4J82A

Crystal structure of beta'-cop/insig-2 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j82A01
3FGBA 4L1QD 4A2MA 4A11B 4ZOYA 1JJUB 1U2VC 2H47A 2TRCB 4GM3A 3SHFA 4O3TB 3U4YA 3ODTA 3EI4A 1SQJA 3PVWB 2UZXB 4ES0A 3OTTA 2BCJB 5FQDA 2GC7A 2PM9A 4QRJA 3CFSB 4JT6C 4LGNA 4J8GA 2P9NC 2AGXA 1A0RB 3IJ0A 3MKSB 2GNQA 3OKWA 3EI4B 5C2WB 3C75H 4CC9A 1MG3A 4Z8LA 3UVMA 4AEZA 2CN2A 4KFMB 5AFU3 1XIPA 3JRPA 3ORVD 3SMRA 2YNOA 2CO0A 2YNNA 2I3TA 4JSNC 3PVUB 4GGCA 3OKTA 3AL8B 2IUPA 4BH6A 4A08A 2QC5A 4CI2A 3I7NA 2HYEA 3UKUC 2YBAA 5SXMA 3JROA 2I0TA 4J86A 3OKYB 2I3SA 3EU7A 5TF2A 4IA9A 1PEVA 2YNPA 3J80g 4J77A 3K27A 3FRXA 4GMBA 5CXCB 4J73A 1N6EA 5EAPA 2HJ4A 1Q47A 3UVKA 5K19A 3I7KA 3ZWLB 2PM7B 3N0EA 5FXYA 5IT9g 5CYKB 4E54B 3RFGA 3I7PA 2HXCA 3BG0A 3EI3B 1XHMA 3MZLA 3EI2A 2XU7A 2HJBA 5TEFA 3PXSD 2IWFA 4JSVC 4A0BB 5HYNB 4CI3A 3F3GA 2AGZA 1U4CA 3PSLA 1TYQC 4CI8A 4LG8A 1PBYB 3CIKB 2H13A 4TZ4A 3EI1B 2B4EA 1JMZB 4JSXC 3UR4A 3EWEA 3B7FA 1B9YA 3BG1A 5IJ7E 3JB9L 4XEIC 1GP2B 3UVLA 5EMKB 4E5ZB 4K3ID 5IGOA 3OKYA 3RSEC 4A0AA 3AFCA 4IMMA 2HKRA 2H6KA 3A0FA 1SHYB 2YMUA 3AH8B 5GXIA 2P9LC 3V5WB 2CE8A 4J0WA 5HE0B 5GMKn 4A11A 3C99A 4G56B 4X63B 3RN0D 5IJ8E 3F3FA 3VA6A 2Z2NA 1K8KC 4ESGA 3N0DA 4GQBB 1JOFA 4YVDA 4PSWB 2AGWA 4A7JA 3F3PA 5B4WA 3EG6A 3PE7A 5EMLB 2P9UC 1S4UX 2W18A 3HFQA 3L4MD 4O1QD 1K32A 4ZOVA 4BL0A 2G9AA 3I8CA 4FA9D 4J82A 5I5IA 2OVRB 4OWRA 2UZYB 3JZHA 4FA4D 2P9KC 3UKRC 4JXMA 5C9ZB 1R5MA 4GQ1A 4R7AB 5FKQA 3RMZD 1FWXA 4JT5C 3JAMg 4CZYA 3SFZA 4JD2C 3L4OD 4E54A 1XKSA 5FKTA 4A09A 3JPXA 4XYHA 3C9CA 5CXBB 3RN1D 3V9FA 4A08B 3MXXA 4PC0A 4FB1D 3VGZA 4FWWA 5TEEA 5GXHA 4CZVA 3IIYA 1GXRA 1PGUA 1NEXB 5HE2B 4QT8A 4CY5A 5CXCA 2H9PA 2P9SC 1TBGA 2B5MA 2H68A 3JZGA 5AJAA 2J57G 4U7AA 2H14A 4K3JB 4ZN4A 2CE9A 4FHLA 3I7HA 2EBSA 3IKOA 2BBKH 1L0QA 3RLMD 1OMWB 4LG9A 2Z2PA 1NR0A 4A2LA 3IIWA 4JSPC 3IJCA 5EM2B 3MKQA 4D6VA 3DSMA 5FKSA 4J8BA 4J79A 2AH1A 3OW8A 4Y5RD 5I5JA 4ERZA 4O3UB 4X60B 1P22A 4L3GD 2OVQB 4ERQA 3SBPA 3C5MA 2GC4A 2OIZA 2PM6B 2O9KA 5A2Qg 3P4FA 4I79A 5TDHB 4A0AB 5JWZA 2CO0C 4GZ8A 4Y7RA 5FA5B 3DXMC 5EARA 4OZUA 1B9XA 5I5MA 4ERYA 1N6DA 4O9DA 3PXTD 4CY1A 4QL1A 2H6NA 3DWLC 2QXVA 4J78A 4EWRA 5FLXg 3FM0A 3KRWB 4GM8A 4A0BA 5HQGA 3EI1A 3SBQA 5HE3B 3RFHA 2OVPB 2CNXA 1GG2B 2Z2OA 4A09B 2H9LA 5H1MA 1PI6A 3I7OA 3OL2A 2B5NA 3PXWD 3UVNA 5GSAA 3JZNA 4D0KA 2CN3A 3EMHA 3NVQA 5CYKA 4CI1A 4PBZA 1MDAH 2HESX 2AH0A 3E0CA 3SWSD 3J81g 4GM9A 4XYIA 4J87A 5EM2A 2P9IC 3NVNA 2I0SA 2OK6A 4CY3A 4PXWA 5EALA 4X3EA 4GQ2P 5H14A 3DM0A 2IAAA 5H17A 2IUVA 4AOWA 2H6QA 1GOTB 5IC7A 3ULEC 4U1EI 2XL2A 3GFCA 4X61B 2AGLA 3VH0A 3I2NA 2IUQA 4E5ZA 3UVOA 4PSXB 2I0RA 4J0XA 5AMSA 4H5JA 2H9NA 4QQEA 4NSXA 5FKRA 3I8EA 4PBYA 3KRXB 1JMXB 3I89A 4N14A 3MMYA 3AL8A 2P9PC 2PBIB 2XL3A 5HE1B 2J55H 5K1CC 3PSCB 4FA1D 3SLED 4BUJC 2MTAH 1RI6A 2XYIA 3CFVA 4CZXA 3DXKC 4FAND 1QNIA 4GGDA 3SBRA 2AQ5A 1ERJA 2B5LA 3SN6B 5CXBA 2OJYA 2YB8B 3I7LA 4L9OA 2AGYA 3BWSA 2J56H 5EMMB 2G99A 2PM9B 4CY2A 2HKMA 1OLZA 3MZKA 4H5IA 3SJLD 2IURA 5KDOB 1SQ9A 4PNKB 4HDJA 3NVXA 4GGAA 3W15A 3SCYA 4J81A 4O45A 4J84A 4FAVD 4FA5D 2OK4A 1VYHC 1MG2A 4L3HD 2IWKA 5EMJB 5THAA 3V7DB 1YFQA 3EI2B 5C2VB 3SXTD 3AL9A 3K26A 3RRMC 1N6FA 3GREA 2H3XA 3OL2B 3IJ1A 4ZOZA 3SVWD 4UI9R 3EI3A 4MK0B 5EAMA 2Q7QA 4ZOXA 2H9MA 5IGQA
chains in the Genus database with same CATH superfamily
