4J82A

Crystal structure of beta'-cop/insig-2 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j82A01
5EAMA 4A2LA 1GXRA 2Z2PA 2G99A 3DXMC 4GM8A 2YMUA 4A0AA 2CNXA 3RFGA 3SN6B 3I8EA 5I5MA 4Y7RA 2PM6B 3NVQA 2HJ4A 2YB8B 2Z2OA 4PXWA 4LGNA 1QNIA 4H5JA 1SQJA 2IWKA 1N6DA 3GREA 4O1QD 5HE2B 3I7HA 3JZGA 4J0XA 3JRPA 4JD2C 5CXCB 5KDOB 1PI6A 1MDAH 4NSXA 2YNPA 2BBKH 2P9KC 2H6KA 3MZKA 4AOWA 3OKYB 3PSLA 1JJUB 4QQEA 2H14A 3OL2A 5EMJB 3PXWD 2UZXB 4A2MA 3AL8A 2B4EA 4A09B 4EWRA 2GNQA 3EI4B 4IMMA 2AQ5A 5AJAA 2P9UC 1A0RB 4HDJA 3AFCA 2PM7B 4N14A 5H1MA 5CXBB 4BH6A 5TEEA 1NR0A 2HXCA 1B9YA 1B9XA 3FRXA 2YNOA 3N0DA 3OW8A 2IUPA 1U2VC 4CI8A 1VYHC 1RI6A 4LG9A 4LG8A 1SQ9A 2I0SA 4L3HD 4GGAA 3F3FA 3OKYA 1XIPA 5IGOA 3DXKC 3HFQA 4PSXB 3UKUC 2AGWA 4J77A 4A09A 5GSAA 2AGZA 3PSCB 3SBPA 3EG6A 3RFHA 1GOTB 1L0QA 2YNNA 3KRXB 1ERJA 1PBYB 3RRMC 2CN2A 2AGXA 3U4YA 4J8BA 4J81A 4AEZA 4A0BB 4PBYA 5CYKB 3OKTA 2J57G 5FKTA 4Y5RD 1SHYB 4U7AA 3PXTD 4E54B 3SVWD 4J0WA 4PC0A 2HKMA 3RLMD 3SBRA 3F3GA 3AH8B 2OK6A 3PXSD 4L1QD 2B5MA 3I7OA 4JSNC 3E0CA 4CZVA 2OJYA 5I5JA 5EMMB 3A0FA 5TEFA 3RSEC 5EMLB 3SMRA 5IC7A 2P9IC 3C75H 4GGDA 1N6FA 4GGCA 4CZXA 3SFZA 3C9CA 5TF2A 4K3JB 5EM2B 2I3TA 4OZUA 2OK4A 3PVWB 2XYIA 4GM9A 5CYKA 3I7NA 3EI3B 2PM9A 3PVUB 3B7FA 5HE3B 1U4CA 5HQGA 3JZHA 1JOFA 2I3SA 4E5ZB 2J55H 3MKSB 5IJ7E 4U1EI 3V5WB 2CO0C 2GC7A 4BL0A 2HJBA 5THAA 4ZN4A 3SJLD 3EI2B 3EI1A 5HE1B 3UVLA 2XL2A 1S4UX 3VH0A 3UVOA 4XYHA 2OVQB 1P22A 2OVPB 5H17A 4J84A 4CI1A 5A2Qg 3IJ1A 3I2NA 4O3UB 5HYNB 4TZ4A 2XU7A 4QL1A 4CI3A 5GXIA 5C2VB 5EMKB 2AH0A 3FGBA 3CFSB 2P9PC 3DWLC 4E5ZA 5GMKn 3C5MA 3MKQA 5CXCA 4L9OA 4BUJC 4GQBB 3EI2A 3J81g 3IJ0A 4H5IA 3SLED 3BG1A 4J82A 4CY5A 4ERYA 5HE0B 4I79A 3KRWB 4ES0A 3EI4A 5EAPA 1MG3A 3F3PA 5FKSA 4R7AB 3I7PA 5SXMA 4FAND 1GG2B 4L3GD 2OIZA 5FKQA 2QXVA 4ZOYA 4JSXC 2H6QA 3ZWLB 4JSVC 2CE9A 3J80g 2H6NA 5K1CC 3EU7A 2J56H 4QRJA 5CXBA 3ULEC 2CN3A 2P9LC 2QC5A 3I7KA 3VGZA 4GMBA 5TDHB 3MMYA 5C9ZB 3SCYA 2AGYA 3K26A 4CZYA 4J73A 2B5NA 4O9DA 3NVXA 4ZOZA 2P9NC 3VA6A 3IKOA 4FA1D 1JMXB 2MTAH 4J86A 2O9KA 4J87A 3I7LA 2B5LA 1K8KC 3FM0A 5AMSA 3SBQA 3UR4A 3IJCA 4K3ID 3PE7A 4FHLA 4A0BA 4ZOXA 3JPXA 5IT9g 3ODTA 4XEIC 3MZLA 5FXYA 3CIKB 3JROA 3OL2B 3IIYA 2H9LA 4E54A 3SWSD 3AL8B 4OWRA 1XKSA 4CC9A 3DSMA 2BCJB 2H9NA 2HKRA 4YVDA 2PBIB 5IJ8E 4PSWB 3EMHA 5B4WA 2CO0A 2IWFA 4PNKB 4GQ2P 3GFCA 4A08B 2H3XA 3RN0D 1XHMA 4KFMB 2OVRB 5JWZA 4ZOVA 4A11B 2HESX 2XL3A 4J78A 4ERQA 4CY1A 5EARA 5EM2A 2P9SC 5H14A 4CI2A 1OLZA 3UVNA 2EBSA 3EI3A 4JSPC 4PBZA 2AH1A 3L4OD 4CY3A 3OTTA 2UZYB 3NVNA 4Z8LA 4CY2A 5K19A 2AGLA 4FA9D 5FKRA 5EALA 4JXMA 2G9AA 3P4FA 4D0KA 3SXTD 4GZ8A 4FA4D 3I89A 5FA5B 1Q47A 4A08A 4UI9R 5AFU3 5I5IA 2IURA 2I0RA 1TYQC 2H47A 3V7DB 1PGUA 4A7JA 3IIWA 4A11A 5C2WB 2H13A 3JB9L 1TBGA 4JT6C 4XYIA 2HYEA 5IGQA 4O45A 1FWXA 2Q7QA 4ESGA 3K27A 5FQDA 3L4MD 4GQ1A 4X60B 1MG2A 3W15A 2IUQA 4MK0B 3MXXA 4FWWA 4FB1D 1NEXB 2CE8A 1K32A 2IUVA 4X61B 3EWEA 2H9MA 3V9FA 1N6EA 3DM0A 4FAVD 4FA5D 4A0AB 3UKRC 2GC4A 4O3TB 4JT5C 2PM9B 4X3EA 2IAAA 4QT8A 3RMZD 3UVKA 2H68A 2I0TA 3ORVD 1R5MA 3JZNA 1OMWB 5GXHA 3N0EA 4J79A 4J8GA 3BWSA 1PEVA 5FLXg 3AL9A 3UVMA 2W18A 4IA9A 3BG0A 1GP2B 2Z2NA 3CFVA 3C99A 4X63B 3I8CA 3OKWA 4GM3A 3SHFA 3RN1D 3EI1B 1JMZB 2TRCB 4ERZA 4D6VA 2YBAA 2H9PA 3JAMg 1YFQA 4G56B
chains in the Genus database with same CATH superfamily
