGGQGNPPGDLLLVVRMLPHPVFRLEGQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKMRLKGGGFPGPAGRGDLYLEVRITIPERLTPEEEALWKKLAEAYYAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining crystallography and EPR: crystal and solution structures of the multidomain cochaperone DnaJ.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein DnaJ 2
total genus 62
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF01556 DnaJ_C DnaJ C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4j80A01
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A02
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4j80A03
3I38A 3TJ8A 2DMXA 2CUGA 2LGWA 2N04A 2B26A 1N4CA 1GMWD 2CTQA 1NLTA 2QWPB 3NXZA 4J80A 1C3GA 2KQXA 3L9ZA 3NY0A 2QWQB 1BQ0A 3AG7A 2QLDA 2M6YA 4IT5A 2Q2GA 2YS8A 2YUAA 1EB0A 1XAOA 1FAFA 3AGZA 2OCHA 3LA0A 1GMUA 3TJAA 2Y4TA 1GH6A 2GUZA 2QWRB 3TJ9A 3UO3A 2Y4UA 1IURA 2CTRA 1HDJA 1GMVA 1EARA 3UO2A 1GMWA 3AGXA 2PF4E 2GUZB 4J7ZA 3UCSC 1XBLA 2QSAA 3APQA 3LZ8A 2L6LA 4L3KA 2EJ7A 2QWNB 2CTWA 3AGYA 1FPOA 2CTPA 2LO1A 1WJZA 3BVOA 1BQZA 3APOA 2DN9A 2N05A 2QWOB 1NZ6A 4RWUA
chains in the Genus database with same CATH superfamily
4LF7B 3ZS8C 1R3IC 3OR6C 1YF2A 3H9VA 4BIOA 4JYCA 4G2KA 2IJHA 1FXHA 2XAFA 1AILA 2NNUA 4X1KA 2UXCB 3CCMV 5KA5A 4DK0A 1Y74A 3RYFB 4FVMA 3K03A 1QQCA 4PJ0Z 4JI0O 3SPHA 1J95A 5J2TB 4WFBV 1MG1A 1P7BA 4JV5B 1R6TA 4UVCA 5BR8O 2V1DA 2BE3A 4P9PA 1EN6A 1YHQV 2AW9A 2HFEC 2ZXWC 1D5NA 2P06A 4JI1O 5LGNA 5C8YA 2F4VO 4X8AA 1SQFA 1L1FA 3OAAG 5FPOA 5KA6A 2Q2GA 1IX9A 5IY5B 5J2UA 2Z0AA 1HDJA 5KX5B 1WPBA 1SS3A 4UB6Z 1VQPV 1NBMG 4JYYA 4PD4F 4ICGA 1K7DA 2EINB 2JJ1G 1YJWV 3VQYA 2Q7GA 3HPLC 1GN4A 2YSUB 4X1IA 5JCOA 4BWAA 4JI3B 3SPGA 3LSQA 3ABKC 2WLIB 1R3LC 1QBZA 3ML0A 1FXVA 2Y0IA 1PL4A 2ZE5A 3QO5A 3K9SA 1NU1H 5LHHA 2R9RB 1R73A 4CC5A 1ORQC 4LF6B 4PV1B 2IJJA 4ZKIA 3EXAA 1XMQB 4TV9B 4B7KA 4JTAB 2OTJV 2RNBA 4J42A 4MW3A 3QNEA 5FNVA 2AHYA 4AHCA 4JZ2A 1VQ9V 1PV0A 4MVRA 1NTKH 3OGCC 1JR9A 5JCOC 1QLNA 2A7WA 1VMGA 2KKWA 1K8AW 1FXKB 3JSLA 5J2UB 2X0LA 3K58A 4PDVA 4O4JB 2HVJC 4LH7A 2OT5A 1O9HA 3AK1A 2RN9A 4DR7B 2ZE7A 5JH7A 4IHJB 3CCVV 1JCHA 3AG7A 5JJNB 3IAYA 4LF4O 2DYSB 2W0XA 5KHHA 3NXSA 2YXLA 3OTOO 4B3RB 3SPIA 3JASA 1XNRB 4LH6A 4B3RO 2KG7A 4OPAA 1SQXH 1H2LA 1QHTA 2E3CA 3N2GA 3CS5A 1K97A 1BL8A 2JEXA 1IXBA 4Z2WA 3ZRVA 5EBMC 2IH1C 1JVMA 4YXWG 1S0VA 1K5QA 5TISZ 3ZBHA 2LW7A 4D7SA 2P7TC 5B1AC 1M93A 4LF5O 3FAVA 4DV2B 4LP8A 1YSCA 3CC7V 2RDCA 1JA8A 1Q3EA 4DV2O 3G71V 3BY6A 1HNZO 1V54C 5LA6B 4JYAO 3OEHG 3DC6A 2QTSA 3OTFA 1WN7A 2UXXA 1AR1B 3CRCA 4OGQB 2CH7B 4F4LA 1FFTB 1N33B 4O2AA 4MVOA 3D3QA 1W59A 1KBHA 4GKKO 1ROPA 5B1AB 4W4LA 3MDSA 1Q5OA 2JEUA 3FB7C 2UXNA 3CMAV 4EEQA 2GBOA 1VQ5V 1S77D 1I0HA 1M57C 3T1YO 5L3CA 3AGZA 2Q0AA 1Y74B 4FPPA 1R3KC 4BW9A 1YI2V 2PI4A 3CCEV 2OYQA 2JDIG 3HB3B 1RPOA 3T4ZA 2XT9A 5IJ0B 1YJ9V 2XHBA 1K4CC 1RSOB 3A0BZ 2JGDA 4CS4A 1MSDA 2E5LO 1V9PA 2ODXA 2QM7A 3OR7C 4PA3A 2CGOA 3Q4HB 2KG7B 1K4DC 1N34O 3JD1A 4DR4B 2LQTA 3E22A 2Q6AA 3RYHB 1HR0B 1Z5VA 4OPHA 5EBLC 4LFAO 1D5AA 4B3TB 4R50A 5LP6B 3WFVA 3I55V 4TV9A 4GKJO 1BHBA 1K5SA 4XDJA 2UU9O 1SQVH 1ZL8A 3JD4A 3BA9A 1B04A 2ZIMA 3ZIAG 2GTAA 3CX5F 3E8GA 1G1XB 2BOCC 2E74B 2ZE6A 1XMOO 3GWOA 1AR4A 5HFMA 3OMAB 2YICA 1Q7YW 3CSXA 4CZZA 4GCZA 4JF3A 1Q8IA 3HKDB 1UJWB 3H01A 3U10A 1P84F 3CXCU 4DV4O 1KECA 5CA0B 1WLEA 4YJ2A 1JPXA 2LW1A 1M9NA 2N05A 3UT5A 3OMNB 3CYOA 4J10A 3FX7A 4JI4O 3AK2A 3OUSA 3A8TA 4DR3O 1LNQA 4Z1MG 1Z2GA 2EZOA 2KSDA 5B5EZ 3ETGA 5DEDA 3W7XA 1JJ2U 4LF6O 5LHIA 4CBCA 1WAZA 3C3TA 4TOIA 2DE0X 1NH2D 2LO1A 4UCSA 4I4TB 4N23A 4X66O 1L0LH 4YY3B 1L0NH 3K57A 5FPRA 3OE7G 3I5DA 4JV5O 3D8CA 1HNXB 3H1LH 1VQ8V 3SR2C 5B66Z 3E2EA 2P5OA 5IY5C 1GM8A 1PL0A 3MHHC 4LF9O 3M7MX 4LR3A 3HKCB 1B3QA 5EBWC 4DRXA 4I0XB 1J5EO 5EIBD 2ZM6O 2W0FC 2CH7A 3I38A 3LUTB 2JJ2G 1EZVH 3J81N 3WB1A 5AG2A 4LWSB 4KL1A 3ZHVA 3VQXA 3K5NA 2YC0A 2FB5A 4NXNB 3SJQC 1LR1A 2QJ1A 1MSWD 2UUCO 2PZSA 1XNRO 1FPOA 1S76D 2VQFO 2DQ0A 3ZMVA 2WLLB 3JALB 3RYCA 2IBZH 2DMXA 2LGQA 4JI0B 4GKJB 1DK1A 5KMGB 1RM1C 2Q0OC 3NY0A 1MNGA 1VF5B 2E75B 3CJHB 4UCOA 4K35A 2N74A 4LFCO 1HW7A 5IE9A 3SYCA 4MT8A 