3FGBA 1JTDB 2BKLA 4L1QD 4A2MA 4A11B 4ZOYA 1JJUB 1U2VC 2VDKA 2H47A 2TRCB 4GM3A 3SHFA 4O3TB 3U4YA 3ODTA 3EI4A 1UOPA 1SQJA 3PVWB 2UZXB 2VDOA 4ES0A 3OTTA 2BCJB 5FQDA 2GC7A 2PM9A 3NIDA 4QRJA 3CFSB 2VZ1A 4JT6C 4LGNA 2P9NC 4J8GA 2AGXA 2QR5A 1A0RB 3IJ0A 3MKSB 3IUNA 2GNQA 3OKWA 5C86A 3EI4B 5C2WB 3C75H 4CC9A 1MG3A 4Z8LA 3UVMA 4AEZA 2CN2A 4KFMB 5AFU3 1XIPA 3JRPA 3ORVD 3GC3B 5M5VA 1H2ZA 4G1EA 3O4IA 3MVDK 3SMRA 2YNOA 2CO0A 5FFGA 1E8MA 2I3TA 2YNNA 4JHPC 4JSNC 1C9LA 3GD1I 3PVUB 3OKTA 4GGCA 3AL8B 3KCIA 2IUPA 4BH6A 4A08A 2QC5A 4CI2A 1GOGA 4G1MA 3I7NA 3K72A 2HYEA 3UKUC 2YBAA 5SXMA 1JV2A 3JROA 2I0TA 3NIFA 4J86A 3OKYB 3EQ9A 2I3SA 4QAMA 4WK4A 3O4HA 1GOFA 5M5SA 3EU7A 5TF2A 4IA9A 1PEVA 2YNPA 5E6UA 3J80g 4UM9A 4J77A 4WK0A 3K27A 3FRXA 4GMBA 5CXCB 4J73A 1N6EA 5EAPA 3ZDZA 2HJ4A 1Q47A 3UVKA 4D9SA 5K19A 3I7KA 3ZWLB 2PM7B 5M5RA 3N0EA 5FXYA 5IT9g 5CYKB 4E54B 3RFGA 3I7PA 3T3MA 2HXCA 3BG0A 3EI3B 1XHMA 3MZLA 4UM8A 3EI2A 2XU7A 2HJBA 5TEFA 1TYEA 3PXSD 2IWFA 4JSVC 4AN0A 4A0BB 5HYNB 4CI3A 3F3GA 2AGZA 1U4CA 3PSLA 1TYQC 4CI8A 4MMZA 4LG8A 1PBYB 3CIKB 2H13A 4TZ4A 3EI1B 2B4EA 1JMZB 1QFMA 4JSXC 3UR4A 3EWEA 4L1MA 3B7FA 1B9YA 3BG1A 5IJ7E 3JB9L 4XEIC 1GP2B 3UVLA 5EMKB 4E5ZB 4K3ID 3VI4A 5IGOA 2EIBA 3OKYA 3RSEC 4A0AA 3AFCA 4IMMA 2HKRA 4WJKA 2H6KA 4MMYA 3A0FA 1SHYB 2YMUA 3AH8B 2VDNA 5GXIA 3K71A 2P9LC 3V5WB 2CE8A 4J0WA 5HE0B 4BCDA 1YR2A 5GMKn 4A11A 3C99A 5M61A 4G56B 4X63B 2EIEA 1O6GA 3F3FA 3RN0D 5IJ8E 3VA6A 2Z2NA 1K8KC 4ESGA 3N0DA 4GQBB 1UOOA 1JOFA 4YVDA 2VDQA 4PSWB 3FCSA 2AGWA 3IJEA 4A7JA 2VDMA 3F3PA 5B4WA 1H2YA 3EG6A 3PE7A 5EMLB 2P9UC 3ZE2A 1S4UX 2W18A 3IULA 3HFQA 3L4MD 4O02A 4O1QD 1K32A 5E6SA 3QI0A 4ZOVA 5FFOA 1H2WA 4BL0A 2G9AA 3I8CA 4FA9D 4J82A 5I5IA 2OVRB 1VZ2A 4OWRA 2UZYB 2VC2A 3JZHA 4FA4D 2P9KC 4RE5A 2EIDA 4JXMA 3UKRC 5C9ZB 1R5MA 4GQ1A 4R7AB 2XDWA 3ZDXA 4RE6A 5FKQA 3RMZD 1FWXA 3IUMA 4JT5C 3JAMg 4CZYA 3SFZA 4JD2C 3L4OD 4E54A 1XKSA 5FKTA 4A09A 3JPXA 4XYHA 3C9CA 5CXBB 3RN1D 1BPOA 3V9FA 4BCBA 4BCCA 4BP9A 4A08B 3MXXA 3MUNA 4PC0A 4FB1D 3VGZA 1VZ3A 4FWWA 1T2XA 5TEEA 5GXHA 2VDLA 4CZVA 3ZDYA 3IIYA 1GXRA 1PGUA 1NEXB 5HE2B 3QHYB 4QT8A 4CY5A 5CXCA 1O6FA 3O4JA 3V4PA 2XZGA 2H9PA 3IURA 2P9SC 1TBGA 1C9IA 2B5MA 3DDUA 4AMZA 2H68A 3JZGA 5AJAA 2J57G 4U7AA 2H14A 4K3JB 4Z7NA 4ZN4A 2CE9A 4FHLA 3I7HA 2EBSA 3IKOA 2BBKH 1K3IA 1L0QA 4JHNA 3RLMD 1VE6A 1OMWB 4LG9A 2Z2PA 1NR0A 4A2LA 3IIWA 4JSPC 3IJCA 5EM2B 3MKQA 1H2XA 4D6VA 3DSMA 5FKSA 3MUOA 1GOHA 4J8BA 1L5GA 4J79A 2AH1A 3OW8A 4Y5RD 5I5JA 4ERZA 4O3UB 4X60B 5C92A 1P22A 4L3GD 2OVQB 4ERQA 3SBPA 3C5MA 2GC4A 2OIZA 2PM6B 2O9KA 5A2Qg 3P4FA 4I79A 5TDHB 5M5UA 2XE4A 4A0AB 5JWZA 2CO0C 4GZ8A 4Y7RA 5FA5B 2QZPA 3DXMC 1UOQA 5EARA 4OZUA 1B9XA 5I5MA 3VI3A 4ERYA 5M5TA 1N6DA 3NIGA 4O9DA 3PXTD 4WK2A 3EQ8A 4CY1A 4QL1A 2H6NA 3DWLC 2QXVA 4J78A 4EWRA 5FLXg 3FM0A 3KRWB 4GM8A 4A0BA 5HQGA 3EI1A 3SBQA 5HE3B 1VE7A 3RFHA 2OVPB 5E6RA 1A12A 2CNXA 4NBMA 1GG2B 2Z2OA 4A09B 2H9LA 5H1MA 1PI6A 3I7OA 3OL2A 2B5NA 3PXWD 5HDBA 3UVNA 5GSAA 3JZNA 3O4GA 4D0KA 2CN3A 3EMHA 3NVQA 5CYKA 4CI1A 1MDAH 4PBZA 2HESX 2EICA 2AH0A 3E0CA 3SWSD 3J81g 4GM9A 4DNWA 3ZE1A 4XYIA 4J87A 5EM2A 2P9IC 3NVNA 2I0SA 2OK6A 3T3PA 4CY3A 4PXWA 5EALA 4X3EA 4GQ2P 5H14A 3DM0A 2IAAA 5H17A 2IUVA 1QFSA 2VZ3A 4AOWA 2H6QA 4Z7OA 1GOTB 5IC7A 3ULEC 4U1EI 2XL2A 3GFCA 4X61B 2AGLA 3VH0A 2VDPA 3I2NA 2IUQA 4O2WA 4E5ZA 3UVOA 4PSXB 2I0RA 4J0XA 