4J82A

Crystal structure of beta'-cop/insig-2 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
b'KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j82A01
3BWSA 4A2MA 2OK4A 2XL3A 2H3XA 4FAVD 3N0DA 4LG8A 4H5IA 4Z8LA 3I2NA 3CFVA 2P9LC 2AH1A 1FWXA 3DSMA 3UVKA 2HKRA 1N6EA 4G56B 4ZOXA 4D0KA 3BG1A 2H47A 4MK0B 3C9CA 4JT5C 3DXMC 5AMSA 1JMZB 2IWFA 2W18A 1YFQA 3PXWD 5GMKn 2B4EA 2PBIB 4J82A 2B5LA 4CI8A 1RI6A 3GREA 3B7FA 4J79A 4J87A 2G99A 4ESGA 4JSPC 4QL1A 3PE7A 4A2LA 2J56H 5HYNB 3SMRA 4E54A 3ORVD 2H9NA 2HKMA 3DM0A 3OW8A 3JZNA 4J8GA 3EU7A 3FRXA 3OKTA 1SHYB 1TBGA 3SJLD 2HYEA 3PXTD 3JRPA 4BL0A 4PBYA 2GNQA 5JWZA 4O3UB 3SWSD 3C5MA 4J8BA 1NEXB 1OMWB 4PSWB 4BUJC 2PM7B 1B9XA 3OKYB 4XEIC 3OTTA 3RFGA 3EI1A 4GM9A 5EAPA 4JSXC 3C75H 4XYIA 5H14A 4FHLA 3DXKC 5C9ZB 4J0WA 2YNOA 2IUVA 1B9YA 4JT6C 4A7JA 4E54B 1N6DA 4JD2C 5EAMA 2AH0A 3JROA 5K1CC 1MG3A 2I0SA 3VH0A 5FKQA 4FA1D 5K19A 3I8EA 3A0FA 4NSXA 4ERZA 4FAND 3SCYA 3F3GA 4ES0A 3V9FA 3EI4A 4PXWA 1GOTB 3EG6A 1GG2B 3EI1B 3OKWA 5CXBA 3MMYA 4CY3A 4A0BA 1MG2A 4JXMA 4FA9D 1PBYB 2CNXA 5THAA 3ODTA 2P9IC 2AGXA 2OVPB 4UI9R 3JB9L 4CI2A 1XHMA 4LGNA 3L4MD 3JZGA 4QQEA 3ULEC 3RFHA 2XL2A 1ERJA 5CXCB 5IGQA 4FB1D 5AFU3 3NVQA 1K8KC 4J86A 5IC7A 5KDOB 3UKUC 2O9KA 3AL9A 3IJ0A 4FWWA 3PXSD 5IT9g 2AGYA 5AJAA 1PEVA 4GZ8A 5EALA 2UZYB 4GMBA 4O3TB 4OZUA 5IGOA 2YB8B 2H68A 4A09A 4X3EA 2P9PC 5FKRA 2AQ5A 4A0BB 2IWKA 1OLZA 3FM0A 3NVXA 5FKTA 3RSEC 1U2VC 2P9KC 5GSAA 3IJ1A 3JPXA 1VYHC 4FA4D 4L3GD 2Z2NA 5FKSA 3RLMD 3SN6B 4ERQA 5EMJB 2HXCA 2QC5A 2CN3A 2YMUA 1Q47A 4L9OA 5FA5B 2YNPA 3C99A 2I3TA 2OJYA 4O9DA 4CZXA 4IMMA 5EMLB 4IA9A 4A09B 4YVDA 1JJUB 1NR0A 2I0TA 2Z2PA 4J77A 3AH8B 2H14A 2B5MA 2H9MA 1JMXB 1N6FA 4PNKB 3AL8A 2P9UC 4U1EI 5I5MA 2MTAH 3NVNA 5GXIA 4JSNC 4L3HD 4O1QD 3MKQA 4J73A 2OVQB 4J81A 1PGUA 2H9PA 2OVRB 2CO0A 3MZKA 4KFMB 5TF2A 1GP2B 2YNNA 4GGDA 5HQGA 4PSXB 2IUQA 3I89A 1L0QA 3BG0A 3OL2A 5HE0B 2H13A 1R5MA 4HDJA 3U4YA 5A2Qg 4A0AA 4PC0A 4EWRA 3V5WB 5FXYA 4LG9A 4CZYA 5IJ7E 2H9LA 2CE9A 1TYQC 5EMKB 5TDHB 5CYKA 2BCJB 3AL8B 4Y7RA 3EI2A 2Q7QA 3RN0D 3VGZA 3VA6A 4GQ2P 3EMHA 3UVNA 4ERYA 4CY5A 4I79A 1MDAH 3ZWLB 1U4CA 3J80g 3I7OA 2QXVA 4J84A 2AGWA 4X61B 3OL2B 2BBKH 4CI1A 4A08A 4R7AB 3EI4B 1GXRA 4X60B 1SQJA 2IUPA 1QNIA 3IKOA 5B4WA 2I0RA 5CXBB 3E0CA 3UVOA 3I7PA 2H6KA 4ZOYA 4OWRA 5CYKB 3N0EA 3EI2B 1A0RB 3L4OD 3F3FA 3SBPA 5C2VB 5FLXg 5FQDA 4N14A 3SLED 4J0XA 5HE2B 3SXTD 4A11A 2PM9A 2XU7A 4AEZA 5EM2A 3OKYA 2GC7A 3SBQA 3K26A 3RRMC 5I5IA 2J55H 2GC4A 3PSLA 4D6VA 2P9NC 2YBAA 3I8CA 3W15A 2P9SC 3PVUB 3F3PA 4U7AA 2CO0C 3SHFA 3MZLA 3PVWB 4O45A 4A08B 3UVMA 2HESX 4K3ID 4H5JA 1XKSA 4Y5RD 2HJ4A 4CY1A 2CN2A 3UKRC 3I7HA 2CE8A 4K3JB 1SQ9A 3IIWA 3I7KA 2UZXB 3HFQA 3IIYA 1K32A 2I3SA 3CFSB 4GQBB 4L1QD 4XYHA 5IJ8E 4GM3A 3AFCA 5C2WB 4GM8A 2AGZA 4CC9A 3MKSB 4GQ1A 5HE3B 3KRXB 4QRJA 4A11B 2PM9B 2H6QA 5EM2B 3UR4A 4CI3A 2TRCB 2Z2OA 3EI3A 1PI6A 1XIPA 3IJCA 5GXHA 2PM6B 3RN1D 3MXXA 3UVLA 4GGAA 3GFCA 2J57G 5EARA 4X63B 4TZ4A 1S4UX 5TEEA 4BH6A 1P22A 3DWLC 5I5JA 4E5ZA 2AGLA 5HE1B 2B5NA 5CXCA 1JOFA 3I7LA 5H1MA 4ZOZA 3SVWD 5SXMA 4ZN4A 2EBSA 3I7NA 4CY2A 4ZOVA 3RMZD 3SFZA 2OK6A 3SBRA 4FA5D 3EWEA 2IAAA 4JSVC 3EI3B 4QT8A 3FGBA 4AOWA 4GGCA 2G9AA 4PBZA 3P4FA 2HJBA 2XYIA 5H17A 3J81g 3V7DB 3PSCB 4E5ZB 3CIKB 4A0AB 4J78A 2OIZA 3JAMg 3KRWB 3K27A 2IURA 2H6NA 4CZVA 5TEFA 3JZHA 5EMMB