4ZOLB 3P3NA 1TUEB 3AK3A 3RGBA 3U0ZA 5CBGA 3IC9A 1BGYH 5K1PA 4WFFA 5EC2C 4WBNA 5KHKA 3C90A 4J7JA 4L87A 2B26A 3H1IH 4RUFA 1I08A 4NTYA 3ZMZA 2JGDB 1SRYA 3P30A 3K0DA 1XILA 4Q20A 5F2VO 5JH7B 4UVBA 1HNXO 2LP7A 5JVDA 3CCUV 5ITZB 1FJGB 2YIDA 4JPRA 4FFKA 1FJGO 2EIKC 3WU2Z 3IGAC 5KHIA 1Y6XA 2B5UA 4BW5A 2Q4PA 3W7UA 1N0JA 4ZHQB 3BAAA 1M90W 2HLDG 1HNWO 1MABG 1QVFU 1GMUA 3BFRA 5LYJB 4DYLA 5K1XA 4QNHB 1RPRA 4FZ1A 4RAIA 4YY3O 2ADQB 3ZX6A 2IU0A 2CTPA 3BVOA 2CE4A 4FLUA 1K33A 4ASUG 3M8AA 1V55C 5J9PC 5B3SC 2F23A 2UUAO 3UT5B 3DGEA 2FYUH 5KHGA 2QGNA 4G28B 4FZ0A 1XL4A 4LFCB 4X1IB 2YDEA 4U3JB 1R3JC 3MAQA 1Q86W 3J80N 3HKBA 2B9ZA 5H6RA 3ETEA 1CXZB 1SA0B 3SPJA 2B1IA 3SYOA 3J7AU 3QO8A 4H44B 4IL6Z 3CRRA 2ZD9A 4FMTA 4NB5A 2EIMC 3CPWU 2BTQB 3L9DA 3N2KA 1GK9A 1GMVA 3JAWA 4DV3B 1H8HG 2MK3A 3P32A 3QO7A 5IJ9A 1IBMO 3ZMTA 3T1CA 2QWOB 3RVYA 1NTZH 1F23A 1OCRB 1ZX3A 2GDSA 1IBLO 4CH3A 3N27A 4HAMA 2YEVA 2ZKOA 4QGPA 1VQOV 1XNQO 3N2KB 1CEZA 4DV5B 3RN4A 1GMWA 3AG2C 2HJDA 4DR5B 1OZ0A 4JTDB 1Y76B 4AILC 1AB3A 4PA4A 4UCTA 4CC6A 4GT1A 2CUGA 5JJJB 4NTXA 1H2SB 3CD6V 3CC4V 1P7GA 2E5LB 3E35A 4MTFA 2IW5A 4AQYO 2WPDG 1QLEB 3ABTA 3SPCA 2Q8VA 4DUZB 1DF5A 3APQA 1HR0O 3PN1A 4MVUA 1VEWA 3C3SA 3L73H 4X65O 1T5EA 1VF6C 3K06A 4H0LB 4LF8B 5LOVA 4O2AB 4FLWA 3O9OA 4FIPC 1P49A 1EZJA 4OX9B 2OTLV 1GH6A 3G6BA 2CTRA 1IXMA 1XI1A 3UCSC 1EN5A 2ZM6B 3ABKB 1GMGA 1PNLA 3GB7C 3ZMSA 3E8BA 3IFXA 4YJ3A 2JK5C 3LDDA 5IYBO 3B8NA 4ZBMA 4WFAV 1ZUQA 2UXDO 4X1KB 1V54B 5KUMA 3ETQA 3LA0A 1VQMV 3OUFA 1BZKA 4PELA 2Y0PA 3UO2A 3FYEB 4TQDA 1TAEA 4TQFA 4UV9A 1HWYA 3AGYA 4QPKA 2ARHA 2BCCH 4TSFG 1W0JG 2HR3A 1WA8B 2P67A 2XASA 2XNDG 3RYIB 2RMKB 3E89A 3JAKA 1JX9A 2XAHA 4QPJA 3ABUA 3AG3B 1N36B 5H9CA 1SERA 5GONB 5BR8B 1NVPB 2QSAA 1AJPA 3PJSK 3STLC 2QKSA 4GUNA 3CRAA 4KHPB 3QF7A 3STZC 1AI5A 3KCYA 1XDCA 3JALA 2ZE8A 2W6IG 1YDXA 4KXRA 1I5XA 1M1KW 2EIJC 1VQ6V 5EZYB 4DK1A 5B1BB 4B3TO 4O4JA 2H94A 1OCCB 3D3IA 4O4HB 1FXKA 3LDCA 4I50A 1DF4A 3A2FA 4P9OA 2IM9A 2YI8A 1UPGA 1KD1W 3K3WA 4GX5A 4O4IA 1IVSA 1C3GA 2BSKA 2ZR3A 4MTGA 4DV7O 2K1EA 5LMUO 1VQ4V 1UFIA 4NTWA 4U3JA 3X2QC 2P6JA 2Q7HA 3R65A 2Y69B 1XHZA 1FS0G 1GM9A 3UO3A 4J9ZB 1K73W 4E2LA 1FFXB 5DM6V 1B6QA 3ZMUA 3K04A 2EJRA 3CHXA 1MZEA 2QWQB 1YCIA 2AZ2A 3K0GA 4JAUA 1XAOA 1FAFA 4DV1B 3ABMB 4JI2B 3OEEG 3TGUH 3EFFK 5GW7A 5BZBA 4DR2O 2EINC 1WNSA 4EFEA 2UUBB 1A32A 1H8EG 2ZIOA 3SJBC 2UXDB 3JARA 5EYPB 4EB6A 2ITDC 2ZT9B 4P30A 3F7VC 3I56V 2XAGA 3BABA 1Q82W 2QM8A 3G67A 1IBKB 5DECA 1GN3A 4LNUA 1NKDA 3DC5A 2VQFB 3JCZA 4UCRA 4RQEA 5LP6C 3C6EC 4EFBA 4FM1A 4X9QA 1BQZA 2VS0A 5GTIZ 2DN9A 2Q67A 5LGUA 4X62B 4NYKA 4MVMA 4UV8A 5B1OA 1NS1A 5CA1A 2VRZA 1NT2B 3AG2B 4I50B 1XMOB 4O4HA 4X20A 3HKEA 2VWKA 3KG2A 3K5MA 1MOFA 3TJ9A 1PM9A 5CB4A 5LL6Y 5LP6A 4EKWA 2FL4A 4DR4O 2P22C 2VQEO 4UB8Z 2H8PC 3E8FA 4TV8A 2CTQA 3FKSG 3RYHA 5KLVH 2VQEB 3OT7A 2JZ8A 2UXBB 4LF9B 3WG7C 2YUAA 3K08A 3CE2A 1ZTEA 1YJNV 1H2NA 2RQ6A 1SQPH 3LSUA 1S5HC 2QEXV 1OCZC 2EILB 3SYAA 1CP9A 1N33O 1OCOB 2B1GA 4H37A 2HEPA 2A79B 1HNWB 3WB2A 4GX2A 3RWRD 1YITV 4DRXB 1IBKO 3ETDA 4I9WA 4ZI7B 3LNNA 3LNMB 4PA7A 2AXTZ 4B3SO 3JARB 4UUJC 3SYQA 3OGIB 1G4YB 3JD3A 2Q9LA 1RP3B 4ZI7A 4CH4A 4CH6A 2LJ2A 1GO3F 4JI2O 5KAIZ 4Q6GA 4DR2B 2A3QA 2VWJA 2ZNJA 3QTCA 1HP8A 1TVKB 1IURA 1EARA 3SDLA 5A2QN 5CBFA 2EJ7A 2W6JG 5LXTB 5JQGB 1VARA 1NTMH 2EULA 2R9AA 2EIKB 4YIPA 1VQKV 3FAVB 4JI7B 4PDMA 1SQGA 3U11A 2HP8A 4LFAB 3G6EV 3FYIB 1JJOA 2XTAA 4GZRB 4JAAA 4YJ2B 3NR7A 5L3BA 4J11A 3OMIB 4UVAA 3KZIZ 2WLHA 1PD3A 1I94O 1H2MA 2L35A 4IIJA 4JI5O 1MZFA 3OD4A 2QR4A 4JI5B 1S5JA 2BTOA 2ZDIC 4X20B 4O2BB 3AG4B 1BS3A 3T1HB 4W4KA 2DYRB 4JZGA 5KUKA 4DR5O 3TXQA 1X59A 2WAMA 1OHHG 2F93B 2L6LA 1JFFA 3B8MA 1O9GA 1AROP 4DUYO 2YEVB 2CAZC 3ABMC 3JD0A 2UXBO 2WA3A 2OWOA 3ZEDA 3FFQA 1Z5WA 4LNUB 4X64O 4FLXA 5CMUA 1M57B 2DWEC 1Q6UA 3JYCA 4U7OA 3RFRA 3RYIA 1NR1A 2NN4A 3AGXA 3DTUB 2PF4E 2GUZB 1YTFD 4I55A 2H3OA 2ZR2A 4IYIA 2PY5A 1BHAA 5EZYA 5BMVB 3RT3C 1XMQO 3E83A 3TJTA 4PA6A 1DTOA 3T1HO 4UCUA 5IJ0A 3K79A 4L8JA 1WB8A 4GX1A 3CCLV 4HNAA 2CDYA 1E1QG 5GTHZ 1XHXA 5JQGA 4O2BA 1NH2B 3WB0A 4DW1A 3ZN1A 2QA4V 2WLIA 3W7TA 4HNAB 1S72V 1N4CA 2QWPB 