5AMSA 4H5JA 2H9NA 4QQEA 4NSXA 5FKRA 3I8EA 4PBYA 3KRXB 1JMXB 3I89A 1E5TA 4N14A 4BP8A 4AMYA 3OF7A 3MMYA 3AL8A 2P9PC 2PBIB 2VDRA 2XL3A 5HE1B 2J55H 5K1CC 3PSCB 4FA1D 3SLED 4BUJC 1I2MB 2MTAH 1RI6A 2XYIA 3CFVA 2HU7A 3V4VA 1M1XA 4CZXA 3DXKC 4G55A 4FAND 1QNIA 4GGDA 3SBRA 2AQ5A 1ERJA 2HU5A 2B5LA 3SN6B 1UTCA 5CXBA 2OJYA 2YB8B 3IUJA 3I7LA 4L9OA 2AGYA 3BWSA 2J56H 4Z7QA 3EQ7A 4NENA 5EMMB 4NC4A 2HU8A 2WQ8A 2G99A 2PM9B 4CY2A 2HKMA 1OLZA 3MZKA 4H5IA 3SJLD 2IURA 5KDOB 1SQ9A 4PNKB 4HDJA 3NVXA 4GGAA 3W15A 4DNVA 3SCYA 4AX4A 3FCUA 4J81A 4O45A 3ZE0A 4J84A 4FAVD 2JKXA 1U8CA 3IUQA 4FA5D 2OK4A 1VYHC 1MG2A 4L3HD 2IWKA 5EMJB 5THAA 3K6SA 3V7DB 1YFQA 3EI2B 1E8NA 5C2VB 3SXTD 3AL9A 3K26A 3RRMC 1N6FA 3GREA 2H3XA 3OL2B 3IJ1A 4ZOZA 3SVWD 3IVMA 4UI9R 3EI3A 4MK0B 4NAAA 4DNUA 5EAMA 2Q7QA 4ZOXA 2H9MA 4MMXA 4IRZA 5IGQA 4AN1A
chains in the Genus database with same CATH topology
3FGBA 4L1QD 4A2MA 4A11B 4ZOYA 1JJUB 1U2VC 2H47A 2TRCB 4GM3A 3SHFA 4O3TB 3U4YA 3ODTA 3EI4A 1SQJA 3PVWB 2UZXB 4ES0A 3OTTA 2BCJB 5FQDA 2GC7A 2PM9A 4QRJA 3CFSB 4JT6C 4LGNA 4J8GA 2P9NC 2AGXA 1A0RB 3IJ0A 3MKSB 2GNQA 3OKWA 3EI4B 5C2WB 3C75H 4CC9A 1MG3A 4Z8LA 3UVMA 4AEZA 2CN2A 4KFMB 5AFU3 1XIPA 3JRPA 3ORVD 3SMRA 2YNOA 2CO0A 2YNNA 2I3TA 4JSNC 3PVUB 4GGCA 3OKTA 3AL8B 2IUPA 4BH6A 4A08A 2QC5A 4CI2A 3I7NA 2HYEA 3UKUC 2YBAA 5SXMA 3JROA 2I0TA 4J86A 3OKYB 2I3SA 3EU7A 5TF2A 4IA9A 1PEVA 2YNPA 3J80g 4J77A 3K27A 3FRXA 4GMBA 5CXCB 4J73A 1N6EA 5EAPA 2HJ4A 1Q47A 3UVKA 5K19A 3I7KA 3ZWLB 2PM7B 3N0EA 5FXYA 5IT9g 5CYKB 4E54B 3RFGA 3I7PA 2HXCA 3BG0A 3EI3B 1XHMA 3MZLA 3EI2A 2XU7A 2HJBA 5TEFA 3PXSD 2IWFA 4JSVC 4A0BB 5HYNB 4CI3A 3F3GA 2AGZA 1U4CA 3PSLA 1TYQC 4CI8A 4LG8A 1PBYB 3CIKB 2H13A 4TZ4A 3EI1B 2B4EA 1JMZB 4JSXC 3UR4A 3EWEA 3B7FA 1B9YA 3BG1A 5IJ7E 3JB9L 4XEIC 1GP2B 3UVLA 5EMKB 4E5ZB 4K3ID 5IGOA 3OKYA 3RSEC 4A0AA 3AFCA 4IMMA 2HKRA 2H6KA 3A0FA 1SHYB 2YMUA 3AH8B 5GXIA 2P9LC 3V5WB 2CE8A 4J0WA 5HE0B 5GMKn 4A11A 3C99A 4G56B 4X63B 3RN0D 5IJ8E 3F3FA 3VA6A 2Z2NA 1K8KC 4ESGA 3N0DA 4GQBB 1JOFA 4YVDA 4PSWB 2AGWA 4A7JA 3F3PA 5B4WA 3EG6A 3PE7A 5EMLB 2P9UC 1S4UX 2W18A 3HFQA 3L4MD 4O1QD 1K32A 4ZOVA 4BL0A 2G9AA 3I8CA 4FA9D 4J82A 5I5IA 2OVRB 4OWRA 2UZYB 3JZHA 4FA4D 2P9KC 3UKRC 4JXMA 5C9ZB 1R5MA 4GQ1A 4R7AB 5FKQA 3RMZD 1FWXA 4JT5C 3JAMg 4CZYA 3SFZA 4JD2C 3L4OD 4E54A 1XKSA 5FKTA 4A09A 3JPXA 4XYHA 3C9CA 5CXBB 3RN1D 3V9FA 4A08B 3MXXA 4PC0A 4FB1D 3VGZA 4FWWA 5TEEA 5GXHA 4CZVA 3IIYA 1GXRA 1PGUA 1NEXB 5HE2B 4QT8A 4CY5A 5CXCA 2H9PA 2P9SC 1TBGA 2B5MA 2H68A 3JZGA 5AJAA 2J57G 4U7AA 2H14A 4K3JB 4ZN4A 2CE9A 4FHLA 3I7HA 2EBSA 3IKOA 2BBKH 1L0QA 3RLMD 1OMWB 4LG9A 2Z2PA 1NR0A 4A2LA 3IIWA 4JSPC 3IJCA 5EM2B 3MKQA 4D6VA 3DSMA 5FKSA 4J8BA 4J79A 2AH1A 3OW8A 4Y5RD 5I5JA 4ERZA 4O3UB 4X60B 1P22A 4L3GD 2OVQB 4ERQA 3SBPA 3C5MA 2GC4A 2OIZA 2PM6B 2O9KA 5A2Qg 3P4FA 4I79A 5TDHB 4A0AB 5JWZA 2CO0C 4GZ8A 4Y7RA 5FA5B 3DXMC 5EARA 4OZUA 1B9XA 5I5MA 4ERYA 1N6DA 4O9DA 3PXTD 4CY1A 4QL1A 2H6NA 3DWLC 2QXVA 4J78A 4EWRA 5FLXg 3FM0A 3KRWB 4GM8A 4A0BA 5HQGA 3EI1A 3SBQA 5HE3B 3RFHA 2OVPB 2CNXA 1GG2B 2Z2OA 4A09B 2H9LA 5H1MA 1PI6A 3I7OA 3OL2A 2B5NA 3PXWD 3UVNA 5GSAA 3JZNA 4D0KA 2CN3A 3EMHA 3NVQA 5CYKA 4CI1A 4PBZA 1MDAH 2HESX 2AH0A 3E0CA 3SWSD 3J81g 4GM9A 4XYIA 4J87A 5EM2A 2P9IC 3NVNA 2I0SA 2OK6A 4CY3A 4PXWA 5EALA 4X3EA 4GQ2P 5H14A 3DM0A 2IAAA 5H17A 2IUVA 4AOWA 2H6QA 1GOTB 