4J82A

Crystal structure of beta'-cop/insig-2 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j82A01
3OKWA 2CN3A 4J78A 3FRXA 2AH0A 1GXRA 4OWRA 5FXYA 3I8EA 3PXSD 4J86A 4PSXB 1PI6A 3VH0A 4E54B 4U1EI 4L9OA 3V7DB 1K32A 5EAPA 3DWLC 3BG1A 2Z2PA 4J79A 3JROA 3P4FA 5FLXg 5EAMA 4QQEA 4R7AB 4LG8A 4X60B 5IJ7E 3PE7A 4XYHA 4J81A 4BUJC 3MZKA 2G9AA 3JAMg 2PM9A 3I8CA 2XYIA 4E54A 2P9LC 3C5MA 5CXCB 1YFQA 3FGBA 4PNKB 4CY2A 2IWKA 2TRCB 5IC7A 1GG2B 4PSWB 4ZOVA 2YNPA 1OLZA 4GGDA 1JMZB 3CFSB 3OL2B 4JSPC 3EWEA 2AGWA 1JJUB 3AL9A 4D6VA 1N6EA 4AOWA 4J84A 4ERZA 3JZGA 2I3SA 3GREA 2IURA 3KRWB 3SCYA 2W18A 3OKYA 4ES0A 5EMJB 2HXCA 5CXCA 2H47A 3DM0A 4FA1D 3L4MD 2AGYA 4G56B 2J55H 2YB8B 1PGUA 2PM9B 3CFVA 3NVNA 4A09A 4JD2C 3JZHA 1K8KC 4J82A 4JT5C 1R5MA 3DXKC 4GGCA 2Z2NA 3PXWD 4K3ID 2XL3A 4CY5A 3W15A 3OW8A 2AH1A 4O3UB 5C2VB 1XKSA 2HESX 4H5JA 4ZOYA 4MK0B 4JSNC 2H9NA 2YNOA 3HFQA 1TYQC 4CZVA 4O3TB 4Y7RA 3K26A 2HKRA 5EM2A 4FAVD 4QT8A 3NVQA 5HYNB 2UZXB 3EG6A 3ORVD 2J56H 2B5LA 3SBPA 1U2VC 5EMLB 4K3JB 2AGZA 4PC0A 4HDJA 4E5ZB 2H6NA 3EI2A 1ERJA 4X63B 2B4EA 3RN1D 4FB1D 4CI1A 1RI6A 2I0RA 2CE8A 2HJ4A 5HQGA 3RLMD 3BWSA 3JPXA 2H9MA 2I3TA 4A0BB 1TBGA 4GQ2P 5CXBA 2P9SC 1VYHC 2PBIB 4GQBB 2H9PA 2I0SA 4J73A 1MDAH 2Z2OA 2P9UC 5H1MA 3EI3B 3SLED 3JRPA 5FKQA 5HE3B 1JMXB 4O9DA 3GFCA 3MZLA 2UZYB 4FA4D 2CNXA 4FAND 4QRJA 4A0AA 3AL8A 4CY1A 2MTAH 5GXHA 4J87A 3RFHA 3FM0A 2OK4A 1B9XA 4PBZA 5AMSA 5H17A 1N6FA 1XHMA 4GM8A 5EMMB 5FQDA 4A08B 3ULEC 4J8BA 2H13A 3SBQA 3UKUC 3JB9L 3OKTA 2CO0A 3RN0D 2IAAA 2B5NA 4PBYA 3RMZD 3VA6A 5EMKB 5GSAA 4GM3A 3V9FA 1QNIA 4BH6A 3IJCA 4TZ4A 3SWSD 2IUVA 3UKRC 3OTTA 3A0FA 4FHLA 5CYKA 5GXIA 3C75H 4I79A 1JOFA 3EI4A 3SXTD 5I5IA 3EMHA 2YMUA 1U4CA 1GP2B 2OVPB 4ZN4A 3CIKB 4U7AA 4CI3A 2CE9A 3PXTD 2YNNA 5IGQA 1Q47A 4O1QD 1GOTB 3DXMC 4JXMA 5FKSA 3UR4A 3I7NA 4L1QD 4EWRA 5K19A 1A0RB 3N0DA 2OVRB 3NVXA 3SFZA 1S4UX 4J0WA 3EI1A 3EI4B 2P9KC 2HJBA 5EARA 2O9KA 2IUQA 4JT6C 3IIWA 4N14A 3KRXB 5FKTA 4A2MA 2BCJB 2H3XA 3MKSB 2QC5A 2BBKH 3VGZA 4A11B 2G99A 2XU7A 3F3PA 5KDOB 4A11A 4Y5RD 3K27A 1OMWB 5HE1B 5K1CC 3PVWB 3V5WB 4QL1A 4CZYA 3EI1B 1NEXB 3SVWD 3BG0A 5IJ8E 3J80g 4CI2A 2IWFA 2P9NC 1MG2A 4YVDA 4AEZA 3SN6B 1P22A 3AFCA 3I7PA 2PM7B 3MMYA 2GC4A 4A2LA 5A2Qg 4CC9A 4KFMB 3ZWLB 3I7OA 3L4OD 4J8GA 2J57G 5TEEA 3I7HA 4FA9D 2Q7QA 2YBAA 2EBSA 4ZOZA 5H14A 4FA5D 5CYKB 4NSXA 3C9CA 4BL0A 4CY3A 5CXBB 2P9PC 4A0BA 4IA9A 4Z8LA 3UVNA 4GZ8A 3UVMA 2H6KA 1PBYB 4JSXC 5C2WB 3U4YA 5TEFA 3AH8B 4J0XA 4CZXA 1MG3A 3J81g 4FWWA 3N0EA 1SHYB 2OVQB 2CN2A 4E5ZA 1XIPA 3MKQA 4D0KA 4L3GD 3ODTA 2QXVA 5GMKn 2GC7A 2CO0C 3C99A 4GQ1A 5AJAA 4LGNA 3IJ0A 4GM9A 5FA5B 1SQ9A 3F3GA 1L0QA 4X3EA 5FKRA 3SMRA 5JWZA 3DSMA 4A08A 1NR0A 2PM6B 2H68A 2AGLA 5EALA 4XEIC 2OK6A 2HKMA 4ESGA 1SQJA 3UVOA 4UI9R 5EM2B 3AL8B 4A0AB 2B5MA 4ERYA 3JZNA 5TDHB 1PEVA 3UVLA 4JSVC 3RFGA 2AQ5A 4GGAA 2XL2A 3B7FA 5THAA 4H5IA 3PVUB 1N6DA 4XYIA 4L3HD 5TF2A 3EI3A 5IGOA 5C9ZB 4GMBA 2GNQA 5HE0B 2P9IC 3PSLA 2IUPA 4A09B 3RSEC 2H9LA 3MXXA 3E0CA 2I0TA 3SJLD 4ERQA 5B4WA 3I2NA 2HYEA 1FWXA 4A7JA 2OJYA 3OKYB 2H6QA 4O45A 3SHFA 2AGXA 3SBRA 4IMMA 3EI2B 5SXMA 3PSCB 5HE2B 2OIZA 3IKOA 1B9YA 2H14A 3RRMC 3UVKA 4CI8A 5AFU3 3OL2A 4OZUA 5IT9g 4PXWA 4X61B 3IIYA 4J77A 4LG9A 3IJ1A 3I7KA 3I89A 3F3FA 3I7LA 5I5JA 5I5MA 3EU7A 4ZOXA
chains in the Genus database with same CATH superfamily
