4J82A

Crystal structure of beta'-cop/insig-2 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j82A01
1JMZB 4D0KA 1B9XA 5IC7A 3C75H 3GREA 3EWEA 4GM8A 3I7OA 1NEXB 3UVNA 5H14A 2Z2OA 5HYNB 4JXMA 4CY5A 2GNQA 3CFVA 2PBIB 2P9NC 4GMBA 4J82A 2H9PA 5HQGA 2AGXA 3AL8B 3HFQA 1L0QA 4GM9A 5H17A 2P9KC 3K26A 3CIKB 2IAAA 4L3HD 4CZYA 2G9AA 4O1QD 3C5MA 4PSXB 5FKSA 1U2VC 3W15A 4ERZA 1PGUA 3EI4A 1ERJA 1SQJA 5CXCB 2XU7A 3NVQA 3VGZA 4CC9A 5EM2A 4J73A 4KFMB 3GFCA 5H1MA 1GXRA 3AH8B 4PNKB 3OL2A 4H5JA 5K19A 1K32A 4A2MA 2O9KA 4A09B 4FAND 4A0BA 5A2Qg 3I2NA 2B5MA 4FWWA 3IJ0A 4A11A 3DWLC 4L1QD 4JT6C 5AMSA 2G99A 4MK0B 3OW8A 4GGDA 3B7FA 4QRJA 4JSPC 2EBSA 3C99A 3UR4A 3BG1A 3RLMD 5IGQA 5JWZA 2BBKH 2OK6A 4J87A 3OKYB 4GQ2P 2HESX 4X61B 3OTTA 2AH0A 2H9NA 1MG2A 4GM3A 3PXSD 5EARA 3F3GA 2J55H 3KRWB 4N14A 3UVKA 4A09A 4E54A 1PEVA 4GGCA 4A0BB 5GSAA 3SBRA 3FGBA 4K3JB 2OK4A 2IUVA 3IIWA 4LGNA 3BWSA 2AH1A 1VYHC 4Z8LA 3EI4B 2YMUA 2H68A 2AGYA 3DM0A 3SVWD 1N6EA 5HE3B 5TEEA 2B4EA 2H13A 2J57G 5EMKB 1N6FA 4E54B 2CN2A 3V7DB 2HYEA 5GXHA 5I5MA 2CE9A 4L3GD 1TYQC 4G56B 4YVDA 3SFZA 4CI8A 3JAMg 2PM6B 2QC5A 3PSLA 4Y5RD 3I8EA 2H47A 3BG0A 5CXBB 1PBYB 3ODTA 5K1CC 3ULEC 3UKRC 4BH6A 3I8CA 4J0XA 2XL2A 3SMRA 1PI6A 4LG8A 1NR0A 2B5NA 3JZNA 4GQ1A 4E5ZA 3RFGA 4CY3A 4A08B 5TF2A 4XYHA 5C2VB 5CXBA 3EI3B 5FA5B 3PSCB 3RSEC 5EMLB 3SLED 3UVOA 2OJYA 4IA9A 3ORVD 4H5IA 4QQEA 2IUQA 1Q47A 3I7NA 3OKWA 3CFSB 4J81A 4A0AA 2H6KA 4O3UB 1GG2B 3I7LA 2IWFA 4TZ4A 3SJLD 3U4YA 2I3SA 2OVQB 4FA1D 4J84A 4Y7RA 2W18A 2H3XA 4CZVA 3JZHA 2AGWA 3EI1A 4LG9A 1GOTB 2Z2PA 1MDAH 3OL2B 1R5MA 2MTAH 4PC0A 1A0RB 4ERQA 4PBZA 2CNXA 1SHYB 4J79A 3MXXA 4JT5C 3JROA 4J78A 4I79A 4JSXC 2P9SC 3OKYA 3C9CA 3PVWB 1K8KC 2HXCA 4QT8A 3JPXA 3RN1D 1RI6A 4CY2A 3EI1B 3SBPA 4J77A 3JB9L 2H6QA 3AL9A 5TDHB 2CO0C 5EM2B 4ESGA 3OKTA 3SN6B 2PM9B 3F3PA 4IMMA 3IIYA 4GZ8A 4XEIC 1JMXB 3MZKA 3PVUB 3UKUC 4QL1A 5FKQA 3SHFA 4A0AB 4A08A 2PM7B 2CE8A 4PXWA 5EAPA 3VH0A 4JSVC 2YBAA 2XL3A 2BCJB 3VA6A 3N0EA 5FLXg 2AQ5A 2OVPB 2IURA 3L4OD 2UZYB 3EU7A 2GC7A 2H9MA 1MG3A 4J0WA 2J56H 4JD2C 5EMJB 1U4CA 4ZOVA 4CI3A 3DSMA 2QXVA 5EAMA 4X3EA 2H6NA 2HJBA 3P4FA 4AEZA 4BUJC 3DXKC 3DXMC 5I5IA 1FWXA 2Q7QA 5CYKB 1OLZA 2I0RA 4R7AB 3MKQA 1P22A 4O45A 5EALA 1GP2B 3AFCA 4U1EI 1XHMA 1QNIA 5IJ8E 4ZOZA 5EMMB 3MZLA 4CI1A 3PXTD 4UI9R 3V5WB 3UVLA 2AGLA 2Z2NA 3K27A 1N6DA 3KRXB 4FA4D 5THAA 3NVXA 5IT9g 5FKRA 4A11B 3RN0D 1OMWB 5HE0B 4K3ID 5CXCA 2H14A 3EI2A 3FRXA 1B9YA 3FM0A 2IWKA 5HE1B 2YNNA 2OVRB 3JZGA 4GGAA 2OIZA 3I7PA 5CYKA 3I7KA 4CZXA 2H9LA 2HKMA 3RRMC 1JOFA 5SXMA 2CO0A 4AOWA 5B4WA 3IJ1A 1SQ9A 5C2WB 2XYIA 3EMHA 2P9UC 4FA9D 5C9ZB 5GMKn 1XKSA 4CI2A 2I3TA 3IKOA 3A0FA 4NSXA 4D6VA 5HE2B 4J8BA 4ERYA 2P9IC 4E5ZB 4O9DA 2IUPA 2CN3A 4ZN4A 3F3FA 4J86A 4ES0A 4OWRA 3ZWLB 3RMZD 3E0CA 3SWSD 3UVMA 4HDJA 4FB1D 5FQDA 4ZOYA 4L9OA 3SBQA 2PM9A 5TEFA 3J80g 2AGZA 4PBYA 3PXWD 1S4UX 4FHLA 3EI2B 3PE7A 2UZXB 3V9FA 3MMYA 2YNOA 3I89A 5IGOA 4PSWB 4XYIA 1JJUB 4EWRA 4JSNC 3IJCA 5KDOB 4CY1A 4U7AA 4O3TB 1TBGA 5AJAA 2GC4A 2HJ4A 4FA5D 2P9PC 2TRCB 5IJ7E 2B5LA 5FXYA 5FKTA 4X63B 3EG6A 5AFU3 3L4MD 3I7HA 4GQBB 4ZOXA 5I5JA 4BL0A 3J81g 3EI3A 3MKSB 3NVNA 2YNPA 3JRPA 4A2LA 5GXIA 3RFHA 3SCYA 2YB8B 3N0DA 2HKRA 4J8GA 4X60B 4A7JA 2I0SA 1YFQA 4FAVD 3AL8A 1XIPA 2I0TA 3SXTD 2P9LC 4OZUA
chains in the Genus database with same CATH superfamily