5EAMA 4A2LA 1GXRA 2Z2PA 2G99A 3DXMC 4GM8A 2YMUA 4A0AA 2CNXA 3RFGA 3IULA 3SN6B 3I8EA 3ZE2A 4Y7RA 2PM6B 5I5MA 5M5RA 3NVQA 2HJ4A 2YB8B 2Z2OA 4PXWA 4LGNA 1QNIA 4H5JA 1SQJA 2IWKA 1N6DA 3GREA 5M5SA 4O1QD 5HE2B 3I7HA 3JZGA 3QHYB 4J0XA 3JRPA 4JD2C 5CXCB 5KDOB 1PI6A 1QFSA 1MDAH 4UM9A 4NSXA 2YNPA 2BBKH 2P9KC 2H6KA 3MZKA 3OF7A 2VDKA 4AOWA 3OKYB 2EICA 3PSLA 1JJUB 1O6GA 2H14A 4QQEA 3OL2A 5EMJB 3PXWD 2EIDA 2UZXB 4A2MA 3AL8A 2B4EA 4A09B 4EWRA 2VDRA 2GNQA 3EI4B 4IMMA 2AQ5A 5AJAA 2P9UC 1A0RB 4HDJA 3AFCA 2PM7B 4N14A 5H1MA 5CXBB 4BH6A 5TEEA 2QZPA 1NR0A 4RE5A 2HXCA 1B9YA 1B9XA 3FRXA 3VI4A 2YNOA 3N0DA 3OW8A 4WK0A 3GC3B 2IUPA 1U2VC 4CI8A 1VYHC 1RI6A 4LG9A 4LG8A 1SQ9A 2I0SA 1GOGA 4L3HD 4AMYA 4GGAA 3F3FA 3OKYA 1XIPA 4L1MA 5IGOA 4JHNA 3DXKC 3HFQA 4PSXB 4WK2A 2AGWA 3UKUC 4J77A 4A09A 2VC2A 5GSAA 4IRZA 2AGZA 3PSCB 5HDBA 3IJEA 3SBPA 3EG6A 3K72A 3RFHA 1GOTB 3KRXB 1L0QA 2YNNA 2QR5A 1ERJA 1PBYB 3RRMC 2CN2A 4NAAA 2VZ1A 2AGXA 3QI0A 3U4YA 4WJKA 1H2YA 4J8BA 4J81A 4AEZA 4A0BB 4PBYA 5CYKB 3OKTA 1C9IA 3V4VA 2J57G 5FKTA 4Y5RD 1SHYB 4U7AA 3PXTD 4E54B 4AMZA 3SVWD 4NBMA 4J0WA 4PC0A 2HKMA 3RLMD 3SBRA 3V4PA 3F3GA 4DNWA 3AH8B 2OK6A 3PXSD 4L1QD 4Z7NA 2B5MA 5E6UA 3I7OA 4JSNC 2XE4A 1YR2A 3E0CA 4CZVA 4BCCA 2OJYA 5I5JA 5EMMB 3NIGA 3A0FA 5TEFA 3RSEC 5EMLB 3SMRA 2HU8A 5IC7A 2P9IC 3DDUA 3C75H 4GGDA 1N6FA 4GGCA 4CZXA 3SFZA 3C9CA 5TF2A 4K3JB 5EM2B 2I3TA 4OZUA 2OK4A 3PVWB 2XYIA 1VZ2A 4GM9A 3FCUA 5CYKA 3I7NA 3EI3B 2PM9A 3IUJA 3PVUB 3B7FA 5HE3B 2HU5A 1U4CA 5HQGA 3JZHA 3KCIA 1JOFA 1H2WA 1QFMA 2I3SA 3K6SA 4E5ZB 2J55H 3MKSB 5IJ7E 4NC4A 4O02A 4U1EI 3V5WB 4BP8A 2CO0C 2GC7A 4BL0A 2HJBA 1BPOA 1GOFA 5THAA 4ZN4A 3SJLD 3EI2B 3EI1A 2VDPA 5HE1B 3NIDA 2XZGA 3UVLA 2XL2A 1S4UX 4Z7QA 3VH0A 3UVOA 4XYHA 1U8CA 2OVQB 1UOQA 1P22A 5M5TA 2OVPB 2VDLA 2BKLA 3EQ9A 5H17A 1H2ZA 4J84A 4CI1A 5A2Qg 3ZDYA 3IJ1A 3I2NA 4O3UB 5HYNB 4TZ4A 2XU7A 4QL1A 2EIEA 4CI3A 5GXIA 5C2VB 5EMKB 2AH0A 3FGBA 3CFSB 2P9PC 2WQ8A 3DWLC 4E5ZA 5GMKn 3C5MA 3MKQA 5CXCA 4L9OA 1UOPA 5C86A 1UTCA 4BUJC 4GQBB 3EI2A 3J81g 3IJ0A 4H5IA 4UM8A 4MMZA 3SLED 3BG1A 4J82A 4CY5A 1VZ3A 4ERYA 5HE0B 4I79A 3KRWB 4ES0A 3EI4A 5EAPA 1MG3A 3EQ7A 3F3PA 4NENA 4R7AB 5FKSA 5M61A 3I7PA 5SXMA 4FAND 1GG2B 4L3GD 2OIZA 5FKQA 2QXVA 4ZOYA 4JSXC 1VE6A 2H6QA 3ZWLB 4JSVC 1E5TA 2CE9A 2JKXA 3J80g 2H6NA 5E6RA 5K1CC 3EU7A 4O2WA 2J56H 4QRJA 4G1EA 5CXBA 2CN3A 3ULEC 2P9LC 2QC5A 3I7KA 3VGZA 2XDWA 4GMBA 3IUNA 5TDHB 3IUMA 3MMYA 5C9ZB 3SCYA 2AGYA 4AX4A 3K26A 3O4IA 4J73A 4CZYA 2B5NA 4O9DA 2VDQA 3MVDK 3NVXA 4ZOZA 3O4GA 4BCDA 2P9NC 1E8MA 3VA6A 3NIFA 3IKOA 4FA1D 1JMXB 2MTAH 3T3MA 4J86A 2O9KA 4J87A 3I7LA 2B5LA 1K8KC 3FM0A 5AMSA 3SBQA 3T3PA 3UR4A 5M5VA 3IJCA 4K3ID 3PE7A 4FHLA 4AN1A 4A0BA 4ZOXA 3JPXA 5IT9g 3ODTA 4XEIC 3MZLA 5FXYA 3CIKB 3JROA 3OL2B 2VDNA 3IIYA 2H9LA 4E54A 5E6SA 3SWSD 3AL8B 4OWRA 3GD1I 1XKSA 4CC9A 3DSMA 2BCJB 2H9NA 2HKRA 4YVDA 2PBIB 4BCBA 5IJ8E 4PSWB 3EMHA 5B4WA 2CO0A 2IWFA 4PNKB 4GQ2P 3GFCA 4JHPC 4A08B 2H3XA 3RN0D 4DNUA 1XHMA 4KFMB 5FFGA 2OVRB 5JWZA 2EIBA 4ZOVA 4A11B 2HESX 2XL3A 1UOOA 4J78A 4ERQA 4CY1A 5EARA 2VZ3A 5EM2A 2P9SC 4Z7OA 5FFOA 5H14A 4CI2A 1OLZA 1JV2A 3UVNA 2EBSA 3EI3A 4JSPC 4PBZA 2AH1A 3L4OD 5M5UA 4CY3A 3OTTA 2UZYB 3NVNA 4Z8LA 4CY2A 1E8NA 3K71A 5K19A 2AGLA 4FA9D 5FKRA 5EALA 4JXMA 2G9AA 3P4FA 1A12A 4RE6A 4D0KA 3SXTD 3ZDXA 4BP9A 4GZ8A 4FA4D 4D9SA 3EQ8A 3I89A 4AN0A 5FA5B 1Q47A 