1BPOA 3OKWA 2CN3A 4J78A 1JV2A 4WK4A 3FRXA 2AH0A 1GXRA 4OWRA 5FXYA 3I8EA 3PXSD 4J86A 4PSXB 1PI6A 3VH0A 4E54B 4U1EI 4L9OA 3V7DB 1K32A 5EAPA 3DWLC 3BG1A 2QR5A 2Z2PA 4J79A 3JROA 3P4FA 3NIGA 5EAMA 5FLXg 1E8MA 4QQEA 4R7AB 4LG8A 4X60B 3ZDZA 5IJ7E 3PE7A 4XYHA 4J81A 4BCBA 4BUJC 3MVDK 4G55A 3MZKA 2G9AA 3JAMg 2PM9A 3I8CA 2XYIA 4E54A 2P9LC 3C5MA 5M5VA 5CXCB 1YFQA 3FGBA 4PNKB 3V4VA 1K3IA 3K72A 4CY2A 2IWKA 2TRCB 5IC7A 1GG2B 4PSWB 3OF7A 4ZOVA 5M61A 2YNPA 1OLZA 4GGDA 1JMZB 1C9LA 3CFSB 3ZE0A 3OL2B 5E6SA 3T3PA 1H2WA 4JSPC 3IUJA 3EWEA 2AGWA 1JJUB 3AL9A 4D6VA 1N6EA 4AOWA 4J84A 4ERZA 3JZGA 4AMYA 2I3SA 3GREA 4O02A 2IURA 4WK2A 3KRWB 3SCYA 4DNWA 2VDLA 2W18A 3OKYA 1VE7A 5EMJB 2HXCA 4ES0A 5CXCA 2H47A 3DM0A 4FA1D 3L4MD 2AGYA 4G56B 2J55H 2YB8B 4BP8A 1PGUA 2PM9B 3CFVA 3NVNA 1UOOA 4A09A 4JD2C 3JZHA 1K8KC 4J82A 4JT5C 1R5MA 3DXKC 2VZ3A 4GGCA 2Z2NA 3PXWD 4K3ID 2XL3A 4CY5A 3W15A 3OW8A 2AH1A 4O3UB 5C2VB 1XKSA 2HESX 4H5JA 4ZOYA 4MK0B 4JSNC 2H9NA 2JKXA 2YNOA 3HFQA 4WK0A 1TYQC 4CZVA 4O3TB 4Y7RA 2EIBA 3K26A 2HKRA 5EM2A 4FAVD 3FCUA 4QT8A 3IVMA 3NVQA 4NBMA 2XDWA 5HYNB 2UZXB 1VZ3A 3EG6A 3ORVD 2J56H 2B5LA 3SBPA 1I2MB 1U2VC 5EMLB 1VZ2A 4DNUA 4K3JB 2AGZA 1U8CA 4PC0A 3ZDYA 4HDJA 1E5TA 1YR2A 4E5ZB 2H6NA 3T3MA 3FCSA 3EI2A 4Z7QA 2BKLA 1ERJA 4X63B 4JHPC 2B4EA 3RN1D 4FB1D 4CI1A 1RI6A 2I0RA 2CE8A 2HJ4A 5HQGA 3RLMD 4RE5A 3ZDXA 3BWSA 1E8NA 3JPXA 2H9MA 2I3TA 3O4GA 4A0BB 1TBGA 4GQ2P 5CXBA 2P9SC 1VYHC 2PBIB 2VDPA 4GQBB 4O2WA 1A12A 2H9PA 2I0SA 4J73A 1MDAH 2XE4A 2VDNA 2Z2OA 2P9UC 5H1MA 3EI3B 3SLED 1H2YA 1H2ZA 3JRPA 5FKQA 5HE3B 1JMXB 4O9DA 3GFCA 3MZLA 2UZYB 4FA4D 2CNXA 4FAND 3MUOA 3EQ7A 4QRJA 4A0AA 3AL8A 4CY1A 2MTAH 5GXHA 4J87A 3RFHA 3FM0A 2OK4A 1B9XA 4L1MA 4NC4A 4PBZA 5AMSA 5H17A 1N6FA 1XHMA 4GM8A 5EMMB 5FQDA 4A08B 3ULEC 5M5SA 4Z7NA 2HU7A 4J8BA 2H13A 1L5GA 3SBQA 3UKUC 4Z7OA 3JB9L 3EQ8A 3OKTA 2CO0A 3RN0D 2IAAA 3KCIA 2B5NA 2VZ1A 1GOGA 4PBYA 3RMZD 3VA6A 5EMKB 5GSAA 4GM3A 4IRZA 4WJKA 3V9FA 1QNIA 4BH6A 3IJCA 4AX4A 4TZ4A 3SWSD 2IUVA 3UKRC 3NIFA 4AMZA 3OTTA 3A0FA 4FHLA 5CYKA 5GXIA 3C75H 2QZPA 4I79A 1JOFA 3EI4A 3SXTD 5I5IA 3EMHA 2YMUA 1U4CA 1GP2B 2OVPB 4ZN4A 3CIKB 4U7AA 1C9IA 4CI3A 2CE9A 3DDUA 3PXTD 2YNNA 5E6UA 5IGQA 1Q47A 4O1QD 1GOTB 3DXMC 2VDQA 4JXMA 5FKSA 4BCCA 1QFSA 3GD1I 3VI3A 3UR4A 1JTDB 1TYEA 3I7NA 4L1QD 1QFMA 4EWRA 5K19A 1A0RB 3N0DA 2OVRB 3NVXA 3SFZA 1S4UX 4J0WA 2EICA 5C86A 3EI1A 3EI4B 2P9KC 2HJBA 5EARA 4UM8A 3GC3B 3V4PA 2O9KA 2VDRA 2IUQA 4JT6C 4NENA 3IIWA 4N14A 3KRXB 5FKTA 1H2XA 4A2MA 3K6SA 2BCJB 2H3XA 3MKSB 2QC5A 2BBKH 3VGZA 5FFOA 4A11B 1UTCA 2EIEA 2G99A 2XU7A 3F3PA 5KDOB 4A11A 3O4HA 4Y5RD 3K27A 1OMWB 2WQ8A 5HE1B 5K1CC 3PVWB 3V5WB 3K71A 1M1XA 5HDBA 2HU8A 4QL1A 4CZYA 3EI1B 1NEXB 3SVWD 2VDKA 1GOHA 4MMYA 3BG0A 5IJ8E 3J80g 1UOPA 4CI2A 2IWFA 2P9NC 1MG2A 5M5UA 4YVDA 4AEZA 3ZE2A 3SN6B 1P22A 3AFCA 3I7PA 4G1EA 2PM7B 3MMYA 2GC4A 4MMZA 4A2LA 5A2Qg 5M5RA 4CC9A 3VI4A 4KFMB 1UOQA 3ZWLB 3I7OA 3L4OD 4J8GA 2J57G 2VC2A 5TEEA 3I7HA 4FA9D 2Q7QA 2YBAA 2EBSA 4NAAA 4ZOZA 5H14A 4FA5D 2EIDA 4BP9A 3IJEA 4NSXA 5CYKB 3C9CA 4BL0A 4CY3A 5CXBB 2P9PC 4A0BA 4IA9A 4Z8LA 3O4IA 3UVNA 5E6RA 4GZ8A 3UVMA 2H6KA 1PBYB 4JSXC 5C2WB 3NIDA 3U4YA 5TEFA 3AH8B 4J0XA 4CZXA 1MG3A 3J81g 4FWWA 3EQ9A 3N0EA 1SHYB 2OVQB 2CN2A 4BCDA 5M5TA 4E5ZA 1XIPA 3MKQA 4D0KA 4L3GD 3ODTA 2QXVA 3ZE1A 1T2XA 5GMKn 2GC7A 2CO0C 3C99A 4GQ1A 5AJAA 4LGNA 3IJ0A 