4J8DA

Middle domain of hsc70-interacting protein, crystal form ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
EIDNEGVIEADTDAPQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQPRAQKIAEHRRKYERKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of Hip, an attenuator of the Hsp70 chaperone cycle.
pubmed doi rcsb
molecule keywords Hsc70-interacting protein
molecule tags Chaperone
source organism Rattus norvegicus
total genus 52
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4j8dA00
4ME2A 3CVQA 2XCBA 1P5QA 3MEKA 3VTYA 1ZU2A 5KJMA 2KCKA 2R5SA 1B89A 1WAO1 1YA0A 2ONDA 5EX0A 5BT1A 3UQ3A 2XGSA 3LKUA 2BUGA 2HR2A 3OXLA 4KYOB 4YNDA 3S7JA 2C2LA 2YQ8A 2PZIA 4O6FA 5G05J 3CKCA 3LPZA 3N71A 4BTBA 3CVPA 3CEQA 4UQZA 2XCCA 3RKVA 3S7DA 3FWVA 4JHRA 2HO1A 3GZ1A 4WUYA 1WM5A 4EQFA 2MHKA 3R9AB 4Y6WA 2KCLA 2Y4UA 4G1TA 3TG4A 3Q49B 4YVOA 4BWRA 4RG6A 3MV2B 3E4BA 4AIFA 2XEVA 3MV3B 4GA0A 4HOUA 5DBKA 4J8EA 4I9CA 2VGYA 5A7DB 4W9RA 4J8DA 4N3BA 4GZ6A 4RG9A 1FCHA 2FBNA 5CCLA 4H7XA 1ZBPA 2YHCA 3ZHEA 4JA7A 4I1AA 4BT9A 4CGWA 4XIFA 3RO2A 5JJTA 5HQ8A 4UI9J 2KATA 1HZ4A 3AS5A 4WNGA 5FZSA 1QQEA 1IYGA 3ASGA 1Y8MA 3QWVA 5JJ7A 1ELRA 3K9IA 1E96B 5KJKA 1HH8A 4J8FA 3ASFA 3PE4A 4WNFA 4G26A 3QDNA 5BNWA 3QWPA 2FEZA 4N2QA 1IHGA 4GYWA 4G24A 2QFCA 4CGVA 3KAEA 4GA2A 3LY9A 3MA5A 5DIZA 2VQ2A 2C0MA 4N3AA 5G05C 4G2VA 5AYWD 5CCMA 3Q15A 2VGXA 2KC7A 3PDNA 5FTPA 3TG5A 5FZRA 1KT1A 1XNFA 5ARFA 2OOEA 3CVLA 3CKBA 2KCVA 3LCAA 5FZQA 3Q47B 5ARGA 4JL0A 2IF4A 4F3VA 4U0SA 5KJNA 4APOA 3MKRA 5A6CA 2JLBA 3RU0A 3ULQA 2VSNA 2GW1A 1QZ2A 4N3CA 4AY6A 3S7BA 5EKQD 2IFUA 3OXGA 4I2ZA 4HOTA 4UI9C 2FI7A 3CK7A 4XI9A 2WPVA 3IEGA 3ASHA 3CVNA 4KXKB 3UUXA 3PE3A 3ASDA 3AS8A 3CV0A 4WNDA 2Y4TA 3U4TA 2UWJG 4GZ3A 4UI9K 3ZHEB 2AVPA 5M72A 3CK8A 4U04A 3QWWA 5G04J 3EDTB 5D0QD 4GPKA 4H7YA 3LYAA 1OUVA 4NQ0A 2PQRA 5C1DA 2P58C 2NC9A 2WQHA 4AY5A 4LEUA 5CHEE 2FF4A 1NZNA 5KJLA 