chains in the Genus database with same CATH superfamily
3BWSA 4A2MA 2OK4A 2XL3A 3ZE1A 2H3XA 4FAVD 1QFSA 3N0DA 4H5IA 4LG8A 4Z8LA 3I2NA 3CFVA 2P9LC 3NIDA 2AH1A 4MMXA 1FWXA 3IVMA 3DSMA 3UVKA 2HKRA 1N6EA 3FCUA 4G56B 4ZOXA 4D0KA 3BG1A 2BKLA 2H47A 4MK0B 2VZ3A 3ZDZA 3C9CA 4JT5C 3IURA 1GOGA 3DXMC 5AMSA 1UOPA 1JMZB 2IWFA 2W18A 1YFQA 3PXWD 5GMKn 2B4EA 2PBIB 4DNVA 4J82A 2B5LA 4CI8A 1RI6A 3GREA 3B7FA 4J79A 4J87A 2G99A 1BPOA 4ESGA 1UTCA 4JSPC 4QL1A 3PE7A 2HU7A 4A2LA 2J56H 1M1XA 4AMZA 5HYNB 3SMRA 4E54A 3ORVD 2XZGA 2H9NA 2HKMA 3DM0A 3OW8A 3JZNA 4J8GA 3EU7A 3FRXA 3OKTA 1SHYB 1TBGA 3SJLD 2HYEA 3PXTD 3JRPA 2HU5A 4BL0A 4PBYA 1O6GA 2GNQA 1VZ2A 5JWZA 4O3UB 3GC3B 3SWSD 3C5MA 4J8BA 1C9IA 3QI0A 3IUQA 5M5TA 1NEXB 1OMWB 4PSWB 4BUJC 4RE6A 2PM7B 1B9XA 3OKYB 3V4PA 4XEIC 3OTTA 3RFGA 3EI1A 4GM9A 5EAPA 4JSXC 3C75H 4QAMA 4XYIA 1JV2A 5H14A 4FHLA 4BCBA 2EIDA 4NC4A 3DXKC 5C9ZB 2XE4A 4J0WA 2YNOA 2IUVA 1H2ZA 1B9YA 4JT6C 4A7JA 4G1MA 4E54B 1N6DA 1E8NA 1TYEA 2QR5A 4JD2C 4Z7OA 3DDUA 5EAMA 2AH0A 3NIGA 3JROA 5K1CC 1MG3A 1QFMA 2I0SA 1E8MA 3VH0A 5FKQA 5E6SA 1H2XA 4FA1D 5K19A 3I8EA 3A0FA 4NSXA 4ERZA 4FAND 3SCYA 3F3GA 4ES0A 3V9FA 2WQ8A 3EI4A 4PXWA 1GOTB 4L1MA 3EG6A 1GG2B 3EI1B 3OKWA 5CXBA 3MMYA 4CY3A 4A0BA 1MG2A 5C92A 4JHPC 4JXMA 4FA9D 1PBYB 2CNXA 5THAA 3ODTA 2P9IC 2AGXA 3O4IA 4UM9A 4NAAA 2OVPB 4UI9R 3JB9L 4CI2A 1XHMA 4LGNA 4WK0A 3L4MD 3KCIA 1GOFA 1UOOA 3JZGA 4QQEA 3RFHA 3ULEC 2XL2A 5FFOA 1T2XA 1ERJA 5CXCB 5IGQA 4WK4A 4FB1D 5AFU3 3NVQA 1K8KC 4J86A 5IC7A 5KDOB 3T3PA 3UKUC 2O9KA 3AL9A 3IJ0A 4FWWA 3OF7A 3PXSD 5IT9g 2AGYA 4UM8A 5AJAA 1PEVA 2VDPA 3GD1I 4GZ8A 5EALA 2UZYB 4GMBA 1VE6A 4O3TB 4OZUA 5IGOA 2YB8B 2H68A 4A09A 1H2WA 4X3EA 2VDQA 2P9PC 5FKRA 2AQ5A 3IUJA 4A0BB 2IWKA 1OLZA 3FM0A 3NVXA 5FKTA 3RSEC 5M61A 1U2VC 2P9KC 5GSAA 3IJ1A 3JPXA 1VYHC 4FA4D 4AX4A 4L3GD 2Z2NA 5FKSA 5M5VA 3RLMD 3IUMA 3SN6B 4ERQA 1A12A 5EMJB 2HXCA 4WK2A 2QC5A 2CN3A 2YMUA 1Q47A 4L9OA 5FA5B 2YNPA 3C99A 2I3TA 2OJYA 4O9DA 4CZXA 4IMMA 5EMLB 4IA9A 4A09B 4YVDA 4O02A 1JJUB 4JHNA 1NR0A 3K72A 2VDMA 2I0TA 2Z2PA 4J77A 3AH8B 4BP8A 1VZ3A 1UOQA 2B5MA 2H14A 4BP9A 2H9MA 1JMXB 1N6FA 4PNKB 3AL8A 2P9UC 4U1EI 5I5MA 4AMYA 2MTAH 3NVNA 5GXIA 4JSNC 4L3HD 4O1QD 2VZ1A 3MKQA 3EQ8A 4J73A 2OVQB 4J81A 4MMYA 1PGUA 2H9PA 2OVRB 2CO0A 3MZKA 4KFMB 5M5RA 5TF2A 1GP2B 2YNNA 4GGDA 5HQGA 4PSXB 2IUQA 3EQ7A 3I89A 1L0QA 3BG0A 3OL2A 5HE0B 2H13A 1R5MA 4HDJA 2EIBA 3U4YA 5A2Qg 4A0AA 4PC0A 4EWRA 5M5UA 3V5WB 5FXYA 4LG9A 3ZE2A 4CZYA 5IJ7E 3O4GA 2H9LA 2CE9A 1TYQC 5E6RA 5EMKB 5TDHB 5CYKA 2BCJB 3AL8B 5E6UA 4Y7RA 3EI2A 2Q7QA 3RN0D 2VDOA 3VGZA 4AN1A 3VA6A 4GQ2P 2HU8A 3EMHA 3UVNA 4ERYA 4CY5A 3ZE0A 4I79A 4Z7NA 1MDAH 3ZWLB 1U4CA 3J80g 3I7OA 2QXVA 5C86A 5FFGA 4J84A 2AGWA 4X61B 3MVDK 3VI4A 5HDBA 3OL2B 2BBKH 4CI1A 5M5SA 4A08A 4R7AB 3T3MA 4NBMA 4O2WA 3EI4B 1GXRA 4X60B 1SQJA 2IUPA 2QZPA 1QNIA 3IKOA 3QHYB 5B4WA 1U8CA 2I0RA 3E0CA 5CXBB 3UVOA 3I7PA 2H6KA 4ZOYA 4OWRA 2VDKA 5CYKB 3N0EA 2XDWA 3EI2B 1A0RB 4NENA 3L4OD 3F3FA 3SBPA 2VDNA 5C2VB 5FLXg 5FQDA 4N14A 3SLED 4J0XA 5HE2B 3O4JA 3SXTD 4A11A 2PM9A 2XU7A 4AEZA 5EM2A 1E5TA 3OKYA 3ZDXA 2GC7A 3SBQA 3K26A 3RRMC 5I5IA 2J55H 1VE7A 2GC4A 3PSLA 4D6VA 2P9NC 2YBAA 3I8CA 3W15A 2P9SC 3PVUB 3F3PA 4U7AA 2CO0C 3SHFA 3MZLA 3PVWB 4O45A 4AN0A 4A08B 3UVMA 2HESX 4K3ID 4H5JA 1XKSA 4Y5RD 2HJ4A 4CY1A 2CN2A 3UKRC 3I7HA 2CE8A 3IUNA 4K3JB 4MMZA 1SQ9A 3IIWA 1I2MB 3EQ9A 