4A08A 4UI9R 5AFU3 3FCSA 1L5GA 4G1MA 5I5IA 2IURA 2I0RA 1I2MB 1TYQC 2H47A 3V7DB 1PGUA 4A7JA 3IIWA 4A11A 5C2WB 4G55A 2H13A 1VE7A 3JB9L 1TBGA 4JT6C 4XYIA 3ZE1A 2HYEA 5IGQA 4O45A 1FWXA 2Q7QA 2VDOA 4ESGA 3K27A 5FQDA 3L4MD 4GQ1A 4MMYA 4X60B 2VDMA 1MG2A 3W15A 2IUQA 3VI3A 4MK0B 1C9LA 3MXXA 4FWWA 4FB1D 4QAMA 1JTDB 1T2XA 1NEXB 2CE8A 1K32A 2IUVA 4X61B 3EWEA 2H9MA 3V9FA 3O4HA 1O6FA 1N6EA 3DM0A 4FAVD 4FA5D 4WK4A 3UKRC 4A0AB 2GC4A 4O3TB 4JT5C 2PM9B 4X3EA 2IAAA 1M1XA 4QT8A 3RMZD 3UVKA 2H68A 2I0TA 3ZDZA 3ORVD 1R5MA 3JZNA 1OMWB 3IVMA 5GXHA 3N0EA 4J79A 4J8GA 4MMXA 1TYEA 3BWSA 1PEVA 5FLXg 5C92A 2HU7A 3AL9A 3IUQA 3UVMA 3ZE0A 2W18A 4IA9A 3BG0A 1GP2B 1H2XA 2Z2NA 3CFVA 3C99A 3MUOA 3O4JA 4X63B 3I8CA 3OKWA 4GM3A 3SHFA 1K3IA 3RN1D 1GOHA 4DNVA 3EI1B 1JMZB 3IURA 2TRCB 4ERZA 4D6VA 2YBAA 2H9PA 3JAMg 1YFQA 3MUNA 4G56B
chains in the Genus database with same CATH topology
5EAMA 4A2LA 1GXRA 2Z2PA 2G99A 3DXMC 4GM8A 2YMUA 4A0AA 2CNXA 3RFGA 3SN6B 3I8EA 5I5MA 4Y7RA 2PM6B 3NVQA 2HJ4A 2YB8B 2Z2OA 4PXWA 4LGNA 1QNIA 4H5JA 1SQJA 2IWKA 1N6DA 3GREA 4O1QD 5HE2B 3I7HA 3JZGA 4J0XA 3JRPA 4JD2C 5CXCB 5KDOB 1PI6A 1MDAH 4NSXA 2YNPA 2BBKH 2P9KC 2H6KA 3MZKA 4AOWA 3OKYB 3PSLA 1JJUB 4QQEA 2H14A 3OL2A 5EMJB 3PXWD 2UZXB 4A2MA 3AL8A 2B4EA 4A09B 4EWRA 2GNQA 3EI4B 4IMMA 2AQ5A 5AJAA 2P9UC 1A0RB 4HDJA 3AFCA 2PM7B 4N14A 5H1MA 5CXBB 4BH6A 5TEEA 1NR0A 2HXCA 1B9YA 1B9XA 3FRXA 2YNOA 3N0DA 3OW8A 2IUPA 1U2VC 4CI8A 1VYHC 1RI6A 4LG9A 4LG8A 1SQ9A 2I0SA 4L3HD 4GGAA 3F3FA 3OKYA 1XIPA 5IGOA 3DXKC 3HFQA 4PSXB 3UKUC 2AGWA 4J77A 4A09A 5GSAA 2AGZA 3PSCB 3SBPA 3EG6A 3RFHA 1GOTB 1L0QA 2YNNA 3KRXB 1ERJA 1PBYB 3RRMC 2CN2A 2AGXA 3U4YA 4J8BA 4J81A 4AEZA 4A0BB 4PBYA 5CYKB 3OKTA 2J57G 5FKTA 4Y5RD 1SHYB 4U7AA 3PXTD 4E54B 3SVWD 4J0WA 4PC0A 2HKMA 3RLMD 3SBRA 3F3GA 3AH8B 2OK6A 3PXSD 4L1QD 2B5MA 3I7OA 4JSNC 3E0CA 4CZVA 2OJYA 5I5JA 5EMMB 3A0FA 5TEFA 3RSEC 5EMLB 3SMRA 5IC7A 2P9IC 3C75H 4GGDA 1N6FA 4GGCA 4CZXA 3SFZA 3C9CA 5TF2A 4K3JB 5EM2B 2I3TA 4OZUA 2OK4A 3PVWB 2XYIA 4GM9A 5CYKA 3I7NA 3EI3B 2PM9A 3PVUB 3B7FA 5HE3B 1U4CA 5HQGA 3JZHA 1JOFA 2I3SA 4E5ZB 2J55H 3MKSB 5IJ7E 4U1EI 3V5WB 2CO0C 2GC7A 4BL0A 2HJBA 5THAA 4ZN4A 3SJLD 3EI2B 3EI1A 5HE1B 3UVLA 2XL2A 1S4UX 3VH0A 3UVOA 4XYHA 2OVQB 1P22A 2OVPB 5H17A 4J84A 4CI1A 5A2Qg 3IJ1A 3I2NA 4O3UB 5HYNB 4TZ4A 2XU7A 4QL1A 4CI3A 5GXIA 5C2VB 5EMKB 2AH0A 3FGBA 3CFSB 2P9PC 3DWLC 4E5ZA 5GMKn 3C5MA 3MKQA 5CXCA 4L9OA 4BUJC 4GQBB 3EI2A 3J81g 3IJ0A 4H5IA 3SLED 3BG1A 4J82A 4CY5A 4ERYA 5HE0B 4I79A 3KRWB 4ES0A 3EI4A 5EAPA 1MG3A 3F3PA 5FKSA 4R7AB 3I7PA 5SXMA 4FAND 1GG2B 4L3GD 2OIZA 5FKQA 2QXVA 4ZOYA 4JSXC 2H6QA 3ZWLB 4JSVC 2CE9A 3J80g 2H6NA 5K1CC 3EU7A 2J56H 4QRJA 5CXBA 3ULEC 2CN3A 2P9LC 2QC5A 3I7KA 3VGZA 4GMBA 5TDHB 3MMYA 5C9ZB 3SCYA 2AGYA 3K26A 4CZYA 4J73A 2B5NA 4O9DA 3NVXA 4ZOZA 2P9NC 3VA6A 3IKOA 4FA1D 1JMXB 2MTAH 4J86A 2O9KA 4J87A 3I7LA 2B5LA 1K8KC 3FM0A 5AMSA 3SBQA 3UR4A 3IJCA 4K3ID 3PE7A 4FHLA 4A0BA 4ZOXA 3JPXA 5IT9g 3ODTA 4XEIC 3MZLA 5FXYA 3CIKB 3JROA 3OL2B 3IIYA 2H9LA 4E54A 3SWSD 3AL8B 4OWRA 1XKSA 4CC9A 3DSMA 2BCJB 2H9NA 2HKRA 4YVDA 2PBIB 5IJ8E 4PSWB 3EMHA 5B4WA 2CO0A 2IWFA 4PNKB 4GQ2P 3GFCA 4A08B 2H3XA 3RN0D 1XHMA 4KFMB 2OVRB 5JWZA 4ZOVA 4A11B 2HESX 2XL3A 4J78A 4ERQA 4CY1A 5EARA 5EM2A 2P9SC 5H14A 4CI2A 1OLZA 3UVNA 2EBSA 3EI3A 4JSPC 4PBZA 2AH1A 3L4OD 4CY3A 3OTTA 2UZYB 3NVNA 4Z8LA 4CY2A 