4J82A

Crystal structure of beta'-cop/insig-2 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
b'KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 90
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j82A01
2H68A 4ES0A 4L3HD 5HE0B 5EMLB 3PXWD 5FKSA 2B5NA 3RSEC 1SQJA 2P9KC 4GZ8A 5SXMA 5K19A 5EARA 2J55H 4G56B 3OKWA 1TBGA 5TDHB 5EMJB 1VYHC 4HDJA 4L1QD 3SBQA 4E5ZA 2H6KA 3EI1A 2XL3A 3UKRC 5K1CC 1K32A 4QT8A 4J0XA 3CFSB 3OTTA 2UZYB 4Y5RD 3MXXA 5IJ7E 3SWSD 5FKQA 2AGWA 3IKOA 4U7AA 3SBPA 2QC5A 3RMZD 5H14A 5HE2B 5CXCB 4ZOZA 3SHFA 5EAPA 2I3SA 2OK6A 5C2VB 4J77A 2O9KA 2HJ4A 5GSAA 2HKRA 2P9SC 5IC7A 3OW8A 2TRCB 4JSPC 3BG1A 3MMYA 1U4CA 4ERZA 2OVQB 2H3XA 5GXHA 3RN1D 3OL2A 3RN0D 2XL2A 3EMHA 5THAA 2Z2PA 3I8CA 3RFHA 2CE8A 3SFZA 4GM9A 2H13A 3PSCB 4A09B 5EM2B 1PGUA 3N0DA 2W18A 3SJLD 4CI8A 1TYQC 4L9OA 3FM0A 2YNNA 4J78A 3F3GA 4PBYA 3EI2A 4PSWB 2P9LC 2CO0C 2YB8B 5B4WA 3EI4B 1N6EA 1MG3A 2YNPA 4J86A 5FKTA 5HYNB 4MK0B 2PM7B 2AGXA 3FGBA 4ERYA 4FA1D 1P22A 3I7PA 3PVUB 2HKMA 2I0TA 2UZXB 4JSXC 4A11B 4ESGA 3C99A 3AL8A 5I5IA 4PXWA 2YMUA 3I7HA 4CZXA 4YVDA 3MKSB 3W15A 3I7OA 1QNIA 4X63B 5EMKB 5GXIA 5JWZA 4JT5C 4CZYA 2H9NA 2AH0A 2H6QA 2HESX 4AOWA 3RRMC 1NR0A 4JSNC 3OKYA 2AGZA 2Z2NA 3C75H 5FLXg 5CYKA 4A7JA 3K27A 1XHMA 2B4EA 5FXYA 3AH8B 5TF2A 2H9MA 5CXBA 3B7FA 4U1EI 3P4FA 4FA5D 5EMMB 4IA9A 3J80g 4Z8LA 4A08B 1JJUB 4BUJC 4ZOVA 4A2LA 4K3ID 3V7DB 4FA4D 3I2NA 1OLZA 2PM9B 2P9UC 4LGNA 1RI6A 3ODTA 3SXTD 2G9AA 4ZN4A 3UVNA 3SBRA 5I5JA 1MDAH 3N0EA 3V9FA 2IUPA 4X61B 3JROA 4A0BB 4FB1D 3PE7A 3OKTA 2AH1A 3EI3A 3IIYA 4O1QD 2QXVA 5EALA 3MZKA 5EM2A 3EWEA 1JMXB 4GQ1A 4EWRA 4XEIC 3ZWLB 4CY2A 4OZUA 1U2VC 4JD2C 3K26A 3L4MD 3SN6B 2IAAA 1GG2B 1A0RB 3EI4A 3SMRA 2BCJB 4Y7RA 2CN3A 3VGZA 2CNXA 3AL9A 4H5JA 4IMMA 4E5ZB 4GGAA 3EI1B 4J79A 3UVKA 3VA6A 5C2WB 4GQBB 4CC9A 3UR4A 4ZOYA 4GM3A 4E54A 2GC7A 2IUVA 5FQDA 3JRPA 3I8EA 3PVWB 4D0KA 3NVNA 4OWRA 4O9DA 1Q47A 5H17A 3UVOA 2IUQA 5IGQA 2AGYA 3DSMA 3CIKB 5I5MA 4O3TB 3UKUC 4GM8A 2H9PA 4JXMA 2P9IC 4GQ2P 3PXSD 5IT9g 2OVRB 4FAND 1L0QA 4QL1A 3OL2B 2H9LA 3FRXA 2YNOA 3I89A 4J87A 1S4UX 3C9CA 1ERJA 2PM6B 4LG9A 2IWFA 5TEEA 4CY1A 2AGLA 1PBYB 4J84A 4J0WA 3SVWD 3CFVA 4TZ4A 3DXKC 3KRWB 4J8BA 3EI2B 3F3FA 3GREA 1XIPA 1OMWB 4L3GD 4AEZA 4CI1A 2AQ5A 3F3PA 3JPXA 2HXCA 3MKQA 3IJCA 2CE9A 3I7KA 3EG6A 3I7LA 1SQ9A 5CXCA 1YFQA 1B9XA 4H5IA 4A0AB 4CI3A 4QRJA 4J81A 2IWKA 2OVPB 4D6VA 3ORVD 4O3UB 5A2Qg 2XYIA 1FWXA 3AL8B 1GP2B 3L4OD 3IJ1A 4GGCA 5AMSA 4CI2A 4GGDA 4J82A 1GXRA 3I7NA 1NEXB 3IIWA 3DWLC 4FHLA 3MZLA 4J8GA 4JSVC 2XU7A 2GNQA 3UVMA 3C5MA 1K8KC 2G99A 2IURA 4CY3A 4A09A 3J81g 2OK4A 1MG2A 4CZVA 2OIZA 2HYEA 3OKYB 5AFU3 5FKRA 2B5LA 5CYKB 4J73A 3JZNA 3U4YA 1N6FA 5HE3B 5HE1B 3ULEC 4PC0A 4XYHA 5IJ8E 2CO0A 5CXBB 3E0CA 2H6NA 2I3TA 4PSXB 5FA5B 4ERQA 4PNKB 3JAMg 4K3JB 2P9NC 4KFMB 3JB9L 4QQEA 2H47A 4GMBA 4A11A 4I79A 4R7AB 2B5MA 1B9YA 1XKSA 5GMKn 5H1MA 4X3EA 3EI3B 3BG0A 4ZOXA 3EU7A 3V5WB 1JMZB 3AFCA 2Q7QA 1JOFA 4A2MA 2J56H 3GFCA 4FAVD 2MTAH 2Z2OA 3IJ0A 3NVQA 5AJAA 2BBKH 3DXMC 4NSXA 4PBZA 2CN2A 2YBAA 5C9ZB 4BH6A 4CY5A 3JZHA 1R5MA 4X60B 3SLED 2J57G 4A08A 2P9PC 4A0AA 2H14A 4LG8A 1PI6A 2PBIB 2PM9A 3A0FA 4O45A 3BWSA 4E54B 3RLMD 4BL0A 4UI9R 4XYIA 5EAMA 2EBSA 2HJBA 2I0SA 1N6DA 3DM0A 4A0BA 1GOTB 3RFGA 3KRXB 2GC4A 3JZGA 5HQGA 5IGOA 1PEVA 3PSLA 4JT6C 3HFQA 3SCYA 3UVLA 2OJYA 4FA9D 1SHYB 2I0RA 3PXTD 5TEFA 5KDOB 3NVXA 4N14A 3VH0A 4FWWA