3I7KA 2UZXB 3ZDYA 3IJEA 3HFQA 3IIYA 1K32A 2I3SA 1JTDB 2VDLA 2VC2A 3CFSB 4GQBB 4L1QD 4XYHA 5IJ8E 4GM3A 3AFCA 5C2WB 4GM8A 2AGZA 4CC9A 3MKSB 4GQ1A 5HE3B 3KRXB 4QRJA 2JKXA 4A11B 2PM9B 2H6QA 5EM2B 2VDRA 3UR4A 4CI3A 2TRCB 2EIEA 2EICA 2Z2OA 1PI6A 3EI3A 1XIPA 3IJCA 5GXHA 2PM6B 3RN1D 3MXXA 3UVLA 4GGAA 3GFCA 2J57G 5EARA 4BCDA 4X63B 4TZ4A 1S4UX 5TEEA 4BH6A 1P22A 3DWLC 1H2YA 5I5JA 4Z7QA 4E5ZA 4IRZA 2AGLA 3K6SA 5HE1B 2B5NA 5CXCA 1JOFA 3IULA 3I7LA 5H1MA 4ZOZA 3V4VA 3SVWD 4BCCA 5SXMA 4ZN4A 2EBSA 3I7NA 4CY2A 4DNWA 1L5GA 4ZOVA 4G55A 3RMZD 4RE5A 3SFZA 2OK6A 3SBRA 3K71A 4WJKA 4FA5D 1GOHA 3EWEA 2IAAA 3VI3A 4JSVC 4D9SA 3EI3B 4QT8A 3O4HA 3NIFA 4G1EA 1YR2A 3FGBA 4AOWA 1C9LA 4GGCA 2G9AA 1K3IA 4PBZA 4DNUA 3MUNA 3P4FA 3FCSA 3MUOA 2HJBA 2XYIA 5H17A 3J81g 3V7DB 3PSCB 4E5ZB 3CIKB 4A0AB 4J78A 2OIZA 3JAMg 3KRWB 3K27A 1O6FA 2IURA 2H6NA 4CZVA 5TEFA 3JZHA 5EMMB
chains in the Genus database with same CATH topology
3BWSA 4A2MA 2OK4A 2XL3A 2H3XA 4FAVD 3N0DA 4LG8A 4H5IA 4Z8LA 3I2NA 3CFVA 2P9LC 2AH1A 1FWXA 3DSMA 3UVKA 2HKRA 1N6EA 4G56B 4ZOXA 4D0KA 3BG1A 2H47A 4MK0B 3C9CA 4JT5C 3DXMC 5AMSA 1JMZB 2IWFA 2W18A 1YFQA 3PXWD 5GMKn 2B4EA 2PBIB 4J82A 2B5LA 4CI8A 1RI6A 3GREA 3B7FA 4J79A 4J87A 2G99A 4ESGA 4JSPC 4QL1A 3PE7A 4A2LA 2J56H 5HYNB 3SMRA 4E54A 3ORVD 2H9NA 2HKMA 3DM0A 3OW8A 3JZNA 4J8GA 3EU7A 3FRXA 3OKTA 1SHYB 1TBGA 3SJLD 2HYEA 3PXTD 3JRPA 4BL0A 4PBYA 2GNQA 5JWZA 4O3UB 3SWSD 3C5MA 4J8BA 1NEXB 1OMWB 4PSWB 4BUJC 2PM7B 1B9XA 3OKYB 4XEIC 3OTTA 3RFGA 3EI1A 4GM9A 5EAPA 4JSXC 3C75H 4XYIA 5H14A 4FHLA 3DXKC 5C9ZB 4J0WA 2YNOA 2IUVA 1B9YA 4JT6C 4A7JA 4E54B 1N6DA 4JD2C 5EAMA 2AH0A 3JROA 5K1CC 1MG3A 2I0SA 3VH0A 5FKQA 4FA1D 5K19A 3I8EA 3A0FA 4NSXA 4ERZA 4FAND 3SCYA 3F3GA 4ES0A 3V9FA 3EI4A 4PXWA 1GOTB 3EG6A 1GG2B 3EI1B 3OKWA 5CXBA 3MMYA 4CY3A 4A0BA 1MG2A 4JXMA 4FA9D 1PBYB 2CNXA 5THAA 3ODTA 2P9IC 2AGXA 2OVPB 4UI9R 3JB9L 4CI2A 1XHMA 4LGNA 3L4MD 3JZGA 4QQEA 3ULEC 3RFHA 2XL2A 1ERJA 5CXCB 5IGQA 4FB1D 5AFU3 3NVQA 1K8KC 4J86A 5IC7A 5KDOB 3UKUC 2O9KA 3AL9A 3IJ0A 4FWWA 3PXSD 5IT9g 2AGYA 5AJAA 1PEVA 4GZ8A 5EALA 2UZYB 4GMBA 4O3TB 4OZUA 5IGOA 2YB8B 2H68A 4A09A 4X3EA 2P9PC 5FKRA 2AQ5A 4A0BB 2IWKA 1OLZA 3FM0A 3NVXA 5FKTA 3RSEC 1U2VC 2P9KC 5GSAA 3IJ1A 3JPXA 1VYHC 4FA4D 4L3GD 2Z2NA 5FKSA 3RLMD 3SN6B 4ERQA 5EMJB 2HXCA 2QC5A 2CN3A 2YMUA 1Q47A 4L9OA 5FA5B 2YNPA 3C99A 2I3TA 2OJYA 4O9DA 4CZXA 4IMMA 5EMLB 4IA9A 4A09B 4YVDA 1JJUB 1NR0A 2I0TA 2Z2PA 4J77A 3AH8B 2H14A 2B5MA 2H9MA 1JMXB 1N6FA 4PNKB 3AL8A 2P9UC 4U1EI 5I5MA 2MTAH 3NVNA 5GXIA 4JSNC 4L3HD 4O1QD 3MKQA 4J73A 2OVQB 4J81A 1PGUA 2H9PA 2OVRB 2CO0A 3MZKA 4KFMB 5TF2A 1GP2B 2YNNA 4GGDA 5HQGA 4PSXB 2IUQA 3I89A 1L0QA 3BG0A 3OL2A 5HE0B 2H13A 1R5MA 4HDJA 3U4YA 5A2Qg 4A0AA 4PC0A 4EWRA 3V5WB 5FXYA 4LG9A 4CZYA 5IJ7E 2H9LA 2CE9A 1TYQC 5EMKB 5TDHB 5CYKA 2BCJB 3AL8B 4Y7RA 3EI2A 2Q7QA 3RN0D 3VGZA 3VA6A 4GQ2P 3EMHA 3UVNA 4ERYA 4CY5A 4I79A 1MDAH 3ZWLB 1U4CA 3J80g 3I7OA 2QXVA 4J84A 2AGWA 4X61B 3OL2B 2BBKH 4CI1A 4A08A 4R7AB 3EI4B 1GXRA 4X60B 1SQJA 2IUPA 1QNIA 3IKOA 5B4WA 2I0RA 5CXBB 3E0CA 3UVOA 3I7PA 2H6KA 4ZOYA 4OWRA 5CYKB 3N0EA 3EI2B 1A0RB 3L4OD 3F3FA 3SBPA 5C2VB 5FLXg 5FQDA 4N14A 3SLED 4J0XA 5HE2B 3SXTD 4A11A 2PM9A 2XU7A 4AEZA 5EM2A 3OKYA 2GC7A 3SBQA 3K26A 3RRMC 5I5IA 2J55H 2GC4A 3PSLA 4D6VA 2P9NC 2YBAA 3I8CA 3W15A 2P9SC 3PVUB 3F3PA 4U7AA 2CO0C 3SHFA 3MZLA 3PVWB 4O45A 