2XE4A 1JMZB 4D0KA 1B9XA 1E5TA 5IC7A 3C75H 3MUOA 3GREA 3EWEA 4GM8A 4Z7QA 2XDWA 3I7OA 1NEXB 4AMYA 3UVNA 5H14A 1QFMA 2Z2OA 3IUMA 5HYNB 4JXMA 4CY5A 2GNQA 4UM8A 3CFVA 2PBIB 2P9NC 4GMBA 4J82A 2H9PA 5HQGA 2AGXA 3AL8B 3HFQA 1L0QA 4GM9A 3VI3A 1JV2A 5H17A 2P9KC 3K26A 3OF7A 3CIKB 2IAAA 4L3HD 4CZYA 1UOQA 2G9AA 4O1QD 3C5MA 4PSXB 5FKSA 4IRZA 1U2VC 3MUNA 1K3IA 4AMZA 3W15A 1VZ2A 4ERZA 3ZDXA 5C92A 1I2MB 1PGUA 1VZ3A 3EI4A 1ERJA 3ZDYA 1SQJA 5CXCB 1O6GA 2XU7A 4WK0A 3NVQA 5HDBA 3VGZA 1UOOA 4CC9A 5EM2A 4J73A 3K71A 4KFMB 3GFCA 5H1MA 1GXRA 4L1MA 1H2XA 1M1XA 3AH8B 4PNKB 2VDLA 3OL2A 4H5JA 3NIGA 5K19A 1K32A 4A2MA 2O9KA 4A09B 4FAND 4A0BA 5A2Qg 4FWWA 3I2NA 2B5MA 3IJ0A 4OZUA 2QR5A 3EQ9A 4A11A 3DWLC 4L1QD 1C9IA 4JT6C 5AMSA 5M5SA 2G99A 4MK0B 1H2YA 3OW8A 4GGDA 3B7FA 4QRJA 4JSPC 3FCSA 2EBSA 3C99A 3UR4A 2EIDA 4O02A 3BG1A 4NAAA 3RLMD 5IGQA 5JWZA 5M5VA 4NBMA 2BBKH 2OK6A 4J87A 3OKYB 4GQ2P 2HESX 2VZ1A 4X61B 3OTTA 2VDMA 2H9NA 2AH0A 1MG2A 4GM3A 1GOFA 3PXSD 5EARA 3F3GA 2J55H 3KRWB 4N14A 3UVKA 4A09A 4E54A 1PEVA 4GGCA 3O4IA 4A0BB 5GSAA 4UM9A 3SBRA 3FGBA 4K3JB 5M5RA 2OK4A 2IUVA 3IIWA 4LGNA 3BWSA 2AH1A 4JHPC 4NC4A 1VYHC 4Z8LA 3EI4B 2YMUA 2H68A 2AGYA 3DM0A 3SVWD 1N6EA 5HE3B 5TEEA 2B4EA 2H13A 1BPOA 2J57G 5EMKB 4MMXA 1N6FA 1U8CA 4E54B 2CN2A 3V7DB 2HYEA 5GXHA 5I5MA 2CE9A 4L3GD 1TYQC 4G56B 4YVDA 3SFZA 4CI8A 1A12A 3DDUA 1O6FA 1UOPA 3JAMg 1YR2A 2PM6B 2QC5A 3PSLA 4Y5RD 3I8EA 2H47A 2HU8A 3BG0A 5CXBB 3FCUA 4Z7NA 3QHYB 4MMYA 1C9LA 1PBYB 3ODTA 3KCIA 5K1CC 3O4GA 3ULEC 3UKRC 2HU5A 4BH6A 3I8CA 4J0XA 3IVMA 2XL2A 3SMRA 4BCBA 1PI6A 4LG8A 1NR0A 4G1EA 2B5NA 3JZNA 4GQ1A 4E5ZA 3RFGA 4CY3A 3EQ8A 4A08B 4G1MA 5TF2A 2XZGA 4XYHA 4RE6A 2VDOA 5C2VB 3GC3B 5CXBA 3EI3B 5FA5B 3O4JA 3PSCB 3RSEC 5EMLB 3IJEA 3SLED 3UVOA 2OJYA 2VC2A 4IA9A 4DNWA 3ORVD 4H5IA 2IUQA 1Q47A 3I7NA 3OKWA 4J81A 3CFSB 4QQEA 4BCCA 4A0AA 2H6KA 4O3UB 1GG2B 3I7LA 2EIBA 2IWFA 3V4PA 4TZ4A 3SJLD 1GOHA 3U4YA 5FFOA 2VZ3A 2I3SA 2OVQB 4FA1D 4J84A 4AN0A 4Y7RA 2W18A 2H3XA 4CZVA 3NIDA 3JZHA 2AGWA 3EI1A 5E6RA 4LG9A 5M61A 2HU7A 1GOTB 1JTDB 2Z2PA 1MDAH 3OL2B 1R5MA 2MTAH 4PC0A 1A0RB 4ERQA 4Z7OA 3NIFA 4PBZA 3V4VA 2CNXA 4D9SA 1SHYB 3O4HA 4J79A 3MXXA 3MVDK 4JT5C 3JROA 4J78A 4I79A 4JSXC 2P9SC 3OKYA 3C9CA 3PVWB 1K8KC 2HXCA 3JPXA 4QT8A 3RN1D 1RI6A 2VDNA 4CY2A 3EI1B 3SBPA 1L5GA 3IUQA 4J77A 3JB9L 3GD1I 2H6QA 3AL9A 5TDHB 3T3PA 2CO0C 3ZE0A 1E8NA 3EQ7A 5EM2B 4ESGA 4WK2A 3OKTA 4O2WA 4WJKA 2PM9B 3SN6B 3F3PA 4IMMA 3IIYA 4GZ8A 4MMZA 4QAMA 1JMXB 3MZKA 4XEIC 3PVUB 3UKUC 4QL1A 5FKQA 3SHFA 4A0AB 4A08A 2PM7B 2CE8A 4PXWA 5EAPA 3VH0A 4JSVC 2YBAA 2XL3A 2BCJB 3VA6A 3N0EA 5FLXg 2AQ5A 2OVPB 2IURA 3L4OD 2UZYB 3EU7A 2GC7A 2H9MA 1MG3A 4J0WA 3VI4A 2J56H 4JD2C 5EMJB 1U4CA 4ZOVA 4CI3A 3DSMA 2JKXA 2QXVA 5EAMA 4X3EA 4BP8A 2H6NA 2HJBA 5M5UA 3P4FA 4AEZA 2VDPA 1TYEA 5M5TA 4BUJC 3DXKC 1E8MA 3DXMC 4BCDA 5I5IA 1FWXA 2Q7QA 5CYKB 1OLZA 2I0RA 4R7AB 3MKQA 1P22A 4O45A 5EALA 3ZDZA 1GP2B 3IUNA 3AFCA 4U1EI 1XHMA 5E6SA 3T3MA 1QNIA 5IJ8E 4ZOZA 5EMMB 2BKLA 3MZLA 4CI1A 1T2XA 3PXTD 4UI9R 3V5WB 3UVLA 2AGLA 2Z2NA 2EICA 3K27A 1N6DA 3KRXB 4FA4D 5THAA 2VDKA 3NVXA 5IT9g 5FKRA 1H2ZA 3RN0D 1OMWB 4A11B 5HE0B 4K3ID 4BP9A 5CXCA 2H14A 3EI2A 1QFSA 3FRXA 1B9YA 3FM0A 2IWKA 5HE1B 2YNNA 2OVRB 3JZGA 4GGAA 3K6SA 2OIZA 3ZE2A 2EIEA 3I7PA 4JHNA 5CYKA 3I7KA 4CZXA 2H9LA 2HKMA 3RRMC 1JOFA 5SXMA 4AN1A 2CO0A 4AOWA 5B4WA 3IJ1A 1SQ9A 