4N39A 3U3WA 5JJ6A 3RIBA 3UPVA 3GZ2A 2XGOA 3TAXA 4JA9A 3WXXA 3ZFWA 2LNIA 1KT0A 3O48A 4UQYA 5EX3A 4WNEA 3NF1A 1HXIA 4GZ5A 3KD7A 3SZ7A 2VGXB 2Q7FA 2C0LA 4U0ZA 3BEEA 5HI7A 4AM9A 4ABNA 2FO7A 2I6HA 3QKYA 4BT8A 3HYMB 4I17A 1PC2A 3RO3A 5FT9A 3VTXA 1NA3A 3S7FA 5D0OD 3OXFA 2PL2A 4GA1A 4IN3B 3LY8A 5FJYA 4XI0A 1ELWA 4CDRA 3GYZA 2XGMA 3ZGQA 2E2EA 3ESKA 3GW4A 2HYZA 5G04C 1NA0A 4N5CA 4KBQA 3ZN3A 4HOQA 2LSUA 4I2WA 2J9QA 3CK9A 2PQNA 1A17A 3JYSA 4B94A 2VYIA 3RJVA 2VSYA 3URZA 3SF4A 1KLXA 3ZPJA 3TGOA 5LCWC 2UY1A 2XPIA 4GYYA 2V5FA 4GYOA 1TJCA 4I9EA 4HORA 4U0UA 3Q5MA 2DBAA 3KS2A 4UQXA 2UY1B 4N2SA 4G25A 4YVQC 4BTAA 5BW8C 2L6JA 4GCOA 4NRHB 5LCWJ 4Y6CA 4A1SA 3FFLA 4HOSA 4U07A 3AS4A 4J0UA 3LY7A 3FP3A 3QOUA 3Q4AB 4GCNA 1W3BA 4G23A 2LSVA
chains in the Genus database with same CATH superfamily
4GU5A 3CVQA 4Q94A 1P5QA 3MEKA 4L1BA 4ANXA 2XPYA 1E8YA 2KCKA 3CVUA 4HVBA 4R7LA 1BI7B 1N4PA 3I4GA 4K5BA 3NOGD 3ULEG 4N5QA 3B7SA 3L82A 1DNPA 2ZU6B 3R7QA 1HG5A 3TWSA 3JUEA 2OV8A 2WXMA 4YNDA 2YQ8A 1Y6IA 4HQDA 3T5XA 4JHKA 5G05J 3CKCA 4F7AA 1RW2A 4X8QA 3LPZA 1X81A 3SNXA 2EQXA 4BTBA 1INZA 2EIME 3W9FA 3ZEFA 4MLPA 4A55A 1N94A 4MRUA 1VDYA 3FU3A 3MKQA 3CGHA 1WM5A 4EQFA 3R9AB 4Y6WA 2J07A 4G1TA 3TG4A 3JQ1A 5B1BE 4JC8A 2NYJA 1DCQA 5DBKA 3UIPC 2DYRE 4DRXE 4NURA 4AJWA 3C3RA 5A7DB 5AJLA 3LS8A 4J8DA 4RG9A 1FCHA 2L6BA 5CCLA 4FLBA 4JB8P 1OWNA 3FUIA 2WVIA 2ZXWE 4OAUC 2WXHA 3ASOE 4CGWA 2H6GA 3AG4E 1O5MA 3L22A 1QNFA 4GMLA 1TN7A 5BUZA 4UI9J 4ATGA 1HZ4A 4ZHBA 3I4RB 3ZYQA 3EHMA 2MOWA 4FHKA 4CDMA 4EHMA 4EZJA 2E0IA 4E85A 1WY6A 2OEVA 1E96B 5KJKA 1HH8A 1SQMA 4WNFA 3W9GA 4YDYA 3PZ1A 3QWPA 2FEZA 1IHGA 3D9LA 2QFCA 4DX1A 3HXFA 3ZU7B 3LY9A 4RQIA 1O1TA 4Z68A 2YINA 3UKUG 2C0MA 1UN9A 1LD8A 5AYWD 5CEAA 3LJ3A 4C48B 3Q15A 1EF1C 3UM2A 1Q2ZA 5FTPA 1N4QA 3TG5A 3MYVA 4FU3A 2WM9A 3IHYA 1KT1A 1XNFA 1GW6A 2HE0A 3AJIA 4LSZE 3CKBA 5J90A 4TV3A 4HRNA 5FZQA 1LD7A 4CDNA 3TWWA 