4A08B 3UVMA 2HESX 4K3ID 4H5JA 1XKSA 4Y5RD 2HJ4A 4CY1A 2CN2A 3UKRC 3I7HA 2CE8A 4K3JB 1SQ9A 3IIWA 3I7KA 2UZXB 3HFQA 3IIYA 1K32A 2I3SA 3CFSB 4GQBB 4L1QD 4XYHA 5IJ8E 4GM3A 3AFCA 5C2WB 4GM8A 2AGZA 4CC9A 3MKSB 4GQ1A 5HE3B 3KRXB 4QRJA 4A11B 2PM9B 2H6QA 5EM2B 3UR4A 4CI3A 2TRCB 2Z2OA 3EI3A 1PI6A 1XIPA 3IJCA 5GXHA 2PM6B 3RN1D 3MXXA 3UVLA 4GGAA 3GFCA 2J57G 5EARA 4X63B 4TZ4A 1S4UX 5TEEA 4BH6A 1P22A 3DWLC 5I5JA 4E5ZA 2AGLA 5HE1B 2B5NA 5CXCA 1JOFA 3I7LA 5H1MA 4ZOZA 3SVWD 5SXMA 4ZN4A 2EBSA 3I7NA 4CY2A 4ZOVA 3RMZD 3SFZA 2OK6A 3SBRA 4FA5D 3EWEA 2IAAA 4JSVC 3EI3B 4QT8A 3FGBA 4AOWA 4GGCA 2G9AA 4PBZA 3P4FA 2HJBA 2XYIA 5H17A 3J81g 3V7DB 3PSCB 4E5ZB 3CIKB 4A0AB 4J78A 2OIZA 3JAMg 3KRWB 3K27A 2IURA 2H6NA 4CZVA 5TEFA 3JZHA 5EMMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BWS A;  4A2M A;  2OK4 A;  2XL3 A;  2H3X A;  4FAV D;  3N0D A;  4LG8 A;  4H5I A;  4Z8L A;  3I2N A;  3CFV A;  2P9L C;  2AH1 A;  1FWX A;  3DSM A;  3UVK A;  2HKR A;  1N6E A;  4G56 B;  4ZOX A;  4D0K A;  3BG1 A;  2H47 A;  4MK0 B;  3C9C A;  4JT5 C;  3DXM C;  5AMS A;  1JMZ B;  2IWF A;  2W18 A;  1YFQ A;  3PXW D;  5GMK n;  2B4E A;  2PBI B;  4J82 A;  2B5L A;  4CI8 A;  1RI6 A;  3GRE A;  3B7F A;  4J79 A;  4J87 A;  2G99 A;  4ESG A;  4JSP C;  4QL1 A;  3PE7 A;  4A2L A;  2J56 H;  5HYN B;  3SMR A;  4E54 A;  3ORV D;  2H9N A;  2HKM A;  3DM0 A;  3OW8 A;  3JZN A;  4J8G A;  3EU7 A;  3FRX A;  3OKT A;  1SHY B;  1TBG A;  3SJL D;  2HYE A;  3PXT D;  3JRP A;  4BL0 A;  4PBY A;  2GNQ A;  5JWZ A;  4O3U B;  3SWS D;  3C5M A;  4J8B A;  1NEX B;  1OMW B;  4PSW B;  4BUJ C;  2PM7 B;  1B9X A;  3OKY B;  4XEI C;  3OTT A;  3RFG A;  3EI1 A;  4GM9 A;  5EAP A;  4JSX C;  3C75 H;  4XYI A;  5H14 A;  4FHL A;  3DXK C;  5C9Z B;  4J0W A;  2YNO A;  2IUV A;  1B9Y A;  4JT6 C;  4A7J A;  4E54 B;  1N6D A;  4JD2 C;  5EAM A;  2AH0 A;  3JRO A;  5K1C C;  1MG3 A;  2I0S A;  3VH0 A;  5FKQ A;  4FA1 D;  5K19 A;  3I8E A;  3A0F A;  4NSX A;  4ERZ A;  4FAN D;  3SCY A;  3F3G A;  4ES0 A;  3V9F A;  3EI4 A;  4PXW A;  1GOT B;  3EG6 A;  1GG2 B;  3EI1 B;  3OKW A;  5CXB A;  3MMY A;  4CY3 A;  4A0B A;  1MG2 A;  4JXM A;  4FA9 D;  1PBY B;  2CNX A;  5THA A;  3ODT A;  2P9I C;  2AGX A;  2OVP B;  4UI9 R;  3JB9 L;  4CI2 A;  1XHM A;  4LGN A;  3L4M D;  3JZG A;  4QQE A;  3ULE C;  3RFH A;  2XL2 A;  1ERJ A;  5CXC B;  5IGQ A;  4FB1 D;  5AFU 3;  3NVQ A;  1K8K C;  4J86 A;  5IC7 A;  5KDO B;  3UKU C;  2O9K A;  3AL9 A;  3IJ0 A;  4FWW A;  3PXS D;  5IT9 g;  2AGY A;  5AJA A;  1PEV A;  4GZ8 A;  5EAL A;  2UZY B;  4GMB A;  4O3T B;  4OZU A;  5IGO A;  2YB8 B;  2H68 A;  4A09 A;  4X3E A;  2P9P C;  5FKR A;  2AQ5 A;  4A0B B;  2IWK A;  1OLZ A;  3FM0 A;  3NVX A;  5FKT A;  3RSE C;  1U2V C;  2P9K C;  5GSA A;  3IJ1 A;  3JPX A;  1VYH C;  4FA4 D;  4L3G D;  2Z2N A;  5FKS A;  3RLM D;  3SN6 B;  4ERQ A;  5EMJ B;  2HXC A;  2QC5 A;  2CN3 A;  2YMU A;  1Q47 A;  4L9O A;  5FA5 B;  2YNP A;  3C99 A;  2I3T A;  2OJY A;  4O9D A;  4CZX A;  4IMM A;  5EML B;  4IA9 A;  4A09 B;  4YVD A;  1JJU B;  1NR0 A;  2I0T A;  2Z2P A;  4J77 A;  3AH8 B;  2H14 A;  2B5M A;  2H9M A;  1JMX B;  1N6F A;  4PNK B;  3AL8 A;  2P9U C;  4U1E I;  5I5M A;  2MTA H;  3NVN A;  5GXI A;  4JSN C;  4L3H D;  4O1Q D;  3MKQ A;  4J73 A;  2OVQ B;  4J81 A;  1PGU A;  2H9P A;  2OVR B;  2CO0 A;  3MZK A;  4KFM B;  5TF2 A;  1GP2 B;  2YNN A;  4GGD A;  5HQG