4HBNA 4O4LA 3R66A 2D2CB 5L3FA 1AP5A 1R6NA 4DV0O 4PHZA 2JS5A 3RW0A 1NI8A 2BSKB 3ZHRA 3LSSA 3ZHQA 1GM7A 4DV0B 2AGAA 1QCEA 4D6TH 1YIJV 3X2QB 4MVSA 4PDLA 2ZNIA 4H33A 4NVPA 4MSWC 3L71H 4JASA 1QU7A 4DXWA 4AQYB 3HR0A 3L70H 4G27B 3QG5A 2QDOA 4TUYA 5E79Z 1SESA 4X64B 4O4LB 4FLVA 1GAXA 1XNQB 1H2KA 3EVKA 5J2TA 5B1NA 2LFSA 3ASOB 3LDEA 5IYZA 1LUWA 2PYJA 4DR6O 4I5SA 1SF9A 3N2GB 2ZCEA 2KQXA 4X1YA 2WWWA 2HHHB 4DW0A 1GRJA 5IWAO 4DUYB 2QE7G 3M99B 2Q68A 1Q6IA 3D36A 4CH5A 2NLJC 1X4TA 3JAMN 1N36O 5CN0A 1K92A 2A9HA 1IBMB 2EX3A 2JGUA 3SYPA 4C7UA 4JI6O 1ENVA 3T1YB 1AJNA 2YIBD 2YIBA 2HG5C 3UKMA 4BIUA 1VQLV 1THZA 1FXKC 2IJKA 1F4NA 2F43G 2P4KA 4KFMA 3P3PA 1US6A 1F4MA 1XUQA 2NR5A 1TVKA 3B4SA 2HHHO 4F6RA 3T4DA 4NXMO 5FNVB 1M56B 5CB4B 1G8MA 2GTSA 2EIMB 1VQ7V 2WSSG 5EYPA 4NXNO 3H1KH 1NJIW 3VQVA 1S5LZ 4RUEA 1IDSA 1XQ8A 3ABLB 1KQSU 1OCCC 4DUZO 2QTOA 2Z3YA 4JI7O 3B77A 4NKGB 3E86A 1N32O 3AG1C 2JVMA 1K9MW 4X65B 2IJIA 4FM2A 3RVZA 3AKOB 4I55B 3ZHUA 4ZHQA 2OCCB 2GUZA 4QE9A 2XUMA 1M56C 4GLXA 3G80A 1P4RA 4FK5C 2Q5ZA 1BSMA 2HKOA 4XBFA 2O57A 5C93A 1NZ6A 5LXTA 5C8YB 1BT8A 4U3FH 1WP7A 4HYOA 3SJCC 4UFZA 1Q6HA 2M6YA 2QM4A 3QVNA 4LFBB 2PUSA 3UQ8A 1F51A 4BIZA 1EBOA 3JATA 3D36C 1FD9A 1XL6A 1XBLA 1QR8A 4LF7O 2ITCC 3CC2V 3NXZA 4J41A 3HKEB 3JAWB 2Y69C 2JIZG 3RYFA 4DR3B 2G38A 1G6UA 4IT5A 2DYRC 1CPYA 4F6RB 3BHPA 2EZPA 1I5YA 5JVDB 1D2DA 1JQ0A 4H13B 2QWNB 4YIOA 4F6EA 2WLKA 2ETNA 2OIGA 5GONA 5BXZA 5E1AC 3ASOC 4PI0A 4I7ZB 4DO2A 1ZSPA 3GWKC 5LMNB 1SQBH 3TK1A 3F7YC 2AZ0A 2UUAB 2ZQMA 1AP6A 1NQTA 4LWSA 3AG1B 4WCEV 4JGSA 2E76B 4KUMA 4U7NA 3JATB 3ZJZA 5L3GA 5KAFZ 2LGWA 4JAVA 1J5EB 1N0NA 2GHYA 3O65A 3VOUA 3TCUA 3CCQV 4PDRA 3BPZA 5B3SB 1E79G 2EBOA 4GYCB 1FYJA 4X66B 5IYZB 4B3MB 1KP3A 1SKVA 4JTCB 4X89A 4B3MO 1U97A 4DV6O 5CBHA 2X6CA 4TUYB 3MHSC 2DYSC 5LOVB 2D3OW 2MW2B 3ICXA 4I0XA 2LFRA 4QE7A 2OIEA 3CCJV 1ZLZA 2UUBO 4XDLA 4JYAB 1OCZB 4FLTA 2QKAA 3VQWA 4IYHA 1PP9H 2F95B 5DN6G 4DV4B 5IWAB 2CGNA 1YEWA 3H1HH 2OCHA 3CEIA 3RBZA 5KMGA 3KCXA 1WB7A 1Y76A 2Q73A 1IBLB 4JI6B 4DR1B 3CB2A 4K8XA 3G4SV 1KC8W 1XEQA 2ILMA 3K5LA 5H6QA 3S3XA 1ZL8B 1GKFA 4HZ3A 5BY1A 1BQ0A 1WPXA 4DV5O 1OCRC 3MD0A 3TETA 2YXHA 2ATKC 1R6KA 1PNKA 4PI2A 1TA8A 1WA8A 5LMUB 3OTOB 3FD9A 4QJFB 3HKDA 3APOA 5EIBC 4CS3A 4B7EA 1VF7A 3E22B 1GMWD 3Q4HA 4NR1A 2WLNA 3EHBB 4LBEC 1Q90D 3BCCH 2HVKC 4WF9V 3AG4C 2QKCA 4MTXA 1W2BU 3ASNB 2YXYA 1AR5A 3ZHSA 1YVWA 1KKDA 2GSMB 3OFNG 1I7FA 3BA8A 2JVDA 5IJ9B 1XREA 3W7WA 2P4VA 4XDKA 2UUCB 2F1MA 2Y4TA 2QWRB 1VP7A 1GN6A 5H5NA 2R70A 4YHHB 4JI3O 2C2AA 3BRCA 2V4DA 5EK0A 4YHHO 4GKKB 1SA0A 5FLXN 1URFA 5LGTA 5CA0A 1KU9A 2IU3A 4AI8A 3T2MA 2X6AA 2Z5UA 1S3JA 1V55B 2DOSA 2XOKG 4TWKA 4UCVA 1FFXA 1EN4A 1AJQA 2A0LA 2IH3C 4UXNA 3S3WA 1GTOA 5D5QA 1DLBA 3TJ8A 5LBQA 1N8RW 2HJFC 3SJAC 4MW8A 1JFFB 3E8HA 3KKYA 2QLDA 1Y66A 3CXHF 1U96A 5D5PA 3JSNA 4LCUC 5B1BC 5BMVA 3TXSA 2EIJB 4WBNB 4B08A 5JJEB 1H2GA 3GVMA 2DWDC 3JASB 5FL7G 3CCRV 1PPJH 3JAKB 5IDJA 2BTQA 2Y48A 5IT9N 4ZOLA 2RCVA 1LUVA 4TT3G 1FKAO 1BCCH 2ODMA 4DR6B 4JI1B 4LF4B 4BR6A 4MTOA 3TJAA 4IHJA 3CCSV 2Y4UA 1RSOA 2YI9A 4JI8O 3BEHA 2FMLA 1WJZA 4A5UB 4MVZA 1RFYA 2DQ3A 1ZAUA 4X1YB 3ZHTA 3CMEV 3ZCCA 2Q69A 1XOUA 1YXBA 4KHPO 1QNMA 1F7YA 2CK3G 2GV9A 3F5WC 1N34B 3K59A 1JMKC 3CP1A 1YTFB 1NR7A 1BE3H 2PGGA 3AEIA 1H38A 3CJHA 4J7KA 2DJVA 1B06A 1COWG 4P2ZA 1MA1A 2Q7EA 3IJ4A 4I9QA 1KMIZ 2ZXWB 2X6BA 5IYCO 3UM7A 4ZIBA 1GN2A 5L3DA 3CRMA 4R8CA 5HFLA 3ZRXA 1EB0A 1K34A 5A9GA 3B40A 2ZDIA 5LA6A 1SETA 5H2FZ 4I4TA 3ZRSA 3VBBA 4ABMA 3JD2A 4YJ3B 3L72H 4QIWF 1OCOC 1Q43A 4K8ZA 4PA9A 4E4EA 1I94B 3ASNC 4R6ZA 4FLYA 5KX5A 2ADPA 2PYLA 3A0HZ 3L9ZA 1NVPD 1TGOA 4IGGA 2YS8A 5KHJA 1HNZB 2F4VB 3IC7A 1SZXA 2A06H 4LF8O 1N32B 4EB6B 1OJHA 4FJCC 4FLZA 4K0KB 2UU9B 3DXRA 1YZBA 4JI4B 3L74H 4JI8B 4TV8B 2P90A 2RJZA 2N04A 3B09A 2XAJA 5LYJA 3ZRWB 1SC5B 4J9YB 4OXSA 1OV9A 5JWPA 5CA1B 4Z1VA 2EILC 5IYDO 1NLTA 5ITZA 1MMMA 1KKCA 3F5TA 1AI7A 4RQFA 4X88A 2YIAA 4NXMB 1KUQA 2AHZA 3JCUZ 3LZ8A 1KB9F 4R7CA 1SQQH 4JYBA 2CTWA 3L75H 2OCCC 2FKXA 1L8DA 2KB1A 2V7QG 2R9IA 2PI5A 2PTMA 2WA4A 3FB8C 1PNMA 5CA3A 4LFBO 2ZINA 4IIJB 4DR7O 3THOA 3AG3C 4WFEA 4CS2A 1WP8A 2DW4A 1EM1A 