chains in the Genus database with same CATH superfamily
2H68A 4ES0A 4L3HD 5HE0B 3KCIA 5EMLB 3PXWD 5FKSA 2B5NA 3RSEC 1SQJA 3V4PA 2EIEA 2P9KC 3K71A 4GZ8A 5SXMA 5K19A 5EARA 2J55H 4G56B 3OKWA 1TBGA 5TDHB 5EMJB 1VYHC 4HDJA 4L1QD 3SBQA 3T3PA 1TYEA 4E5ZA 2H6KA 3EI1A 2XL3A 1U8CA 3UKRC 5K1CC 1K32A 4QT8A 4J0XA 3CFSB 3OTTA 2UZYB 4Y5RD 3MXXA 5C92A 5IJ7E 3SWSD 5FKQA 2VDQA 2AGWA 2QZPA 3IKOA 4U7AA 3SBPA 2QC5A 3RMZD 5H14A 3QI0A 5HE2B 5CXCB 4ZOZA 3SHFA 3MUNA 3ZE0A 5EAPA 2I3SA 3VI3A 2OK6A 5C2VB 1UTCA 4RE6A 4J77A 2O9KA 1O6FA 2HJ4A 5GSAA 2HKRA 2P9SC 5IC7A 4AMYA 3OW8A 2TRCB 4JSPC 3BG1A 3MMYA 1U4CA 4ERZA 2OVQB 2H3XA 5GXHA 3RN1D 3OL2A 3RN0D 2XL2A 3EMHA 5THAA 2Z2PA 3O4IA 3I8CA 3RFHA 2CE8A 3SFZA 3IVMA 4GM9A 2H13A 3PSCB 4A09B 2VZ1A 5EM2B 1JTDB 2VDKA 1PGUA 3N0DA 2W18A 3SJLD 4CI8A 4Z7OA 1TYQC 4L9OA 3FM0A 2YNNA 3NIFA 4J78A 3F3GA 4PBYA 3EI2A 4PSWB 2P9LC 2CO0C 2YB8B 5B4WA 3EI4B 1N6EA 3K6SA 5HDBA 1MG3A 2BKLA 2YNPA 4J86A 5FKTA 5HYNB 4MK0B 2PM7B 2AGXA 3FGBA 4ERYA 4FA1D 1P22A 3I7PA 3PVUB 4L1MA 2HKMA 2I0TA 2UZXB 4JSXC 4A11B 4ESGA 3C99A 3AL8A 5I5IA 4PXWA 2YMUA 3I7HA 4CZXA 3NIGA 4YVDA 3MKSB 4G1MA 3T3MA 3DDUA 3W15A 3I7OA 2HU5A 1QNIA 4X63B 5EMKB 5GXIA 5JWZA 4JT5C 4CZYA 2H9NA 2AH0A 2HU8A 2H6QA 2QR5A 2HESX 4AOWA 3NIDA 3RRMC 1NR0A 3OKYA 4JSNC 2AGZA 1E8NA 2VDPA 2Z2NA 3C75H 4MMXA 4WK0A 3ZDXA 5FLXg 2EIBA 5CYKA 4A7JA 3K27A 1XHMA 4NC4A 4DNUA 2B4EA 4NBMA 5M5UA 4MMZA 5FXYA 3IUJA 3AH8B 5TF2A 2H9MA 5CXBA 3B7FA 4NAAA 4U1EI 3P4FA 4FA5D 5EMMB 4IA9A 3J80g 4Z8LA 4A08B 1JJUB 4BUJC 4UM9A 4ZOVA 4A2LA 4K3ID 3V7DB 4FA4D 4JHNA 2WQ8A 3I2NA 1OLZA 2PM9B 2P9UC 4UM8A 4QAMA 4LGNA 1RI6A 3ODTA 3SXTD 2G9AA 4ZN4A 3UVNA 3SBRA 1C9LA 5I5JA 1MDAH 4BCCA 3N0EA 3V9FA 2IUPA 4G55A 3JROA 4X61B 3ZDYA 4A0BB 4FB1D 3PE7A 3FCSA 3OKTA 2AH1A 3EI3A 3IIYA 4O1QD 2QXVA 5EALA 3MZKA 5EM2A 3EWEA 1JMXB 4GQ1A 3ZDZA 4XEIC 3ZWLB 4CY2A 4EWRA 4OZUA 1U2VC 3VI4A 4JD2C 3K26A 3L4MD 3SN6B 2IAAA 1GG2B 2EICA 2VDRA 1A0RB 4O02A 3EI4A 3O4HA 3SMRA 2BCJB 4Y7RA 5E6SA 3IUMA 2CN3A 3VGZA 2EIDA 2CNXA 3AL9A 4H5JA 4IMMA 4E5ZB 4GGAA 3EI1B 4D9SA 4J79A 3UVKA 3VA6A 5C2WB 4GQBB 4MMYA 5E6RA 4CC9A 3UR4A 4ZOYA 4GM3A 4E54A 1VE6A 2GC7A 5M5VA 2IUVA 5FQDA 1T2XA 3JRPA 3I8EA 4AMZA 2HU7A 3PVWB 4D0KA 3NVNA 3EQ9A 1E8MA 4OWRA 4O9DA 1Q47A 5H17A 3UVOA 2IUQA 5IGQA 2AGYA 3DSMA 3CIKB 5I5MA 4O3TB 3UKUC 1GOHA 4GM8A 2H9PA 4JXMA 2P9IC 4GQ2P 3PXSD 1UOOA 3MUOA 5C86A 5IT9g 2OVRB 4FAND 5M61A 1L0QA 4QL1A 3OL2B 2H9LA 3FRXA 2YNOA 3I89A 3ZE2A 5M5TA 4J87A 1S4UX 3C9CA 1ERJA 2PM6B 4LG9A 2VDLA 2IWFA 5TEEA 4AX4A 4CY1A 2AGLA 1PBYB 4J84A 4J0WA 1E5TA 3SVWD 3CFVA 3IUNA 4TZ4A 4Z7NA 2XE4A 1VE7A 3DXKC 3KRWB 4J8BA 1QFMA 3EI2B 3F3FA 3GREA 1XIPA 1OMWB 4L3GD 4AEZA 4CI1A 2AQ5A 3F3PA 3JPXA 2HXCA 3MKQA 3IJCA 2CE9A 3I7KA 3EG6A 3I7LA 1SQ9A 5CXCA 1YFQA 1B9XA 4H5IA 4A0AB 4CI3A 4QRJA 4J81A 5M5SA 2IWKA 1C9IA 1UOPA 2VDOA 1UOQA 2OVPB 4D6VA 3ORVD 4O3UB 2VC2A 5A2Qg 2XYIA 1FWXA 4BCBA 3AL8B 1GP2B 3L4OD 3IJ1A 2VDMA 4GGCA 4BP9A 5AMSA 1YR2A 4AN1A 4CI2A 4GGDA 1GOGA 4J82A 1GXRA 1QFSA 1GOFA 1NEXB 3IIWA 3I7NA 3DWLC 4FHLA 3MZLA 4J8GA 4JSVC 2XU7A 5E6UA 2GNQA 3UVMA 3IUQA 4NENA 3IURA 3C5MA 1K8KC 2G99A 2IURA 4CY3A 4A09A 3J81g 2OK4A 1MG2A 4BP8A 4CZVA 2OIZA 2HYEA 3OKYB 3O4GA 1H2ZA 4WJKA 5FKRA 5AFU3 2B5LA 5CYKB 4J73A 3JZNA 3U4YA 1N6FA 5HE3B 5HE1B 3ULEC 2VZ3A 4DNWA 4PC0A 1O6GA 4XYHA 5IJ8E 2CO0A 5CXBB 