5C2WB 2XYIA 5C86A 3EMHA 5E6UA 2P9UC 4FA9D 5C9ZB 1VE7A 5GMKn 1XKSA 4CI2A 2I3TA 5FFGA 4NENA 3IULA 3IKOA 1UTCA 3A0FA 3ZE1A 4NSXA 4D6VA 3QI0A 5HE2B 4J8BA 4ERYA 2P9IC 4E5ZB 4O9DA 2IUPA 2CN3A 4ZN4A 3F3FA 4J86A 4ES0A 4OWRA 2QZPA 3ZWLB 4AX4A 3RMZD 3E0CA 3SWSD 3UVMA 4HDJA 4DNUA 4FB1D 5FQDA 4ZOYA 4L9OA 3SBQA 2PM9A 5TEFA 3J80g 2AGZA 4PBYA 3K72A 3PXWD 1S4UX 4FHLA 3IUJA 3EI2B 4G55A 3PE7A 2UZXB 3V9FA 3MMYA 2YNOA 3I89A 5IGOA 4PSWB 4XYIA 1JJUB 4EWRA 3IURA 4JSNC 3IJCA 5KDOB 4CY1A 4U7AA 4O3TB 1TBGA 1H2WA 5AJAA 2WQ8A 2GC4A 4RE5A 2HJ4A 4FA5D 2P9PC 2TRCB 5IJ7E 2B5LA 5FXYA 5FKTA 4X63B 3EG6A 5AFU3 2VDRA 3L4MD 2VDQA 3I7HA 4GQBB 4ZOXA 5I5JA 4BL0A 3J81g 3EI3A 3MKSB 3NVNA 4WK4A 2YNPA 3JRPA 4A2LA 5GXIA 1VE6A 3RFHA 3SCYA 2YB8B 4DNVA 3N0DA 2HKRA 4J8GA 4X60B 4A7JA 2I0SA 1YFQA 4FAVD 3AL8A 1XIPA 2I0TA 3SXTD 2P9LC 1GOGA
chains in the Genus database with same CATH topology
1JMZB 4D0KA 1B9XA 5IC7A 3C75H 3GREA 3EWEA 4GM8A 3I7OA 1NEXB 3UVNA 5H14A 2Z2OA 5HYNB 4JXMA 4CY5A 2GNQA 3CFVA 2PBIB 2P9NC 4GMBA 4J82A 2H9PA 5HQGA 2AGXA 3AL8B 3HFQA 1L0QA 4GM9A 5H17A 2P9KC 3K26A 3CIKB 2IAAA 4L3HD 4CZYA 2G9AA 4O1QD 3C5MA 4PSXB 5FKSA 1U2VC 3W15A 4ERZA 1PGUA 3EI4A 1ERJA 1SQJA 5CXCB 2XU7A 3NVQA 3VGZA 4CC9A 5EM2A 4J73A 4KFMB 3GFCA 5H1MA 1GXRA 3AH8B 4PNKB 3OL2A 4H5JA 5K19A 1K32A 4A2MA 2O9KA 4A09B 4FAND 4A0BA 5A2Qg 3I2NA 2B5MA 4FWWA 3IJ0A 4A11A 3DWLC 4L1QD 4JT6C 5AMSA 2G99A 4MK0B 3OW8A 4GGDA 3B7FA 4QRJA 4JSPC 2EBSA 3C99A 3UR4A 3BG1A 3RLMD 5IGQA 5JWZA 2BBKH 2OK6A 4J87A 3OKYB 4GQ2P 2HESX 4X61B 3OTTA 2AH0A 2H9NA 1MG2A 4GM3A 3PXSD 5EARA 3F3GA 2J55H 3KRWB 4N14A 3UVKA 4A09A 4E54A 1PEVA 4GGCA 4A0BB 5GSAA 3SBRA 3FGBA 4K3JB 2OK4A 2IUVA 3IIWA 4LGNA 3BWSA 2AH1A 1VYHC 4Z8LA 3EI4B 2YMUA 2H68A 2AGYA 3DM0A 3SVWD 1N6EA 5HE3B 5TEEA 2B4EA 2H13A 2J57G 5EMKB 1N6FA 4E54B 2CN2A 3V7DB 2HYEA 5GXHA 5I5MA 2CE9A 4L3GD 1TYQC 4G56B 4YVDA 3SFZA 4CI8A 3JAMg 2PM6B 2QC5A 3PSLA 4Y5RD 3I8EA 2H47A 3BG0A 5CXBB 1PBYB 3ODTA 5K1CC 3ULEC 3UKRC 4BH6A 3I8CA 4J0XA 2XL2A 3SMRA 1PI6A 4LG8A 1NR0A 2B5NA 3JZNA 4GQ1A 4E5ZA 3RFGA 4CY3A 4A08B 5TF2A 4XYHA 5C2VB 5CXBA 3EI3B 5FA5B 3PSCB 3RSEC 5EMLB 3SLED 3UVOA 2OJYA 4IA9A 3ORVD 4H5IA 4QQEA 2IUQA 1Q47A 3I7NA 3OKWA 3CFSB 4J81A 4A0AA 2H6KA 4O3UB 1GG2B 3I7LA 2IWFA 4TZ4A 3SJLD 3U4YA 2I3SA 2OVQB 4FA1D 4J84A 4Y7RA 2W18A 2H3XA 4CZVA 3JZHA 2AGWA 3EI1A 4LG9A 1GOTB 2Z2PA 1MDAH 3OL2B 1R5MA 2MTAH 4PC0A 1A0RB 4ERQA 4PBZA 2CNXA 1SHYB 4J79A 3MXXA 4JT5C 3JROA 4J78A 4I79A 4JSXC 2P9SC 3OKYA 3C9CA 3PVWB 1K8KC 2HXCA 4QT8A 3JPXA 3RN1D 1RI6A 4CY2A 3EI1B 3SBPA 4J77A 3JB9L 2H6QA 3AL9A 5TDHB 2CO0C 5EM2B 4ESGA 3OKTA 3SN6B 2PM9B 3F3PA 4IMMA 3IIYA 4GZ8A 4XEIC 1JMXB 3MZKA 3PVUB 3UKUC 4QL1A 5FKQA 3SHFA 4A0AB 4A08A 2PM7B 2CE8A 4PXWA 5EAPA 3VH0A 4JSVC 2YBAA 2XL3A 2BCJB 3VA6A 3N0EA 5FLXg 2AQ5A 2OVPB 2IURA 3L4OD 2UZYB 3EU7A 2GC7A 2H9MA 1MG3A 4J0WA 2J56H 4JD2C 5EMJB 1U4CA 4ZOVA 4CI3A 3DSMA 2QXVA 5EAMA 4X3EA 2H6NA 2HJBA 3P4FA 4AEZA 4BUJC 3DXKC 3DXMC 5I5IA 1FWXA 2Q7QA 5CYKB 1OLZA 2I0RA 4R7AB 3MKQA 1P22A 4O45A 5EALA 1GP2B 3AFCA 4U1EI 1XHMA 1QNIA 5IJ8E 4ZOZA 5EMMB 3MZLA 4CI1A 3PXTD 4UI9R 3V5WB 3UVLA 2AGLA 2Z2NA 3K27A 1N6DA 3KRXB 4FA4D 5THAA 3NVXA 5IT9g 5FKRA 4A11B 3RN0D 1OMWB 5HE0B 4K3ID 5CXCA 2H14A 3EI2A 3FRXA 1B9YA 3FM0A 2IWKA 5HE1B 2YNNA 2OVRB 3JZGA 4GGAA 2OIZA 3I7PA 5CYKA 3I7KA 4CZXA 2H9LA 2HKMA 3RRMC 1JOFA 5SXMA 