4GM9A 1VE6A 5FA5B 5FFGA 1SQ9A 3F3GA 5C92A 1L0QA 4X3EA 5FKRA 2HU5A 3SMRA 5JWZA 3DSMA 4A08A 1NR0A 4DNVA 1GOFA 2H68A 2PM6B 2AGLA 5EALA 4XEIC 2OK6A 3IURA 4JHNA 2HKMA 4ESGA 1SQJA 3UVOA 4UI9R 5EM2B 3AL8B 4A0AB 2B5MA 4UM9A 4ERYA 3JZNA 5TDHB 2VDOA 1PEVA 3UVLA 4JSVC 3RFGA 2AQ5A 4GGAA 2XL2A 3B7FA 5THAA 3IUQA 4H5IA 3PVUB 1N6DA 4XYIA 4L3HD 5TF2A 3EI3A 5IGOA 5C9ZB 4MMXA 4GMBA 2GNQA 5HE0B 2P9IC 3PSLA 2IUPA 4A09B 3RSEC 2XZGA 2H9LA 3MXXA 3E0CA 2I0TA 3SJLD 4ERQA 5B4WA 4RE6A 3I2NA 2HYEA 1FWXA 4A7JA 3O4JA 4AN1A 2OJYA 3OKYB 2H6QA 4O45A 3SHFA 2AGXA 3SBRA 4IMMA 3EI2B 5SXMA 1O6FA 3PSCB 5HE2B 2OIZA 3IKOA 3IUNA 4QAMA 1B9YA 4AN0A 2H14A 2VDMA 4D9SA 3RRMC 3UVKA 4CI8A 1O6GA 5AFU3 3IULA 3OL2A 4OZUA 5IT9g 4G1MA 4PXWA 3IIYA 4J77A 4LG9A 4X61B 3IUMA 3IJ1A 3I7KA 3I89A 3F3FA 3I7LA 5I5JA 3QHYB 5I5MA 3QI0A 3MUNA 3EU7A 4ZOXA
chains in the Genus database with same CATH topology
3OKWA 2CN3A 4J78A 3FRXA 2AH0A 1GXRA 4OWRA 5FXYA 3I8EA 3PXSD 4J86A 4PSXB 1PI6A 3VH0A 4E54B 4U1EI 4L9OA 3V7DB 1K32A 5EAPA 3DWLC 3BG1A 2Z2PA 4J79A 3JROA 3P4FA 5FLXg 5EAMA 4QQEA 4R7AB 4LG8A 4X60B 5IJ7E 3PE7A 4XYHA 4J81A 4BUJC 3MZKA 2G9AA 3JAMg 2PM9A 3I8CA 2XYIA 4E54A 2P9LC 3C5MA 5CXCB 1YFQA 3FGBA 4PNKB 4CY2A 2IWKA 2TRCB 5IC7A 1GG2B 4PSWB 4ZOVA 2YNPA 1OLZA 4GGDA 1JMZB 3CFSB 3OL2B 4JSPC 3EWEA 2AGWA 1JJUB 3AL9A 4D6VA 1N6EA 4AOWA 4J84A 4ERZA 3JZGA 2I3SA 3GREA 2IURA 3KRWB 3SCYA 2W18A 3OKYA 4ES0A 5EMJB 2HXCA 5CXCA 2H47A 3DM0A 4FA1D 3L4MD 2AGYA 4G56B 2J55H 2YB8B 1PGUA 2PM9B 3CFVA 3NVNA 4A09A 4JD2C 3JZHA 1K8KC 4J82A 4JT5C 1R5MA 3DXKC 4GGCA 2Z2NA 3PXWD 4K3ID 2XL3A 4CY5A 3W15A 3OW8A 2AH1A 4O3UB 5C2VB 1XKSA 2HESX 4H5JA 4ZOYA 4MK0B 4JSNC 2H9NA 2YNOA 3HFQA 1TYQC 4CZVA 4O3TB 4Y7RA 3K26A 2HKRA 5EM2A 4FAVD 4QT8A 3NVQA 5HYNB 2UZXB 3EG6A 3ORVD 2J56H 2B5LA 3SBPA 1U2VC 5EMLB 4K3JB 2AGZA 4PC0A 4HDJA 4E5ZB 2H6NA 3EI2A 1ERJA 4X63B 2B4EA 3RN1D 4FB1D 4CI1A 1RI6A 2I0RA 2CE8A 2HJ4A 5HQGA 3RLMD 3BWSA 3JPXA 2H9MA 2I3TA 4A0BB 1TBGA 4GQ2P 5CXBA 2P9SC 1VYHC 2PBIB 4GQBB 2H9PA 2I0SA 4J73A 1MDAH 2Z2OA 2P9UC 5H1MA 3EI3B 3SLED 3JRPA 5FKQA 5HE3B 1JMXB 4O9DA 3GFCA 3MZLA 2UZYB 4FA4D 2CNXA 4FAND 4QRJA 4A0AA 3AL8A 4CY1A 2MTAH 5GXHA 4J87A 3RFHA 3FM0A 2OK4A 1B9XA 4PBZA 5AMSA 5H17A 1N6FA 1XHMA 4GM8A 5EMMB 5FQDA 4A08B 3ULEC 4J8BA 2H13A 3SBQA 3UKUC 3JB9L 3OKTA 2CO0A 3RN0D 2IAAA 2B5NA 4PBYA 3RMZD 3VA6A 5EMKB 5GSAA 4GM3A 3V9FA 1QNIA 4BH6A 3IJCA 4TZ4A 3SWSD 2IUVA 3UKRC 3OTTA 3A0FA 4FHLA 5CYKA 5GXIA 3C75H 4I79A 1JOFA 3EI4A 3SXTD 5I5IA 3EMHA 2YMUA 1U4CA 1GP2B 2OVPB 4ZN4A 3CIKB 4U7AA 4CI3A 2CE9A 3PXTD 2YNNA 5IGQA 1Q47A 4O1QD 1GOTB 3DXMC 4JXMA 5FKSA 3UR4A 3I7NA 4L1QD 4EWRA 5K19A 1A0RB 3N0DA 2OVRB 3NVXA 3SFZA 1S4UX 4J0WA 3EI1A 3EI4B 2P9KC 2HJBA 5EARA 2O9KA 2IUQA 4JT6C 3IIWA 4N14A 3KRXB 5FKTA 4A2MA 2BCJB 2H3XA 3MKSB 2QC5A 2BBKH 3VGZA 4A11B 2G99A 2XU7A 3F3PA 5KDOB 4A11A 4Y5RD 3K27A 1OMWB 5HE1B 5K1CC 3PVWB 3V5WB 4QL1A 4CZYA 3EI1B 1NEXB 3SVWD 3BG0A 5IJ8E 3J80g 4CI2A 2IWFA 2P9NC 1MG2A 4YVDA 4AEZA 3SN6B 1P22A 3AFCA 3I7PA 2PM7B 3MMYA 2GC4A 4A2LA 5A2Qg 4CC9A 4KFMB 3ZWLB 3I7OA 3L4OD 4J8GA 2J57G 5TEEA 3I7HA 4FA9D 2Q7QA 2YBAA 2EBSA 4ZOZA 5H14A 4FA5D 5CYKB 4NSXA 3C9CA 4BL0A 4CY3A 5CXBB 2P9PC 4A0BA 4IA9A 4Z8LA 3UVNA 4GZ8A 3UVMA 2H6KA 1PBYB 4JSXC 5C2WB 3U4YA 5TEFA 3AH8B 4J0XA 4CZXA 1MG3A 3J81g 4FWWA 3N0EA 1SHYB 2OVQB 2CN2A 4E5ZA 1XIPA 3MKQA 4D0KA 4L3GD 