A;  4PSX B;  2IUQ A;  3I89 A;  1L0Q A;  3BG0 A;  3OL2 A;  5HE0 B;  2H13 A;  1R5M A;  4HDJ A;  3U4Y A;  5A2Q g;  4A0A A;  4PC0 A;  4EWR A;  3V5W B;  5FXY A;  4LG9 A;  4CZY A;  5IJ7 E;  2H9L A;  2CE9 A;  1TYQ C;  5EMK B;  5TDH B;  5CYK A;  2BCJ B;  3AL8 B;  4Y7R A;  3EI2 A;  2Q7Q A;  3RN0 D;  3VGZ A;  3VA6 A;  4GQ2 P;  3EMH A;  3UVN A;  4ERY A;  4CY5 A;  4I79 A;  1MDA H;  3ZWL B;  1U4C A;  3J80 g;  3I7O A;  2QXV A;  4J84 A;  2AGW A;  4X61 B;  3OL2 B;  2BBK H;  4CI1 A;  4A08 A;  4R7A B;  3EI4 B;  1GXR A;  4X60 B;  1SQJ A;  2IUP A;  1QNI A;  3IKO A;  5B4W A;  2I0R A;  5CXB B;  3E0C A;  3UVO A;  3I7P A;  2H6K A;  4ZOY A;  4OWR A;  5CYK B;  3N0E A;  3EI2 B;  1A0R B;  3L4O D;  3F3F A;  3SBP A;  5C2V B;  5FLX g;  5FQD A;  4N14 A;  3SLE D;  4J0X A;  5HE2 B;  3SXT D;  4A11 A;  2PM9 A;  2XU7 A;  4AEZ A;  5EM2 A;  3OKY A;  2GC7 A;  3SBQ A;  3K26 A;  3RRM C;  5I5I A;  2J55 H;  2GC4 A;  3PSL A;  4D6V A;  2P9N C;  2YBA A;  3I8C A;  3W15 A;  2P9S C;  3PVU B;  3F3P A;  4U7A A;  2CO0 C;  3SHF A;  3MZL A;  3PVW B;  4O45 A;  4A08 B;  3UVM A;  2HES X;  4K3I D;  4H5J A;  1XKS A;  4Y5R D;  2HJ4 A;  4CY1 A;  2CN2 A;  3UKR C;  3I7H A;  2CE8 A;  4K3J B;  1SQ9 A;  3IIW A;  3I7K A;  2UZX B;  3HFQ A;  3IIY A;  1K32 A;  2I3S A;  3CFS B;  4GQB B;  4L1Q D;  4XYH A;  5IJ8 E;  4GM3 A;  3AFC A;  5C2W B;  4GM8 A;  2AGZ A;  4CC9 A;  3MKS B;  4GQ1 A;  5HE3 B;  3KRX B;  4QRJ A;  4A11 B;  2PM9 B;  2H6Q A;  5EM2 B;  3UR4 A;  4CI3 A;  2TRC B;  2Z2O A;  3EI3 A;  1PI6 A;  1XIP A;  3IJC A;  5GXH A;  2PM6 B;  3RN1 D;  3MXX A;  3UVL A;  4GGA A;  3GFC A;  2J57 G;  5EAR A;  4X63 B;  4TZ4 A;  1S4U X;  5TEE A;  4BH6 A;  1P22 A;  3DWL C;  5I5J A;  4E5Z A;  2AGL A;  5HE1 B;  2B5N A;  5CXC A;  1JOF A;  3I7L A;  5H1M A;  4ZOZ A;  3SVW D;  5SXM A;  4ZN4 A;  2EBS A;  3I7N A;  4CY2 A;  4ZOV A;  3RMZ D;  3SFZ A;  2OK6 A;  3SBR A;  4FA5 D;  3EWE A;  2IAA A;  4JSV C;  3EI3 B;  4QT8 A;  3FGB A;  4AOW A;  4GGC A;  2G9A A;  4PBZ A;  3P4F A;  2HJB A;  2XYI A;  5H17 A;  3J81 g;  3V7D B;  3PSC B;  4E5Z B;  3CIK B;  4A0A B;  4J78 A;  2OIZ A;  3JAM g;  3KRW B;  3K27 A;  2IUR A;  2H6N A;  4CZV A;  5TEF A;  3JZH A;  5EMM B; 
#chains in the Genus database with same CATH topology
 3BWS A;  4A2M A;  2OK4 A;  2XL3 A;  3ZE1 A;  2H3X A;  4FAV D;  1QFS A;  3N0D A;  4H5I A;  4LG8 A;  4Z8L A;  3I2N A;  3CFV A;  2P9L C;  3NID A;  2AH1 A;  4MMX A;  1FWX A;  3IVM A;  3DSM A;  3UVK A;  2HKR A;  1N6E A;  3FCU A;  4G56 B;  4ZOX A;  4D0K A;  3BG1 A;  2BKL A;  2H47 A;  4MK0 B;  2VZ3 A;  3ZDZ A;  3C9C A;  4JT5 C;  3IUR A;  1GOG A;  3DXM C;  5AMS A;  1UOP A;  1JMZ B;  2IWF A;  2W18 A;  1YFQ A;  3PXW D;  5GMK n;  2B4E A;  2PBI B;  4DNV A;  4J82 A;  2B5L A;  4CI8 A;  1RI6 A;  3GRE A;  3B7F A;  4J79 A;  4J87 A;  2G99 A;  1BPO A;  4ESG A;  1UTC A;  4JSP C;  4QL1 A;  3PE7 A;  2HU7 A;  4A2L A;  2J56 H;  1M1X A;  4AMZ A;  5HYN B;  3SMR A;  4E54 A;  3ORV D;  2XZG A;  2H9N A;  2HKM A;  3DM0 A;  3OW8 A;  3JZN A;  4J8G A;  3EU7 A;  3FRX A;  3OKT A;  1SHY B;  1TBG A;  3SJL D;  2HYE A;  3PXT D;  3JRP A;  2HU5 A;  4BL0 A;  4PBY A;  1O6G A;  2GNQ A;  1VZ2 A;  5JWZ A;  4O3U B;  3GC3 B;  3SWS D;  3C5M A;  4J8B A;  1C9I A;  3QI0 A;  3IUQ A;  5M5T A;  1NEX B;  1OMW B;  4PSW B;  4BUJ C;  4RE6 A;  2PM7 B;  1B9X A;  3OKY B;  3V4P A;  4XEI