5IC7A 3ULEC 4U1EI 2XL2A 3GFCA 4X61B 2AGLA 3VH0A 3I2NA 2IUQA 4E5ZA 3UVOA 4PSXB 2I0RA 4J0XA 5AMSA 4H5JA 2H9NA 4QQEA 4NSXA 5FKRA 3I8EA 4PBYA 3KRXB 1JMXB 3I89A 4N14A 3MMYA 3AL8A 2P9PC 2PBIB 2XL3A 5HE1B 2J55H 5K1CC 3PSCB 4FA1D 3SLED 4BUJC 2MTAH 1RI6A 2XYIA 3CFVA 4CZXA 3DXKC 4FAND 1QNIA 4GGDA 3SBRA 2AQ5A 1ERJA 2B5LA 3SN6B 5CXBA 2OJYA 2YB8B 3I7LA 4L9OA 2AGYA 3BWSA 2J56H 5EMMB 2G99A 2PM9B 4CY2A 2HKMA 1OLZA 3MZKA 4H5IA 3SJLD 2IURA 5KDOB 1SQ9A 4PNKB 4HDJA 3NVXA 4GGAA 3W15A 3SCYA 4J81A 4O45A 4J84A 4FAVD 4FA5D 2OK4A 1VYHC 1MG2A 4L3HD 2IWKA 5EMJB 5THAA 3V7DB 1YFQA 3EI2B 5C2VB 3SXTD 3AL9A 3K26A 3RRMC 1N6FA 3GREA 2H3XA 3OL2B 3IJ1A 4ZOZA 3SVWD 4UI9R 3EI3A 4MK0B 5EAMA 2Q7QA 4ZOXA 2H9MA 5IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGB A;  4L1Q D;  4A2M A;  4A11 B;  4ZOY A;  1JJU B;  1U2V C;  2H47 A;  2TRC B;  4GM3 A;  3SHF A;  4O3T B;  3U4Y A;  3ODT A;  3EI4 A;  1SQJ A;  3PVW B;  2UZX B;  4ES0 A;  3OTT A;  2BCJ B;  5FQD A;  2GC7 A;  2PM9 A;  4QRJ A;  3CFS B;  4JT6 C;  4LGN A;  4J8G A;  2P9N C;  2AGX A;  1A0R B;  3IJ0 A;  3MKS B;  2GNQ A;  3OKW A;  3EI4 B;  5C2W B;  3C75 H;  4CC9 A;  1MG3 A;  4Z8L A;  3UVM A;  4AEZ A;  2CN2 A;  4KFM B;  5AFU 3;  1XIP A;  3JRP A;  3ORV D;  3SMR A;  2YNO A;  2CO0 A;  2YNN A;  2I3T A;  4JSN C;  3PVU B;  4GGC A;  3OKT A;  3AL8 B;  2IUP A;  4BH6 A;  4A08 A;  2QC5 A;  4CI2 A;  3I7N A;  2HYE A;  3UKU C;  2YBA A;  5SXM A;  3JRO A;  2I0T A;  4J86 A;  3OKY B;  2I3S A;  3EU7 A;  5TF2 A;  4IA9 A;  1PEV A;  2YNP A;  3J80 g;  4J77 A;  3K27 A;  3FRX A;  4GMB A;  5CXC B;  4J73 A;  1N6E A;  5EAP A;  2HJ4 A;  1Q47 A;  3UVK A;  5K19 A;  3I7K A;  3ZWL B;  2PM7 B;  3N0E A;  5FXY A;  5IT9 g;  5CYK B;  4E54 B;  3RFG A;  3I7P A;  2HXC A;  3BG0 A;  3EI3 B;  1XHM A;  3MZL A;  3EI2 A;  2XU7 A;  2HJB A;  5TEF A;  3PXS D;  2IWF A;  4JSV C;  4A0B B;  5HYN B;  4CI3 A;  3F3G A;  2AGZ A;  1U4C A;  3PSL A;  1TYQ C;  4CI8 A;  4LG8 A;  1PBY B;  3CIK B;  2H13 A;  4TZ4 A;  3EI1 B;  2B4E A;  1JMZ B;  4JSX C;  3UR4 A;  3EWE A;  3B7F A;  1B9Y A;  3BG1 A;  5IJ7 E;  3JB9 L;  4XEI C;  1GP2 B;  3UVL A;  5EMK B;  4E5Z B;  4K3I D;  5IGO A;  3OKY A;  3RSE C;  4A0A A;  3AFC A;  4IMM A;  2HKR A;  2H6K A;  3A0F A;  1SHY B;  2YMU A;  3AH8 B;  5GXI A;  2P9L C;  3V5W B;  2CE8 A;  4J0W A;  5HE0 B;  5GMK n;  4A11 A;  3C99 A;  4G56 B;  4X63 B;  3RN0 D;  5IJ8 E;  3F3F A;  3VA6 A;  2Z2N A;  1K8K C;  4ESG A;  3N0D A;  4GQB B;  1JOF A;  4YVD A;  4PSW B;  2AGW A;  4A7J A;  3F3P A;  5B4W A;  3EG6 A;  3PE7 A;  5EML B;  2P9U C;  1S4U X;  2W18 A;  3HFQ A;  3L4M D;  4O1Q D;  1K32 A;  4ZOV A;  4BL0 A;  2G9A A;  3I8C A;  4FA9 D;  4J82 A;  5I5I A;  2OVR B;  4OWR A;  2UZY B;  3JZH A;  4FA4 D;  2P9K C;  3UKR C;  4JXM A;  5C9Z B;  1R5M A;  4GQ1 A;  4R7A B;  5FKQ A;  3RMZ D;  1FWX A;  4JT5 C;  3JAM g;  4CZY A;  3SFZ A;  4JD2 C;  3L4O D;  4E54 A;  1XKS A;  5FKT A;  4A09 A;  3JPX A;  4XYH A;  3C9C A;  5CXB B;  3RN1 D;  3V9F A;  4A08 B;  3MXX A;  4PC0 A;  4FB1 D;  3VGZ A;  4FWW A;  5TEE A;  5GXH A;  4CZV A;  3IIY A;  1GXR A;  1PGU A;  1NEX B;  5HE2 B;  4QT8 A;  4CY5 A;  5CXC A;  2H9P A;  2P9S C;  1TBG A;  2B5M A;  2H68 A;  3JZG A;  5AJA A;  2J57 G;  4U7A A;  2H14 A;  4K3J B;  4ZN4 A;  2CE9 A;  4FHL A;  3I7H A;  2EBS A;  3IKO A;  2BBK H;  1L0Q A;  3RLM D;  1OMW B;  4LG9 A;  