3ODTA 2QXVA 5GMKn 2GC7A 2CO0C 3C99A 4GQ1A 5AJAA 4LGNA 3IJ0A 4GM9A 5FA5B 1SQ9A 3F3GA 1L0QA 4X3EA 5FKRA 3SMRA 5JWZA 3DSMA 4A08A 1NR0A 2PM6B 2H68A 2AGLA 5EALA 4XEIC 2OK6A 2HKMA 4ESGA 1SQJA 3UVOA 4UI9R 5EM2B 3AL8B 4A0AB 2B5MA 4ERYA 3JZNA 5TDHB 1PEVA 3UVLA 4JSVC 3RFGA 2AQ5A 4GGAA 2XL2A 3B7FA 5THAA 4H5IA 3PVUB 1N6DA 4XYIA 4L3HD 5TF2A 3EI3A 5IGOA 5C9ZB 4GMBA 2GNQA 5HE0B 2P9IC 3PSLA 2IUPA 4A09B 3RSEC 2H9LA 3MXXA 3E0CA 2I0TA 3SJLD 4ERQA 5B4WA 3I2NA 2HYEA 1FWXA 4A7JA 2OJYA 3OKYB 2H6QA 4O45A 3SHFA 2AGXA 3SBRA 4IMMA 3EI2B 5SXMA 3PSCB 5HE2B 2OIZA 3IKOA 1B9YA 2H14A 3RRMC 3UVKA 4CI8A 5AFU3 3OL2A 4OZUA 5IT9g 4PXWA 4X61B 3IIYA 4J77A 4LG9A 3IJ1A 3I7KA 3I89A 3F3FA 3I7LA 5I5JA 5I5MA 3EU7A 4ZOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKW A;  2CN3 A;  4J78 A;  3FRX A;  2AH0 A;  1GXR A;  4OWR A;  5FXY A;  3I8E A;  3PXS D;  4J86 A;  4PSX B;  1PI6 A;  3VH0 A;  4E54 B;  4U1E I;  4L9O A;  3V7D B;  1K32 A;  5EAP A;  3DWL C;  3BG1 A;  2Z2P A;  4J79 A;  3JRO A;  3P4F A;  5FLX g;  5EAM A;  4QQE A;  4R7A B;  4LG8 A;  4X60 B;  5IJ7 E;  3PE7 A;  4XYH A;  4J81 A;  4BUJ C;  3MZK A;  2G9A A;  3JAM g;  2PM9 A;  3I8C A;  2XYI A;  4E54 A;  2P9L C;  3C5M A;  5CXC B;  1YFQ A;  3FGB A;  4PNK B;  4CY2 A;  2IWK A;  2TRC B;  5IC7 A;  1GG2 B;  4PSW B;  4ZOV A;  2YNP A;  1OLZ A;  4GGD A;  1JMZ B;  3CFS B;  3OL2 B;  4JSP C;  3EWE A;  2AGW A;  1JJU B;  3AL9 A;  4D6V A;  1N6E A;  4AOW A;  4J84 A;  4ERZ A;  3JZG A;  2I3S A;  3GRE A;  2IUR A;  3KRW B;  3SCY A;  2W18 A;  3OKY A;  4ES0 A;  5EMJ B;  2HXC A;  5CXC A;  2H47 A;  3DM0 A;  4FA1 D;  3L4M D;  2AGY A;  4G56 B;  2J55 H;  2YB8 B;  1PGU A;  2PM9 B;  3CFV A;  3NVN A;  4A09 A;  4JD2 C;  3JZH A;  1K8K C;  4J82 A;  4JT5 C;  1R5M A;  3DXK C;  4GGC A;  2Z2N A;  3PXW D;  4K3I D;  2XL3 A;  4CY5 A;  3W15 A;  3OW8 A;  2AH1 A;  4O3U B;  5C2V B;  1XKS A;  2HES X;  4H5J A;  4ZOY A;  4MK0 B;  4JSN C;  2H9N A;  2YNO A;  3HFQ A;  1TYQ C;  4CZV A;  4O3T B;  4Y7R A;  3K26 A;  2HKR A;  5EM2 A;  4FAV D;  4QT8 A;  3NVQ A;  5HYN B;  2UZX B;  3EG6 A;  3ORV D;  2J56 H;  2B5L A;  3SBP A;  1U2V C;  5EML B;  4K3J B;  2AGZ A;  4PC0 A;  4HDJ A;  4E5Z B;  2H6N A;  3EI2 A;  1ERJ A;  4X63 B;  2B4E A;  3RN1 D;  4FB1 D;  4CI1 A;  1RI6 A;  2I0R A;  2CE8 A;  2HJ4 A;  5HQG A;  3RLM D;  3BWS A;  3JPX A;  2H9M A;  2I3T A;  4A0B B;  1TBG A;  4GQ2 P;  5CXB A;  2P9S C;  1VYH C;  2PBI B;  4GQB B;  2H9P A;  2I0S A;  4J73 A;  1MDA H;  2Z2O A;  2P9U C;  5H1M A;  3EI3 B;  3SLE D;  3JRP A;  5FKQ A;  5HE3 B;  1JMX B;  4O9D A;  3GFC A;  3MZL A;  2UZY B;  4FA4 D;  2CNX A;  4FAN D;  4QRJ A;  4A0A A;  3AL8 A;  4CY1 A;  2MTA H;  5GXH A;  4J87 A;  3RFH A;  3FM0 A;  2OK4 A;  1B9X A;  4PBZ A;  5AMS A;  5H17 A;  1N6F A;  1XHM A;  4GM8 A;  5EMM B;  5FQD A;  4A08 B;  3ULE C;  4J8B A;  2H13 A;  3SBQ A;  3UKU C;  3JB9 L;  3OKT A;  2CO0 A;  3RN0 D;  2IAA A;  2B5N A;  4PBY A;  3RMZ D;  3VA6 A;  5EMK B;  5GSA A;  4GM3 A;  3V9F A;  1QNI A;  4BH6 A;  3IJC A;  4TZ4 A;  3SWS D;  2IUV A;  3UKR C;  3OTT A;  3A0F A;  4FHL A;  5CYK A;  5GXI A;  3C75 H;  4I79 A;  1JOF A;  3EI4 A;  3SXT D;  5I5I A;  3EMH A;  2YMU A;  1U4C A;  1GP2 B;  2OVP B;  4ZN4 A;  3CIK B;  4U7A A;  4CI3 A;  2CE9 A;  3PXT D;  2YNN A;  5IGQ A;  1Q47 A;  4O1Q D;  1GOT B;  3DXM C;  4JXM A;  5FKS A;  3UR4 A;  3I7N A;  