1KP2A 4J7ZA 1RM1B 2BOBC 3HKBB 2JRIA 3ZRWA 2WLLA 4GX0A 3RYCB 4DR1O 2JRRA 4K0KO 1Q81W 1QR9A 1VF6A 1Y4MA 4N21A 3CRQA 4BAYA 3ZN0A 5LHGA 4X62O 4J80A 1AVMA 4LC1A 3H1JH 3K9AA 4KP4A 3DXRB 1R1BA 1KYOF 4MVQA 4DV7B 1PKXA 1DGSA 1TUBB 1W0KG 1JOYA 3A0RA 1VQNV 4L3KA 1BMFG 1SZTA 4LF5B 3FB6C 3CWBH 1ZWIC 5LMNO 1IZ3A 2M7WA 3HKCA 1TUBA 2WLMA 4FFBA 4D7TA 3DSQA 4DV6B 3C5XC 1AI6A 3K5OA 3WG7B 2K9PA 4DV1O 2WLJA 4FM0A 1QVGU 1M5IA 3SGIA 4WFGA 4RWUA 5L3EA 1M4UA 5EC1C 1EFRG 1VIBA 2UXCO 2JS3A 4FFBB 1E1RG 4K3AA 3OW2U 4MS2A 3W7SA 2X7RB 3FB5C 4OX9O 2FTKA 1Y67A 4O4IB 4WFHA 4DV3O 1QLEC 3OM3B 2F66C 2R72A 1K3EA 3ABLC 4RO2A 1AI4A 2XAQA 4B3SB 3B2EE
chains in the Genus database with same CATH topology
3I38A 3TJ8A 2DMXA 2CUGA 2LGWA 2N04A 2B26A 1N4CA 1GMWD 2CTQA 1NLTA 2QWPB 3NXZA 4J80A 1C3GA 2KQXA 3L9ZA 3NY0A 2QWQB 1BQ0A 3AG7A 2QLDA 2M6YA 4IT5A 2Q2GA 2YS8A 2YUAA 1EB0A 1XAOA 1FAFA 3AGZA 2OCHA 3LA0A 1GMUA 3TJAA 2Y4TA 1GH6A 2GUZA 2QWRB 3TJ9A 3UO3A 2Y4UA 1IURA 2CTRA 1HDJA 1GMVA 1EARA 3UO2A 1GMWA 3AGXA 2PF4E 2GUZB 4J7ZA 3UCSC 1XBLA 2QSAA 3APQA 3LZ8A 2L6LA 4L3KA 2EJ7A 2QWNB 2CTWA 3AGYA 1FPOA 2CTPA 2LO1A 1WJZA 3BVOA 1BQZA 3APOA 2DN9A 2N05A 2QWOB 1NZ6A 4RWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I38 A;  3TJ8 A;  2DMX A;  2CUG A;  2LGW A;  2N04 A;  2B26 A;  1N4C A;  1GMW D;  2CTQ A;  1NLT A;  2QWP B;  3NXZ A;  4J80 A;  1C3G A;  2KQX A;  3L9Z A;  3NY0 A;  2QWQ B;  1BQ0 A;  3AG7 A;  2QLD A;  2M6Y A;  4IT5 A;  2Q2G A;  2YS8 A;  2YUA A;  1EB0 A;  1XAO A;  1FAF A;  3AGZ A;  2OCH A;  3LA0 A;  1GMU A;  3TJA A;  2Y4T A;  1GH6 A;  2GUZ A;  2QWR B;  3TJ9 A;  3UO3 A;  2Y4U A;  1IUR A;  2CTR A;  1HDJ A;  1GMV A;  1EAR A;  3UO2 A;  1GMW A;  3AGX A;  2PF4 E;  2GUZ B;  4J7Z A;  3UCS C;  1XBL A;  2QSA A;  3APQ A;  3LZ8 A;  2L6L A;  4L3K A;  2EJ7 A;  2QWN B;  2CTW A;  3AGY A;  1FPO A;  2CTP A;  2LO1 A;  1WJZ A;  3BVO A;  1BQZ A;  3APO A;  2DN9 A;  2N05 A;  2QWO B;  1NZ6 A;  4RWU A; 
#chains in the Genus database with same CATH topology
 4LF7 B;  3ZS8 C;  1R3I C;  3OR6 C;  1YF2 A;  3H9V A;  4BIO A;  4JYC A;  4G2K A;  2IJH A;  1FXH A;  2XAF A;  1AIL A;  2NNU A;  4X1K A;  2UXC B;  3CCM V;  5KA5 A;  4DK0 A;  1Y74 A;  3RYF B;  4FVM A;  3K03 A;  1QQC A;  4PJ0 Z;  4JI0 O;  3SPH A;  1J95 A;  5J2T B;  4WFB V;  1MG1 A;  1P7B A;  4JV5 B;  1R6T A;  4UVC A;  5BR8 O;  2V1D A;  2BE3 A;  4P9P A;  1EN6 A;  1YHQ V;  2AW9 A;  2HFE C;  2ZXW C;  1D5N A;  2P06 A;  4JI1 O;  5LGN A;  5C8Y A;  2F4V O;  4X8A A;  1SQF A;  1L1F A;  3OAA G;  5FPO A;  5KA6 A;  2Q2G A;  1IX9 A;  5IY5 B;  5J2U A;  2Z0A A;  1HDJ A;  5KX5 B;  1WPB A;  1SS3 A;  4UB6 Z;  1VQP V;  1NBM G;  4JYY A;  4PD4 F;  4ICG A;  1K7D A;  2EIN B;  2JJ1 G;  1YJW V;  3VQY A;  2Q7G A;  3HPL C;  1GN4 A;  2YSU B;  4X1I A;  5JCO A;  4BWA A;  4JI3 B;  3SPG A;  3LSQ A;  3ABK C;  2WLI B;  1R3L C;  1QBZ A;  3ML0 A;  1FXV A;  2Y0I A;  1PL4 A;  2ZE5 A;  3QO5 A;  3K9S A;  1NU1 H;  5LHH A;  2R9R B;  1R73 A;  4CC5 A;  1ORQ C;  4LF6 B;  4PV1 B;  2IJJ A;  4ZKI A;  3EXA A;  1XMQ B;  4TV9 B;  4B7K A;  4JTA B;  2OTJ V;  2RNB A;  4J42 A;  4MW3 A;  3QNE A;  5FNV A;  2AHY A;  4AHC A;  4JZ2 A;  1VQ9 V;  1PV0 A;  4MVR A;  1NTK H;  3OGC C;  1JR9 A;  5JCO C;  1QLN A;  2A7W A;  1VMG A;  2KKW A;  1K8A W;  1FXK B;  3JSL A;  5J2U B;  2X0L A;  3K58 A;  4PDV A;  4O4J B;  2HVJ C;  4LH7 A;  2OT5 A;  1O9H A;  3AK1 A;  2RN9 A;  4DR7 B;  2ZE7 A;  5JH7 A;  4IHJ B;  3CCV V;  1JCH A;  3AG7 A;  5JJN B;  3IAY A;  4LF4 O;  2DYS B;  2W0X A;  5KHH A;  3NXS A;  2YXL A;  3OTO O;  4B3R B;  3SPI A;  3JAS A;  1XNR B;  4LH6 A;  4B3R O;  2KG7 A;  4OPA A;  1SQX H;  1H2L A;  1QHT A;  2E3C A;  3N2G A;  3CS5 A;  1K97 A;  1BL8 A;  2JEX A;  1IXB A;  4Z2W A;  3ZRV A;  5EBM C;  2IH1 C;  1JVM A;  4YXW G;  1S0V A;  1K5Q A;  5TIS Z;  3ZBH A;  2LW7 A;  4D7S A;  2P7T C;  5B1A C;  1M93 A;  4LF5 O;  3FAV A;  4DV2 B;  4LP8 A;  1YSC A;  3CC7 V;  2RDC A;  1JA8 A;  1Q3E A;  4DV2 O;  3G71 V;  3BY6 A;  1HNZ O;  1V54 C;  5LA6 B;  4JYA O;  3OEH G;  3DC6 A;  2QTS A;  3OTF A;  1WN7 A;  2UXX A;  1AR1 B;  3CRC A;  4OGQ B;  2CH7 B;  