2Z2P A;  1NR0 A;  4A2L A;  3IIW A;  4JSP C;  3IJC A;  5EM2 B;  3MKQ A;  4D6V A;  3DSM A;  5FKS A;  4J8B A;  4J79 A;  2AH1 A;  3OW8 A;  4Y5R D;  5I5J A;  4ERZ A;  4O3U B;  4X60 B;  1P22 A;  4L3G D;  2OVQ B;  4ERQ A;  3SBP A;  3C5M A;  2GC4 A;  2OIZ A;  2PM6 B;  2O9K A;  5A2Q g;  3P4F A;  4I79 A;  5TDH B;  4A0A B;  5JWZ A;  2CO0 C;  4GZ8 A;  4Y7R A;  5FA5 B;  3DXM C;  5EAR A;  4OZU A;  1B9X A;  5I5M A;  4ERY A;  1N6D A;  4O9D A;  3PXT D;  4CY1 A;  4QL1 A;  2H6N A;  3DWL C;  2QXV A;  4J78 A;  4EWR A;  5FLX g;  3FM0 A;  3KRW B;  4GM8 A;  4A0B A;  5HQG A;  3EI1 A;  3SBQ A;  5HE3 B;  3RFH A;  2OVP B;  2CNX A;  1GG2 B;  2Z2O A;  4A09 B;  2H9L A;  5H1M A;  1PI6 A;  3I7O A;  3OL2 A;  2B5N A;  3PXW D;  3UVN A;  5GSA A;  3JZN A;  4D0K A;  2CN3 A;  3EMH A;  3NVQ A;  5CYK A;  4CI1 A;  4PBZ A;  1MDA H;  2HES X;  2AH0 A;  3E0C A;  3SWS D;  3J81 g;  4GM9 A;  4XYI A;  4J87 A;  5EM2 A;  2P9I C;  3NVN A;  2I0S A;  2OK6 A;  4CY3 A;  4PXW A;  5EAL A;  4X3E A;  4GQ2 P;  5H14 A;  3DM0 A;  2IAA A;  5H17 A;  2IUV A;  4AOW A;  2H6Q A;  1GOT B;  5IC7 A;  3ULE C;  4U1E I;  2XL2 A;  3GFC A;  4X61 B;  2AGL A;  3VH0 A;  3I2N A;  2IUQ A;  4E5Z A;  3UVO A;  4PSX B;  2I0R A;  4J0X A;  5AMS A;  4H5J A;  2H9N A;  4QQE A;  4NSX A;  5FKR A;  3I8E A;  4PBY A;  3KRX B;  1JMX B;  3I89 A;  4N14 A;  3MMY A;  3AL8 A;  2P9P C;  2PBI B;  2XL3 A;  5HE1 B;  2J55 H;  5K1C C;  3PSC B;  4FA1 D;  3SLE D;  4BUJ C;  2MTA H;  1RI6 A;  2XYI A;  3CFV A;  4CZX A;  3DXK C;  4FAN D;  1QNI A;  4GGD A;  3SBR A;  2AQ5 A;  1ERJ A;  2B5L A;  3SN6 B;  5CXB A;  2OJY A;  2YB8 B;  3I7L A;  4L9O A;  2AGY A;  3BWS A;  2J56 H;  5EMM B;  2G99 A;  2PM9 B;  4CY2 A;  2HKM A;  1OLZ A;  3MZK A;  4H5I A;  3SJL D;  2IUR A;  5KDO B;  1SQ9 A;  4PNK B;  4HDJ A;  3NVX A;  4GGA A;  3W15 A;  3SCY A;  4J81 A;  4O45 A;  4J84 A;  4FAV D;  4FA5 D;  2OK4 A;  1VYH C;  1MG2 A;  4L3H D;  2IWK A;  5EMJ B;  5THA A;  3V7D B;  1YFQ A;  3EI2 B;  5C2V B;  3SXT D;  3AL9 A;  3K26 A;  3RRM C;  1N6F A;  3GRE A;  2H3X A;  3OL2 B;  3IJ1 A;  4ZOZ A;  3SVW D;  4UI9 R;  3EI3 A;  4MK0 B;  5EAM A;  2Q7Q A;  4ZOX A;  2H9M A;  5IGQ A; 
#chains in the Genus database with same CATH topology
 3FGB A;  1JTD B;  2BKL A;  4L1Q D;  4A2M A;  4A11 B;  4ZOY A;  1JJU B;  1U2V C;  2VDK A;  2H47 A;  2TRC B;  4GM3 A;  3SHF A;  4O3T B;  3U4Y A;  3ODT A;  3EI4 A;  1UOP A;  1SQJ A;  3PVW B;  2UZX B;  2VDO A;  4ES0 A;  3OTT A;  2BCJ B;  5FQD A;  2GC7 A;  2PM9 A;  3NID A;  4QRJ A;  3CFS B;  2VZ1 A;  4JT6 C;  4LGN A;  2P9N C;  4J8G A;  2AGX A;  2QR5 A;  1A0R B;  3IJ0 A;  3MKS B;  3IUN A;  2GNQ A;  3OKW A;  5C86 A;  3EI4 B;  5C2W B;  3C75 H;  4CC9 A;  1MG3 A;  4Z8L A;  3UVM A;  4AEZ A;  2CN2 A;  4KFM B;  5AFU 3;  1XIP A;  3JRP A;  3ORV D;  3GC3 B;  5M5V A;  1H2Z A;  4G1E A;  3O4I A;  3MVD K;  3SMR A;  2YNO A;  2CO0 A;  5FFG A;  1E8M A;  2I3T A;  2YNN A;  4JHP C;  4JSN C;  1C9L A;  3GD1 I;  3PVU B;  3OKT A;  4GGC A;  3AL8 B;  3KCI A;  2IUP A;  4BH6 A;  4A08 A;  2QC5 A;  4CI2 A;  1GOG A;  4G1M A;  3I7N A;  3K72 A;  2HYE A;  3UKU C;  2YBA A;  5SXM A;  1JV2 A;  3JRO A;  2I0T A;  3NIF A;  4J86 A;  3OKY B;  3EQ9 A;  2I3S A;  4QAM A;  4WK4 A;  3O4H A;  1GOF A;  5M5S A;  3EU7 A;  5TF2 A;  4IA9 A;  1PEV A;  2YNP A;  5E6U A;  3J80 g;  4UM9 A;  4J77 A;  4WK0 