2CO0A 4AOWA 5B4WA 3IJ1A 1SQ9A 5C2WB 2XYIA 3EMHA 2P9UC 4FA9D 5C9ZB 5GMKn 1XKSA 4CI2A 2I3TA 3IKOA 3A0FA 4NSXA 4D6VA 5HE2B 4J8BA 4ERYA 2P9IC 4E5ZB 4O9DA 2IUPA 2CN3A 4ZN4A 3F3FA 4J86A 4ES0A 4OWRA 3ZWLB 3RMZD 3E0CA 3SWSD 3UVMA 4HDJA 4FB1D 5FQDA 4ZOYA 4L9OA 3SBQA 2PM9A 5TEFA 3J80g 2AGZA 4PBYA 3PXWD 1S4UX 4FHLA 3EI2B 3PE7A 2UZXB 3V9FA 3MMYA 2YNOA 3I89A 5IGOA 4PSWB 4XYIA 1JJUB 4EWRA 4JSNC 3IJCA 5KDOB 4CY1A 4U7AA 4O3TB 1TBGA 5AJAA 2GC4A 2HJ4A 4FA5D 2P9PC 2TRCB 5IJ7E 2B5LA 5FXYA 5FKTA 4X63B 3EG6A 5AFU3 3L4MD 3I7HA 4GQBB 4ZOXA 5I5JA 4BL0A 3J81g 3EI3A 3MKSB 3NVNA 2YNPA 3JRPA 4A2LA 5GXIA 3RFHA 3SCYA 2YB8B 3N0DA 2HKRA 4J8GA 4X60B 4A7JA 2I0SA 1YFQA 4FAVD 3AL8A 1XIPA 2I0TA 3SXTD 2P9LC 4OZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMZ B;  4D0K A;  1B9X A;  5IC7 A;  3C75 H;  3GRE A;  3EWE A;  4GM8 A;  3I7O A;  1NEX B;  3UVN A;  5H14 A;  2Z2O A;  5HYN B;  4JXM A;  4CY5 A;  2GNQ A;  3CFV A;  2PBI B;  2P9N C;  4GMB A;  4J82 A;  2H9P A;  5HQG A;  2AGX A;  3AL8 B;  3HFQ A;  1L0Q A;  4GM9 A;  5H17 A;  2P9K C;  3K26 A;  3CIK B;  2IAA A;  4L3H D;  4CZY A;  2G9A A;  4O1Q D;  3C5M A;  4PSX B;  5FKS A;  1U2V C;  3W15 A;  4ERZ A;  1PGU A;  3EI4 A;  1ERJ A;  1SQJ A;  5CXC B;  2XU7 A;  3NVQ A;  3VGZ A;  4CC9 A;  5EM2 A;  4J73 A;  4KFM B;  3GFC A;  5H1M A;  1GXR A;  3AH8 B;  4PNK B;  3OL2 A;  4H5J A;  5K19 A;  1K32 A;  4A2M A;  2O9K A;  4A09 B;  4FAN D;  4A0B A;  5A2Q g;  3I2N A;  2B5M A;  4FWW A;  3IJ0 A;  4A11 A;  3DWL C;  4L1Q D;  4JT6 C;  5AMS A;  2G99 A;  4MK0 B;  3OW8 A;  4GGD A;  3B7F A;  4QRJ A;  4JSP C;  2EBS A;  3C99 A;  3UR4 A;  3BG1 A;  3RLM D;  5IGQ A;  5JWZ A;  2BBK H;  2OK6 A;  4J87 A;  3OKY B;  4GQ2 P;  2HES X;  4X61 B;  3OTT A;  2AH0 A;  2H9N A;  1MG2 A;  4GM3 A;  3PXS D;  5EAR A;  3F3G A;  2J55 H;  3KRW B;  4N14 A;  3UVK A;  4A09 A;  4E54 A;  1PEV A;  4GGC A;  4A0B B;  5GSA A;  3SBR A;  3FGB A;  4K3J B;  2OK4 A;  2IUV A;  3IIW A;  4LGN A;  3BWS A;  2AH1 A;  1VYH C;  4Z8L A;  3EI4 B;  2YMU A;  2H68 A;  2AGY A;  3DM0 A;  3SVW D;  1N6E A;  5HE3 B;  5TEE A;  2B4E A;  2H13 A;  2J57 G;  5EMK B;  1N6F A;  4E54 B;  2CN2 A;  3V7D B;  2HYE A;  5GXH A;  5I5M A;  2CE9 A;  4L3G D;  1TYQ C;  4G56 B;  4YVD A;  3SFZ A;  4CI8 A;  3JAM g;  2PM6 B;  2QC5 A;  3PSL A;  4Y5R D;  3I8E A;  2H47 A;  3BG0 A;  5CXB B;  1PBY B;  3ODT A;  5K1C C;  3ULE C;  3UKR C;  4BH6 A;  3I8C A;  4J0X A;  2XL2 A;  3SMR A;  1PI6 A;  4LG8 A;  1NR0 A;  2B5N A;  3JZN A;  4GQ1 A;  4E5Z A;  3RFG A;  4CY3 A;  4A08 B;  5TF2 A;  4XYH A;  5C2V B;  5CXB A;  3EI3 B;  5FA5 B;  3PSC B;  3RSE C;  5EML B;  3SLE D;  3UVO A;  2OJY A;  4IA9 A;  3ORV D;  4H5I A;  4QQE A;  2IUQ A;  1Q47 A;  3I7N A;  3OKW A;  3CFS B;  4J81 A;  4A0A A;  2H6K A;  4O3U B;  1GG2 B;  3I7L A;  2IWF A;  4TZ4 A;  3SJL D;  3U4Y A;  2I3S A;  2OVQ B;  4FA1 D;  4J84 A;  4Y7R A;  2W18 A;  2H3X A;  4CZV A;  3JZH A;  2AGW A;  3EI1 A;  4LG9 A;  1GOT B;  2Z2P A;  1MDA H;  3OL2 B;  1R5M A;  2MTA H;  4PC0 A;  1A0R B;  4ERQ A;  4PBZ A;  2CNX A;  1SHY B;  4J79 A;  3MXX A;  4JT5 C;  3JRO A;  4J78 A;  4I79 A;  4JSX C;  2P9S C;  3OKY A;  3C9C A;  3PVW B;  1K8K C;  2HXC A;  4QT8 A;  3JPX A;  3RN1 D;  1RI6 A;  4CY2 A;  3EI1 B;  3SBP A;  4J77 A;  3JB9 L;  2H6Q A;  3AL9 A;  5TDH B;  2CO0 C;  5EM2 B;  4ESG A;  3OKT A;  3SN6 B;  2PM9 B;  