4F4L A;  1FFT B;  1N33 B;  4O2A A;  4MVO A;  3D3Q A;  1W59 A;  1KBH A;  4GKK O;  1ROP A;  5B1A B;  4W4L A;  3MDS A;  1Q5O A;  2JEU A;  3FB7 C;  2UXN A;  3CMA V;  4EEQ A;  2GBO A;  1VQ5 V;  1S77 D;  1I0H A;  1M57 C;  3T1Y O;  5L3C A;  3AGZ A;  2Q0A A;  1Y74 B;  4FPP A;  1R3K C;  4BW9 A;  1YI2 V;  2PI4 A;  3CCE V;  2OYQ A;  2JDI G;  3HB3 B;  1RPO A;  3T4Z A;  2XT9 A;  5IJ0 B;  1YJ9 V;  2XHB A;  1K4C C;  1RSO B;  3A0B Z;  2JGD A;  4CS4 A;  1MSD A;  2E5L O;  1V9P A;  2ODX A;  2QM7 A;  3OR7 C;  4PA3 A;  2CGO A;  3Q4H B;  2KG7 B;  1K4D C;  1N34 O;  3JD1 A;  4DR4 B;  2LQT A;  3E22 A;  2Q6A A;  3RYH B;  1HR0 B;  1Z5V A;  4OPH A;  5EBL C;  4LFA O;  1D5A A;  4B3T B;  4R50 A;  5LP6 B;  3WFV A;  3I55 V;  4TV9 A;  4GKJ O;  1BHB A;  1K5S A;  4XDJ A;  2UU9 O;  1SQV H;  1ZL8 A;  3JD4 A;  3BA9 A;  1B04 A;  2ZIM A;  3ZIA G;  2GTA A;  3CX5 F;  3E8G A;  1G1X B;  2BOC C;  2E74 B;  2ZE6 A;  1XMO O;  3GWO A;  1AR4 A;  5HFM A;  3OMA B;  2YIC A;  1Q7Y W;  3CSX A;  4CZZ A;  4GCZ A;  4JF3 A;  1Q8I A;  3HKD B;  1UJW B;  3H01 A;  3U10 A;  1P84 F;  3CXC U;  4DV4 O;  1KEC A;  5CA0 B;  1WLE A;  4YJ2 A;  1JPX A;  2LW1 A;  1M9N A;  2N05 A;  3UT5 A;  3OMN B;  3CYO A;  4J10 A;  3FX7 A;  4JI4 O;  3AK2 A;  3OUS A;  3A8T A;  4DR3 O;  1LNQ A;  4Z1M G;  1Z2G A;  2EZO A;  2KSD A;  5B5E Z;  3ETG A;  5DED A;  3W7X A;  1JJ2 U;  4LF6 O;  5LHI A;  4CBC A;  1WAZ A;  3C3T A;  4TOI A;  2DE0 X;  1NH2 D;  2LO1 A;  4UCS A;  4I4T B;  4N23 A;  4X66 O;  1L0L H;  4YY3 B;  1L0N H;  3K57 A;  5FPR A;  3OE7 G;  3I5D A;  4JV5 O;  3D8C A;  1HNX B;  3H1L H;  1VQ8 V;  3SR2 C;  5B66 Z;  3E2E A;  2P5O A;  5IY5 C;  1GM8 A;  1PL0 A;  3MHH C;  4LF9 O;  3M7M X;  4LR3 A;  3HKC B;  1B3Q A;  5EBW C;  4DRX A;  4I0X B;  1J5E O;  5EIB D;  2ZM6 O;  2W0F C;  2CH7 A;  3I38 A;  3LUT B;  2JJ2 G;  1EZV H;  3J81 N;  3WB1 A;  5AG2 A;  4LWS B;  4KL1 A;  3ZHV A;  3VQX A;  3K5N A;  2YC0 A;  2FB5 A;  4NXN B;  3SJQ C;  1LR1 A;  2QJ1 A;  1MSW D;  2UUC O;  2PZS A;  1XNR O;  1FPO A;  1S76 D;  2VQF O;  2DQ0 A;  3ZMV A;  2WLL B;  3JAL B;  3RYC A;  2IBZ H;  2DMX A;  2LGQ A;  4JI0 B;  4GKJ B;  1DK1 A;  5KMG B;  1RM1 C;  2Q0O C;  3NY0 A;  1MNG A;  1VF5 B;  2E75 B;  3CJH B;  4UCO A;  4K35 A;  2N74 A;  4LFC O;  1HW7 A;  5IE9 A;  3SYC A;  4MT8 A;  4ZOL B;  3P3N A;  1TUE B;  3AK3 A;  3RGB A;  3U0Z A;  5CBG A;  3IC9 A;  1BGY H;  5K1P A;  4WFF A;  5EC2 C;  4WBN A;  5KHK A;  3C90 A;  4J7J A;  4L87 A;  2B26 A;  3H1I H;  4RUF A;  1I08 A;  4NTY A;  3ZMZ A;  2JGD B;  1SRY A;  3P30 A;  3K0D A;  1XIL A;  4Q20 A;  5F2V O;  5JH7 B;  4UVB A;  1HNX O;  2LP7 A;  5JVD A;  3CCU V;  5ITZ B;  1FJG B;  2YID A;  4JPR A;  4FFK A;  1FJG O;  2EIK C;  3WU2 Z;  3IGA C;  5KHI A;  1Y6X A;  2B5U A;  4BW5 A;  2Q4P A;  3W7U A;  1N0J A;  4ZHQ B;  3BAA A;  1M90 W;  2HLD G;  1HNW O;  1MAB G;  1QVF U;  1GMU A;  3BFR A;  5LYJ B;  4DYL A;  5K1X A;  4QNH B;  1RPR A;  4FZ1 A;  4RAI A;  4YY3 O;  2ADQ B;  3ZX6 A;  2IU0 A;  2CTP A;  3BVO A;  2CE4 A;  4FLU A;  1K33 A;  4ASU G;  3M8A A;  1V55 C;  5J9P C;  5B3S C;  2F23 A;  2UUA O;  3UT5 B;  3DGE A;  2FYU H;  5KHG A;  2QGN A;  4G28 B;  4FZ0 A;  1XL4 A;  4LFC B;  4X1I B;  2YDE A;  4U3J B;  1R3J C;  3MAQ A;  1Q86 W;  3J80 N;  3HKB A;  2B9Z A;  5H6R A;  3ETE A;  1CXZ B;  1SA0 B;  3SPJ A;  2B1I A;  3SYO A;  3J7A U;  3QO8 A;  4H44 B;  4IL6 Z;  3CRR A;  2ZD9 A;  4FMT A;  4NB5 A;  2EIM C;  3CPW U;  2BTQ B;  3L9D A;  3N2K A;  1GK9 A;  1GMV A;  3JAW A;  4DV3 B;  1H8H G;  2MK3 A;  3P32 A;  3QO7 A;  5IJ9 A;  1IBM O;  3ZMT A;  3T1C A;  2QWO B;  3RVY A;  1NTZ H;  1F23 A;  1OCR B;  1ZX3 A;  2GDS A;  1IBL O;  4CH3 A;  3N27 A;  4HAM A;  2YEV A;  2ZKO A;  4QGP A;  1VQO V;  1XNQ O;  3N2K B;  1CEZ A;  4DV5 B;  3RN4 A;  1GMW A;  3AG2 C;  2HJD A;  4DR5 B;  1OZ0 A;  4JTD B;  1Y76 B;  4AIL C;  1AB3 A;  4PA4 A;  4UCT A;  4CC6 A;  4GT1 A;  2CUG A;  5JJJ B;  4NTX A;  1H2S B;  3CD6 V;  3CC4 V;  1P7G A;  2E5L B;  3E35 A;  4MTF A;  2IW5 A;  4AQY O;  2WPD G;  1QLE B;  3ABT A;  3SPC A;  2Q8V A;  4DUZ B;  1DF5 A;  3APQ A;  1HR0 O;  3PN1 A;  4MVU A;  1VEW A;  