4L1Q D;  4EWR A;  5K19 A;  1A0R B;  3N0D A;  2OVR B;  3NVX A;  3SFZ A;  1S4U X;  4J0W A;  3EI1 A;  3EI4 B;  2P9K C;  2HJB A;  5EAR A;  2O9K A;  2IUQ A;  4JT6 C;  3IIW A;  4N14 A;  3KRX B;  5FKT A;  4A2M A;  2BCJ B;  2H3X A;  3MKS B;  2QC5 A;  2BBK H;  3VGZ A;  4A11 B;  2G99 A;  2XU7 A;  3F3P A;  5KDO B;  4A11 A;  4Y5R D;  3K27 A;  1OMW B;  5HE1 B;  5K1C C;  3PVW B;  3V5W B;  4QL1 A;  4CZY A;  3EI1 B;  1NEX B;  3SVW D;  3BG0 A;  5IJ8 E;  3J80 g;  4CI2 A;  2IWF A;  2P9N C;  1MG2 A;  4YVD A;  4AEZ A;  3SN6 B;  1P22 A;  3AFC A;  3I7P A;  2PM7 B;  3MMY A;  2GC4 A;  4A2L A;  5A2Q g;  4CC9 A;  4KFM B;  3ZWL B;  3I7O A;  3L4O D;  4J8G A;  2J57 G;  5TEE A;  3I7H A;  4FA9 D;  2Q7Q A;  2YBA A;  2EBS A;  4ZOZ A;  5H14 A;  4FA5 D;  5CYK B;  4NSX A;  3C9C A;  4BL0 A;  4CY3 A;  5CXB B;  2P9P C;  4A0B A;  4IA9 A;  4Z8L A;  3UVN A;  4GZ8 A;  3UVM A;  2H6K A;  1PBY B;  4JSX C;  5C2W B;  3U4Y A;  5TEF A;  3AH8 B;  4J0X A;  4CZX A;  1MG3 A;  3J81 g;  4FWW A;  3N0E A;  1SHY B;  2OVQ B;  2CN2 A;  4E5Z A;  1XIP A;  3MKQ A;  4D0K A;  4L3G D;  3ODT A;  2QXV A;  5GMK n;  2GC7 A;  2CO0 C;  3C99 A;  4GQ1 A;  5AJA A;  4LGN A;  3IJ0 A;  4GM9 A;  5FA5 B;  1SQ9 A;  3F3G A;  1L0Q A;  4X3E A;  5FKR A;  3SMR A;  5JWZ A;  3DSM A;  4A08 A;  1NR0 A;  2PM6 B;  2H68 A;  2AGL A;  5EAL A;  4XEI C;  2OK6 A;  2HKM A;  4ESG A;  1SQJ A;  3UVO A;  4UI9 R;  5EM2 B;  3AL8 B;  4A0A B;  2B5M A;  4ERY A;  3JZN A;  5TDH B;  1PEV A;  3UVL A;  4JSV C;  3RFG A;  2AQ5 A;  4GGA A;  2XL2 A;  3B7F A;  5THA A;  4H5I A;  3PVU B;  1N6D A;  4XYI A;  4L3H D;  5TF2 A;  3EI3 A;  5IGO A;  5C9Z B;  4GMB A;  2GNQ A;  5HE0 B;  2P9I C;  3PSL A;  2IUP A;  4A09 B;  3RSE C;  2H9L A;  3MXX A;  3E0C A;  2I0T A;  3SJL D;  4ERQ A;  5B4W A;  3I2N A;  2HYE A;  1FWX A;  4A7J A;  2OJY A;  3OKY B;  2H6Q A;  4O45 A;  3SHF A;  2AGX A;  3SBR A;  4IMM A;  3EI2 B;  5SXM A;  3PSC B;  5HE2 B;  2OIZ A;  3IKO A;  1B9Y A;  2H14 A;  3RRM C;  3UVK A;  4CI8 A;  5AFU 3;  3OL2 A;  4OZU A;  5IT9 g;  4PXW A;  4X61 B;  3IIY A;  4J77 A;  4LG9 A;  3IJ1 A;  3I7K A;  3I89 A;  3F3F A;  3I7L A;  5I5J A;  5I5M A;  3EU7 A;  4ZOX A; 
#chains in the Genus database with same CATH topology
 1BPO A;  3OKW A;  2CN3 A;  4J78 A;  1JV2 A;  4WK4 A;  3FRX A;  2AH0 A;  1GXR A;  4OWR A;  5FXY A;  3I8E A;  3PXS D;  4J86 A;  4PSX B;  1PI6 A;  3VH0 A;  4E54 B;  4U1E I;  4L9O A;  3V7D B;  1K32 A;  5EAP A;  3DWL C;  3BG1 A;  2QR5 A;  2Z2P A;  4J79 A;  3JRO A;  3P4F A;  3NIG A;  5EAM A;  5FLX g;  1E8M A;  4QQE A;  4R7A B;  4LG8 A;  4X60 B;  3ZDZ A;  5IJ7 E;  3PE7 A;  4XYH A;  4J81 A;  4BCB A;  4BUJ C;  3MVD K;  4G55 A;  3MZK A;  2G9A A;  3JAM g;  2PM9 A;  3I8C A;  2XYI A;  4E54 A;  2P9L C;  3C5M A;  5M5V A;  5CXC B;  1YFQ A;  3FGB A;  4PNK B;  3V4V A;  1K3I A;  3K72 A;  4CY2 A;  2IWK A;  2TRC B;  5IC7 A;  1GG2 B;  4PSW B;  3OF7 A;  4ZOV A;  5M61 A;  2YNP A;  1OLZ A;  4GGD A;  1JMZ B;  1C9L A;  3CFS B;  3ZE0 A;  3OL2 B;  5E6S A;  3T3P A;  1H2W A;  4JSP C;  3IUJ A;  3EWE A;  2AGW A;  1JJU B;  3AL9 A;  4D6V A;  1N6E A;  4AOW A;  4J84 A;  4ERZ A;  3JZG A;  4AMY A;  2I3S A;  3GRE A;  4O02 A;  2IUR A;  4WK2 A;  3KRW B;  3SCY A;  4DNW A;  2VDL A;  2W18 A;  3OKY A;  1VE7 A;  5EMJ B;  2HXC A;  4ES0 A;  5CXC A;  2H47 A;  3DM0 A;  4FA1 D;  3L4M D;  2AGY A;  