C;  3OTT A;  3RFG A;  3EI1 A;  4GM9 A;  5EAP A;  4JSX C;  3C75 H;  4QAM A;  4XYI A;  1JV2 A;  5H14 A;  4FHL A;  4BCB A;  2EID A;  4NC4 A;  3DXK C;  5C9Z B;  2XE4 A;  4J0W A;  2YNO A;  2IUV A;  1H2Z A;  1B9Y A;  4JT6 C;  4A7J A;  4G1M A;  4E54 B;  1N6D A;  1E8N A;  1TYE A;  2QR5 A;  4JD2 C;  4Z7O A;  3DDU A;  5EAM A;  2AH0 A;  3NIG A;  3JRO A;  5K1C C;  1MG3 A;  1QFM A;  2I0S A;  1E8M A;  3VH0 A;  5FKQ A;  5E6S A;  1H2X A;  4FA1 D;  5K19 A;  3I8E A;  3A0F A;  4NSX A;  4ERZ A;  4FAN D;  3SCY A;  3F3G A;  4ES0 A;  3V9F A;  2WQ8 A;  3EI4 A;  4PXW A;  1GOT B;  4L1M A;  3EG6 A;  1GG2 B;  3EI1 B;  3OKW A;  5CXB A;  3MMY A;  4CY3 A;  4A0B A;  1MG2 A;  5C92 A;  4JHP C;  4JXM A;  4FA9 D;  1PBY B;  2CNX A;  5THA A;  3ODT A;  2P9I C;  2AGX A;  3O4I A;  4UM9 A;  4NAA A;  2OVP B;  4UI9 R;  3JB9 L;  4CI2 A;  1XHM A;  4LGN A;  4WK0 A;  3L4M D;  3KCI A;  1GOF A;  1UOO A;  3JZG A;  4QQE A;  3RFH A;  3ULE C;  2XL2 A;  5FFO A;  1T2X A;  1ERJ A;  5CXC B;  5IGQ A;  4WK4 A;  4FB1 D;  5AFU 3;  3NVQ A;  1K8K C;  4J86 A;  5IC7 A;  5KDO B;  3T3P A;  3UKU C;  2O9K A;  3AL9 A;  3IJ0 A;  4FWW A;  3OF7 A;  3PXS D;  5IT9 g;  2AGY A;  4UM8 A;  5AJA A;  1PEV A;  2VDP A;  3GD1 I;  4GZ8 A;  5EAL A;  2UZY B;  4GMB A;  1VE6 A;  4O3T B;  4OZU A;  5IGO A;  2YB8 B;  2H68 A;  4A09 A;  1H2W A;  4X3E A;  2VDQ A;  2P9P C;  5FKR A;  2AQ5 A;  3IUJ A;  4A0B B;  2IWK A;  1OLZ A;  3FM0 A;  3NVX A;  5FKT A;  3RSE C;  5M61 A;  1U2V C;  2P9K C;  5GSA A;  3IJ1 A;  3JPX A;  1VYH C;  4FA4 D;  4AX4 A;  4L3G D;  2Z2N A;  5FKS A;  5M5V A;  3RLM D;  3IUM A;  3SN6 B;  4ERQ A;  1A12 A;  5EMJ B;  2HXC A;  4WK2 A;  2QC5 A;  2CN3 A;  2YMU A;  1Q47 A;  4L9O A;  5FA5 B;  2YNP A;  3C99 A;  2I3T A;  2OJY A;  4O9D A;  4CZX A;  4IMM A;  5EML B;  4IA9 A;  4A09 B;  4YVD A;  4O02 A;  1JJU B;  4JHN A;  1NR0 A;  3K72 A;  2VDM A;  2I0T A;  2Z2P A;  4J77 A;  3AH8 B;  4BP8 A;  1VZ3 A;  1UOQ A;  2B5M A;  2H14 A;  4BP9 A;  2H9M A;  1JMX B;  1N6F A;  4PNK B;  3AL8 A;  2P9U C;  4U1E I;  5I5M A;  4AMY A;  2MTA H;  3NVN A;  5GXI A;  4JSN C;  4L3H D;  4O1Q D;  2VZ1 A;  3MKQ A;  3EQ8 A;  4J73 A;  2OVQ B;  4J81 A;  4MMY A;  1PGU A;  2H9P A;  2OVR B;  2CO0 A;  3MZK A;  4KFM B;  5M5R A;  5TF2 A;  1GP2 B;  2YNN A;  4GGD A;  5HQG A;  4PSX B;  2IUQ A;  3EQ7 A;  3I89 A;  1L0Q A;  3BG0 A;  3OL2 A;  5HE0 B;  2H13 A;  1R5M A;  4HDJ A;  2EIB A;  3U4Y A;  5A2Q g;  4A0A A;  4PC0 A;  4EWR A;  5M5U A;  3V5W B;  5FXY A;  4LG9 A;  3ZE2 A;  4CZY A;  5IJ7 E;  3O4G A;  2H9L A;  2CE9 A;  1TYQ C;  5E6R A;  5EMK B;  5TDH B;  5CYK A;  2BCJ B;  3AL8 B;  5E6U A;  4Y7R A;  3EI2 A;  2Q7Q A;  3RN0 D;  2VDO A;  3VGZ A;  4AN1 A;  3VA6 A;  4GQ2 P;  2HU8 A;  3EMH A;  3UVN A;  4ERY A;  4CY5 A;  3ZE0 A;  4I79 A;  4Z7N A;  1MDA H;  3ZWL B;  1U4C A;  3J80 g;  3I7O A;  2QXV A;  5C86 A;  5FFG A;  4J84 A;  2AGW A;  4X61 B;  3MVD K;  3VI4 A;  5HDB A;  3OL2 B;  2BBK H;  4CI1 A;  5M5S A;  4A08 A;  4R7A B;  3T3M A;  4NBM A;  4O2W A;  3EI4 B;  1GXR A;  4X60 B;  1SQJ A;  2IUP A;  2QZP A;  1QNI A;  3IKO A;  3QHY B;  5B4W A;  1U8C A;  2I0R A;  3E0C A;  5CXB B;  3UVO A;  3I7P A;  2H6K A;  4ZOY A;  4OWR A;  2VDK A;  5CYK B;  3N0E A;  2XDW A;  3EI2 B;  1A0R B;  4NEN A;  3L4O D;  3F3F A;  3SBP A;  2VDN A;  5C2V B;  5FLX g;  5FQD A;  4N14 A;  3SLE D;  4J0X A;  