3E0CA 1BPOA 2H6NA 2VDNA 2I3TA 4PSXB 5FA5B 4ERQA 4PNKB 3EQ7A 3JAMg 4IRZA 4K3JB 4AN0A 2P9NC 3O4JA 4KFMB 4QQEA 2H47A 4GMBA 4WK4A 3ZE1A 3JB9L 2JKXA 4A11A 5M5RA 4I79A 4G1EA 1H2WA 4R7AB 5FFOA 2B5MA 1B9YA 1XKSA 3V4VA 1A12A 3IULA 5FFGA 5GMKn 5H1MA 1K3IA 4X3EA 4DNVA 4BCDA 3EI3B 3BG0A 3GD1I 4ZOXA 3EU7A 3V5WB 1JMZB 4WK2A 3AFCA 2Q7QA 1JOFA 4A2MA 2J56H 3GFCA 4FAVD 1I2MB 2MTAH 2XDWA 2Z2OA 3IJ0A 4JHPC 3NVQA 3EQ8A 5AJAA 3MVDK 2BBKH 3DXMC 4NSXA 4PBZA 2CN2A 2YBAA 5C9ZB 3QHYB 4BH6A 4CY5A 3JZHA 1R5MA 1VZ3A 3OF7A 4X60B 3SLED 3FCUA 2J57G 4A08A 4Z7QA 1M1XA 1JV2A 1L5GA 2P9PC 4A0AA 2H14A 2XZGA 4LG8A 1PI6A 2PBIB 4O2WA 2PM9A 3A0FA 3GC3B 4O45A 3BWSA 4E54B 3RLMD 1H2YA 4BL0A 4UI9R 4XYIA 5EAMA 2EBSA 3K72A 2HJBA 2I0SA 1N6DA 1VZ2A 3DM0A 3IJEA 4A0BA 1GOTB 3RFGA 3KRXB 2GC4A 3JZGA 5HQGA 5IGOA 1PEVA 3PSLA 4JT6C 3HFQA 3SCYA 3UVLA 4FWWA 2OJYA 4FA9D 1SHYB 4RE5A 2I0RA 3PXTD 5TEFA 5KDOB 3NVXA 4N14A 3VH0A 1H2XA
chains in the Genus database with same CATH topology
2H68A 4ES0A 4L3HD 5HE0B 5EMLB 3PXWD 5FKSA 2B5NA 3RSEC 1SQJA 2P9KC 4GZ8A 5SXMA 5K19A 5EARA 2J55H 4G56B 3OKWA 1TBGA 5TDHB 5EMJB 1VYHC 4HDJA 4L1QD 3SBQA 4E5ZA 2H6KA 3EI1A 2XL3A 3UKRC 5K1CC 1K32A 4QT8A 4J0XA 3CFSB 3OTTA 2UZYB 4Y5RD 3MXXA 5IJ7E 3SWSD 5FKQA 2AGWA 3IKOA 4U7AA 3SBPA 2QC5A 3RMZD 5H14A 5HE2B 5CXCB 4ZOZA 3SHFA 5EAPA 2I3SA 2OK6A 5C2VB 4J77A 2O9KA 2HJ4A 5GSAA 2HKRA 2P9SC 5IC7A 3OW8A 2TRCB 4JSPC 3BG1A 3MMYA 1U4CA 4ERZA 2OVQB 2H3XA 5GXHA 3RN1D 3OL2A 3RN0D 2XL2A 3EMHA 5THAA 2Z2PA 3I8CA 3RFHA 2CE8A 3SFZA 4GM9A 2H13A 3PSCB 4A09B 5EM2B 1PGUA 3N0DA 2W18A 3SJLD 4CI8A 1TYQC 4L9OA 3FM0A 2YNNA 4J78A 3F3GA 4PBYA 3EI2A 4PSWB 2P9LC 2CO0C 2YB8B 5B4WA 3EI4B 1N6EA 1MG3A 2YNPA 4J86A 5FKTA 5HYNB 4MK0B 2PM7B 2AGXA 3FGBA 4ERYA 4FA1D 1P22A 3I7PA 3PVUB 2HKMA 2I0TA 2UZXB 4JSXC 4A11B 4ESGA 3C99A 3AL8A 5I5IA 4PXWA 2YMUA 3I7HA 4CZXA 4YVDA 3MKSB 3W15A 3I7OA 1QNIA 4X63B 5EMKB 5GXIA 5JWZA 4JT5C 4CZYA 2H9NA 2AH0A 2H6QA 2HESX 4AOWA 3RRMC 1NR0A 4JSNC 3OKYA 2AGZA 2Z2NA 3C75H 5FLXg 5CYKA 4A7JA 3K27A 1XHMA 2B4EA 5FXYA 3AH8B 5TF2A 2H9MA 5CXBA 3B7FA 4U1EI 3P4FA 4FA5D 5EMMB 4IA9A 3J80g 4Z8LA 4A08B 1JJUB 4BUJC 4ZOVA 4A2LA 4K3ID 3V7DB 4FA4D 3I2NA 1OLZA 2PM9B 2P9UC 4LGNA 1RI6A 3ODTA 3SXTD 2G9AA 4ZN4A 3UVNA 3SBRA 5I5JA 1MDAH 3N0EA 3V9FA 2IUPA 4X61B 3JROA 4A0BB 4FB1D 3PE7A 3OKTA 2AH1A 3EI3A 3IIYA 4O1QD 2QXVA 5EALA 3MZKA 5EM2A 3EWEA 1JMXB 4GQ1A 4EWRA 4XEIC 3ZWLB 4CY2A 4OZUA 1U2VC 4JD2C 3K26A 3L4MD 3SN6B 2IAAA 1GG2B 1A0RB 3EI4A 3SMRA 2BCJB 4Y7RA 2CN3A 3VGZA 2CNXA 3AL9A 4H5JA 4IMMA 4E5ZB 4GGAA 3EI1B 4J79A 3UVKA 3VA6A 5C2WB 4GQBB 4CC9A 3UR4A 4ZOYA 4GM3A 4E54A 2GC7A 2IUVA 5FQDA 3JRPA 3I8EA 3PVWB 4D0KA 3NVNA 4OWRA 4O9DA 1Q47A 5H17A 3UVOA 2IUQA 5IGQA 2AGYA 3DSMA 3CIKB 5I5MA 4O3TB 3UKUC 4GM8A 2H9PA 4JXMA 2P9IC 4GQ2P 3PXSD 5IT9g 2OVRB 4FAND 1L0QA 4QL1A 3OL2B 2H9LA 3FRXA 2YNOA 3I89A 4J87A 1S4UX 3C9CA 1ERJA 2PM6B 4LG9A 2IWFA 5TEEA 4CY1A 2AGLA 1PBYB 4J84A 4J0WA 3SVWD 3CFVA 4TZ4A 3DXKC 3KRWB 4J8BA 3EI2B 3F3FA 3GREA 1XIPA 1OMWB 4L3GD 4AEZA 4CI1A 2AQ5A 3F3PA 3JPXA 2HXCA 3MKQA 3IJCA 2CE9A 3I7KA 3EG6A 3I7LA 1SQ9A 5CXCA 1YFQA 1B9XA 4H5IA 4A0AB 4CI3A 4QRJA 4J81A 2IWKA 2OVPB 4D6VA 3ORVD 4O3UB 5A2Qg 2XYIA 1FWXA 3AL8B 1GP2B 3L4OD 3IJ1A 4GGCA 5AMSA 4CI2A 4GGDA 4J82A 1GXRA 3I7NA 1NEXB 3IIWA 3DWLC 4FHLA 3MZLA 4J8GA 4JSVC 2XU7A 2GNQA 3UVMA 3C5MA 1K8KC 2G99A 2IURA 4CY3A 4A09A 3J81g 