3FU0A 1BPOA 2X38A 1JPLA 4APOA 5A6CA 2A4ZA 3RU0A 1UN8A 2VSNA 1EYHA 1TNUA 5EIBE 1XGWA 4AY6A 5AENA 2AXZA 3EIJA 3P1UA 4U8VD 2NXPA 4FP7A 5T4YA 3HXCA 3SI5A 5KNHD 3HDXA 1N11A 3PNTB 2ZISA 4GMJA 5CBNA 3CVYA 4XKCA 5AQ9A 5LOZA 3FTZA 4AVXA 3BUAA 4WNDA 4HB5A 1H2TC 3U4TA 1H19A 4GZ3A 4UI9K 4K5AB 2GRNB 1OWMA 5M72A 4OAVB 4FHJA 4U04A 4DX2A 2WXOA 3FU5A 3DSUA 3EDTB 3TXNA 3LYAA 2WXLA 4HLLA 2IOSA 4NQ0A 2PQRA 4ANUA 4AY5A 5ANRA 3ENEA 3C72A 1TNBA 5J08A 4IRUA 1JWFA 4J6IA 4I6GA 2DYSE 3DEOA 4O60A 3GZ2A 2WXGA 1H6PA 2H6HA 1KZPA 2BKGA 4WNEA 3C5RA 5CERB 3KD7A 3HVEB 2Q7FA 3FUNA 2M63A 4TRQA 4ABNA 2FO7A 2I6HA 2WMNA 2OVFA 1U3DA 4LCTA 4LNBA 4ILGA 4B89A 5E76A 1DVPA 1TN6A 4BSZB 2WXJA 5EYPF 4GA1A 2JABA 4IN3B 3TJPA 2P9PG 4IYPA 2R02A 3BU8A 2J09A 4MBGA 3CSTA 2XPZA 5BXOA 4XKBA 5AAOA 4QQIA 5G04C 1PY1A 1NA0A 4GTMA 1UOHA 4KBQA 2LSUA 2KM4A 1A17A 5BV1A 5ENTD 4JW1A 2J8SD 4CT4A 1MQSA 1OCRE 4GMRA 5FINA 2VSXE 1OT8A 2F0YA 4PS3A 2V5FA 4L7TA 2RKKA 4L23A 4U0UA 3Q5MA 3UT8A 3JXJA 1N9AA 3JUIA 4URKA 4G25A 4AV7A 4BTAA 2XENA 4GTVA 4GCOA 4NRHB 2ETBA 4HOSA 4U07A 2AW6A 4G23A 4HFGA 2LSVA 4ME2A 2A5UA 3TWTA 1HU3A 3PUJA 4FJZA 1B89A 1HO8A 5BT1A 4UWLA 3SFZA 3UQ3A 4HRMB 4YDEA 3Q7AA 2XGSA 2B0OE 3E37A 1X5BA 2BUGA 3HXDA 1MJ0A 3C3QA 2LXMA 2BF0X 4KYOB 3S7JA 5HRYA 4EPZA 3TWUA 3KSQA 5LX8A 1QYMA 3O4ZA 2DCPA 4K03A 3VLDA 1FVFA 1MHQA 3CEQA 5G2NA 4UQZA 2XCCA 3S7DA 3FWVA 2XEHA 4WUYA 1FT2A 3L17A 2EIJE 4YVOA 3LDZA 1N0RA 1HX8A 1ZB1A 5EILA 4BEPA 2XEVA 3MV3B 4GA0A 3OAWA 2ETAA 4J8EA 4EZLA 4CT0A 1HG2A 4W9RA 2VTBB 3LEWA 3DXKG 4GZ6A 5T3RA 4YDWA 5E75A 3DSWA 2YHCA 3KEZA 2XS8A 3QARA 2X6FA 4JVSA 3PS6A 4JA7A 4I1AA 2Y1LE 2GGFA 3CIAA 4HRLA 1OWLA 4XIFA 3ML8A 1G3NB 3ASGA 2FULA 2CFZA 2MYOA 4ANWA 4M3OA 5JJ7A 3D9NA 4DX6D 4L2YA 3NZUA 4U95D 3G2WA 3CHRA 2EINE 4GYWA 4CGVA 3B7UX 5D2MC 3KAEA 4Q69A 2IJGX 5EN5D 2ZGDA 2IY0C 5DIZA 2VQ2A 4O1PA 1NL4A 4N3AA 5G05C 4G2VA 4AOFA 1S0PA 2QY7A 4OVVA 3CHPA 