A;  3K27 A;  3FRX A;  4GMB A;  5CXC B;  4J73 A;  1N6E A;  5EAP A;  3ZDZ A;  2HJ4 A;  1Q47 A;  3UVK A;  4D9S A;  5K19 A;  3I7K A;  3ZWL B;  2PM7 B;  5M5R A;  3N0E A;  5FXY A;  5IT9 g;  5CYK B;  4E54 B;  3RFG A;  3I7P A;  3T3M A;  2HXC A;  3BG0 A;  3EI3 B;  1XHM A;  3MZL A;  4UM8 A;  3EI2 A;  2XU7 A;  2HJB A;  5TEF A;  1TYE A;  3PXS D;  2IWF A;  4JSV C;  4AN0 A;  4A0B B;  5HYN B;  4CI3 A;  3F3G A;  2AGZ A;  1U4C A;  3PSL A;  1TYQ C;  4CI8 A;  4MMZ A;  4LG8 A;  1PBY B;  3CIK B;  2H13 A;  4TZ4 A;  3EI1 B;  2B4E A;  1JMZ B;  1QFM A;  4JSX C;  3UR4 A;  3EWE A;  4L1M A;  3B7F A;  1B9Y A;  3BG1 A;  5IJ7 E;  3JB9 L;  4XEI C;  1GP2 B;  3UVL A;  5EMK B;  4E5Z B;  4K3I D;  3VI4 A;  5IGO A;  2EIB A;  3OKY A;  3RSE C;  4A0A A;  3AFC A;  4IMM A;  2HKR A;  4WJK A;  2H6K A;  4MMY A;  3A0F A;  1SHY B;  2YMU A;  3AH8 B;  2VDN A;  5GXI A;  3K71 A;  2P9L C;  3V5W B;  2CE8 A;  4J0W A;  5HE0 B;  4BCD A;  1YR2 A;  5GMK n;  4A11 A;  3C99 A;  5M61 A;  4G56 B;  4X63 B;  2EIE A;  1O6G A;  3F3F A;  3RN0 D;  5IJ8 E;  3VA6 A;  2Z2N A;  1K8K C;  4ESG A;  3N0D A;  4GQB B;  1UOO A;  1JOF A;  4YVD A;  2VDQ A;  4PSW B;  3FCS A;  2AGW A;  3IJE A;  4A7J A;  2VDM A;  3F3P A;  5B4W A;  1H2Y A;  3EG6 A;  3PE7 A;  5EML B;  2P9U C;  3ZE2 A;  1S4U X;  2W18 A;  3IUL A;  3HFQ A;  3L4M D;  4O02 A;  4O1Q D;  1K32 A;  5E6S A;  3QI0 A;  4ZOV A;  5FFO A;  1H2W A;  4BL0 A;  2G9A A;  3I8C A;  4FA9 D;  4J82 A;  5I5I A;  2OVR B;  1VZ2 A;  4OWR A;  2UZY B;  2VC2 A;  3JZH A;  4FA4 D;  2P9K C;  4RE5 A;  2EID A;  4JXM A;  3UKR C;  5C9Z B;  1R5M A;  4GQ1 A;  4R7A B;  2XDW A;  3ZDX A;  4RE6 A;  5FKQ A;  3RMZ D;  1FWX A;  3IUM A;  4JT5 C;  3JAM g;  4CZY A;  3SFZ A;  4JD2 C;  3L4O D;  4E54 A;  1XKS A;  5FKT A;  4A09 A;  3JPX A;  4XYH A;  3C9C A;  5CXB B;  3RN1 D;  1BPO A;  3V9F A;  4BCB A;  4BCC A;  4BP9 A;  4A08 B;  3MXX A;  3MUN A;  4PC0 A;  4FB1 D;  3VGZ A;  1VZ3 A;  4FWW A;  1T2X A;  5TEE A;  5GXH A;  2VDL A;  4CZV A;  3ZDY A;  3IIY A;  1GXR A;  1PGU A;  1NEX B;  5HE2 B;  3QHY B;  4QT8 A;  4CY5 A;  5CXC A;  1O6F A;  3O4J A;  3V4P A;  2XZG A;  2H9P A;  3IUR A;  2P9S C;  1TBG A;  1C9I A;  2B5M A;  3DDU A;  4AMZ A;  2H68 A;  3JZG A;  5AJA A;  2J57 G;  4U7A A;  2H14 A;  4K3J B;  4Z7N A;  4ZN4 A;  2CE9 A;  4FHL A;  3I7H A;  2EBS A;  3IKO A;  2BBK H;  1K3I A;  1L0Q A;  4JHN A;  3RLM D;  1VE6 A;  1OMW B;  4LG9 A;  2Z2P A;  1NR0 A;  4A2L A;  3IIW A;  4JSP C;  3IJC A;  5EM2 B;  3MKQ A;  1H2X A;  4D6V A;  3DSM A;  5FKS A;  3MUO A;  1GOH A;  4J8B A;  1L5G A;  4J79 A;  2AH1 A;  3OW8 A;  4Y5R D;  5I5J A;  4ERZ A;  4O3U B;  4X60 B;  5C92 A;  1P22 A;  4L3G D;  2OVQ B;  4ERQ A;  3SBP A;  3C5M A;  2GC4 A;  2OIZ A;  2PM6 B;  2O9K A;  5A2Q g;  3P4F A;  4I79 A;  5TDH B;  5M5U A;  2XE4 A;  4A0A B;  5JWZ A;  2CO0 C;  4GZ8 A;  4Y7R A;  5FA5 B;  2QZP A;  3DXM C;  1UOQ A;  5EAR A;  4OZU A;  1B9X A;  5I5M A;  3VI3 A;  4ERY A;  5M5T A;  1N6D A;  3NIG A;  4O9D A;  3PXT D;  4WK2 A;  3EQ8 A;  4CY1 A;  4QL1 A;  2H6N A;  3DWL C;  2QXV A;  4J78 A;  4EWR A;  5FLX g;  3FM0 A;  3KRW B;  4GM8 A;  4A0B A;  5HQG A;  3EI1 A;  3SBQ A;  5HE3 B;  1VE7 A;  3RFH A;  2OVP B;  5E6R A;  1A12 A;  2CNX A;  4NBM A;  1GG2 B;  2Z2O A;  4A09 B;  2H9L A;  5H1M A;  1PI6 A;  3I7O A;  3OL2 A;  2B5N A;  3PXW D;  5HDB A;  3UVN A;  5GSA