2OK4A 1MG2A 4CZVA 2OIZA 2HYEA 3OKYB 5AFU3 5FKRA 2B5LA 5CYKB 4J73A 3JZNA 3U4YA 1N6FA 5HE3B 5HE1B 3ULEC 4PC0A 4XYHA 5IJ8E 2CO0A 5CXBB 3E0CA 2H6NA 2I3TA 4PSXB 5FA5B 4ERQA 4PNKB 3JAMg 4K3JB 2P9NC 4KFMB 3JB9L 4QQEA 2H47A 4GMBA 4A11A 4I79A 4R7AB 2B5MA 1B9YA 1XKSA 5GMKn 5H1MA 4X3EA 3EI3B 3BG0A 4ZOXA 3EU7A 3V5WB 1JMZB 3AFCA 2Q7QA 1JOFA 4A2MA 2J56H 3GFCA 4FAVD 2MTAH 2Z2OA 3IJ0A 3NVQA 5AJAA 2BBKH 3DXMC 4NSXA 4PBZA 2CN2A 2YBAA 5C9ZB 4BH6A 4CY5A 3JZHA 1R5MA 4X60B 3SLED 2J57G 4A08A 2P9PC 4A0AA 2H14A 4LG8A 1PI6A 2PBIB 2PM9A 3A0FA 4O45A 3BWSA 4E54B 3RLMD 4BL0A 4UI9R 4XYIA 5EAMA 2EBSA 2HJBA 2I0SA 1N6DA 3DM0A 4A0BA 1GOTB 3RFGA 3KRXB 2GC4A 3JZGA 5HQGA 5IGOA 1PEVA 3PSLA 4JT6C 3HFQA 3SCYA 3UVLA 2OJYA 4FA9D 1SHYB 2I0RA 3PXTD 5TEFA 5KDOB 3NVXA 4N14A 3VH0A 4FWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H68 A;  4ES0 A;  4L3H D;  5HE0 B;  5EML B;  3PXW D;  5FKS A;  2B5N A;  3RSE C;  1SQJ A;  2P9K C;  4GZ8 A;  5SXM A;  5K19 A;  5EAR A;  2J55 H;  4G56 B;  3OKW A;  1TBG A;  5TDH B;  5EMJ B;  1VYH C;  4HDJ A;  4L1Q D;  3SBQ A;  4E5Z A;  2H6K A;  3EI1 A;  2XL3 A;  3UKR C;  5K1C C;  1K32 A;  4QT8 A;  4J0X A;  3CFS B;  3OTT A;  2UZY B;  4Y5R D;  3MXX A;  5IJ7 E;  3SWS D;  5FKQ A;  2AGW A;  3IKO A;  4U7A A;  3SBP A;  2QC5 A;  3RMZ D;  5H14 A;  5HE2 B;  5CXC B;  4ZOZ A;  3SHF A;  5EAP A;  2I3S A;  2OK6 A;  5C2V B;  4J77 A;  2O9K A;  2HJ4 A;  5GSA A;  2HKR A;  2P9S C;  5IC7 A;  3OW8 A;  2TRC B;  4JSP C;  3BG1 A;  3MMY A;  1U4C A;  4ERZ A;  2OVQ B;  2H3X A;  5GXH A;  3RN1 D;  3OL2 A;  3RN0 D;  2XL2 A;  3EMH A;  5THA A;  2Z2P A;  3I8C A;  3RFH A;  2CE8 A;  3SFZ A;  4GM9 A;  2H13 A;  3PSC B;  4A09 B;  5EM2 B;  1PGU A;  3N0D A;  2W18 A;  3SJL D;  4CI8 A;  1TYQ C;  4L9O A;  3FM0 A;  2YNN A;  4J78 A;  3F3G A;  4PBY A;  3EI2 A;  4PSW B;  2P9L C;  2CO0 C;  2YB8 B;  5B4W A;  3EI4 B;  1N6E A;  1MG3 A;  2YNP A;  4J86 A;  5FKT A;  5HYN B;  4MK0 B;  2PM7 B;  2AGX A;  3FGB A;  4ERY A;  4FA1 D;  1P22 A;  3I7P A;  3PVU B;  2HKM A;  2I0T A;  2UZX B;  4JSX C;  4A11 B;  4ESG A;  3C99 A;  3AL8 A;  5I5I A;  4PXW A;  2YMU A;  3I7H A;  4CZX A;  4YVD A;  3MKS B;  3W15 A;  3I7O A;  1QNI A;  4X63 B;  5EMK B;  5GXI A;  5JWZ A;  4JT5 C;  4CZY A;  2H9N A;  2AH0 A;  2H6Q A;  2HES X;  4AOW A;  3RRM C;  1NR0 A;  4JSN C;  3OKY A;  2AGZ A;  2Z2N A;  3C75 H;  5FLX g;  5CYK A;  4A7J A;  3K27 A;  1XHM A;  2B4E A;  5FXY A;  3AH8 B;  5TF2 A;  2H9M A;  5CXB A;  3B7F A;  4U1E I;  3P4F A;  4FA5 D;  5EMM B;  4IA9 A;  3J80 g;  4Z8L A;  4A08 B;  1JJU B;  4BUJ C;  4ZOV A;  4A2L A;  4K3I D;  3V7D B;  4FA4 D;  3I2N A;  1OLZ A;  2PM9 B;  2P9U C;  4LGN A;  1RI6 A;  3ODT A;  3SXT D;  2G9A A;  4ZN4 A;  3UVN A;  3SBR A;  5I5J A;  1MDA H;  3N0E A;  3V9F A;  2IUP A;  4X61 B;  3JRO A;  4A0B B;  4FB1 D;  3PE7 A;  3OKT A;  2AH1 A;  3EI3 A;  3IIY A;  4O1Q D;  2QXV A;  5EAL A;  3MZK A;  5EM2 A;  3EWE A;  1JMX B;  4GQ1 A;  4EWR A;  4XEI C;  3ZWL B;  4CY2 A;  4OZU A;  1U2V C;  4JD2 C;  3K26 A;  3L4M D;  3SN6 B;  2IAA A;  1GG2 B;  1A0R B;  3EI4 A;  3SMR A;  2BCJ B;  4Y7R A;  2CN3 A;  3VGZ A;  2CNX A;  3AL9 A;  4H5J A;  4IMM A;  4E5Z B;  4GGA A;  3EI1 B;  4J79 A;  3UVK A;  3VA6 A;  5C2W B;  4GQB B;  4CC9 A;  3UR4 A;  4ZOY A;  4GM3 A;  4E54 A;  2GC7 A;  2IUV A;  5FQD A;  3JRP A;  3I8E A;  3PVW B;  4D0K A;  3NVN A;  4OWR