4G56 B;  2J55 H;  2YB8 B;  4BP8 A;  1PGU A;  2PM9 B;  3CFV A;  3NVN A;  1UOO A;  4A09 A;  4JD2 C;  3JZH A;  1K8K C;  4J82 A;  4JT5 C;  1R5M A;  3DXK C;  2VZ3 A;  4GGC A;  2Z2N A;  3PXW D;  4K3I D;  2XL3 A;  4CY5 A;  3W15 A;  3OW8 A;  2AH1 A;  4O3U B;  5C2V B;  1XKS A;  2HES X;  4H5J A;  4ZOY A;  4MK0 B;  4JSN C;  2H9N A;  2JKX A;  2YNO A;  3HFQ A;  4WK0 A;  1TYQ C;  4CZV A;  4O3T B;  4Y7R A;  2EIB A;  3K26 A;  2HKR A;  5EM2 A;  4FAV D;  3FCU A;  4QT8 A;  3IVM A;  3NVQ A;  4NBM A;  2XDW A;  5HYN B;  2UZX B;  1VZ3 A;  3EG6 A;  3ORV D;  2J56 H;  2B5L A;  3SBP A;  1I2M B;  1U2V C;  5EML B;  1VZ2 A;  4DNU A;  4K3J B;  2AGZ A;  1U8C A;  4PC0 A;  3ZDY A;  4HDJ A;  1E5T A;  1YR2 A;  4E5Z B;  2H6N A;  3T3M A;  3FCS A;  3EI2 A;  4Z7Q A;  2BKL A;  1ERJ A;  4X63 B;  4JHP C;  2B4E A;  3RN1 D;  4FB1 D;  4CI1 A;  1RI6 A;  2I0R A;  2CE8 A;  2HJ4 A;  5HQG A;  3RLM D;  4RE5 A;  3ZDX A;  3BWS A;  1E8N A;  3JPX A;  2H9M A;  2I3T A;  3O4G A;  4A0B B;  1TBG A;  4GQ2 P;  5CXB A;  2P9S C;  1VYH C;  2PBI B;  2VDP A;  4GQB B;  4O2W A;  1A12 A;  2H9P A;  2I0S A;  4J73 A;  1MDA H;  2XE4 A;  2VDN A;  2Z2O A;  2P9U C;  5H1M A;  3EI3 B;  3SLE D;  1H2Y A;  1H2Z A;  3JRP A;  5FKQ A;  5HE3 B;  1JMX B;  4O9D A;  3GFC A;  3MZL A;  2UZY B;  4FA4 D;  2CNX A;  4FAN D;  3MUO A;  3EQ7 A;  4QRJ A;  4A0A A;  3AL8 A;  4CY1 A;  2MTA H;  5GXH A;  4J87 A;  3RFH A;  3FM0 A;  2OK4 A;  1B9X A;  4L1M A;  4NC4 A;  4PBZ A;  5AMS A;  5H17 A;  1N6F A;  1XHM A;  4GM8 A;  5EMM B;  5FQD A;  4A08 B;  3ULE C;  5M5S A;  4Z7N A;  2HU7 A;  4J8B A;  2H13 A;  1L5G A;  3SBQ A;  3UKU C;  4Z7O A;  3JB9 L;  3EQ8 A;  3OKT A;  2CO0 A;  3RN0 D;  2IAA A;  3KCI A;  2B5N A;  2VZ1 A;  1GOG A;  4PBY A;  3RMZ D;  3VA6 A;  5EMK B;  5GSA A;  4GM3 A;  4IRZ A;  4WJK A;  3V9F A;  1QNI A;  4BH6 A;  3IJC A;  4AX4 A;  4TZ4 A;  3SWS D;  2IUV A;  3UKR C;  3NIF A;  4AMZ A;  3OTT A;  3A0F A;  4FHL A;  5CYK A;  5GXI A;  3C75 H;  2QZP A;  4I79 A;  1JOF A;  3EI4 A;  3SXT D;  5I5I A;  3EMH A;  2YMU A;  1U4C A;  1GP2 B;  2OVP B;  4ZN4 A;  3CIK B;  4U7A A;  1C9I A;  4CI3 A;  2CE9 A;  3DDU A;  3PXT D;  2YNN A;  5E6U A;  5IGQ A;  1Q47 A;  4O1Q D;  1GOT B;  3DXM C;  2VDQ A;  4JXM A;  5FKS A;  4BCC A;  1QFS A;  3GD1 I;  3VI3 A;  3UR4 A;  1JTD B;  1TYE A;  3I7N A;  4L1Q D;  1QFM A;  4EWR A;  5K19 A;  1A0R B;  3N0D A;  2OVR B;  3NVX A;  3SFZ A;  1S4U X;  4J0W A;  2EIC A;  5C86 A;  3EI1 A;  3EI4 B;  2P9K C;  2HJB A;  5EAR A;  4UM8 A;  3GC3 B;  3V4P A;  2O9K A;  2VDR A;  2IUQ A;  4JT6 C;  4NEN A;  3IIW A;  4N14 A;  3KRX B;  5FKT A;  1H2X A;  4A2M A;  3K6S A;  2BCJ B;  2H3X A;  3MKS B;  2QC5 A;  2BBK H;  3VGZ A;  5FFO A;  4A11 B;  1UTC A;  2EIE A;  2G99 A;  2XU7 A;  3F3P A;  5KDO B;  4A11 A;  3O4H A;  4Y5R D;  3K27 A;  1OMW B;  2WQ8 A;  5HE1 B;  5K1C C;  3PVW B;  3V5W B;  3K71 A;  1M1X A;  5HDB A;  2HU8 A;  4QL1 A;  4CZY A;  3EI1 B;  1NEX B;  3SVW D;  2VDK A;  1GOH A;  4MMY A;  3BG0 A;  5IJ8 E;  3J80 g;  1UOP A;  4CI2 A;  2IWF A;  2P9N C;  1MG2 A;  5M5U A;  4YVD A;  4AEZ A;  3ZE2 A;  3SN6 B;  1P22 A;  3AFC A;  3I7P A;  4G1E A;  2PM7 B;  3MMY A;  2GC4 A;  4MMZ A;  4A2L A;  5A2Q g;  5M5R A;  4CC9 A;  3VI4 A;  4KFM B;  1UOQ A;  3ZWL B;  3I7O A;  3L4O D;  4J8G A;  2J57 G;  2VC2 A;  5TEE A;  3I7H A;  4FA9 D;  2Q7Q A;  2YBA