5K19A 2AGLA 4FA9D 5FKRA 5EALA 4JXMA 2G9AA 3P4FA 4D0KA 3SXTD 4GZ8A 4FA4D 3I89A 5FA5B 1Q47A 4A08A 4UI9R 5AFU3 5I5IA 2IURA 2I0RA 1TYQC 2H47A 3V7DB 1PGUA 4A7JA 3IIWA 4A11A 5C2WB 2H13A 3JB9L 1TBGA 4JT6C 4XYIA 2HYEA 5IGQA 4O45A 1FWXA 2Q7QA 4ESGA 3K27A 5FQDA 3L4MD 4GQ1A 4X60B 1MG2A 3W15A 2IUQA 4MK0B 3MXXA 4FWWA 4FB1D 1NEXB 2CE8A 1K32A 2IUVA 4X61B 3EWEA 2H9MA 3V9FA 1N6EA 3DM0A 4FAVD 4FA5D 4A0AB 3UKRC 2GC4A 4O3TB 4JT5C 2PM9B 4X3EA 2IAAA 4QT8A 3RMZD 3UVKA 2H68A 2I0TA 3ORVD 1R5MA 3JZNA 1OMWB 5GXHA 3N0EA 4J79A 4J8GA 3BWSA 1PEVA 5FLXg 3AL9A 3UVMA 2W18A 4IA9A 3BG0A 1GP2B 2Z2NA 3CFVA 3C99A 4X63B 3I8CA 3OKWA 4GM3A 3SHFA 3RN1D 3EI1B 1JMZB 2TRCB 4ERZA 4D6VA 2YBAA 2H9PA 3JAMg 1YFQA 4G56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAM A;  4A2L A;  1GXR A;  2Z2P A;  2G99 A;  3DXM C;  4GM8 A;  2YMU A;  4A0A A;  2CNX A;  3RFG A;  3SN6 B;  3I8E A;  5I5M A;  4Y7R A;  2PM6 B;  3NVQ A;  2HJ4 A;  2YB8 B;  2Z2O A;  4PXW A;  4LGN A;  1QNI A;  4H5J A;  1SQJ A;  2IWK A;  1N6D A;  3GRE A;  4O1Q D;  5HE2 B;  3I7H A;  3JZG A;  4J0X A;  3JRP A;  4JD2 C;  5CXC B;  5KDO B;  1PI6 A;  1MDA H;  4NSX A;  2YNP A;  2BBK H;  2P9K C;  2H6K A;  3MZK A;  4AOW A;  3OKY B;  3PSL A;  1JJU B;  4QQE A;  2H14 A;  3OL2 A;  5EMJ B;  3PXW D;  2UZX B;  4A2M A;  3AL8 A;  2B4E A;  4A09 B;  4EWR A;  2GNQ A;  3EI4 B;  4IMM A;  2AQ5 A;  5AJA A;  2P9U C;  1A0R B;  4HDJ A;  3AFC A;  2PM7 B;  4N14 A;  5H1M A;  5CXB B;  4BH6 A;  5TEE A;  1NR0 A;  2HXC A;  1B9Y A;  1B9X A;  3FRX A;  2YNO A;  3N0D A;  3OW8 A;  2IUP A;  1U2V C;  4CI8 A;  1VYH C;  1RI6 A;  4LG9 A;  4LG8 A;  1SQ9 A;  2I0S A;  4L3H D;  4GGA A;  3F3F A;  3OKY A;  1XIP A;  5IGO A;  3DXK C;  3HFQ A;  4PSX B;  3UKU C;  2AGW A;  4J77 A;  4A09 A;  5GSA A;  2AGZ A;  3PSC B;  3SBP A;  3EG6 A;  3RFH A;  1GOT B;  1L0Q A;  2YNN A;  3KRX B;  1ERJ A;  1PBY B;  3RRM C;  2CN2 A;  2AGX A;  3U4Y A;  4J8B A;  4J81 A;  4AEZ A;  4A0B B;  4PBY A;  5CYK B;  3OKT A;  2J57 G;  5FKT A;  4Y5R D;  1SHY B;  4U7A A;  3PXT D;  4E54 B;  3SVW D;  4J0W A;  4PC0 A;  2HKM A;  3RLM D;  3SBR A;  3F3G A;  3AH8 B;  2OK6 A;  3PXS D;  4L1Q D;  2B5M A;  3I7O A;  4JSN C;  3E0C A;  4CZV A;  2OJY A;  5I5J A;  5EMM B;  3A0F A;  5TEF A;  3RSE C;  5EML B;  3SMR A;  5IC7 A;  2P9I C;  3C75 H;  4GGD A;  1N6F A;  4GGC A;  4CZX A;  3SFZ A;  3C9C A;  5TF2 A;  4K3J B;  5EM2 B;  2I3T A;  4OZU A;  2OK4 A;  3PVW B;  2XYI A;  4GM9 A;  5CYK A;  3I7N A;  3EI3 B;  2PM9 A;  3PVU B;  3B7F A;  5HE3 B;  1U4C A;  5HQG A;  3JZH A;  1JOF A;  2I3S A;  4E5Z B;  2J55 H;  3MKS B;  5IJ7 E;  4U1E I;  3V5W B;  2CO0 C;  2GC7 A;  4BL0 A;  2HJB A;  5THA A;  4ZN4 A;  3SJL D;  3EI2 B;  3EI1 A;  5HE1 B;  3UVL A;  2XL2 A;  1S4U X;  3VH0 A;  3UVO A;  4XYH A;  2OVQ B;  1P22 A;  2OVP B;  5H17 A;  4J84 A;  4CI1 A;  5A2Q g;  3IJ1 A;  3I2N A;  4O3U B;  5HYN B;  4TZ4 A;  2XU7 A;  4QL1 A;  4CI3 A;  5GXI A;  5C2V B;  5EMK B;  2AH0 A;  3FGB A;  3CFS B;  2P9P C;  3DWL C;  4E5Z A;  5GMK n;  3C5M A;  3MKQ A;  5CXC A;  4L9O A;  4BUJ C;  4GQB B;  3EI2 A;  3J81 g;  3IJ0 A;  4H5I A;  3SLE D;  3BG1 A;  4J82 A;  4CY5 A;  4ERY A;  5HE0 B;  4I79 A;  3KRW B;  4ES0 A;  3EI4 A;  5EAP A;  1MG3 A;  3F3P A;  5FKS A;  4R7A B;  3I7P A;  5SXM A;  4FAN D;  1GG2 B;  4L3G D;  2OIZ A;  5FKQ A;  2QXV A;  4ZOY A;  4JSX C;  2H6Q A;  