3C3S A;  3L73 H;  4X65 O;  1T5E A;  1VF6 C;  3K06 A;  4H0L B;  4LF8 B;  5LOV A;  4O2A B;  4FLW A;  3O9O A;  4FIP C;  1P49 A;  1EZJ A;  4OX9 B;  2OTL V;  1GH6 A;  3G6B A;  2CTR A;  1IXM A;  1XI1 A;  3UCS C;  1EN5 A;  2ZM6 B;  3ABK B;  1GMG A;  1PNL A;  3GB7 C;  3ZMS A;  3E8B A;  3IFX A;  4YJ3 A;  2JK5 C;  3LDD A;  5IYB O;  3B8N A;  4ZBM A;  4WFA V;  1ZUQ A;  2UXD O;  4X1K B;  1V54 B;  5KUM A;  3ETQ A;  3LA0 A;  1VQM V;  3OUF A;  1BZK A;  4PEL A;  2Y0P A;  3UO2 A;  3FYE B;  4TQD A;  1TAE A;  4TQF A;  4UV9 A;  1HWY A;  3AGY A;  4QPK A;  2ARH A;  2BCC H;  4TSF G;  1W0J G;  2HR3 A;  1WA8 B;  2P67 A;  2XAS A;  2XND G;  3RYI B;  2RMK B;  3E89 A;  3JAK A;  1JX9 A;  2XAH A;  4QPJ A;  3ABU A;  3AG3 B;  1N36 B;  5H9C A;  1SER A;  5GON B;  5BR8 B;  1NVP B;  2QSA A;  1AJP A;  3PJS K;  3STL C;  2QKS A;  4GUN A;  3CRA A;  4KHP B;  3QF7 A;  3STZ C;  1AI5 A;  3KCY A;  1XDC A;  3JAL A;  2ZE8 A;  2W6I G;  1YDX A;  4KXR A;  1I5X A;  1M1K W;  2EIJ C;  1VQ6 V;  5EZY B;  4DK1 A;  5B1B B;  4B3T O;  4O4J A;  2H94 A;  1OCC B;  3D3I A;  4O4H B;  1FXK A;  3LDC A;  4I50 A;  1DF4 A;  3A2F A;  4P9O A;  2IM9 A;  2YI8 A;  1UPG A;  1KD1 W;  3K3W A;  4GX5 A;  4O4I A;  1IVS A;  1C3G A;  2BSK A;  2ZR3 A;  4MTG A;  4DV7 O;  2K1E A;  5LMU O;  1VQ4 V;  1UFI A;  4NTW A;  4U3J A;  3X2Q C;  2P6J A;  2Q7H A;  3R65 A;  2Y69 B;  1XHZ A;  1FS0 G;  1GM9 A;  3UO3 A;  4J9Z B;  1K73 W;  4E2L A;  1FFX B;  5DM6 V;  1B6Q A;  3ZMU A;  3K04 A;  2EJR A;  3CHX A;  1MZE A;  2QWQ B;  1YCI A;  2AZ2 A;  3K0G A;  4JAU A;  1XAO A;  1FAF A;  4DV1 B;  3ABM B;  4JI2 B;  3OEE G;  3TGU H;  3EFF K;  5GW7 A;  5BZB A;  4DR2 O;  2EIN C;  1WNS A;  4EFE A;  2UUB B;  1A32 A;  1H8E G;  2ZIO A;  3SJB C;  2UXD B;  3JAR A;  5EYP B;  4EB6 A;  2ITD C;  2ZT9 B;  4P30 A;  3F7V C;  3I56 V;  2XAG A;  3BAB A;  1Q82 W;  2QM8 A;  3G67 A;  1IBK B;  5DEC A;  1GN3 A;  4LNU A;  1NKD A;  3DC5 A;  2VQF B;  3JCZ A;  4UCR A;  4RQE A;  5LP6 C;  3C6E C;  4EFB A;  4FM1 A;  4X9Q A;  1BQZ A;  2VS0 A;  5GTI Z;  2DN9 A;  2Q67 A;  5LGU A;  4X62 B;  4NYK A;  4MVM A;  4UV8 A;  5B1O A;  1NS1 A;  5CA1 A;  2VRZ A;  1NT2 B;  3AG2 B;  4I50 B;  1XMO B;  4O4H A;  4X20 A;  3HKE A;  2VWK A;  3KG2 A;  3K5M A;  1MOF A;  3TJ9 A;  1PM9 A;  5CB4 A;  5LL6 Y;  5LP6 A;  4EKW A;  2FL4 A;  4DR4 O;  2P22 C;  2VQE O;  4UB8 Z;  2H8P C;  3E8F A;  4TV8 A;  2CTQ A;  3FKS G;  3RYH A;  5KLV H;  2VQE B;  3OT7 A;  2JZ8 A;  2UXB B;  4LF9 B;  3WG7 C;  2YUA A;  3K08 A;  3CE2 A;  1ZTE A;  1YJN V;  1H2N A;  2RQ6 A;  1SQP H;  3LSU A;  1S5H C;  2QEX V;  1OCZ C;  2EIL B;  3SYA A;  1CP9 A;  1N33 O;  1OCO B;  2B1G A;  4H37 A;  2HEP A;  2A79 B;  1HNW B;  3WB2 A;  4GX2 A;  3RWR D;  1YIT V;  4DRX B;  1IBK O;  3ETD A;  4I9W A;  4ZI7 B;  3LNN A;  3LNM B;  4PA7 A;  2AXT Z;  4B3S O;  3JAR B;  4UUJ C;  3SYQ A;  3OGI B;  1G4Y B;  3JD3 A;  2Q9L A;  1RP3 B;  4ZI7 A;  4CH4 A;  4CH6 A;  2LJ2 A;  1GO3 F;  4JI2 O;  5KAI Z;  4Q6G A;  4DR2 B;  2A3Q A;  2VWJ A;  2ZNJ A;  3QTC A;  1HP8 A;  1TVK B;  1IUR A;  1EAR A;  3SDL A;  5A2Q N;  5CBF A;  2EJ7 A;  2W6J G;  5LXT B;  5JQG B;  1VAR A;  1NTM H;  2EUL A;  2R9A A;  2EIK B;  4YIP A;  1VQK V;  3FAV B;  4JI7 B;  4PDM A;  1SQG A;  3U11 A;  2HP8 A;  4LFA B;  3G6E V;  3FYI B;  1JJO A;  2XTA A;  4GZR B;  4JAA A;  4YJ2 B;  3NR7 A;  5L3B A;  4J11 A;  3OMI B;  4UVA A;  3KZI Z;  2WLH A;  1PD3 A;  1I94 O;  1H2M A;  2L35 A;  4IIJ A;  4JI5 O;  1MZF A;  3OD4 A;  2QR4 A;  4JI5 B;  1S5J A;  2BTO A;  2ZDI C;  4X20 B;  4O2B B;  3AG4 B;  1BS3 A;  3T1H B;  4W4K A;  2DYR B;  4JZG A;  5KUK A;  4DR5 O;  3TXQ A;  1X59 A;  2WAM A;  1OHH G;  2F93 B;  2L6L A;  1JFF A;  3B8M A;  1O9G A;  1ARO P;  4DUY O;  2YEV B;  2CAZ C;  3ABM C;  3JD0 A;  2UXB O;  2WA3 A;  2OWO A;  3ZED A;  3FFQ A;  1Z5W A;  4LNU B;  4X64 O;  4FLX A;  5CMU A;  1M57 B;  2DWE C;  1Q6U A;  3JYC A;  4U7O A;  3RFR A;  3RYI A;  1NR1 A;  2NN4 A;  3AGX A;  3DTU B;  2PF4 E;  2GUZ B;  1YTF D;  4I55 A;  2H3O A;  2ZR2 A;  4IYI A;  2PY5 A;  1BHA A;  5EZY A;  5BMV B;  3RT3 C;  1XMQ O;  3E83 A;  3TJT A;  4PA6 A;  1DTO A;  3T1H