4K0RA 3DPYA 5KBAA 2NSZA 5ARFA 3CVLA 3NBNB 2AXVA 3PZ4A 4ACLA 3MGBA 2I2OA 3Q47B 3CLJA 1RZ4A 3RRUA 4JL0A 2WXIA 5JHAA 2IF4A 3SFXA 4F3VA 2V0PA 3C3OA 5EDSA 3EIQC 3CR3A 3SD5A 3CHMA 3L13A 2PNNA 1WG0A 2IEJA 2IO2C 4NACA 4HNAD 1BI8B 4GAAA 3DSTA 3MKQB 3OXGA 4K5CA 1N0QA 4UI9C 1NFIE 4B8AA 4TXRA 3PRZA 5IY5E 4LUNU 3QJZA 2X6IA 3ASHA 2WQ7A 5CRVA 3ZKJA 2QYJA 3Q7FA 3SBSA 3VLEA 4CYMD 3GZSA 3B95A 1U3CA 3AS8A 3J5QB 3QNKA 4G11A 3FUDA 2AVPA 4FC8A 3G2UA 3APDA 4BETA 5ITZF 1H0AA 4JEHA 4GTTA 5D0QD 5EIDA 3UM3A 4XZ4A 2NC9A 2WXNA 2WQHA 4DI4A 3HRAA 4LEUA 5CHEE 2Y3AA 3UINC 5KJLA 2WB2A 5T8IA 3EHNA 1E7UA 3ML9A 2HM8A 5AQ7A 5AIJA 1OCZE 4Q96A 3L16A 3HIZA 3ZW3A 2OVBA 3Q9NC 2XGOA 3UM1A 3ZFWA 4UQYA 5EX3A 4DJAA 1HXIA 4GZ5A 3PUKA 4IULA 3SZ7A 1IHBA 2L0IA 2H6FA 1JCSA 2LAIA 1MX4A 1OWOA 3ISMC 4AM9A 5LP0A 1EPUA 1FT1A 1L5JA 4TXPA 3FTXA 2GRMA 4U96D 4PDXA 4I17A 2QYUA 4F1SA 3LVRE 2RFMA 4RVBA 5FT9A 3S7FA 4ILIA 2PL2A 3UIOC 2WXPA 2DWZA 4WAFA 2EILE 4OYSA 3ONKA 5KWDA 3G2TA 3Q79A 3HG0D 5HKPA 4EBAA 2P2CP 3L08A 1BLXB 3RRMB 4HOQA 2J9QA 3E32A 4BESA 4TUMA 4JPSA 2BTDA 2EIKE 3CK9A 1DCEA 4APFA 1FPPA 1H2VC 2V8SE 2P9UG 4B94A 2VYIA 1IKND 3RK6A 3JQ0A 2Y69E 2VSYA 3URZA 1TYQG 1S64A 4OVUA 3V31A 3TGOA 1TR4A 4I6EA 2RFAA 2XPIA 1E8WA 4HBDA 3IBEA 4DI3A 3FDHA 4GYOA 1TJCA 4FULA 2LUHA 3KS2A 1TNYA 4N2SA 5CRUA 1TEZA 5BW8C 1TNZA 4Y6CA 3G2VA 5AQAA 3PZ2A 2IONA 3FFLA 3PVLA 4AP2A 2XS1A 1HS6A 3Q9UC 3Q4AB 4GCNA 1W3BA 3UTMA 3FUJA 4O1OA 3FUFA 1LF8A 4WWOA 4F1PA 1ZU2A 2L9BA 4G8KA 2R5SA 1WAO1 2ONDA 4E6HA 1E8ZA 2I9CA 4U8YD 3DBSA 3NQPA 4U8HA 5ENSD 3X2QE 2HR2A 3OXLA 3AAAC 3JXIA 4FADA 1JCRA 3NAWA 3ZUVB 3UXGA 2C2LA 4O6FA 2PM6A 5BV0A 4XEIG 3NZSA 4U7EB 2R2LA 3DRAA 3CVPA 5ENPD 3FEXA 1YMPA 3B7RL 3RKVA 1N4SA 2KCLA 4RG6A 3R7RA 4FJYA 3I3NA 4JD2G 3MV2B 3DPDA 3E4BA 2DIWA 3AU5A 3LJNA 4BFRA 4HOUA 3D9MA 1Z3XA 3TWRA 4HS2A 2FBNA 4H7XA 1KZOA 1D8DA 2IQCA 3QK0A 4A63B 3ZHEA 2J4BA 2WXFA 4BT9A 1UJJA 2VGEA 