3F3P A;  4IMM A;  3IIY A;  4GZ8 A;  4XEI C;  1JMX B;  3MZK A;  3PVU B;  3UKU C;  4QL1 A;  5FKQ A;  3SHF A;  4A0A B;  4A08 A;  2PM7 B;  2CE8 A;  4PXW A;  5EAP A;  3VH0 A;  4JSV C;  2YBA A;  2XL3 A;  2BCJ B;  3VA6 A;  3N0E A;  5FLX g;  2AQ5 A;  2OVP B;  2IUR A;  3L4O D;  2UZY B;  3EU7 A;  2GC7 A;  2H9M A;  1MG3 A;  4J0W A;  2J56 H;  4JD2 C;  5EMJ B;  1U4C A;  4ZOV A;  4CI3 A;  3DSM A;  2QXV A;  5EAM A;  4X3E A;  2H6N A;  2HJB A;  3P4F A;  4AEZ A;  4BUJ C;  3DXK C;  3DXM C;  5I5I A;  1FWX A;  2Q7Q A;  5CYK B;  1OLZ A;  2I0R A;  4R7A B;  3MKQ A;  1P22 A;  4O45 A;  5EAL A;  1GP2 B;  3AFC A;  4U1E I;  1XHM A;  1QNI A;  5IJ8 E;  4ZOZ A;  5EMM B;  3MZL A;  4CI1 A;  3PXT D;  4UI9 R;  3V5W B;  3UVL A;  2AGL A;  2Z2N A;  3K27 A;  1N6D A;  3KRX B;  4FA4 D;  5THA A;  3NVX A;  5IT9 g;  5FKR A;  4A11 B;  3RN0 D;  1OMW B;  5HE0 B;  4K3I D;  5CXC A;  2H14 A;  3EI2 A;  3FRX A;  1B9Y A;  3FM0 A;  2IWK A;  5HE1 B;  2YNN A;  2OVR B;  3JZG A;  4GGA A;  2OIZ A;  3I7P A;  5CYK A;  3I7K A;  4CZX A;  2H9L A;  2HKM A;  3RRM C;  1JOF A;  5SXM A;  2CO0 A;  4AOW A;  5B4W A;  3IJ1 A;  1SQ9 A;  5C2W B;  2XYI A;  3EMH A;  2P9U C;  4FA9 D;  5C9Z B;  5GMK n;  1XKS A;  4CI2 A;  2I3T A;  3IKO A;  3A0F A;  4NSX A;  4D6V A;  5HE2 B;  4J8B A;  4ERY A;  2P9I C;  4E5Z B;  4O9D A;  2IUP A;  2CN3 A;  4ZN4 A;  3F3F A;  4J86 A;  4ES0 A;  4OWR A;  3ZWL B;  3RMZ D;  3E0C A;  3SWS D;  3UVM A;  4HDJ A;  4FB1 D;  5FQD A;  4ZOY A;  4L9O A;  3SBQ A;  2PM9 A;  5TEF A;  3J80 g;  2AGZ A;  4PBY A;  3PXW D;  1S4U X;  4FHL A;  3EI2 B;  3PE7 A;  2UZX B;  3V9F A;  3MMY A;  2YNO A;  3I89 A;  5IGO A;  4PSW B;  4XYI A;  1JJU B;  4EWR A;  4JSN C;  3IJC A;  5KDO B;  4CY1 A;  4U7A A;  4O3T B;  1TBG A;  5AJA A;  2GC4 A;  2HJ4 A;  4FA5 D;  2P9P C;  2TRC B;  5IJ7 E;  2B5L A;  5FXY A;  5FKT A;  4X63 B;  3EG6 A;  5AFU 3;  3L4M D;  3I7H A;  4GQB B;  4ZOX A;  5I5J A;  4BL0 A;  3J81 g;  3EI3 A;  3MKS B;  3NVN A;  2YNP A;  3JRP A;  4A2L A;  5GXI A;  3RFH A;  3SCY A;  2YB8 B;  3N0D A;  2HKR A;  4J8G A;  4X60 B;  4A7J A;  2I0S A;  1YFQ A;  4FAV D;  3AL8 A;  1XIP A;  2I0T A;  3SXT D;  2P9L C;  4OZU A; 
#chains in the Genus database with same CATH topology
 2XE4 A;  1JMZ B;  4D0K A;  1B9X A;  1E5T A;  5IC7 A;  3C75 H;  3MUO A;  3GRE A;  3EWE A;  4GM8 A;  4Z7Q A;  2XDW A;  3I7O A;  1NEX B;  4AMY A;  3UVN A;  5H14 A;  1QFM A;  2Z2O A;  3IUM A;  5HYN B;  4JXM A;  4CY5 A;  2GNQ A;  4UM8 A;  3CFV A;  2PBI B;  2P9N C;  4GMB A;  4J82 A;  2H9P A;  5HQG A;  2AGX A;  3AL8 B;  3HFQ A;  1L0Q A;  4GM9 A;  3VI3 A;  1JV2 A;  5H17 A;  2P9K C;  3K26 A;  3OF7 A;  3CIK B;  2IAA A;  4L3H D;  4CZY A;  1UOQ A;  2G9A A;  4O1Q D;  3C5M A;  4PSX B;  5FKS A;  4IRZ A;  1U2V C;  3MUN A;  1K3I A;  4AMZ A;  3W15 A;  1VZ2 A;  4ERZ A;  3ZDX A;  5C92 A;  1I2M B;  1PGU A;  1VZ3 A;  3EI4 A;  1ERJ A;  3ZDY A;  1SQJ A;  5CXC B;  1O6G A;  2XU7 A;  4WK0 A;  3NVQ A;  5HDB A;  3VGZ A;  1UOO A;  4CC9 A;  5EM2 A;  4J73 A;  3K71 A;  4KFM B;  3GFC A;  5H1M A;  1GXR A;  4L1M A;  1H2X A;  1M1X A;  3AH8 B;  4PNK B;  2VDL A;  3OL2 A;  4H5J A;  3NIG A;  5K19 A;  1K32 A;  4A2M A;  2O9K A;  4A09 B;  4FAN D;  4A0B A;  5A2Q g;  4FWW A;  3I2N A;  2B5M A;  3IJ0 A;  4OZU A;  2QR5 A;  3EQ9 A;  4A11 A;  3DWL C;  4L1Q D;  1C9I A;  4JT6 C;  5AMS A;  5M5S A;  