A;  4O9D A;  1Q47 A;  5H17 A;  3UVO A;  2IUQ A;  5IGQ A;  2AGY A;  3DSM A;  3CIK B;  5I5M A;  4O3T B;  3UKU C;  4GM8 A;  2H9P A;  4JXM A;  2P9I C;  4GQ2 P;  3PXS D;  5IT9 g;  2OVR B;  4FAN D;  1L0Q A;  4QL1 A;  3OL2 B;  2H9L A;  3FRX A;  2YNO A;  3I89 A;  4J87 A;  1S4U X;  3C9C A;  1ERJ A;  2PM6 B;  4LG9 A;  2IWF A;  5TEE A;  4CY1 A;  2AGL A;  1PBY B;  4J84 A;  4J0W A;  3SVW D;  3CFV A;  4TZ4 A;  3DXK C;  3KRW B;  4J8B A;  3EI2 B;  3F3F A;  3GRE A;  1XIP A;  1OMW B;  4L3G D;  4AEZ A;  4CI1 A;  2AQ5 A;  3F3P A;  3JPX A;  2HXC A;  3MKQ A;  3IJC A;  2CE9 A;  3I7K A;  3EG6 A;  3I7L A;  1SQ9 A;  5CXC A;  1YFQ A;  1B9X A;  4H5I A;  4A0A B;  4CI3 A;  4QRJ A;  4J81 A;  2IWK A;  2OVP B;  4D6V A;  3ORV D;  4O3U B;  5A2Q g;  2XYI A;  1FWX A;  3AL8 B;  1GP2 B;  3L4O D;  3IJ1 A;  4GGC A;  5AMS A;  4CI2 A;  4GGD A;  4J82 A;  1GXR A;  3I7N A;  1NEX B;  3IIW A;  3DWL C;  4FHL A;  3MZL A;  4J8G A;  4JSV C;  2XU7 A;  2GNQ A;  3UVM A;  3C5M A;  1K8K C;  2G99 A;  2IUR A;  4CY3 A;  4A09 A;  3J81 g;  2OK4 A;  1MG2 A;  4CZV A;  2OIZ A;  2HYE A;  3OKY B;  5AFU 3;  5FKR A;  2B5L A;  5CYK B;  4J73 A;  3JZN A;  3U4Y A;  1N6F A;  5HE3 B;  5HE1 B;  3ULE C;  4PC0 A;  4XYH A;  5IJ8 E;  2CO0 A;  5CXB B;  3E0C A;  2H6N A;  2I3T A;  4PSX B;  5FA5 B;  4ERQ A;  4PNK B;  3JAM g;  4K3J B;  2P9N C;  4KFM B;  3JB9 L;  4QQE A;  2H47 A;  4GMB A;  4A11 A;  4I79 A;  4R7A B;  2B5M A;  1B9Y A;  1XKS A;  5GMK n;  5H1M A;  4X3E A;  3EI3 B;  3BG0 A;  4ZOX A;  3EU7 A;  3V5W B;  1JMZ B;  3AFC A;  2Q7Q A;  1JOF A;  4A2M A;  2J56 H;  3GFC A;  4FAV D;  2MTA H;  2Z2O A;  3IJ0 A;  3NVQ A;  5AJA A;  2BBK H;  3DXM C;  4NSX A;  4PBZ A;  2CN2 A;  2YBA A;  5C9Z B;  4BH6 A;  4CY5 A;  3JZH A;  1R5M A;  4X60 B;  3SLE D;  2J57 G;  4A08 A;  2P9P C;  4A0A A;  2H14 A;  4LG8 A;  1PI6 A;  2PBI B;  2PM9 A;  3A0F A;  4O45 A;  3BWS A;  4E54 B;  3RLM D;  4BL0 A;  4UI9 R;  4XYI A;  5EAM A;  2EBS A;  2HJB A;  2I0S A;  1N6D A;  3DM0 A;  4A0B A;  1GOT B;  3RFG A;  3KRX B;  2GC4 A;  3JZG A;  5HQG A;  5IGO A;  1PEV A;  3PSL A;  4JT6 C;  3HFQ A;  3SCY A;  3UVL A;  2OJY A;  4FA9 D;  1SHY B;  2I0R A;  3PXT D;  5TEF A;  5KDO B;  3NVX A;  4N14 A;  3VH0 A;  4FWW A; 
#chains in the Genus database with same CATH topology
 2H68 A;  4ES0 A;  4L3H D;  5HE0 B;  3KCI A;  5EML B;  3PXW D;  5FKS A;  2B5N A;  3RSE C;  1SQJ A;  3V4P A;  2EIE A;  2P9K C;  3K71 A;  4GZ8 A;  5SXM A;  5K19 A;  5EAR A;  2J55 H;  4G56 B;  3OKW A;  1TBG A;  5TDH B;  5EMJ B;  1VYH C;  4HDJ A;  4L1Q D;  3SBQ A;  3T3P A;  1TYE A;  4E5Z A;  2H6K A;  3EI1 A;  2XL3 A;  1U8C A;  3UKR C;  5K1C C;  1K32 A;  4QT8 A;  4J0X A;  3CFS B;  3OTT A;  2UZY B;  4Y5R D;  3MXX A;  5C92 A;  5IJ7 E;  3SWS D;  5FKQ A;  2VDQ A;  2AGW A;  2QZP A;  3IKO A;  4U7A A;  3SBP A;  2QC5 A;  3RMZ D;  5H14 A;  3QI0 A;  5HE2 B;  5CXC B;  4ZOZ A;  3SHF A;  3MUN A;  3ZE0 A;  5EAP A;  2I3S A;  3VI3 A;  2OK6 A;  5C2V B;  1UTC A;  4RE6 A;  4J77 A;  2O9K A;  1O6F A;  2HJ4 A;  5GSA A;  2HKR A;  2P9S C;  5IC7 A;  4AMY A;  3OW8 A;  2TRC B;  4JSP C;  3BG1 A;  3MMY A;  1U4C A;  4ERZ A;  2OVQ B;  2H3X A;  5GXH A;  3RN1 D;  3OL2 A;  3RN0 D;  2XL2 A;  3EMH A;  5THA A;  2Z2P A;  3O4I A;  3I8C A;  3RFH A;  2CE8 A;  3SFZ A;  3IVM A;  4GM9 A;  2H13 A;  3PSC B;  4A09 B;  2VZ1 A;  5EM2 B;  1JTD B;  2VDK A;  