3ZWL B;  4JSV C;  2CE9 A;  3J80 g;  2H6N A;  5K1C C;  3EU7 A;  2J56 H;  4QRJ A;  5CXB A;  3ULE C;  2CN3 A;  2P9L C;  2QC5 A;  3I7K A;  3VGZ A;  4GMB A;  5TDH B;  3MMY A;  5C9Z B;  3SCY A;  2AGY A;  3K26 A;  4CZY A;  4J73 A;  2B5N A;  4O9D A;  3NVX A;  4ZOZ A;  2P9N C;  3VA6 A;  3IKO A;  4FA1 D;  1JMX B;  2MTA H;  4J86 A;  2O9K A;  4J87 A;  3I7L A;  2B5L A;  1K8K C;  3FM0 A;  5AMS A;  3SBQ A;  3UR4 A;  3IJC A;  4K3I D;  3PE7 A;  4FHL A;  4A0B A;  4ZOX A;  3JPX A;  5IT9 g;  3ODT A;  4XEI C;  3MZL A;  5FXY A;  3CIK B;  3JRO A;  3OL2 B;  3IIY A;  2H9L A;  4E54 A;  3SWS D;  3AL8 B;  4OWR A;  1XKS A;  4CC9 A;  3DSM A;  2BCJ B;  2H9N A;  2HKR A;  4YVD A;  2PBI B;  5IJ8 E;  4PSW B;  3EMH A;  5B4W A;  2CO0 A;  2IWF A;  4PNK B;  4GQ2 P;  3GFC A;  4A08 B;  2H3X A;  3RN0 D;  1XHM A;  4KFM B;  2OVR B;  5JWZ A;  4ZOV A;  4A11 B;  2HES X;  2XL3 A;  4J78 A;  4ERQ A;  4CY1 A;  5EAR A;  5EM2 A;  2P9S C;  5H14 A;  4CI2 A;  1OLZ A;  3UVN A;  2EBS A;  3EI3 A;  4JSP C;  4PBZ A;  2AH1 A;  3L4O D;  4CY3 A;  3OTT A;  2UZY B;  3NVN A;  4Z8L A;  4CY2 A;  5K19 A;  2AGL A;  4FA9 D;  5FKR A;  5EAL A;  4JXM A;  2G9A A;  3P4F A;  4D0K A;  3SXT D;  4GZ8 A;  4FA4 D;  3I89 A;  5FA5 B;  1Q47 A;  4A08 A;  4UI9 R;  5AFU 3;  5I5I A;  2IUR A;  2I0R A;  1TYQ C;  2H47 A;  3V7D B;  1PGU A;  4A7J A;  3IIW A;  4A11 A;  5C2W B;  2H13 A;  3JB9 L;  1TBG A;  4JT6 C;  4XYI A;  2HYE A;  5IGQ A;  4O45 A;  1FWX A;  2Q7Q A;  4ESG A;  3K27 A;  5FQD A;  3L4M D;  4GQ1 A;  4X60 B;  1MG2 A;  3W15 A;  2IUQ A;  4MK0 B;  3MXX A;  4FWW A;  4FB1 D;  1NEX B;  2CE8 A;  1K32 A;  2IUV A;  4X61 B;  3EWE A;  2H9M A;  3V9F A;  1N6E A;  3DM0 A;  4FAV D;  4FA5 D;  4A0A B;  3UKR C;  2GC4 A;  4O3T B;  4JT5 C;  2PM9 B;  4X3E A;  2IAA A;  4QT8 A;  3RMZ D;  3UVK A;  2H68 A;  2I0T A;  3ORV D;  1R5M A;  3JZN A;  1OMW B;  5GXH A;  3N0E A;  4J79 A;  4J8G A;  3BWS A;  1PEV A;  5FLX g;  3AL9 A;  3UVM A;  2W18 A;  4IA9 A;  3BG0 A;  1GP2 B;  2Z2N A;  3CFV A;  3C99 A;  4X63 B;  3I8C A;  3OKW A;  4GM3 A;  3SHF A;  3RN1 D;  3EI1 B;  1JMZ B;  2TRC B;  4ERZ A;  4D6V A;  2YBA A;  2H9P A;  3JAM g;  1YFQ A;  4G56 B; 
#chains in the Genus database with same CATH topology
 5EAM A;  4A2L A;  1GXR A;  2Z2P A;  2G99 A;  3DXM C;  4GM8 A;  2YMU A;  4A0A A;  2CNX A;  3RFG A;  3IUL A;  3SN6 B;  3I8E A;  3ZE2 A;  4Y7R A;  2PM6 B;  5I5M A;  5M5R A;  3NVQ A;  2HJ4 A;  2YB8 B;  2Z2O A;  4PXW A;  4LGN A;  1QNI A;  4H5J A;  1SQJ A;  2IWK A;  1N6D A;  3GRE A;  5M5S A;  4O1Q D;  5HE2 B;  3I7H A;  3JZG A;  3QHY B;  4J0X A;  3JRP A;  4JD2 C;  5CXC B;  5KDO B;  1PI6 A;  1QFS A;  1MDA H;  4UM9 A;  4NSX A;  2YNP A;  2BBK H;  2P9K C;  2H6K A;  3MZK A;  3OF7 A;  2VDK A;  4AOW A;  3OKY B;  2EIC A;  3PSL A;  1JJU B;  1O6G A;  2H14 A;  4QQE A;  3OL2 A;  5EMJ B;  3PXW D;  2EID A;  2UZX B;  4A2M A;  3AL8 A;  2B4E A;  4A09 B;  4EWR A;  2VDR A;  2GNQ A;  3EI4 B;  4IMM A;  2AQ5 A;  5AJA A;  2P9U C;  1A0R B;  4HDJ A;  3AFC A;  2PM7 B;  4N14 A;  5H1M A;  5CXB B;  4BH6 A;  5TEE A;  2QZP A;  1NR0 A;  4RE5 A;  2HXC A;  1B9Y A;  1B9X A;  3FRX A;  3VI4 A;  2YNO A;  3N0D A;  3OW8 A;  4WK0 A;  3GC3 B;  2IUP A;  1U2V C;  4CI8 A;  1VYH C;  1RI6 A;  4LG9 A;  4LG8 A;  1SQ9 A;  2I0S A;  1GOG A;  4L3H D;  4AMY A;  4GGA A;  3F3F A;  3OKY A;  1XIP A;  4L1M A;  