2G99 A;  4MK0 B;  1H2Y A;  3OW8 A;  4GGD A;  3B7F A;  4QRJ A;  4JSP C;  3FCS A;  2EBS A;  3C99 A;  3UR4 A;  2EID A;  4O02 A;  3BG1 A;  4NAA A;  3RLM D;  5IGQ A;  5JWZ A;  5M5V A;  4NBM A;  2BBK H;  2OK6 A;  4J87 A;  3OKY B;  4GQ2 P;  2HES X;  2VZ1 A;  4X61 B;  3OTT A;  2VDM A;  2H9N A;  2AH0 A;  1MG2 A;  4GM3 A;  1GOF A;  3PXS D;  5EAR A;  3F3G A;  2J55 H;  3KRW B;  4N14 A;  3UVK A;  4A09 A;  4E54 A;  1PEV A;  4GGC A;  3O4I A;  4A0B B;  5GSA A;  4UM9 A;  3SBR A;  3FGB A;  4K3J B;  5M5R A;  2OK4 A;  2IUV A;  3IIW A;  4LGN A;  3BWS A;  2AH1 A;  4JHP C;  4NC4 A;  1VYH C;  4Z8L A;  3EI4 B;  2YMU A;  2H68 A;  2AGY A;  3DM0 A;  3SVW D;  1N6E A;  5HE3 B;  5TEE A;  2B4E A;  2H13 A;  1BPO A;  2J57 G;  5EMK B;  4MMX A;  1N6F A;  1U8C A;  4E54 B;  2CN2 A;  3V7D B;  2HYE A;  5GXH A;  5I5M A;  2CE9 A;  4L3G D;  1TYQ C;  4G56 B;  4YVD A;  3SFZ A;  4CI8 A;  1A12 A;  3DDU A;  1O6F A;  1UOP A;  3JAM g;  1YR2 A;  2PM6 B;  2QC5 A;  3PSL A;  4Y5R D;  3I8E A;  2H47 A;  2HU8 A;  3BG0 A;  5CXB B;  3FCU A;  4Z7N A;  3QHY B;  4MMY A;  1C9L A;  1PBY B;  3ODT A;  3KCI A;  5K1C C;  3O4G A;  3ULE C;  3UKR C;  2HU5 A;  4BH6 A;  3I8C A;  4J0X A;  3IVM A;  2XL2 A;  3SMR A;  4BCB A;  1PI6 A;  4LG8 A;  1NR0 A;  4G1E A;  2B5N A;  3JZN A;  4GQ1 A;  4E5Z A;  3RFG A;  4CY3 A;  3EQ8 A;  4A08 B;  4G1M A;  5TF2 A;  2XZG A;  4XYH A;  4RE6 A;  2VDO A;  5C2V B;  3GC3 B;  5CXB A;  3EI3 B;  5FA5 B;  3O4J A;  3PSC B;  3RSE C;  5EML B;  3IJE A;  3SLE D;  3UVO A;  2OJY A;  2VC2 A;  4IA9 A;  4DNW A;  3ORV D;  4H5I A;  2IUQ A;  1Q47 A;  3I7N A;  3OKW A;  4J81 A;  3CFS B;  4QQE A;  4BCC A;  4A0A A;  2H6K A;  4O3U B;  1GG2 B;  3I7L A;  2EIB A;  2IWF A;  3V4P A;  4TZ4 A;  3SJL D;  1GOH A;  3U4Y A;  5FFO A;  2VZ3 A;  2I3S A;  2OVQ B;  4FA1 D;  4J84 A;  4AN0 A;  4Y7R A;  2W18 A;  2H3X A;  4CZV A;  3NID A;  3JZH A;  2AGW A;  3EI1 A;  5E6R A;  4LG9 A;  5M61 A;  2HU7 A;  1GOT B;  1JTD B;  2Z2P A;  1MDA H;  3OL2 B;  1R5M A;  2MTA H;  4PC0 A;  1A0R B;  4ERQ A;  4Z7O A;  3NIF A;  4PBZ A;  3V4V A;  2CNX A;  4D9S A;  1SHY B;  3O4H A;  4J79 A;  3MXX A;  3MVD K;  4JT5 C;  3JRO A;  4J78 A;  4I79 A;  4JSX C;  2P9S C;  3OKY A;  3C9C A;  3PVW B;  1K8K C;  2HXC A;  3JPX A;  4QT8 A;  3RN1 D;  1RI6 A;  2VDN A;  4CY2 A;  3EI1 B;  3SBP A;  1L5G A;  3IUQ A;  4J77 A;  3JB9 L;  3GD1 I;  2H6Q A;  3AL9 A;  5TDH B;  3T3P A;  2CO0 C;  3ZE0 A;  1E8N A;  3EQ7 A;  5EM2 B;  4ESG A;  4WK2 A;  3OKT A;  4O2W A;  4WJK A;  2PM9 B;  3SN6 B;  3F3P A;  4IMM A;  3IIY A;  4GZ8 A;  4MMZ A;  4QAM A;  1JMX B;  3MZK A;  4XEI C;  3PVU B;  3UKU C;  4QL1 A;  5FKQ A;  3SHF A;  4A0A B;  4A08 A;  2PM7 B;  2CE8 A;  4PXW A;  5EAP A;  3VH0 A;  4JSV C;  2YBA A;  2XL3 A;  2BCJ B;  3VA6 A;  3N0E A;  5FLX g;  2AQ5 A;  2OVP B;  2IUR A;  3L4O D;  2UZY B;  3EU7 A;  2GC7 A;  2H9M A;  1MG3 A;  4J0W A;  3VI4 A;  2J56 H;  4JD2 C;  5EMJ B;  1U4C A;  4ZOV A;  4CI3 A;  3DSM A;  2JKX A;  2QXV A;  5EAM A;  4X3E A;  4BP8 A;  2H6N A;  2HJB A;  5M5U A;  3P4F A;  4AEZ A;  2VDP A;  1TYE A;  5M5T A;  4BUJ C;  3DXK C;  1E8M A;  3DXM C;  4BCD A;  5I5I A;  1FWX A;  2Q7Q A;  5CYK B;  1OLZ A;  2I0R A;  4R7A B;  3MKQ A;  1P22 A;  4O45 A;  5EAL A;  3ZDZ A;  1GP2 B;  3IUN A;  3AFC A;  4U1E I;  1XHM A;  5E6S A;  3T3M A;  1QNI A;  5IJ8 E;  4ZOZ A;  5EMM