5HE2 B;  3O4J A;  3SXT D;  4A11 A;  2PM9 A;  2XU7 A;  4AEZ A;  5EM2 A;  1E5T A;  3OKY A;  3ZDX A;  2GC7 A;  3SBQ A;  3K26 A;  3RRM C;  5I5I A;  2J55 H;  1VE7 A;  2GC4 A;  3PSL A;  4D6V A;  2P9N C;  2YBA A;  3I8C A;  3W15 A;  2P9S C;  3PVU B;  3F3P A;  4U7A A;  2CO0 C;  3SHF A;  3MZL A;  3PVW B;  4O45 A;  4AN0 A;  4A08 B;  3UVM A;  2HES X;  4K3I D;  4H5J A;  1XKS A;  4Y5R D;  2HJ4 A;  4CY1 A;  2CN2 A;  3UKR C;  3I7H A;  2CE8 A;  3IUN A;  4K3J B;  4MMZ A;  1SQ9 A;  3IIW A;  1I2M B;  3EQ9 A;  3I7K A;  2UZX B;  3ZDY A;  3IJE A;  3HFQ A;  3IIY A;  1K32 A;  2I3S A;  1JTD B;  2VDL A;  2VC2 A;  3CFS B;  4GQB B;  4L1Q D;  4XYH A;  5IJ8 E;  4GM3 A;  3AFC A;  5C2W B;  4GM8 A;  2AGZ A;  4CC9 A;  3MKS B;  4GQ1 A;  5HE3 B;  3KRX B;  4QRJ A;  2JKX A;  4A11 B;  2PM9 B;  2H6Q A;  5EM2 B;  2VDR A;  3UR4 A;  4CI3 A;  2TRC B;  2EIE A;  2EIC A;  2Z2O A;  1PI6 A;  3EI3 A;  1XIP A;  3IJC A;  5GXH A;  2PM6 B;  3RN1 D;  3MXX A;  3UVL A;  4GGA A;  3GFC A;  2J57 G;  5EAR A;  4BCD A;  4X63 B;  4TZ4 A;  1S4U X;  5TEE A;  4BH6 A;  1P22 A;  3DWL C;  1H2Y A;  5I5J A;  4Z7Q A;  4E5Z A;  4IRZ A;  2AGL A;  3K6S A;  5HE1 B;  2B5N A;  5CXC A;  1JOF A;  3IUL A;  3I7L A;  5H1M A;  4ZOZ A;  3V4V A;  3SVW D;  4BCC A;  5SXM A;  4ZN4 A;  2EBS A;  3I7N A;  4CY2 A;  4DNW A;  1L5G A;  4ZOV A;  4G55 A;  3RMZ D;  4RE5 A;  3SFZ A;  2OK6 A;  3SBR A;  3K71 A;  4WJK A;  4FA5 D;  1GOH A;  3EWE A;  2IAA A;  3VI3 A;  4JSV C;  4D9S A;  3EI3 B;  4QT8 A;  3O4H A;  3NIF A;  4G1E A;  1YR2 A;  3FGB A;  4AOW A;  1C9L A;  4GGC A;  2G9A A;  1K3I A;  4PBZ A;  4DNU A;  3MUN A;  3P4F A;  3FCS A;  3MUO A;  2HJB A;  2XYI A;  5H17 A;  3J81 g;  3V7D B;  3PSC B;  4E5Z B;  3CIK B;  4A0A B;  4J78 A;  2OIZ A;  3JAM g;  3KRW B;  3K27 A;  1O6F A;  2IUR A;  2H6N A;  4CZV A;  5TEF A;  3JZH A;  5EMM B; 
#chains in the Genus database with same CATH homology
 3BWS A;  4A2M A;  2OK4 A;  2XL3 A;  2H3X A;  4FAV D;  3N0D A;  4LG8 A;  4H5I A;  4Z8L A;  3I2N A;  3CFV A;  2P9L C;  2AH1 A;  1FWX A;  3DSM A;  3UVK A;  2HKR A;  1N6E A;  4G56 B;  4ZOX A;  4D0K A;  3BG1 A;  2H47 A;  4MK0 B;  3C9C A;  4JT5 C;  3DXM C;  5AMS A;  1JMZ B;  2IWF A;  2W18 A;  1YFQ A;  3PXW D;  5GMK n;  2B4E A;  2PBI B;  4J82 A;  2B5L A;  4CI8 A;  1RI6 A;  3GRE A;  3B7F A;  4J79 A;  4J87 A;  2G99 A;  4ESG A;  4JSP C;  4QL1 A;  3PE7 A;  4A2L A;  2J56 H;  5HYN B;  3SMR A;  4E54 A;  3ORV D;  2H9N A;  2HKM A;  3DM0 A;  3OW8 A;  3JZN A;  4J8G A;  3EU7 A;  3FRX A;  3OKT A;  1SHY B;  1TBG A;  3SJL D;  2HYE A;  3PXT D;  3JRP A;  4BL0 A;  4PBY A;  2GNQ A;  5JWZ A;  4O3U B;  3SWS D;  3C5M A;  4J8B A;  1NEX B;  1OMW B;  4PSW B;  4BUJ C;  2PM7 B;  1B9X A;  3OKY B;  4XEI C;  3OTT A;  3RFG A;  3EI1 A;  4GM9 A;  5EAP A;  4JSX C;  3C75 H;  4XYI A;  5H14 A;  4FHL A;  3DXK C;  5C9Z B;  4J0W A;  2YNO A;  2IUV A;  1B9Y A;  4JT6 C;  4A7J A;  4E54 B;  1N6D A;  4JD2 C;  5EAM A;  2AH0 A;  3JRO A;  5K1C C;  1MG3 A;  2I0S A;  3VH0 A;  5FKQ A;  4FA1 D;  5K19 A;  3I8E A;  3A0F A;  4NSX A;  4ERZ A;  4FAN D;  3SCY A;  3F3G A;  4ES0 A;  3V9F A;  3EI4 A;  4PXW A;  1GOT B;  3EG6 A;  1GG2 B;  3EI1 B;  3OKW A;  5CXB A;  3MMY A;  4CY3 A;  4A0B A;  1MG2 A;  4JXM A;  4FA9 D;  1PBY B;  2CNX A;  5THA A;  3ODT A;  2P9I C;  2AGX A;  2OVP B;  4UI9 R;  3JB9 L;  4CI2 A;  1XHM A;  4LGN A;  