5JJTA 1Z5SC 4L9PA 3DSVA 2KATA 2I1KA 4WNGA 1V54E 3FY4A 5ENRD 4HI8A 1E7VA 4G26A 3KSLA 2GRPB 3PREA 4A3TA 3D9OA 3FUMA 3BQOA 5BNWA 4G24A 2ZIRA 3E30A 4XE0A 4GA2A 4F6RD 4J8YA 2P9KG 3R9MA 3FTSA 3MA5A 1JWGA 3DXMG 3ZIMA 3ZYMA 3AG3E 4ILHB 4DLQA 1MX2A 4JHJA 3Q73A 1DC2A 2VGXA 4V3IA 1MZCA 4LNUD 3PDNA 5JA4D 2OOEA 2AWIA 3D9IA 2J4DA 3TWVA 5FQ8A 3FH7A 2GRRB 2XZTG 3FTYA 1H6KA 3G2SA 4LG6A 3DWLG 5FIOA 3BG1B 4GTSA 2JLBA 5CMYA 2JEKA 3ULQA 4MKTA 3NB2A 4N3CA 2XQ0A 2I1JA 4GZDA 3RSEG 4C0EA 4DX7D 2IFUA 4TXQA 2WXRA 5CECB 2FI7A 4XI9A 3D9KA 4UWHA 3ULYA 2WPVA 3IEGA 3L54A 4B8CB 4CEMA 3CVVA 2X6HA 2DZOA 4KXKB 2CFUA 3UUXA 1HFAA 3BG0B 4WWNA 1MYOA 3UKRG 2P9SG 4CCAA 3D9HA 2Y4TA 1AP7A 2UWJG 2F8XK 3JCKC 2F8YA 3DSXA 4J7WA 4C9BB 2AXUA 3CK8A 5C2YA 1SVXA 3EUVA 4WWPA 3QWWA 5FQ7A 3L9TA 2XRZA 4CZ2D 4ANVA 3DEPA 5EYLA 1SA5A 3ZXPA 4DLOA 1S63A 4H7YA 4PH4B 1YCSB 5C1DA 2P58C 3V30A 1SA4A 4DK5A 1NZNA 3IKOB 4N39A 4AEZC 5JJ6A 5B1AE 3UPVA 1JUQA 2OCCE 3FH8A 1BU9A 4GTOA 1AWCB 3TAXA 4JA9A 4B93B 2CHXA 3HHMA 1KT0A 3O48A 4KVOA 3NF1A 1OWPA 1D8EA 2C0LA 1YYHA 3D3MA 3SGHA 3ZRHA 3Q78A 3MCXA 3BEEA 5HI7A 2V4HC 3TXMA 3ZVVA 4ZFHA 3QKYA 3V79K 3HYMB 5AJDA 4FA6A 2R59A 3C98A 3MJWA 1SZAA 3RRNB 4GTRA 3ASNE 1K8KG 2XEEA 1TNOA 4EECA 4GZCA 5FQ6A 5D0OD 3SFYA 5BPPA 3APFA 3CVXA 3FUHA 4UWKA 3LY8A 3FU6A 3GYZA 4PS7A 5G55A 1LTXA 3FTWA 3ESKA 3GW4A 2HYZA 3CHQA 3DSSA 4I43A 4KZ0A 4P29A 4I2WA 4ACKA 2IO3C 2X3MA 3J5PA 2PQNA 2DZNA 1UG3A 1PAQA 3HXEA 3B13A 4I1MA 3T5VA 2WQ6A 2R17C 4LRZA 3WG7E 2KZTA 4LNGA 4ATZD 2J49A 3PZDA 2MRIA 2GRQB 4MS6A 2R05A 1OY3D 3PH0C 1OXJA 1UJKA 1Z3YA 2KZTB 3ZYKA 1OCOE 3AS4A 3LY7A 3FP3A 3FUKA 3QOUA 4DPRA 1KPSB 2XCBA 2LO6A 2ZGGA 3VTYA 2F37A 3V2OA 5KJMA 3FTUA 3APCA 1YA0A 4JXTA 5EX0A 3ABME 3T9KA 3TWXA 3LKUA 4GB9A 1BD8A 5ENNA 3RAUA 3SBTB 3ZXSA 3QAQA 3T8KA 2PZIA 2FO1E 1JCQA 4C0MA 1TN8A 2BEDA 4BY6A 3N71A 2R03A 2VJ8A 3TL5A 1HE8A 2OEWA 2KBXA 3EU5A 4I6JA 2HO1A 4I1OB 