A;  2EBS A;  4NAA A;  4ZOZ A;  5H14 A;  4FA5 D;  2EID A;  4BP9 A;  3IJE A;  4NSX A;  5CYK B;  3C9C A;  4BL0 A;  4CY3 A;  5CXB B;  2P9P C;  4A0B A;  4IA9 A;  4Z8L A;  3O4I A;  3UVN A;  5E6R A;  4GZ8 A;  3UVM A;  2H6K A;  1PBY B;  4JSX C;  5C2W B;  3NID A;  3U4Y A;  5TEF A;  3AH8 B;  4J0X A;  4CZX A;  1MG3 A;  3J81 g;  4FWW A;  3EQ9 A;  3N0E A;  1SHY B;  2OVQ B;  2CN2 A;  4BCD A;  5M5T A;  4E5Z A;  1XIP A;  3MKQ A;  4D0K A;  4L3G D;  3ODT A;  2QXV A;  3ZE1 A;  1T2X A;  5GMK n;  2GC7 A;  2CO0 C;  3C99 A;  4GQ1 A;  5AJA A;  4LGN A;  3IJ0 A;  4GM9 A;  1VE6 A;  5FA5 B;  5FFG A;  1SQ9 A;  3F3G A;  5C92 A;  1L0Q A;  4X3E A;  5FKR A;  2HU5 A;  3SMR A;  5JWZ A;  3DSM A;  4A08 A;  1NR0 A;  4DNV A;  1GOF A;  2H68 A;  2PM6 B;  2AGL A;  5EAL A;  4XEI C;  2OK6 A;  3IUR A;  4JHN A;  2HKM A;  4ESG A;  1SQJ A;  3UVO A;  4UI9 R;  5EM2 B;  3AL8 B;  4A0A B;  2B5M A;  4UM9 A;  4ERY A;  3JZN A;  5TDH B;  2VDO A;  1PEV A;  3UVL A;  4JSV C;  3RFG A;  2AQ5 A;  4GGA A;  2XL2 A;  3B7F A;  5THA A;  3IUQ A;  4H5I A;  3PVU B;  1N6D A;  4XYI A;  4L3H D;  5TF2 A;  3EI3 A;  5IGO A;  5C9Z B;  4MMX A;  4GMB A;  2GNQ A;  5HE0 B;  2P9I C;  3PSL A;  2IUP A;  4A09 B;  3RSE C;  2XZG A;  2H9L A;  3MXX A;  3E0C A;  2I0T A;  3SJL D;  4ERQ A;  5B4W A;  4RE6 A;  3I2N A;  2HYE A;  1FWX A;  4A7J A;  3O4J A;  4AN1 A;  2OJY A;  3OKY B;  2H6Q A;  4O45 A;  3SHF A;  2AGX A;  3SBR A;  4IMM A;  3EI2 B;  5SXM A;  1O6F A;  3PSC B;  5HE2 B;  2OIZ A;  3IKO A;  3IUN A;  4QAM A;  1B9Y A;  4AN0 A;  2H14 A;  2VDM A;  4D9S A;  3RRM C;  3UVK A;  4CI8 A;  1O6G A;  5AFU 3;  3IUL A;  3OL2 A;  4OZU A;  5IT9 g;  4G1M A;  4PXW A;  3IIY A;  4J77 A;  4LG9 A;  4X61 B;  3IUM A;  3IJ1 A;  3I7K A;  3I89 A;  3F3F A;  3I7L A;  5I5J A;  3QHY B;  5I5M A;  3QI0 A;  3MUN A;  3EU7 A;  4ZOX A; 
#chains in the Genus database with same CATH homology
 3OKW A;  2CN3 A;  4J78 A;  3FRX A;  2AH0 A;  1GXR A;  4OWR A;  5FXY A;  3I8E A;  3PXS D;  4J86 A;  4PSX B;  1PI6 A;  3VH0 A;  4E54 B;  4U1E I;  4L9O A;  3V7D B;  1K32 A;  5EAP A;  3DWL C;  3BG1 A;  2Z2P A;  4J79 A;  3JRO A;  3P4F A;  5FLX g;  5EAM A;  4QQE A;  4R7A B;  4LG8 A;  4X60 B;  5IJ7 E;  3PE7 A;  4XYH A;  4J81 A;  4BUJ C;  3MZK A;  2G9A A;  3JAM g;  2PM9 A;  3I8C A;  2XYI A;  4E54 A;  2P9L C;  3C5M A;  5CXC B;  1YFQ A;  3FGB A;  4PNK B;  4CY2 A;  2IWK A;  2TRC B;  5IC7 A;  1GG2 B;  4PSW B;  4ZOV A;  2YNP A;  1OLZ A;  4GGD A;  1JMZ B;  3CFS B;  3OL2 B;  4JSP C;  3EWE A;  2AGW A;  1JJU B;  3AL9 A;  4D6V A;  1N6E A;  4AOW A;  4J84 A;  4ERZ A;  3JZG A;  2I3S A;  3GRE A;  2IUR A;  3KRW B;  3SCY A;  2W18 A;  3OKY A;  4ES0 A;  5EMJ B;  2HXC A;  5CXC A;  2H47 A;  3DM0 A;  4FA1 D;  3L4M D;  2AGY A;  4G56 B;  2J55 H;  2YB8 B;  1PGU A;  2PM9 B;  3CFV A;  3NVN A;  4A09 A;  4JD2 C;  3JZH A;  1K8K C;  4J82 A;  4JT5 C;  1R5M A;  3DXK C;  4GGC A;  2Z2N A;  3PXW D;  4K3I D;  2XL3 A;  4CY5 A;  3W15 A;  3OW8 A;  2AH1 A;  4O3U B;  5C2V B;  1XKS A;  2HES X;  4H5J A;  4ZOY A;  4MK0 B;  4JSN C;  2H9N A;  2YNO A;  3HFQ A;  1TYQ C;  4CZV A;  4O3T B;  4Y7R A;  3K26 A;  2HKR A;  5EM2 A;  4FAV D;  4QT8 A;  3NVQ A;  5HYN B;  2UZX B;  3EG6 A;  3ORV D;  2J56 H;  2B5L A;  3SBP A;  1U2V C;  5EML B;  4K3J B;  2AGZ A;  4PC0 A;  4HDJ A;  4E5Z B;  2H6N A;  3EI2 A;  1ERJ A;  4X63 B;  2B4E