5IGO A;  4JHN A;  3DXK C;  3HFQ A;  4PSX B;  4WK2 A;  2AGW A;  3UKU C;  4J77 A;  4A09 A;  2VC2 A;  5GSA A;  4IRZ A;  2AGZ A;  3PSC B;  5HDB A;  3IJE A;  3SBP A;  3EG6 A;  3K72 A;  3RFH A;  1GOT B;  3KRX B;  1L0Q A;  2YNN A;  2QR5 A;  1ERJ A;  1PBY B;  3RRM C;  2CN2 A;  4NAA A;  2VZ1 A;  2AGX A;  3QI0 A;  3U4Y A;  4WJK A;  1H2Y A;  4J8B A;  4J81 A;  4AEZ A;  4A0B B;  4PBY A;  5CYK B;  3OKT A;  1C9I A;  3V4V A;  2J57 G;  5FKT A;  4Y5R D;  1SHY B;  4U7A A;  3PXT D;  4E54 B;  4AMZ A;  3SVW D;  4NBM A;  4J0W A;  4PC0 A;  2HKM A;  3RLM D;  3SBR A;  3V4P A;  3F3G A;  4DNW A;  3AH8 B;  2OK6 A;  3PXS D;  4L1Q D;  4Z7N A;  2B5M A;  5E6U A;  3I7O A;  4JSN C;  2XE4 A;  1YR2 A;  3E0C A;  4CZV A;  4BCC A;  2OJY A;  5I5J A;  5EMM B;  3NIG A;  3A0F A;  5TEF A;  3RSE C;  5EML B;  3SMR A;  2HU8 A;  5IC7 A;  2P9I C;  3DDU A;  3C75 H;  4GGD A;  1N6F A;  4GGC A;  4CZX A;  3SFZ A;  3C9C A;  5TF2 A;  4K3J B;  5EM2 B;  2I3T A;  4OZU A;  2OK4 A;  3PVW B;  2XYI A;  1VZ2 A;  4GM9 A;  3FCU A;  5CYK A;  3I7N A;  3EI3 B;  2PM9 A;  3IUJ A;  3PVU B;  3B7F A;  5HE3 B;  2HU5 A;  1U4C A;  5HQG A;  3JZH A;  3KCI A;  1JOF A;  1H2W A;  1QFM A;  2I3S A;  3K6S A;  4E5Z B;  2J55 H;  3MKS B;  5IJ7 E;  4NC4 A;  4O02 A;  4U1E I;  3V5W B;  4BP8 A;  2CO0 C;  2GC7 A;  4BL0 A;  2HJB A;  1BPO A;  1GOF A;  5THA A;  4ZN4 A;  3SJL D;  3EI2 B;  3EI1 A;  2VDP A;  5HE1 B;  3NID A;  2XZG A;  3UVL A;  2XL2 A;  1S4U X;  4Z7Q A;  3VH0 A;  3UVO A;  4XYH A;  1U8C A;  2OVQ B;  1UOQ A;  1P22 A;  5M5T A;  2OVP B;  2VDL A;  2BKL A;  3EQ9 A;  5H17 A;  1H2Z A;  4J84 A;  4CI1 A;  5A2Q g;  3ZDY A;  3IJ1 A;  3I2N A;  4O3U B;  5HYN B;  4TZ4 A;  2XU7 A;  4QL1 A;  2EIE A;  4CI3 A;  5GXI A;  5C2V B;  5EMK B;  2AH0 A;  3FGB A;  3CFS B;  2P9P C;  2WQ8 A;  3DWL C;  4E5Z A;  5GMK n;  3C5M A;  3MKQ A;  5CXC A;  4L9O A;  1UOP A;  5C86 A;  1UTC A;  4BUJ C;  4GQB B;  3EI2 A;  3J81 g;  3IJ0 A;  4H5I A;  4UM8 A;  4MMZ A;  3SLE D;  3BG1 A;  4J82 A;  4CY5 A;  1VZ3 A;  4ERY A;  5HE0 B;  4I79 A;  3KRW B;  4ES0 A;  3EI4 A;  5EAP A;  1MG3 A;  3EQ7 A;  3F3P A;  4NEN A;  4R7A B;  5FKS A;  5M61 A;  3I7P A;  5SXM A;  4FAN D;  1GG2 B;  4L3G D;  2OIZ A;  5FKQ A;  2QXV A;  4ZOY A;  4JSX C;  1VE6 A;  2H6Q A;  3ZWL B;  4JSV C;  1E5T A;  2CE9 A;  2JKX A;  3J80 g;  2H6N A;  5E6R A;  5K1C C;  3EU7 A;  4O2W A;  2J56 H;  4QRJ A;  4G1E A;  5CXB A;  2CN3 A;  3ULE C;  2P9L C;  2QC5 A;  3I7K A;  3VGZ A;  2XDW A;  4GMB A;  3IUN A;  5TDH B;  3IUM A;  3MMY A;  5C9Z B;  3SCY A;  2AGY A;  4AX4 A;  3K26 A;  3O4I A;  4J73 A;  4CZY A;  2B5N A;  4O9D A;  2VDQ A;  3MVD K;  3NVX A;  4ZOZ A;  3O4G A;  4BCD A;  2P9N C;  1E8M A;  3VA6 A;  3NIF A;  3IKO A;  4FA1 D;  1JMX B;  2MTA H;  3T3M A;  4J86 A;  2O9K A;  4J87 A;  3I7L A;  2B5L A;  1K8K C;  3FM0 A;  5AMS A;  3SBQ A;  3T3P A;  3UR4 A;  5M5V A;  3IJC A;  4K3I D;  3PE7 A;  4FHL A;  4AN1 A;  4A0B A;  4ZOX A;  3JPX A;  5IT9 g;  3ODT A;  4XEI C;  3MZL A;  5FXY A;  3CIK B;  3JRO A;  3OL2 B;  2VDN A;  3IIY A;  2H9L A;  4E54 A;  5E6S A;  3SWS D;  3AL8 B;  4OWR A;  3GD1 I;  1XKS A;  4CC9 A;  3DSM A;  2BCJ B;  2H9N A;  2HKR A;  4YVD A;  2PBI B;  4BCB A;  5IJ8 E;  4PSW B;  3EMH A;  5B4W A;  2CO0 A;  2IWF A;  4PNK B;  4GQ2 P;  3GFC A;  4JHP C;  4A08 B;  2H3X A;  3RN0 D;  4DNU A;  1XHM A;  4KFM B;  