A;  3JZN A;  3O4G A;  4D0K A;  2CN3 A;  3EMH A;  3NVQ A;  5CYK A;  4CI1 A;  1MDA H;  4PBZ A;  2HES X;  2EIC A;  2AH0 A;  3E0C A;  3SWS D;  3J81 g;  4GM9 A;  4DNW A;  3ZE1 A;  4XYI A;  4J87 A;  5EM2 A;  2P9I C;  3NVN A;  2I0S A;  2OK6 A;  3T3P A;  4CY3 A;  4PXW A;  5EAL A;  4X3E A;  4GQ2 P;  5H14 A;  3DM0 A;  2IAA A;  5H17 A;  2IUV A;  1QFS A;  2VZ3 A;  4AOW A;  2H6Q A;  4Z7O A;  1GOT B;  5IC7 A;  3ULE C;  4U1E I;  2XL2 A;  3GFC A;  4X61 B;  2AGL A;  3VH0 A;  2VDP A;  3I2N A;  2IUQ A;  4O2W A;  4E5Z A;  3UVO A;  4PSX B;  2I0R A;  4J0X A;  5AMS A;  4H5J A;  2H9N A;  4QQE A;  4NSX A;  5FKR A;  3I8E A;  4PBY A;  3KRX B;  1JMX B;  3I89 A;  1E5T A;  4N14 A;  4BP8 A;  4AMY A;  3OF7 A;  3MMY A;  3AL8 A;  2P9P C;  2PBI B;  2VDR A;  2XL3 A;  5HE1 B;  2J55 H;  5K1C C;  3PSC B;  4FA1 D;  3SLE D;  4BUJ C;  1I2M B;  2MTA H;  1RI6 A;  2XYI A;  3CFV A;  2HU7 A;  3V4V A;  1M1X A;  4CZX A;  3DXK C;  4G55 A;  4FAN D;  1QNI A;  4GGD A;  3SBR A;  2AQ5 A;  1ERJ A;  2HU5 A;  2B5L A;  3SN6 B;  1UTC A;  5CXB A;  2OJY A;  2YB8 B;  3IUJ A;  3I7L A;  4L9O A;  2AGY A;  3BWS A;  2J56 H;  4Z7Q A;  3EQ7 A;  4NEN A;  5EMM B;  4NC4 A;  2HU8 A;  2WQ8 A;  2G99 A;  2PM9 B;  4CY2 A;  2HKM A;  1OLZ A;  3MZK A;  4H5I A;  3SJL D;  2IUR A;  5KDO B;  1SQ9 A;  4PNK B;  4HDJ A;  3NVX A;  4GGA A;  3W15 A;  4DNV A;  3SCY A;  4AX4 A;  3FCU A;  4J81 A;  4O45 A;  3ZE0 A;  4J84 A;  4FAV D;  2JKX A;  1U8C A;  3IUQ A;  4FA5 D;  2OK4 A;  1VYH C;  1MG2 A;  4L3H D;  2IWK A;  5EMJ B;  5THA A;  3K6S A;  3V7D B;  1YFQ A;  3EI2 B;  1E8N A;  5C2V B;  3SXT D;  3AL9 A;  3K26 A;  3RRM C;  1N6F A;  3GRE A;  2H3X A;  3OL2 B;  3IJ1 A;  4ZOZ A;  3SVW D;  3IVM A;  4UI9 R;  3EI3 A;  4MK0 B;  4NAA A;  4DNU A;  5EAM A;  2Q7Q A;  4ZOX A;  2H9M A;  4MMX A;  4IRZ A;  5IGQ A;  4AN1 A; 
#chains in the Genus database with same CATH homology
 3FGB A;  4L1Q D;  4A2M A;  4A11 B;  4ZOY A;  1JJU B;  1U2V C;  2H47 A;  2TRC B;  4GM3 A;  3SHF A;  4O3T B;  3U4Y A;  3ODT A;  3EI4 A;  1SQJ A;  3PVW B;  2UZX B;  4ES0 A;  3OTT A;  2BCJ B;  5FQD A;  2GC7 A;  2PM9 A;  4QRJ A;  3CFS B;  4JT6 C;  4LGN A;  4J8G A;  2P9N C;  2AGX A;  1A0R B;  3IJ0 A;  3MKS B;  2GNQ A;  3OKW A;  3EI4 B;  5C2W B;  3C75 H;  4CC9 A;  1MG3 A;  4Z8L A;  3UVM A;  4AEZ A;  2CN2 A;  4KFM B;  5AFU 3;  1XIP A;  3JRP A;  3ORV D;  3SMR A;  2YNO A;  2CO0 A;  2YNN A;  2I3T A;  4JSN C;  3PVU B;  4GGC A;  3OKT A;  3AL8 B;  2IUP A;  4BH6 A;  4A08 A;  2QC5 A;  4CI2 A;  3I7N A;  2HYE A;  3UKU C;  2YBA A;  5SXM A;  3JRO A;  2I0T A;  4J86 A;  3OKY B;  2I3S A;  3EU7 A;  5TF2 A;  4IA9 A;  1PEV A;  2YNP A;  3J80 g;  4J77 A;  3K27 A;  3FRX A;  4GMB A;  5CXC B;  4J73 A;  1N6E A;  5EAP A;  2HJ4 A;  1Q47 A;  3UVK A;  5K19 A;  3I7K A;  3ZWL B;  2PM7 B;  3N0E A;  5FXY A;  5IT9 g;  5CYK B;  4E54 B;  3RFG A;  3I7P A;  2HXC A;  3BG0 A;  3EI3 B;  1XHM A;  3MZL A;  3EI2 A;  2XU7 A;  2HJB A;  5TEF A;  3PXS D;  2IWF A;  4JSV C;  4A0B B;  5HYN B;  4CI3 A;  3F3G A;  2AGZ A;  1U4C A;  3PSL A;  1TYQ C;  4CI8 A;  4LG8 A;  1PBY B;  3CIK B;  2H13 A;  4TZ4 A;  3EI1 B;  2B4E A;  1JMZ B;  4JSX C;  3UR4 A;  3EWE A;  3B7F A;  1B9Y A;  3BG1 A;  5IJ7 E;  3JB9 L;  4XEI C;  1GP2 B;  3UVL A;  5EMK B;  4E5Z B;  4K3I D;  5IGO A;  3OKY A;  3RSE C;  4A0A A;  3AFC A;  4IMM A;  2HKR A;  2H6K