O;  4UCU A;  5IJ0 A;  3K79 A;  4L8J A;  1WB8 A;  4GX1 A;  3CCL V;  4HNA A;  2CDY A;  1E1Q G;  5GTH Z;  1XHX A;  5JQG A;  4O2B A;  1NH2 B;  3WB0 A;  4DW1 A;  3ZN1 A;  2QA4 V;  2WLI A;  3W7T A;  4HNA B;  1S72 V;  1N4C A;  2QWP B;  4HBN A;  4O4L A;  3R66 A;  2D2C B;  5L3F A;  1AP5 A;  1R6N A;  4DV0 O;  4PHZ A;  2JS5 A;  3RW0 A;  1NI8 A;  2BSK B;  3ZHR A;  3LSS A;  3ZHQ A;  1GM7 A;  4DV0 B;  2AGA A;  1QCE A;  4D6T H;  1YIJ V;  3X2Q B;  4MVS A;  4PDL A;  2ZNI A;  4H33 A;  4NVP A;  4MSW C;  3L71 H;  4JAS A;  1QU7 A;  4DXW A;  4AQY B;  3HR0 A;  3L70 H;  4G27 B;  3QG5 A;  2QDO A;  4TUY A;  5E79 Z;  1SES A;  4X64 B;  4O4L B;  4FLV A;  1GAX A;  1XNQ B;  1H2K A;  3EVK A;  5J2T A;  5B1N A;  2LFS A;  3ASO B;  3LDE A;  5IYZ A;  1LUW A;  2PYJ A;  4DR6 O;  4I5S A;  1SF9 A;  3N2G B;  2ZCE A;  2KQX A;  4X1Y A;  2WWW A;  2HHH B;  4DW0 A;  1GRJ A;  5IWA O;  4DUY B;  2QE7 G;  3M99 B;  2Q68 A;  1Q6I A;  3D36 A;  4CH5 A;  2NLJ C;  1X4T A;  3JAM N;  1N36 O;  5CN0 A;  1K92 A;  2A9H A;  1IBM B;  2EX3 A;  2JGU A;  3SYP A;  4C7U A;  4JI6 O;  1ENV A;  3T1Y B;  1AJN A;  2YIB D;  2YIB A;  2HG5 C;  3UKM A;  4BIU A;  1VQL V;  1THZ A;  1FXK C;  2IJK A;  1F4N A;  2F43 G;  2P4K A;  4KFM A;  3P3P A;  1US6 A;  1F4M A;  1XUQ A;  2NR5 A;  1TVK A;  3B4S A;  2HHH O;  4F6R A;  3T4D A;  4NXM O;  5FNV B;  1M56 B;  5CB4 B;  1G8M A;  2GTS A;  2EIM B;  1VQ7 V;  2WSS G;  5EYP A;  4NXN O;  3H1K H;  1NJI W;  3VQV A;  1S5L Z;  4RUE A;  1IDS A;  1XQ8 A;  3ABL B;  1KQS U;  1OCC C;  4DUZ O;  2QTO A;  2Z3Y A;  4JI7 O;  3B77 A;  4NKG B;  3E86 A;  1N32 O;  3AG1 C;  2JVM A;  1K9M W;  4X65 B;  2IJI A;  4FM2 A;  3RVZ A;  3AKO B;  4I55 B;  3ZHU A;  4ZHQ A;  2OCC B;  2GUZ A;  4QE9 A;  2XUM A;  1M56 C;  4GLX A;  3G80 A;  1P4R A;  4FK5 C;  2Q5Z A;  1BSM A;  2HKO A;  4XBF A;  2O57 A;  5C93 A;  1NZ6 A;  5LXT A;  5C8Y B;  1BT8 A;  4U3F H;  1WP7 A;  4HYO A;  3SJC C;  4UFZ A;  1Q6H A;  2M6Y A;  2QM4 A;  3QVN A;  4LFB B;  2PUS A;  3UQ8 A;  1F51 A;  4BIZ A;  1EBO A;  3JAT A;  3D36 C;  1FD9 A;  1XL6 A;  1XBL A;  1QR8 A;  4LF7 O;  2ITC C;  3CC2 V;  3NXZ A;  4J41 A;  3HKE B;  3JAW B;  2Y69 C;  2JIZ G;  3RYF A;  4DR3 B;  2G38 A;  1G6U A;  4IT5 A;  2DYR C;  1CPY A;  4F6R B;  3BHP A;  2EZP A;  1I5Y A;  5JVD B;  1D2D A;  1JQ0 A;  4H13 B;  2QWN B;  4YIO A;  4F6E A;  2WLK A;  2ETN A;  2OIG A;  5GON A;  5BXZ A;  5E1A C;  3ASO C;  4PI0 A;  4I7Z B;  4DO2 A;  1ZSP A;  3GWK C;  5LMN B;  1SQB H;  3TK1 A;  3F7Y C;  2AZ0 A;  2UUA B;  2ZQM A;  1AP6 A;  1NQT A;  4LWS A;  3AG1 B;  4WCE V;  4JGS A;  2E76 B;  4KUM A;  4U7N A;  3JAT B;  3ZJZ A;  5L3G A;  5KAF Z;  2LGW A;  4JAV A;  1J5E B;  1N0N A;  2GHY A;  3O65 A;  3VOU A;  3TCU A;  3CCQ V;  4PDR A;  3BPZ A;  5B3S B;  1E79 G;  2EBO A;  4GYC B;  1FYJ A;  4X66 B;  5IYZ B;  4B3M B;  1KP3 A;  1SKV A;  4JTC B;  4X89 A;  4B3M O;  1U97 A;  4DV6 O;  5CBH A;  2X6C A;  4TUY B;  3MHS C;  2DYS C;  5LOV B;  2D3O W;  2MW2 B;  3ICX A;  4I0X A;  2LFR A;  4QE7 A;  2OIE A;  3CCJ V;  1ZLZ A;  2UUB O;  4XDL A;  4JYA B;  1OCZ B;  4FLT A;  2QKA A;  3VQW A;  4IYH A;  1PP9 H;  2F95 B;  5DN6 G;  4DV4 B;  5IWA B;  2CGN A;  1YEW A;  3H1H H;  2OCH A;  3CEI A;  3RBZ A;  5KMG A;  3KCX A;  1WB7 A;  1Y76 A;  2Q73 A;  1IBL B;  4JI6 B;  4DR1 B;  3CB2 A;  4K8X A;  3G4S V;  1KC8 W;  1XEQ A;  2ILM A;  3K5L A;  5H6Q A;  3S3X A;  1ZL8 B;  1GKF A;  4HZ3 A;  5BY1 A;  1BQ0 A;  1WPX A;  4DV5 O;  1OCR C;  3MD0 A;  3TET A;  2YXH A;  2ATK C;  1R6K A;  1PNK A;  4PI2 A;  1TA8 A;  1WA8 A;  5LMU B;  3OTO B;  3FD9 A;  4QJF B;  3HKD A;  3APO A;  5EIB C;  4CS3 A;  4B7E A;  1VF7 A;  3E22 B;  1GMW D;  3Q4H A;  4NR1 A;  2WLN A;  3EHB B;  4LBE C;  1Q90 D;  3BCC H;  2HVK C;  4WF9 V;  3AG4 C;  2QKC A;  4MTX A;  1W2B U;  3ASN B;  2YXY A;  1AR5 A;  3ZHS A;  1YVW A;  1KKD A;  2GSM B;  3OFN G;  1I7F A;  3BA8 A;  2JVD A;  5IJ9 B;  1XRE A;  3W7W A;  2P4V A;  4XDK A;  2UUC B;  2F1M A;  2Y4T A;  2QWR B;  1VP7 A;  1GN6 A;  5H5N A;  2R70 A;  4YHH B;  4JI3 O;  2C2A A;  3BRC A;  2V4D A;  5EK0 A;  4YHH O;  4GKK B;  1SA0 A;  5FLX N;  1URF A;  5LGT