5FFG A;  2OVR B;  5JWZ A;  2EIB A;  4ZOV A;  4A11 B;  2HES X;  2XL3 A;  1UOO A;  4J78 A;  4ERQ A;  4CY1 A;  5EAR A;  2VZ3 A;  5EM2 A;  2P9S C;  4Z7O A;  5FFO A;  5H14 A;  4CI2 A;  1OLZ A;  1JV2 A;  3UVN A;  2EBS A;  3EI3 A;  4JSP C;  4PBZ A;  2AH1 A;  3L4O D;  5M5U A;  4CY3 A;  3OTT A;  2UZY B;  3NVN A;  4Z8L A;  4CY2 A;  1E8N A;  3K71 A;  5K19 A;  2AGL A;  4FA9 D;  5FKR A;  5EAL A;  4JXM A;  2G9A A;  3P4F A;  1A12 A;  4RE6 A;  4D0K A;  3SXT D;  3ZDX A;  4BP9 A;  4GZ8 A;  4FA4 D;  4D9S A;  3EQ8 A;  3I89 A;  4AN0 A;  5FA5 B;  1Q47 A;  4A08 A;  4UI9 R;  5AFU 3;  3FCS A;  1L5G A;  4G1M A;  5I5I A;  2IUR A;  2I0R A;  1I2M B;  1TYQ C;  2H47 A;  3V7D B;  1PGU A;  4A7J A;  3IIW A;  4A11 A;  5C2W B;  4G55 A;  2H13 A;  1VE7 A;  3JB9 L;  1TBG A;  4JT6 C;  4XYI A;  3ZE1 A;  2HYE A;  5IGQ A;  4O45 A;  1FWX A;  2Q7Q A;  2VDO A;  4ESG A;  3K27 A;  5FQD A;  3L4M D;  4GQ1 A;  4MMY A;  4X60 B;  2VDM A;  1MG2 A;  3W15 A;  2IUQ A;  3VI3 A;  4MK0 B;  1C9L A;  3MXX A;  4FWW A;  4FB1 D;  4QAM A;  1JTD B;  1T2X A;  1NEX B;  2CE8 A;  1K32 A;  2IUV A;  4X61 B;  3EWE A;  2H9M A;  3V9F A;  3O4H A;  1O6F A;  1N6E A;  3DM0 A;  4FAV D;  4FA5 D;  4WK4 A;  3UKR C;  4A0A B;  2GC4 A;  4O3T B;  4JT5 C;  2PM9 B;  4X3E A;  2IAA A;  1M1X A;  4QT8 A;  3RMZ D;  3UVK A;  2H68 A;  2I0T A;  3ZDZ A;  3ORV D;  1R5M A;  3JZN A;  1OMW B;  3IVM A;  5GXH A;  3N0E A;  4J79 A;  4J8G A;  4MMX A;  1TYE A;  3BWS A;  1PEV A;  5FLX g;  5C92 A;  2HU7 A;  3AL9 A;  3IUQ A;  3UVM A;  3ZE0 A;  2W18 A;  4IA9 A;  3BG0 A;  1GP2 B;  1H2X A;  2Z2N A;  3CFV A;  3C99 A;  3MUO A;  3O4J A;  4X63 B;  3I8C A;  3OKW A;  4GM3 A;  3SHF A;  1K3I A;  3RN1 D;  1GOH A;  4DNV A;  3EI1 B;  1JMZ B;  3IUR A;  2TRC B;  4ERZ A;  4D6V A;  2YBA A;  2H9P A;  3JAM g;  1YFQ A;  3MUN A;  4G56 B; 
#chains in the Genus database with same CATH homology
 5EAM A;  4A2L A;  1GXR A;  2Z2P A;  2G99 A;  3DXM C;  4GM8 A;  2YMU A;  4A0A A;  2CNX A;  3RFG A;  3SN6 B;  3I8E A;  5I5M A;  4Y7R A;  2PM6 B;  3NVQ A;  2HJ4 A;  2YB8 B;  2Z2O A;  4PXW A;  4LGN A;  1QNI A;  4H5J A;  1SQJ A;  2IWK A;  1N6D A;  3GRE A;  4O1Q D;  5HE2 B;  3I7H A;  3JZG A;  4J0X A;  3JRP A;  4JD2 C;  5CXC B;  5KDO B;  1PI6 A;  1MDA H;  4NSX A;  2YNP A;  2BBK H;  2P9K C;  2H6K A;  3MZK A;  4AOW A;  3OKY B;  3PSL A;  1JJU B;  4QQE A;  2H14 A;  3OL2 A;  5EMJ B;  3PXW D;  2UZX B;  4A2M A;  3AL8 A;  2B4E A;  4A09 B;  4EWR A;  2GNQ A;  3EI4 B;  4IMM A;  2AQ5 A;  5AJA A;  2P9U C;  1A0R B;  4HDJ A;  3AFC A;  2PM7 B;  4N14 A;  5H1M A;  5CXB B;  4BH6 A;  5TEE A;  1NR0 A;  2HXC A;  1B9Y A;  1B9X A;  3FRX A;  2YNO A;  3N0D A;  3OW8 A;  2IUP A;  1U2V C;  4CI8 A;  1VYH C;  1RI6 A;  4LG9 A;  4LG8 A;  1SQ9 A;  2I0S A;  4L3H D;  4GGA A;  3F3F A;  3OKY A;  1XIP A;  5IGO A;  3DXK C;  3HFQ A;  4PSX B;  3UKU C;  2AGW A;  4J77 A;  4A09 A;  5GSA A;  2AGZ A;  3PSC B;  3SBP A;  3EG6 A;  3RFH A;  1GOT B;  1L0Q A;  2YNN A;  3KRX B;  1ERJ A;  1PBY B;  3RRM C;  2CN2 A;  2AGX A;  3U4Y A;  4J8B A;  4J81 A;  4AEZ A;  4A0B B;  4PBY A;  5CYK B;  3OKT A;  2J57 G;  5FKT A;  4Y5R D;  1SHY B;  4U7A A;  3PXT D;  4E54 B;  3SVW D;  4J0W A;  4PC0 A;  2HKM A;  3RLM D;  3SBR A;  3F3G A;  3AH8 B;  2OK6 A;  3PXS D;  4L1Q D;  2B5M A;  3I7O A;  4JSN C;  3E0C A;  4CZV A;  2OJY A;  5I5J A;  5EMM