A;  3A0F A;  1SHY B;  2YMU A;  3AH8 B;  5GXI A;  2P9L C;  3V5W B;  2CE8 A;  4J0W A;  5HE0 B;  5GMK n;  4A11 A;  3C99 A;  4G56 B;  4X63 B;  3RN0 D;  5IJ8 E;  3F3F A;  3VA6 A;  2Z2N A;  1K8K C;  4ESG A;  3N0D A;  4GQB B;  1JOF A;  4YVD A;  4PSW B;  2AGW A;  4A7J A;  3F3P A;  5B4W A;  3EG6 A;  3PE7 A;  5EML B;  2P9U C;  1S4U X;  2W18 A;  3HFQ A;  3L4M D;  4O1Q D;  1K32 A;  4ZOV A;  4BL0 A;  2G9A A;  3I8C A;  4FA9 D;  4J82 A;  5I5I A;  2OVR B;  4OWR A;  2UZY B;  3JZH A;  4FA4 D;  2P9K C;  3UKR C;  4JXM A;  5C9Z B;  1R5M A;  4GQ1 A;  4R7A B;  5FKQ A;  3RMZ D;  1FWX A;  4JT5 C;  3JAM g;  4CZY A;  3SFZ A;  4JD2 C;  3L4O D;  4E54 A;  1XKS A;  5FKT A;  4A09 A;  3JPX A;  4XYH A;  3C9C A;  5CXB B;  3RN1 D;  3V9F A;  4A08 B;  3MXX A;  4PC0 A;  4FB1 D;  3VGZ A;  4FWW A;  5TEE A;  5GXH A;  4CZV A;  3IIY A;  1GXR A;  1PGU A;  1NEX B;  5HE2 B;  4QT8 A;  4CY5 A;  5CXC A;  2H9P A;  2P9S C;  1TBG A;  2B5M A;  2H68 A;  3JZG A;  5AJA A;  2J57 G;  4U7A A;  2H14 A;  4K3J B;  4ZN4 A;  2CE9 A;  4FHL A;  3I7H A;  2EBS A;  3IKO A;  2BBK H;  1L0Q A;  3RLM D;  1OMW B;  4LG9 A;  2Z2P A;  1NR0 A;  4A2L A;  3IIW A;  4JSP C;  3IJC A;  5EM2 B;  3MKQ A;  4D6V A;  3DSM A;  5FKS A;  4J8B A;  4J79 A;  2AH1 A;  3OW8 A;  4Y5R D;  5I5J A;  4ERZ A;  4O3U B;  4X60 B;  1P22 A;  4L3G D;  2OVQ B;  4ERQ A;  3SBP A;  3C5M A;  2GC4 A;  2OIZ A;  2PM6 B;  2O9K A;  5A2Q g;  3P4F A;  4I79 A;  5TDH B;  4A0A B;  5JWZ A;  2CO0 C;  4GZ8 A;  4Y7R A;  5FA5 B;  3DXM C;  5EAR A;  4OZU A;  1B9X A;  5I5M A;  4ERY A;  1N6D A;  4O9D A;  3PXT D;  4CY1 A;  4QL1 A;  2H6N A;  3DWL C;  2QXV A;  4J78 A;  4EWR A;  5FLX g;  3FM0 A;  3KRW B;  4GM8 A;  4A0B A;  5HQG A;  3EI1 A;  3SBQ A;  5HE3 B;  3RFH A;  2OVP B;  2CNX A;  1GG2 B;  2Z2O A;  4A09 B;  2H9L A;  5H1M A;  1PI6 A;  3I7O A;  3OL2 A;  2B5N A;  3PXW D;  3UVN A;  5GSA A;  3JZN A;  4D0K A;  2CN3 A;  3EMH A;  3NVQ A;  5CYK A;  4CI1 A;  4PBZ A;  1MDA H;  2HES X;  2AH0 A;  3E0C A;  3SWS D;  3J81 g;  4GM9 A;  4XYI A;  4J87 A;  5EM2 A;  2P9I C;  3NVN A;  2I0S A;  2OK6 A;  4CY3 A;  4PXW A;  5EAL A;  4X3E A;  4GQ2 P;  5H14 A;  3DM0 A;  2IAA A;  5H17 A;  2IUV A;  4AOW A;  2H6Q A;  1GOT B;  5IC7 A;  3ULE C;  4U1E I;  2XL2 A;  3GFC A;  4X61 B;  2AGL A;  3VH0 A;  3I2N A;  2IUQ A;  4E5Z A;  3UVO A;  4PSX B;  2I0R A;  4J0X A;  5AMS A;  4H5J A;  2H9N A;  4QQE A;  4NSX A;  5FKR A;  3I8E A;  4PBY A;  3KRX B;  1JMX B;  3I89 A;  4N14 A;  3MMY A;  3AL8 A;  2P9P C;  2PBI B;  2XL3 A;  5HE1 B;  2J55 H;  5K1C C;  3PSC B;  4FA1 D;  3SLE D;  4BUJ C;  2MTA H;  1RI6 A;  2XYI A;  3CFV A;  4CZX A;  3DXK C;  4FAN D;  1QNI A;  4GGD A;  3SBR A;  2AQ5 A;  1ERJ A;  2B5L A;  3SN6 B;  5CXB A;  2OJY A;  2YB8 B;  3I7L A;  4L9O A;  2AGY A;  3BWS A;  2J56 H;  5EMM B;  2G99 A;  2PM9 B;  4CY2 A;  2HKM A;  1OLZ A;  3MZK A;  4H5I A;  3SJL D;  2IUR A;  5KDO B;  1SQ9 A;  4PNK B;  4HDJ A;  3NVX A;  4GGA A;  3W15 A;  3SCY A;  4J81 A;  4O45 A;  4J84 A;  4FAV D;  4FA5 D;  2OK4 A;  1VYH C;  1MG2 A;  4L3H D;  2IWK A;  5EMJ B;  5THA A;  3V7D B;  1YFQ A;  3EI2 B;  5C2V B;  3SXT D;  3AL9 A;  3K26 A;  3RRM C;  1N6F A;  3GRE A;  2H3X A;  3OL2 B;  3IJ1 A;  4ZOZ A;  3SVW D;  4UI9 R;  3EI3 A;  4MK0 B;  5EAM A;  2Q7Q A;  4ZOX A;  2H9M A;  5IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...