A;  3RN1 D;  4FB1 D;  4CI1 A;  1RI6 A;  2I0R A;  2CE8 A;  2HJ4 A;  5HQG A;  3RLM D;  3BWS A;  3JPX A;  2H9M A;  2I3T A;  4A0B B;  1TBG A;  4GQ2 P;  5CXB A;  2P9S C;  1VYH C;  2PBI B;  4GQB B;  2H9P A;  2I0S A;  4J73 A;  1MDA H;  2Z2O A;  2P9U C;  5H1M A;  3EI3 B;  3SLE D;  3JRP A;  5FKQ A;  5HE3 B;  1JMX B;  4O9D A;  3GFC A;  3MZL A;  2UZY B;  4FA4 D;  2CNX A;  4FAN D;  4QRJ A;  4A0A A;  3AL8 A;  4CY1 A;  2MTA H;  5GXH A;  4J87 A;  3RFH A;  3FM0 A;  2OK4 A;  1B9X A;  4PBZ A;  5AMS A;  5H17 A;  1N6F A;  1XHM A;  4GM8 A;  5EMM B;  5FQD A;  4A08 B;  3ULE C;  4J8B A;  2H13 A;  3SBQ A;  3UKU C;  3JB9 L;  3OKT A;  2CO0 A;  3RN0 D;  2IAA A;  2B5N A;  4PBY A;  3RMZ D;  3VA6 A;  5EMK B;  5GSA A;  4GM3 A;  3V9F A;  1QNI A;  4BH6 A;  3IJC A;  4TZ4 A;  3SWS D;  2IUV A;  3UKR C;  3OTT A;  3A0F A;  4FHL A;  5CYK A;  5GXI A;  3C75 H;  4I79 A;  1JOF A;  3EI4 A;  3SXT D;  5I5I A;  3EMH A;  2YMU A;  1U4C A;  1GP2 B;  2OVP B;  4ZN4 A;  3CIK B;  4U7A A;  4CI3 A;  2CE9 A;  3PXT D;  2YNN A;  5IGQ A;  1Q47 A;  4O1Q D;  1GOT B;  3DXM C;  4JXM A;  5FKS A;  3UR4 A;  3I7N A;  4L1Q D;  4EWR A;  5K19 A;  1A0R B;  3N0D A;  2OVR B;  3NVX A;  3SFZ A;  1S4U X;  4J0W A;  3EI1 A;  3EI4 B;  2P9K C;  2HJB A;  5EAR A;  2O9K A;  2IUQ A;  4JT6 C;  3IIW A;  4N14 A;  3KRX B;  5FKT A;  4A2M A;  2BCJ B;  2H3X A;  3MKS B;  2QC5 A;  2BBK H;  3VGZ A;  4A11 B;  2G99 A;  2XU7 A;  3F3P A;  5KDO B;  4A11 A;  4Y5R D;  3K27 A;  1OMW B;  5HE1 B;  5K1C C;  3PVW B;  3V5W B;  4QL1 A;  4CZY A;  3EI1 B;  1NEX B;  3SVW D;  3BG0 A;  5IJ8 E;  3J80 g;  4CI2 A;  2IWF A;  2P9N C;  1MG2 A;  4YVD A;  4AEZ A;  3SN6 B;  1P22 A;  3AFC A;  3I7P A;  2PM7 B;  3MMY A;  2GC4 A;  4A2L A;  5A2Q g;  4CC9 A;  4KFM B;  3ZWL B;  3I7O A;  3L4O D;  4J8G A;  2J57 G;  5TEE A;  3I7H A;  4FA9 D;  2Q7Q A;  2YBA A;  2EBS A;  4ZOZ A;  5H14 A;  4FA5 D;  5CYK B;  4NSX A;  3C9C A;  4BL0 A;  4CY3 A;  5CXB B;  2P9P C;  4A0B A;  4IA9 A;  4Z8L A;  3UVN A;  4GZ8 A;  3UVM A;  2H6K A;  1PBY B;  4JSX C;  5C2W B;  3U4Y A;  5TEF A;  3AH8 B;  4J0X A;  4CZX A;  1MG3 A;  3J81 g;  4FWW A;  3N0E A;  1SHY B;  2OVQ B;  2CN2 A;  4E5Z A;  1XIP A;  3MKQ A;  4D0K A;  4L3G D;  3ODT A;  2QXV A;  5GMK n;  2GC7 A;  2CO0 C;  3C99 A;  4GQ1 A;  5AJA A;  4LGN A;  3IJ0 A;  4GM9 A;  5FA5 B;  1SQ9 A;  3F3G A;  1L0Q A;  4X3E A;  5FKR A;  3SMR A;  5JWZ A;  3DSM A;  4A08 A;  1NR0 A;  2PM6 B;  2H68 A;  2AGL A;  5EAL A;  4XEI C;  2OK6 A;  2HKM A;  4ESG A;  1SQJ A;  3UVO A;  4UI9 R;  5EM2 B;  3AL8 B;  4A0A B;  2B5M A;  4ERY A;  3JZN A;  5TDH B;  1PEV A;  3UVL A;  4JSV C;  3RFG A;  2AQ5 A;  4GGA A;  2XL2 A;  3B7F A;  5THA A;  4H5I A;  3PVU B;  1N6D A;  4XYI A;  4L3H D;  5TF2 A;  3EI3 A;  5IGO A;  5C9Z B;  4GMB A;  2GNQ A;  5HE0 B;  2P9I C;  3PSL A;  2IUP A;  4A09 B;  3RSE C;  2H9L A;  3MXX A;  3E0C A;  2I0T A;  3SJL D;  4ERQ A;  5B4W A;  3I2N A;  2HYE A;  1FWX A;  4A7J A;  2OJY A;  3OKY B;  2H6Q A;  4O45 A;  3SHF A;  2AGX A;  3SBR A;  4IMM A;  3EI2 B;  5SXM A;  3PSC B;  5HE2 B;  2OIZ A;  3IKO A;  1B9Y A;  2H14 A;  3RRM C;  3UVK A;  4CI8 A;  5AFU 3;  3OL2 A;  4OZU A;  5IT9 g;  4PXW A;  4X61 B;  3IIY A;  4J77 A;  4LG9 A;  3IJ1 A;  3I7K A;  3I89 A;  3F3F A;  3I7L A;  5I5J A;  5I5M A;  3EU7 A;  4ZOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...