1PGU A;  3N0D A;  2W18 A;  3SJL D;  4CI8 A;  4Z7O A;  1TYQ C;  4L9O A;  3FM0 A;  2YNN A;  3NIF A;  4J78 A;  3F3G A;  4PBY A;  3EI2 A;  4PSW B;  2P9L C;  2CO0 C;  2YB8 B;  5B4W A;  3EI4 B;  1N6E A;  3K6S A;  5HDB A;  1MG3 A;  2BKL A;  2YNP A;  4J86 A;  5FKT A;  5HYN B;  4MK0 B;  2PM7 B;  2AGX A;  3FGB A;  4ERY A;  4FA1 D;  1P22 A;  3I7P A;  3PVU B;  4L1M A;  2HKM A;  2I0T A;  2UZX B;  4JSX C;  4A11 B;  4ESG A;  3C99 A;  3AL8 A;  5I5I A;  4PXW A;  2YMU A;  3I7H A;  4CZX A;  3NIG A;  4YVD A;  3MKS B;  4G1M A;  3T3M A;  3DDU A;  3W15 A;  3I7O A;  2HU5 A;  1QNI A;  4X63 B;  5EMK B;  5GXI A;  5JWZ A;  4JT5 C;  4CZY A;  2H9N A;  2AH0 A;  2HU8 A;  2H6Q A;  2QR5 A;  2HES X;  4AOW A;  3NID A;  3RRM C;  1NR0 A;  3OKY A;  4JSN C;  2AGZ A;  1E8N A;  2VDP A;  2Z2N A;  3C75 H;  4MMX A;  4WK0 A;  3ZDX A;  5FLX g;  2EIB A;  5CYK A;  4A7J A;  3K27 A;  1XHM A;  4NC4 A;  4DNU A;  2B4E A;  4NBM A;  5M5U A;  4MMZ A;  5FXY A;  3IUJ A;  3AH8 B;  5TF2 A;  2H9M A;  5CXB A;  3B7F A;  4NAA A;  4U1E I;  3P4F A;  4FA5 D;  5EMM B;  4IA9 A;  3J80 g;  4Z8L A;  4A08 B;  1JJU B;  4BUJ C;  4UM9 A;  4ZOV A;  4A2L A;  4K3I D;  3V7D B;  4FA4 D;  4JHN A;  2WQ8 A;  3I2N A;  1OLZ A;  2PM9 B;  2P9U C;  4UM8 A;  4QAM A;  4LGN A;  1RI6 A;  3ODT A;  3SXT D;  2G9A A;  4ZN4 A;  3UVN A;  3SBR A;  1C9L A;  5I5J A;  1MDA H;  4BCC A;  3N0E A;  3V9F A;  2IUP A;  4G55 A;  3JRO A;  4X61 B;  3ZDY A;  4A0B B;  4FB1 D;  3PE7 A;  3FCS A;  3OKT A;  2AH1 A;  3EI3 A;  3IIY A;  4O1Q D;  2QXV A;  5EAL A;  3MZK A;  5EM2 A;  3EWE A;  1JMX B;  4GQ1 A;  3ZDZ A;  4XEI C;  3ZWL B;  4CY2 A;  4EWR A;  4OZU A;  1U2V C;  3VI4 A;  4JD2 C;  3K26 A;  3L4M D;  3SN6 B;  2IAA A;  1GG2 B;  2EIC A;  2VDR A;  1A0R B;  4O02 A;  3EI4 A;  3O4H A;  3SMR A;  2BCJ B;  4Y7R A;  5E6S A;  3IUM A;  2CN3 A;  3VGZ A;  2EID A;  2CNX A;  3AL9 A;  4H5J A;  4IMM A;  4E5Z B;  4GGA A;  3EI1 B;  4D9S A;  4J79 A;  3UVK A;  3VA6 A;  5C2W B;  4GQB B;  4MMY A;  5E6R A;  4CC9 A;  3UR4 A;  4ZOY A;  4GM3 A;  4E54 A;  1VE6 A;  2GC7 A;  5M5V A;  2IUV A;  5FQD A;  1T2X A;  3JRP A;  3I8E A;  4AMZ A;  2HU7 A;  3PVW B;  4D0K A;  3NVN A;  3EQ9 A;  1E8M A;  4OWR A;  4O9D A;  1Q47 A;  5H17 A;  3UVO A;  2IUQ A;  5IGQ A;  2AGY A;  3DSM A;  3CIK B;  5I5M A;  4O3T B;  3UKU C;  1GOH A;  4GM8 A;  2H9P A;  4JXM A;  2P9I C;  4GQ2 P;  3PXS D;  1UOO A;  3MUO A;  5C86 A;  5IT9 g;  2OVR B;  4FAN D;  5M61 A;  1L0Q A;  4QL1 A;  3OL2 B;  2H9L A;  3FRX A;  2YNO A;  3I89 A;  3ZE2 A;  5M5T A;  4J87 A;  1S4U X;  3C9C A;  1ERJ A;  2PM6 B;  4LG9 A;  2VDL A;  2IWF A;  5TEE A;  4AX4 A;  4CY1 A;  2AGL A;  1PBY B;  4J84 A;  4J0W A;  1E5T A;  3SVW D;  3CFV A;  3IUN A;  4TZ4 A;  4Z7N A;  2XE4 A;  1VE7 A;  3DXK C;  3KRW B;  4J8B A;  1QFM A;  3EI2 B;  3F3F A;  3GRE A;  1XIP A;  1OMW B;  4L3G D;  4AEZ A;  4CI1 A;  2AQ5 A;  3F3P A;  3JPX A;  2HXC A;  3MKQ A;  3IJC A;  2CE9 A;  3I7K A;  3EG6 A;  3I7L A;  1SQ9 A;  5CXC A;  1YFQ A;  1B9X A;  4H5I A;  4A0A B;  4CI3 A;  4QRJ A;  4J81 A;  5M5S A;  2IWK A;  1C9I A;  1UOP A;  2VDO A;  1UOQ A;  2OVP B;  4D6V A;  3ORV D;  4O3U B;  2VC2 A;  5A2Q g;  2XYI A;  1FWX A;  4BCB A;  3AL8 B;  1GP2 B;  3L4O D;  3IJ1 A;  2VDM A;  4GGC A;  4BP9 A;  5AMS A;  1YR2 A;  4AN1 A;  4CI2 A;  4GGD A;  1GOG A;  4J82 A;  1GXR A;  1QFS A;  1GOF A;  1NEX B;  3IIW