A;  5CA0 A;  1KU9 A;  2IU3 A;  4AI8 A;  3T2M A;  2X6A A;  2Z5U A;  1S3J A;  1V55 B;  2DOS A;  2XOK G;  4TWK A;  4UCV A;  1FFX A;  1EN4 A;  1AJQ A;  2A0L A;  2IH3 C;  4UXN A;  3S3W A;  1GTO A;  5D5Q A;  1DLB A;  3TJ8 A;  5LBQ A;  1N8R W;  2HJF C;  3SJA C;  4MW8 A;  1JFF B;  3E8H A;  3KKY A;  2QLD A;  1Y66 A;  3CXH F;  1U96 A;  5D5P A;  3JSN A;  4LCU C;  5B1B C;  5BMV A;  3TXS A;  2EIJ B;  4WBN B;  4B08 A;  5JJE B;  1H2G A;  3GVM A;  2DWD C;  3JAS B;  5FL7 G;  3CCR V;  1PPJ H;  3JAK B;  5IDJ A;  2BTQ A;  2Y48 A;  5IT9 N;  4ZOL A;  2RCV A;  1LUV A;  4TT3 G;  1FKA O;  1BCC H;  2ODM A;  4DR6 B;  4JI1 B;  4LF4 B;  4BR6 A;  4MTO A;  3TJA A;  4IHJ A;  3CCS V;  2Y4U A;  1RSO A;  2YI9 A;  4JI8 O;  3BEH A;  2FML A;  1WJZ A;  4A5U B;  4MVZ A;  1RFY A;  2DQ3 A;  1ZAU A;  4X1Y B;  3ZHT A;  3CME V;  3ZCC A;  2Q69 A;  1XOU A;  1YXB A;  4KHP O;  1QNM A;  1F7Y A;  2CK3 G;  2GV9 A;  3F5W C;  1N34 B;  3K59 A;  1JMK C;  3CP1 A;  1YTF B;  1NR7 A;  1BE3 H;  2PGG A;  3AEI A;  1H38 A;  3CJH A;  4J7K A;  2DJV A;  1B06 A;  1COW G;  4P2Z A;  1MA1 A;  2Q7E A;  3IJ4 A;  4I9Q A;  1KMI Z;  2ZXW B;  2X6B A;  5IYC O;  3UM7 A;  4ZIB A;  1GN2 A;  5L3D A;  3CRM A;  4R8C A;  5HFL A;  3ZRX A;  1EB0 A;  1K34 A;  5A9G A;  3B40 A;  2ZDI A;  5LA6 A;  1SET A;  5H2F Z;  4I4T A;  3ZRS A;  3VBB A;  4ABM A;  3JD2 A;  4YJ3 B;  3L72 H;  4QIW F;  1OCO C;  1Q43 A;  4K8Z A;  4PA9 A;  4E4E A;  1I94 B;  3ASN C;  4R6Z A;  4FLY A;  5KX5 A;  2ADP A;  2PYL A;  3A0H Z;  3L9Z A;  1NVP D;  1TGO A;  4IGG A;  2YS8 A;  5KHJ A;  1HNZ B;  2F4V B;  3IC7 A;  1SZX A;  2A06 H;  4LF8 O;  1N32 B;  4EB6 B;  1OJH A;  4FJC C;  4FLZ A;  4K0K B;  2UU9 B;  3DXR A;  1YZB A;  4JI4 B;  3L74 H;  4JI8 B;  4TV8 B;  2P90 A;  2RJZ A;  2N04 A;  3B09 A;  2XAJ A;  5LYJ A;  3ZRW B;  1SC5 B;  4J9Y B;  4OXS A;  1OV9 A;  5JWP A;  5CA1 B;  4Z1V A;  2EIL C;  5IYD O;  1NLT A;  5ITZ A;  1MMM A;  1KKC A;  3F5T A;  1AI7 A;  4RQF A;  4X88 A;  2YIA A;  4NXM B;  1KUQ A;  2AHZ A;  3JCU Z;  3LZ8 A;  1KB9 F;  4R7C A;  1SQQ H;  4JYB A;  2CTW A;  3L75 H;  2OCC C;  2FKX A;  1L8D A;  2KB1 A;  2V7Q G;  2R9I A;  2PI5 A;  2PTM A;  2WA4 A;  3FB8 C;  1PNM A;  5CA3 A;  4LFB O;  2ZIN A;  4IIJ B;  4DR7 O;  3THO A;  3AG3 C;  4WFE A;  4CS2 A;  1WP8 A;  2DW4 A;  1EM1 A;  1KP2 A;  4J7Z A;  1RM1 B;  2BOB C;  3HKB B;  2JRI A;  3ZRW A;  2WLL A;  4GX0 A;  3RYC B;  4DR1 O;  2JRR A;  4K0K O;  1Q81 W;  1QR9 A;  1VF6 A;  1Y4M A;  4N21 A;  3CRQ A;  4BAY A;  3ZN0 A;  5LHG A;  4X62 O;  4J80 A;  1AVM A;  4LC1 A;  3H1J H;  3K9A A;  4KP4 A;  3DXR B;  1R1B A;  1KYO F;  4MVQ A;  4DV7 B;  1PKX A;  1DGS A;  1TUB B;  1W0K G;  1JOY A;  3A0R A;  1VQN V;  4L3K A;  1BMF G;  1SZT A;  4LF5 B;  3FB6 C;  3CWB H;  1ZWI C;  5LMN O;  1IZ3 A;  2M7W A;  3HKC A;  1TUB A;  2WLM A;  4FFB A;  4D7T A;  3DSQ A;  4DV6 B;  3C5X C;  1AI6 A;  3K5O A;  3WG7 B;  2K9P A;  4DV1 O;  2WLJ A;  4FM0 A;  1QVG U;  1M5I A;  3SGI A;  4WFG A;  4RWU A;  5L3E A;  1M4U A;  5EC1 C;  1EFR G;  1VIB A;  2UXC O;  2JS3 A;  4FFB B;  1E1R G;  4K3A A;  3OW2 U;  4MS2 A;  3W7S A;  2X7R B;  3FB5 C;  4OX9 O;  2FTK A;  1Y67 A;  4O4I B;  4WFH A;  4DV3 O;  1QLE C;  3OM3 B;  2F66 C;  2R72 A;  1K3E A;  3ABL C;  4RO2 A;  1AI4 A;  2XAQ A;  4B3S B;  3B2E E; 
#chains in the Genus database with same CATH homology
 3I38 A;  3TJ8 A;  2DMX A;  2CUG A;  2LGW A;  2N04 A;  2B26 A;  1N4C A;  1GMW D;  2CTQ A;  1NLT A;  2QWP B;  3NXZ A;  4J80 A;  1C3G A;  2KQX A;  3L9Z A;  3NY0 A;  2QWQ B;  1BQ0 A;  3AG7 A;  2QLD A;  2M6Y A;  4IT5 A;  2Q2G A;  2YS8 A;  2YUA A;  1EB0 A;  1XAO A;  1FAF A;  3AGZ A;  2OCH A;  3LA0 A;  1GMU A;  3TJA A;  2Y4T A;  1GH6 A;  2GUZ A;  2QWR B;  3TJ9 A;  3UO3 A;  2Y4U A;  1IUR A;  2CTR A;  1HDJ A;  1GMV A;  1EAR A;  3UO2 A;  1GMW A;  3AGX A;  2PF4 E;  2GUZ B;  4J7Z A;  3UCS C;  1XBL A;  2QSA A;  3APQ A;  3LZ8 A;  2L6L A;  4L3K A;  2EJ7 A;  2QWN B;  2CTW A;  3AGY A;  1FPO A;  2CTP A;  2LO1 A;  1WJZ A;  3BVO A;  1BQZ A;  3APO A;  2DN9 A;  2N05 A;  2QWO B;  1NZ6 A;  4RWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...