3L4M D;  3JZG A;  4QQE A;  3ULE C;  3RFH A;  2XL2 A;  1ERJ A;  5CXC B;  5IGQ A;  4FB1 D;  5AFU 3;  3NVQ A;  1K8K C;  4J86 A;  5IC7 A;  5KDO B;  3UKU C;  2O9K A;  3AL9 A;  3IJ0 A;  4FWW A;  3PXS D;  5IT9 g;  2AGY A;  5AJA A;  1PEV A;  4GZ8 A;  5EAL A;  2UZY B;  4GMB A;  4O3T B;  4OZU A;  5IGO A;  2YB8 B;  2H68 A;  4A09 A;  4X3E A;  2P9P C;  5FKR A;  2AQ5 A;  4A0B B;  2IWK A;  1OLZ A;  3FM0 A;  3NVX A;  5FKT A;  3RSE C;  1U2V C;  2P9K C;  5GSA A;  3IJ1 A;  3JPX A;  1VYH C;  4FA4 D;  4L3G D;  2Z2N A;  5FKS A;  3RLM D;  3SN6 B;  4ERQ A;  5EMJ B;  2HXC A;  2QC5 A;  2CN3 A;  2YMU A;  1Q47 A;  4L9O A;  5FA5 B;  2YNP A;  3C99 A;  2I3T A;  2OJY A;  4O9D A;  4CZX A;  4IMM A;  5EML B;  4IA9 A;  4A09 B;  4YVD A;  1JJU B;  1NR0 A;  2I0T A;  2Z2P A;  4J77 A;  3AH8 B;  2H14 A;  2B5M A;  2H9M A;  1JMX B;  1N6F A;  4PNK B;  3AL8 A;  2P9U C;  4U1E I;  5I5M A;  2MTA H;  3NVN A;  5GXI A;  4JSN C;  4L3H D;  4O1Q D;  3MKQ A;  4J73 A;  2OVQ B;  4J81 A;  1PGU A;  2H9P A;  2OVR B;  2CO0 A;  3MZK A;  4KFM B;  5TF2 A;  1GP2 B;  2YNN A;  4GGD A;  5HQG A;  4PSX B;  2IUQ A;  3I89 A;  1L0Q A;  3BG0 A;  3OL2 A;  5HE0 B;  2H13 A;  1R5M A;  4HDJ A;  3U4Y A;  5A2Q g;  4A0A A;  4PC0 A;  4EWR A;  3V5W B;  5FXY A;  4LG9 A;  4CZY A;  5IJ7 E;  2H9L A;  2CE9 A;  1TYQ C;  5EMK B;  5TDH B;  5CYK A;  2BCJ B;  3AL8 B;  4Y7R A;  3EI2 A;  2Q7Q A;  3RN0 D;  3VGZ A;  3VA6 A;  4GQ2 P;  3EMH A;  3UVN A;  4ERY A;  4CY5 A;  4I79 A;  1MDA H;  3ZWL B;  1U4C A;  3J80 g;  3I7O A;  2QXV A;  4J84 A;  2AGW A;  4X61 B;  3OL2 B;  2BBK H;  4CI1 A;  4A08 A;  4R7A B;  3EI4 B;  1GXR A;  4X60 B;  1SQJ A;  2IUP A;  1QNI A;  3IKO A;  5B4W A;  2I0R A;  5CXB B;  3E0C A;  3UVO A;  3I7P A;  2H6K A;  4ZOY A;  4OWR A;  5CYK B;  3N0E A;  3EI2 B;  1A0R B;  3L4O D;  3F3F A;  3SBP A;  5C2V B;  5FLX g;  5FQD A;  4N14 A;  3SLE D;  4J0X A;  5HE2 B;  3SXT D;  4A11 A;  2PM9 A;  2XU7 A;  4AEZ A;  5EM2 A;  3OKY A;  2GC7 A;  3SBQ A;  3K26 A;  3RRM C;  5I5I A;  2J55 H;  2GC4 A;  3PSL A;  4D6V A;  2P9N C;  2YBA A;  3I8C A;  3W15 A;  2P9S C;  3PVU B;  3F3P A;  4U7A A;  2CO0 C;  3SHF A;  3MZL A;  3PVW B;  4O45 A;  4A08 B;  3UVM A;  2HES X;  4K3I D;  4H5J A;  1XKS A;  4Y5R D;  2HJ4 A;  4CY1 A;  2CN2 A;  3UKR C;  3I7H A;  2CE8 A;  4K3J B;  1SQ9 A;  3IIW A;  3I7K A;  2UZX B;  3HFQ A;  3IIY A;  1K32 A;  2I3S A;  3CFS B;  4GQB B;  4L1Q D;  4XYH A;  5IJ8 E;  4GM3 A;  3AFC A;  5C2W B;  4GM8 A;  2AGZ A;  4CC9 A;  3MKS B;  4GQ1 A;  5HE3 B;  3KRX B;  4QRJ A;  4A11 B;  2PM9 B;  2H6Q A;  5EM2 B;  3UR4 A;  4CI3 A;  2TRC B;  2Z2O A;  3EI3 A;  1PI6 A;  1XIP A;  3IJC A;  5GXH A;  2PM6 B;  3RN1 D;  3MXX A;  3UVL A;  4GGA A;  3GFC A;  2J57 G;  5EAR A;  4X63 B;  4TZ4 A;  1S4U X;  5TEE A;  4BH6 A;  1P22 A;  3DWL C;  5I5J A;  4E5Z A;  2AGL A;  5HE1 B;  2B5N A;  5CXC A;  1JOF A;  3I7L A;  5H1M A;  4ZOZ A;  3SVW D;  5SXM A;  4ZN4 A;  2EBS A;  3I7N A;  4CY2 A;  4ZOV A;  3RMZ D;  3SFZ A;  2OK6 A;  3SBR A;  4FA5 D;  3EWE A;  2IAA A;  4JSV C;  3EI3 B;  4QT8 A;  3FGB A;  4AOW A;  4GGC A;  2G9A A;  4PBZ A;  3P4F A;  2HJB A;  2XYI A;  5H17 A;  3J81 g;  3V7D B;  3PSC B;  4E5Z B;  3CIK B;  4A0A B;  4J78 A;  2OIZ A;  3JAM g;  3KRW B;  3K27 A;  2IUR A;  2H6N A;  4CZV A;  5TEF A;  3JZH A;  5EMM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...