A;  3I7N A;  3DWL C;  4FHL A;  3MZL A;  4J8G A;  4JSV C;  2XU7 A;  5E6U A;  2GNQ A;  3UVM A;  3IUQ A;  4NEN A;  3IUR A;  3C5M A;  1K8K C;  2G99 A;  2IUR A;  4CY3 A;  4A09 A;  3J81 g;  2OK4 A;  1MG2 A;  4BP8 A;  4CZV A;  2OIZ A;  2HYE A;  3OKY B;  3O4G A;  1H2Z A;  4WJK A;  5FKR A;  5AFU 3;  2B5L A;  5CYK B;  4J73 A;  3JZN A;  3U4Y A;  1N6F A;  5HE3 B;  5HE1 B;  3ULE C;  2VZ3 A;  4DNW A;  4PC0 A;  1O6G A;  4XYH A;  5IJ8 E;  2CO0 A;  5CXB B;  3E0C A;  1BPO A;  2H6N A;  2VDN A;  2I3T A;  4PSX B;  5FA5 B;  4ERQ A;  4PNK B;  3EQ7 A;  3JAM g;  4IRZ A;  4K3J B;  4AN0 A;  2P9N C;  3O4J A;  4KFM B;  4QQE A;  2H47 A;  4GMB A;  4WK4 A;  3ZE1 A;  3JB9 L;  2JKX A;  4A11 A;  5M5R A;  4I79 A;  4G1E A;  1H2W A;  4R7A B;  5FFO A;  2B5M A;  1B9Y A;  1XKS A;  3V4V A;  1A12 A;  3IUL A;  5FFG A;  5GMK n;  5H1M A;  1K3I A;  4X3E A;  4DNV A;  4BCD A;  3EI3 B;  3BG0 A;  3GD1 I;  4ZOX A;  3EU7 A;  3V5W B;  1JMZ B;  4WK2 A;  3AFC A;  2Q7Q A;  1JOF A;  4A2M A;  2J56 H;  3GFC A;  4FAV D;  1I2M B;  2MTA H;  2XDW A;  2Z2O A;  3IJ0 A;  4JHP C;  3NVQ A;  3EQ8 A;  5AJA A;  3MVD K;  2BBK H;  3DXM C;  4NSX A;  4PBZ A;  2CN2 A;  2YBA A;  5C9Z B;  3QHY B;  4BH6 A;  4CY5 A;  3JZH A;  1R5M A;  1VZ3 A;  3OF7 A;  4X60 B;  3SLE D;  3FCU A;  2J57 G;  4A08 A;  4Z7Q A;  1M1X A;  1JV2 A;  1L5G A;  2P9P C;  4A0A A;  2H14 A;  2XZG A;  4LG8 A;  1PI6 A;  2PBI B;  4O2W A;  2PM9 A;  3A0F A;  3GC3 B;  4O45 A;  3BWS A;  4E54 B;  3RLM D;  1H2Y A;  4BL0 A;  4UI9 R;  4XYI A;  5EAM A;  2EBS A;  3K72 A;  2HJB A;  2I0S A;  1N6D A;  1VZ2 A;  3DM0 A;  3IJE A;  4A0B A;  1GOT B;  3RFG A;  3KRX B;  2GC4 A;  3JZG A;  5HQG A;  5IGO A;  1PEV A;  3PSL A;  4JT6 C;  3HFQ A;  3SCY A;  3UVL A;  4FWW A;  2OJY A;  4FA9 D;  1SHY B;  4RE5 A;  2I0R A;  3PXT D;  5TEF A;  5KDO B;  3NVX A;  4N14 A;  3VH0 A;  1H2X A; 
#chains in the Genus database with same CATH homology
 2H68 A;  4ES0 A;  4L3H D;  5HE0 B;  5EML B;  3PXW D;  5FKS A;  2B5N A;  3RSE C;  1SQJ A;  2P9K C;  4GZ8 A;  5SXM A;  5K19 A;  5EAR A;  2J55 H;  4G56 B;  3OKW A;  1TBG A;  5TDH B;  5EMJ B;  1VYH C;  4HDJ A;  4L1Q D;  3SBQ A;  4E5Z A;  2H6K A;  3EI1 A;  2XL3 A;  3UKR C;  5K1C C;  1K32 A;  4QT8 A;  4J0X A;  3CFS B;  3OTT A;  2UZY B;  4Y5R D;  3MXX A;  5IJ7 E;  3SWS D;  5FKQ A;  2AGW A;  3IKO A;  4U7A A;  3SBP A;  2QC5 A;  3RMZ D;  5H14 A;  5HE2 B;  5CXC B;  4ZOZ A;  3SHF A;  5EAP A;  2I3S A;  2OK6 A;  5C2V B;  4J77 A;  2O9K A;  2HJ4 A;  5GSA A;  2HKR A;  2P9S C;  5IC7 A;  3OW8 A;  2TRC B;  4JSP C;  3BG1 A;  3MMY A;  1U4C A;  4ERZ A;  2OVQ B;  2H3X A;  5GXH A;  3RN1 D;  3OL2 A;  3RN0 D;  2XL2 A;  3EMH A;  5THA A;  2Z2P A;  3I8C A;  3RFH A;  2CE8 A;  3SFZ A;  4GM9 A;  2H13 A;  3PSC B;  4A09 B;  5EM2 B;  1PGU A;  3N0D A;  2W18 A;  3SJL D;  4CI8 A;  1TYQ C;  4L9O A;  3FM0 A;  2YNN A;  4J78 A;  3F3G A;  4PBY A;  3EI2 A;  4PSW B;  2P9L C;  2CO0 C;  2YB8 B;  5B4W A;  3EI4 B;  1N6E A;  1MG3 A;  2YNP A;  4J86 A;  5FKT A;  5HYN B;  4MK0 B;  2PM7 B;  2AGX A;  3FGB A;  4ERY A;  4FA1 D;  1P22 A;  3I7P A;  3PVU B;  2HKM A;  2I0T A;  2UZX B;  4JSX C;  4A11 B;  4ESG A;  3C99 A;  3AL8 A;  5I5I A;  4PXW A;  2YMU A;  3I7H A;  4CZX A;  4YVD A;  3MKS B;  3W15 A;  3I7O A;  1QNI A;  4X63 B;  5EMK B;  5GXI A;  5JWZ A;  4JT5 C;  4CZY A;  2H9N A;  2AH0 A;  2H6Q A;  2HES X;  