B;  3A0F A;  5TEF A;  3RSE C;  5EML B;  3SMR A;  5IC7 A;  2P9I C;  3C75 H;  4GGD A;  1N6F A;  4GGC A;  4CZX A;  3SFZ A;  3C9C A;  5TF2 A;  4K3J B;  5EM2 B;  2I3T A;  4OZU A;  2OK4 A;  3PVW B;  2XYI A;  4GM9 A;  5CYK A;  3I7N A;  3EI3 B;  2PM9 A;  3PVU B;  3B7F A;  5HE3 B;  1U4C A;  5HQG A;  3JZH A;  1JOF A;  2I3S A;  4E5Z B;  2J55 H;  3MKS B;  5IJ7 E;  4U1E I;  3V5W B;  2CO0 C;  2GC7 A;  4BL0 A;  2HJB A;  5THA A;  4ZN4 A;  3SJL D;  3EI2 B;  3EI1 A;  5HE1 B;  3UVL A;  2XL2 A;  1S4U X;  3VH0 A;  3UVO A;  4XYH A;  2OVQ B;  1P22 A;  2OVP B;  5H17 A;  4J84 A;  4CI1 A;  5A2Q g;  3IJ1 A;  3I2N A;  4O3U B;  5HYN B;  4TZ4 A;  2XU7 A;  4QL1 A;  4CI3 A;  5GXI A;  5C2V B;  5EMK B;  2AH0 A;  3FGB A;  3CFS B;  2P9P C;  3DWL C;  4E5Z A;  5GMK n;  3C5M A;  3MKQ A;  5CXC A;  4L9O A;  4BUJ C;  4GQB B;  3EI2 A;  3J81 g;  3IJ0 A;  4H5I A;  3SLE D;  3BG1 A;  4J82 A;  4CY5 A;  4ERY A;  5HE0 B;  4I79 A;  3KRW B;  4ES0 A;  3EI4 A;  5EAP A;  1MG3 A;  3F3P A;  5FKS A;  4R7A B;  3I7P A;  5SXM A;  4FAN D;  1GG2 B;  4L3G D;  2OIZ A;  5FKQ A;  2QXV A;  4ZOY A;  4JSX C;  2H6Q A;  3ZWL B;  4JSV C;  2CE9 A;  3J80 g;  2H6N A;  5K1C C;  3EU7 A;  2J56 H;  4QRJ A;  5CXB A;  3ULE C;  2CN3 A;  2P9L C;  2QC5 A;  3I7K A;  3VGZ A;  4GMB A;  5TDH B;  3MMY A;  5C9Z B;  3SCY A;  2AGY A;  3K26 A;  4CZY A;  4J73 A;  2B5N A;  4O9D A;  3NVX A;  4ZOZ A;  2P9N C;  3VA6 A;  3IKO A;  4FA1 D;  1JMX B;  2MTA H;  4J86 A;  2O9K A;  4J87 A;  3I7L A;  2B5L A;  1K8K C;  3FM0 A;  5AMS A;  3SBQ A;  3UR4 A;  3IJC A;  4K3I D;  3PE7 A;  4FHL A;  4A0B A;  4ZOX A;  3JPX A;  5IT9 g;  3ODT A;  4XEI C;  3MZL A;  5FXY A;  3CIK B;  3JRO A;  3OL2 B;  3IIY A;  2H9L A;  4E54 A;  3SWS D;  3AL8 B;  4OWR A;  1XKS A;  4CC9 A;  3DSM A;  2BCJ B;  2H9N A;  2HKR A;  4YVD A;  2PBI B;  5IJ8 E;  4PSW B;  3EMH A;  5B4W A;  2CO0 A;  2IWF A;  4PNK B;  4GQ2 P;  3GFC A;  4A08 B;  2H3X A;  3RN0 D;  1XHM A;  4KFM B;  2OVR B;  5JWZ A;  4ZOV A;  4A11 B;  2HES X;  2XL3 A;  4J78 A;  4ERQ A;  4CY1 A;  5EAR A;  5EM2 A;  2P9S C;  5H14 A;  4CI2 A;  1OLZ A;  3UVN A;  2EBS A;  3EI3 A;  4JSP C;  4PBZ A;  2AH1 A;  3L4O D;  4CY3 A;  3OTT A;  2UZY B;  3NVN A;  4Z8L A;  4CY2 A;  5K19 A;  2AGL A;  4FA9 D;  5FKR A;  5EAL A;  4JXM A;  2G9A A;  3P4F A;  4D0K A;  3SXT D;  4GZ8 A;  4FA4 D;  3I89 A;  5FA5 B;  1Q47 A;  4A08 A;  4UI9 R;  5AFU 3;  5I5I A;  2IUR A;  2I0R A;  1TYQ C;  2H47 A;  3V7D B;  1PGU A;  4A7J A;  3IIW A;  4A11 A;  5C2W B;  2H13 A;  3JB9 L;  1TBG A;  4JT6 C;  4XYI A;  2HYE A;  5IGQ A;  4O45 A;  1FWX A;  2Q7Q A;  4ESG A;  3K27 A;  5FQD A;  3L4M D;  4GQ1 A;  4X60 B;  1MG2 A;  3W15 A;  2IUQ A;  4MK0 B;  3MXX A;  4FWW A;  4FB1 D;  1NEX B;  2CE8 A;  1K32 A;  2IUV A;  4X61 B;  3EWE A;  2H9M A;  3V9F A;  1N6E A;  3DM0 A;  4FAV D;  4FA5 D;  4A0A B;  3UKR C;  2GC4 A;  4O3T B;  4JT5 C;  2PM9 B;  4X3E A;  2IAA A;  4QT8 A;  3RMZ D;  3UVK A;  2H68 A;  2I0T A;  3ORV D;  1R5M A;  3JZN A;  1OMW B;  5GXH A;  3N0E A;  4J79 A;  4J8G A;  3BWS A;  1PEV A;  5FLX g;  3AL9 A;  3UVM A;  2W18 A;  4IA9 A;  3BG0 A;  1GP2 B;  2Z2N A;  3CFV A;  3C99 A;  4X63 B;  3I8C A;  3OKW A;  4GM3 A;  3SHF A;  3RN1 D;  3EI1 B;  1JMZ B;  2TRC B;  4ERZ A;  4D6V A;  2YBA A;  2H9P A;  3JAM g;  1YFQ A;  4G56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...