B;  2BKL A;  3MZL A;  4CI1 A;  1T2X A;  3PXT D;  4UI9 R;  3V5W B;  3UVL A;  2AGL A;  2Z2N A;  2EIC A;  3K27 A;  1N6D A;  3KRX B;  4FA4 D;  5THA A;  2VDK A;  3NVX A;  5IT9 g;  5FKR A;  1H2Z A;  3RN0 D;  1OMW B;  4A11 B;  5HE0 B;  4K3I D;  4BP9 A;  5CXC A;  2H14 A;  3EI2 A;  1QFS A;  3FRX A;  1B9Y A;  3FM0 A;  2IWK A;  5HE1 B;  2YNN A;  2OVR B;  3JZG A;  4GGA A;  3K6S A;  2OIZ A;  3ZE2 A;  2EIE A;  3I7P A;  4JHN A;  5CYK A;  3I7K A;  4CZX A;  2H9L A;  2HKM A;  3RRM C;  1JOF A;  5SXM A;  4AN1 A;  2CO0 A;  4AOW A;  5B4W A;  3IJ1 A;  1SQ9 A;  5C2W B;  2XYI A;  5C86 A;  3EMH A;  5E6U A;  2P9U C;  4FA9 D;  5C9Z B;  1VE7 A;  5GMK n;  1XKS A;  4CI2 A;  2I3T A;  5FFG A;  4NEN A;  3IUL A;  3IKO A;  1UTC A;  3A0F A;  3ZE1 A;  4NSX A;  4D6V A;  3QI0 A;  5HE2 B;  4J8B A;  4ERY A;  2P9I C;  4E5Z B;  4O9D A;  2IUP A;  2CN3 A;  4ZN4 A;  3F3F A;  4J86 A;  4ES0 A;  4OWR A;  2QZP A;  3ZWL B;  4AX4 A;  3RMZ D;  3E0C A;  3SWS D;  3UVM A;  4HDJ A;  4DNU A;  4FB1 D;  5FQD A;  4ZOY A;  4L9O A;  3SBQ A;  2PM9 A;  5TEF A;  3J80 g;  2AGZ A;  4PBY A;  3K72 A;  3PXW D;  1S4U X;  4FHL A;  3IUJ A;  3EI2 B;  4G55 A;  3PE7 A;  2UZX B;  3V9F A;  3MMY A;  2YNO A;  3I89 A;  5IGO A;  4PSW B;  4XYI A;  1JJU B;  4EWR A;  3IUR A;  4JSN C;  3IJC A;  5KDO B;  4CY1 A;  4U7A A;  4O3T B;  1TBG A;  1H2W A;  5AJA A;  2WQ8 A;  2GC4 A;  4RE5 A;  2HJ4 A;  4FA5 D;  2P9P C;  2TRC B;  5IJ7 E;  2B5L A;  5FXY A;  5FKT A;  4X63 B;  3EG6 A;  5AFU 3;  2VDR A;  3L4M D;  2VDQ A;  3I7H A;  4GQB B;  4ZOX A;  5I5J A;  4BL0 A;  3J81 g;  3EI3 A;  3MKS B;  3NVN A;  4WK4 A;  2YNP A;  3JRP A;  4A2L A;  5GXI A;  1VE6 A;  3RFH A;  3SCY A;  2YB8 B;  4DNV A;  3N0D A;  2HKR A;  4J8G A;  4X60 B;  4A7J A;  2I0S A;  1YFQ A;  4FAV D;  3AL8 A;  1XIP A;  2I0T A;  3SXT D;  2P9L C;  1GOG A; 
#chains in the Genus database with same CATH homology
 1JMZ B;  4D0K A;  1B9X A;  5IC7 A;  3C75 H;  3GRE A;  3EWE A;  4GM8 A;  3I7O A;  1NEX B;  3UVN A;  5H14 A;  2Z2O A;  5HYN B;  4JXM A;  4CY5 A;  2GNQ A;  3CFV A;  2PBI B;  2P9N C;  4GMB A;  4J82 A;  2H9P A;  5HQG A;  2AGX A;  3AL8 B;  3HFQ A;  1L0Q A;  4GM9 A;  5H17 A;  2P9K C;  3K26 A;  3CIK B;  2IAA A;  4L3H D;  4CZY A;  2G9A A;  4O1Q D;  3C5M A;  4PSX B;  5FKS A;  1U2V C;  3W15 A;  4ERZ A;  1PGU A;  3EI4 A;  1ERJ A;  1SQJ A;  5CXC B;  2XU7 A;  3NVQ A;  3VGZ A;  4CC9 A;  5EM2 A;  4J73 A;  4KFM B;  3GFC A;  5H1M A;  1GXR A;  3AH8 B;  4PNK B;  3OL2 A;  4H5J A;  5K19 A;  1K32 A;  4A2M A;  2O9K A;  4A09 B;  4FAN D;  4A0B A;  5A2Q g;  3I2N A;  2B5M A;  4FWW A;  3IJ0 A;  4A11 A;  3DWL C;  4L1Q D;  4JT6 C;  5AMS A;  2G99 A;  4MK0 B;  3OW8 A;  4GGD A;  3B7F A;  4QRJ A;  4JSP C;  2EBS A;  3C99 A;  3UR4 A;  3BG1 A;  3RLM D;  5IGQ A;  5JWZ A;  2BBK H;  2OK6 A;  4J87 A;  3OKY B;  4GQ2 P;  2HES X;  4X61 B;  3OTT A;  2AH0 A;  2H9N A;  1MG2 A;  4GM3 A;  3PXS D;  5EAR A;  3F3G A;  2J55 H;  3KRW B;  4N14 A;  3UVK A;  4A09 A;  4E54 A;  1PEV A;  4GGC A;  4A0B B;  5GSA A;  3SBR A;  3FGB A;  4K3J B;  2OK4 A;  2IUV A;  3IIW A;  4LGN A;  3BWS A;  2AH1 A;  1VYH C;  4Z8L A;  3EI4 B;  2YMU A;  2H68 A;  2AGY A;  3DM0 A;  3SVW D;  1N6E A;  5HE3 B;  5TEE A;  2B4E A;  2H13 A;  2J57 G;  5EMK B;  1N6F A;  4E54 B;  2CN2 A;  3V7D B;  2HYE A;  5GXH A;  5I5M A;  2CE9 A;  4L3G D;  1TYQ C;  4G56 