4AOW A;  3RRM C;  1NR0 A;  4JSN C;  3OKY A;  2AGZ A;  2Z2N A;  3C75 H;  5FLX g;  5CYK A;  4A7J A;  3K27 A;  1XHM A;  2B4E A;  5FXY A;  3AH8 B;  5TF2 A;  2H9M A;  5CXB A;  3B7F A;  4U1E I;  3P4F A;  4FA5 D;  5EMM B;  4IA9 A;  3J80 g;  4Z8L A;  4A08 B;  1JJU B;  4BUJ C;  4ZOV A;  4A2L A;  4K3I D;  3V7D B;  4FA4 D;  3I2N A;  1OLZ A;  2PM9 B;  2P9U C;  4LGN A;  1RI6 A;  3ODT A;  3SXT D;  2G9A A;  4ZN4 A;  3UVN A;  3SBR A;  5I5J A;  1MDA H;  3N0E A;  3V9F A;  2IUP A;  4X61 B;  3JRO A;  4A0B B;  4FB1 D;  3PE7 A;  3OKT A;  2AH1 A;  3EI3 A;  3IIY A;  4O1Q D;  2QXV A;  5EAL A;  3MZK A;  5EM2 A;  3EWE A;  1JMX B;  4GQ1 A;  4EWR A;  4XEI C;  3ZWL B;  4CY2 A;  4OZU A;  1U2V C;  4JD2 C;  3K26 A;  3L4M D;  3SN6 B;  2IAA A;  1GG2 B;  1A0R B;  3EI4 A;  3SMR A;  2BCJ B;  4Y7R A;  2CN3 A;  3VGZ A;  2CNX A;  3AL9 A;  4H5J A;  4IMM A;  4E5Z B;  4GGA A;  3EI1 B;  4J79 A;  3UVK A;  3VA6 A;  5C2W B;  4GQB B;  4CC9 A;  3UR4 A;  4ZOY A;  4GM3 A;  4E54 A;  2GC7 A;  2IUV A;  5FQD A;  3JRP A;  3I8E A;  3PVW B;  4D0K A;  3NVN A;  4OWR A;  4O9D A;  1Q47 A;  5H17 A;  3UVO A;  2IUQ A;  5IGQ A;  2AGY A;  3DSM A;  3CIK B;  5I5M A;  4O3T B;  3UKU C;  4GM8 A;  2H9P A;  4JXM A;  2P9I C;  4GQ2 P;  3PXS D;  5IT9 g;  2OVR B;  4FAN D;  1L0Q A;  4QL1 A;  3OL2 B;  2H9L A;  3FRX A;  2YNO A;  3I89 A;  4J87 A;  1S4U X;  3C9C A;  1ERJ A;  2PM6 B;  4LG9 A;  2IWF A;  5TEE A;  4CY1 A;  2AGL A;  1PBY B;  4J84 A;  4J0W A;  3SVW D;  3CFV A;  4TZ4 A;  3DXK C;  3KRW B;  4J8B A;  3EI2 B;  3F3F A;  3GRE A;  1XIP A;  1OMW B;  4L3G D;  4AEZ A;  4CI1 A;  2AQ5 A;  3F3P A;  3JPX A;  2HXC A;  3MKQ A;  3IJC A;  2CE9 A;  3I7K A;  3EG6 A;  3I7L A;  1SQ9 A;  5CXC A;  1YFQ A;  1B9X A;  4H5I A;  4A0A B;  4CI3 A;  4QRJ A;  4J81 A;  2IWK A;  2OVP B;  4D6V A;  3ORV D;  4O3U B;  5A2Q g;  2XYI A;  1FWX A;  3AL8 B;  1GP2 B;  3L4O D;  3IJ1 A;  4GGC A;  5AMS A;  4CI2 A;  4GGD A;  4J82 A;  1GXR A;  3I7N A;  1NEX B;  3IIW A;  3DWL C;  4FHL A;  3MZL A;  4J8G A;  4JSV C;  2XU7 A;  2GNQ A;  3UVM A;  3C5M A;  1K8K C;  2G99 A;  2IUR A;  4CY3 A;  4A09 A;  3J81 g;  2OK4 A;  1MG2 A;  4CZV A;  2OIZ A;  2HYE A;  3OKY B;  5AFU 3;  5FKR A;  2B5L A;  5CYK B;  4J73 A;  3JZN A;  3U4Y A;  1N6F A;  5HE3 B;  5HE1 B;  3ULE C;  4PC0 A;  4XYH A;  5IJ8 E;  2CO0 A;  5CXB B;  3E0C A;  2H6N A;  2I3T A;  4PSX B;  5FA5 B;  4ERQ A;  4PNK B;  3JAM g;  4K3J B;  2P9N C;  4KFM B;  3JB9 L;  4QQE A;  2H47 A;  4GMB A;  4A11 A;  4I79 A;  4R7A B;  2B5M A;  1B9Y A;  1XKS A;  5GMK n;  5H1M A;  4X3E A;  3EI3 B;  3BG0 A;  4ZOX A;  3EU7 A;  3V5W B;  1JMZ B;  3AFC A;  2Q7Q A;  1JOF A;  4A2M A;  2J56 H;  3GFC A;  4FAV D;  2MTA H;  2Z2O A;  3IJ0 A;  3NVQ A;  5AJA A;  2BBK H;  3DXM C;  4NSX A;  4PBZ A;  2CN2 A;  2YBA A;  5C9Z B;  4BH6 A;  4CY5 A;  3JZH A;  1R5M A;  4X60 B;  3SLE D;  2J57 G;  4A08 A;  2P9P C;  4A0A A;  2H14 A;  4LG8 A;  1PI6 A;  2PBI B;  2PM9 A;  3A0F A;  4O45 A;  3BWS A;  4E54 B;  3RLM D;  4BL0 A;  4UI9 R;  4XYI A;  5EAM A;  2EBS A;  2HJB A;  2I0S A;  1N6D A;  3DM0 A;  4A0B A;  1GOT B;  3RFG A;  3KRX B;  2GC4 A;  3JZG A;  5HQG A;  5IGO A;  1PEV A;  3PSL A;  4JT6 C;  3HFQ A;  3SCY A;  3UVL A;  2OJY A;  4FA9 D;  1SHY B;  2I0R A;  3PXT D;  5TEF A;  5KDO B;  3NVX A;  4N14 A;  3VH0 A;  4FWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...