B;  4YVD A;  3SFZ A;  4CI8 A;  3JAM g;  2PM6 B;  2QC5 A;  3PSL A;  4Y5R D;  3I8E A;  2H47 A;  3BG0 A;  5CXB B;  1PBY B;  3ODT A;  5K1C C;  3ULE C;  3UKR C;  4BH6 A;  3I8C A;  4J0X A;  2XL2 A;  3SMR A;  1PI6 A;  4LG8 A;  1NR0 A;  2B5N A;  3JZN A;  4GQ1 A;  4E5Z A;  3RFG A;  4CY3 A;  4A08 B;  5TF2 A;  4XYH A;  5C2V B;  5CXB A;  3EI3 B;  5FA5 B;  3PSC B;  3RSE C;  5EML B;  3SLE D;  3UVO A;  2OJY A;  4IA9 A;  3ORV D;  4H5I A;  4QQE A;  2IUQ A;  1Q47 A;  3I7N A;  3OKW A;  3CFS B;  4J81 A;  4A0A A;  2H6K A;  4O3U B;  1GG2 B;  3I7L A;  2IWF A;  4TZ4 A;  3SJL D;  3U4Y A;  2I3S A;  2OVQ B;  4FA1 D;  4J84 A;  4Y7R A;  2W18 A;  2H3X A;  4CZV A;  3JZH A;  2AGW A;  3EI1 A;  4LG9 A;  1GOT B;  2Z2P A;  1MDA H;  3OL2 B;  1R5M A;  2MTA H;  4PC0 A;  1A0R B;  4ERQ A;  4PBZ A;  2CNX A;  1SHY B;  4J79 A;  3MXX A;  4JT5 C;  3JRO A;  4J78 A;  4I79 A;  4JSX C;  2P9S C;  3OKY A;  3C9C A;  3PVW B;  1K8K C;  2HXC A;  4QT8 A;  3JPX A;  3RN1 D;  1RI6 A;  4CY2 A;  3EI1 B;  3SBP A;  4J77 A;  3JB9 L;  2H6Q A;  3AL9 A;  5TDH B;  2CO0 C;  5EM2 B;  4ESG A;  3OKT A;  3SN6 B;  2PM9 B;  3F3P A;  4IMM A;  3IIY A;  4GZ8 A;  4XEI C;  1JMX B;  3MZK A;  3PVU B;  3UKU C;  4QL1 A;  5FKQ A;  3SHF A;  4A0A B;  4A08 A;  2PM7 B;  2CE8 A;  4PXW A;  5EAP A;  3VH0 A;  4JSV C;  2YBA A;  2XL3 A;  2BCJ B;  3VA6 A;  3N0E A;  5FLX g;  2AQ5 A;  2OVP B;  2IUR A;  3L4O D;  2UZY B;  3EU7 A;  2GC7 A;  2H9M A;  1MG3 A;  4J0W A;  2J56 H;  4JD2 C;  5EMJ B;  1U4C A;  4ZOV A;  4CI3 A;  3DSM A;  2QXV A;  5EAM A;  4X3E A;  2H6N A;  2HJB A;  3P4F A;  4AEZ A;  4BUJ C;  3DXK C;  3DXM C;  5I5I A;  1FWX A;  2Q7Q A;  5CYK B;  1OLZ A;  2I0R A;  4R7A B;  3MKQ A;  1P22 A;  4O45 A;  5EAL A;  1GP2 B;  3AFC A;  4U1E I;  1XHM A;  1QNI A;  5IJ8 E;  4ZOZ A;  5EMM B;  3MZL A;  4CI1 A;  3PXT D;  4UI9 R;  3V5W B;  3UVL A;  2AGL A;  2Z2N A;  3K27 A;  1N6D A;  3KRX B;  4FA4 D;  5THA A;  3NVX A;  5IT9 g;  5FKR A;  4A11 B;  3RN0 D;  1OMW B;  5HE0 B;  4K3I D;  5CXC A;  2H14 A;  3EI2 A;  3FRX A;  1B9Y A;  3FM0 A;  2IWK A;  5HE1 B;  2YNN A;  2OVR B;  3JZG A;  4GGA A;  2OIZ A;  3I7P A;  5CYK A;  3I7K A;  4CZX A;  2H9L A;  2HKM A;  3RRM C;  1JOF A;  5SXM A;  2CO0 A;  4AOW A;  5B4W A;  3IJ1 A;  1SQ9 A;  5C2W B;  2XYI A;  3EMH A;  2P9U C;  4FA9 D;  5C9Z B;  5GMK n;  1XKS A;  4CI2 A;  2I3T A;  3IKO A;  3A0F A;  4NSX A;  4D6V A;  5HE2 B;  4J8B A;  4ERY A;  2P9I C;  4E5Z B;  4O9D A;  2IUP A;  2CN3 A;  4ZN4 A;  3F3F A;  4J86 A;  4ES0 A;  4OWR A;  3ZWL B;  3RMZ D;  3E0C A;  3SWS D;  3UVM A;  4HDJ A;  4FB1 D;  5FQD A;  4ZOY A;  4L9O A;  3SBQ A;  2PM9 A;  5TEF A;  3J80 g;  2AGZ A;  4PBY A;  3PXW D;  1S4U X;  4FHL A;  3EI2 B;  3PE7 A;  2UZX B;  3V9F A;  3MMY A;  2YNO A;  3I89 A;  5IGO A;  4PSW B;  4XYI A;  1JJU B;  4EWR A;  4JSN C;  3IJC A;  5KDO B;  4CY1 A;  4U7A A;  4O3T B;  1TBG A;  5AJA A;  2GC4 A;  2HJ4 A;  4FA5 D;  2P9P C;  2TRC B;  5IJ7 E;  2B5L A;  5FXY A;  5FKT A;  4X63 B;  3EG6 A;  5AFU 3;  3L4M D;  3I7H A;  4GQB B;  4ZOX A;  5I5J A;  4BL0 A;  3J81 g;  3EI3 A;  3MKS B;  3NVN A;  2YNP A;  3JRP A;  4A2L A;  5GXI A;  3RFH A;  3SCY A;  2YB8 B;  3N0D A;  2HKR A;  4J8G A;  4X60 B;  4A7J A;  2I0S A;  1YFQ A;  4FAV D;  3AL8 A;  1XIP A;  2I0T A;  3SXT D;  2P9L C;  4OZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...