2X6KA 3GZ1A 4JHRA 3UM0A 2MHKA 4JZYA 2Y4UA 3Q49B 4BWRA 1IQUA 3P2BA 4AIFA 2QZAA 3V2XA 4I9CA 2VGYA 3B7BA 5A23A 4N3BA 4QFVA 5H7PA 1ZBPA 4HXIA 1N54A 3EU9A 4LERA 1UW4B 2WXKA 5D66A 4XX5A 3EJNA 3RO2A 3LXUX 5HQ8A 2CG2A 3AS5A 1K1BA 4A1GA 5FZSA 1QQEA 1IYGA 1D9SA 5ENQD 1Y8MA 4HLEA 3QB2A 3QWVA 1ELRA 3K9IA 4BSXA 4J8FA 3ASFA 3PE4A 3U64A 3OTNA 3SY2A 3SQVA 3QDNA 2PM7A 3EHRA 4N2QA 2QC9A 2LXLA 4BX9A 3CHSA 1MX6A 1E8XA 4PS8A 1NP7A 3IV0A 5CCMA 1H6OA 1SZ9A 3HVEA 2KC7A 4HI9A 4A3VA 2RD0A 1K3ZD 5FZRA 1EDUA 2CG3A 2P9LG 4GTPA 2VSOE 3PZ3A 2B6CA 2KCVA 3LCAA 4CRWA 5ARGA 3AG1E 3UX4A 4U0SA 5KJNA 2CHWA 4UWGA 5AN8A 3MKRA 3FTVA 3AG2E 1O1SA 4BX8A 4M7CA 4DX5D 3PEUB 3D9PA 1ELKA 2GW1A 2V5QC 1QZ2A 1N95A 4FLHA 1N52A 3UI2A 4KT6B 5FWQA 5B3SE 3S7BA 5EKQD 2J08A 5AQBA 4I2ZA 1O1RA 4HOTA 3SHFA 4EZKA 3CK7A 2A5EA 3ABKE 2WXQA 3CVNA 3ZYLA 5CMWA 4U63A 3PE3A 4KMOA 3NOCD 3QC1A 3ASDA 3CV0A 2P9NG 4EBAG 4GTQA 4RSYA 5ANLA 3ZHEB 3T8MA 3E34A 3CSFA 2DVWA 3F6QA 3CQCB 5G04J 5CEDB 4PUCA 2P9IG 4TUUA 3MZLB 3U66A 4GPKA 1E90A 1OUVA 4JEUA 2BKKB 2IOLA 2YNQA 4YDOA 3CHOA 2FF4A 2IU1A 2GROB 1SW6A 4D10C 2Y0BG 1V55E 2XHEA 3U3WA 5KNGA 5LFAA 3PEVB 4GPMA 3RIBA 4B0ZA 1S70B 3VLFA 3UT4A 4AXHA 2ETCA 4UUCA 3WXXA 2LNIA 3SO8A 1A5EA 3ESLA 3TWQA 3B7TA 2VGXB 5AARA 4NIKA 3FUEA 4U0ZA 3ZNGA 3PNLB 3Q75A 2H6IA 1K1AA 4BERA 3ABLE 5ENOD 4BT8A 5FQ4A 3HXBA 1PC2A 3RO3A 3MX3A 5JHBA 1FVHA 3VTXA 4KVMA 1NA3A 3IXEA 3CVWA 3OXFA 1H2UA 5KCMA 1HF8A 3ONLA 2CHZA 4DUIA 3UMVA 5FJYA 3FH5A 4XI0A 1ELWA 4CDRA 3S2AA 2XGMA 4UWFA 3ZGQA 2LAHA 3FHEA 3FEYA 2E2EA 3D9JA 2VTBA 3E33A 3IHVA 2AJAA 1QBQA 1IXVA 4N5CA 2V4LA 1TJFA 3ZN3A 1U2VG 2L0TB 2KXPC 1Z6TA 3JYSA 1NI1A 3RJVA 3SF4A 1KLXA 2WMOA 1N4RA 5HS0A 3ZPJA 3CQGB 3L6AA 5LCWC 2UY1A 4J8SA 4GYYA 5JMND 4I9EA 4HORA 3UT7A 3LVQE 4UQXA 2DBAA 2RG8A 3I5PA 4RLYA 4G8LA 3KEAA 2UY1B 2YHEA 4KZCA 2X6JA 4L2LA 2XZDG 4YVQC 2XRYA 2L6JA 3FULA 5LCWJ 5CBOA 4A1SA 3AU4A 2GRLA 4J0UA 2ILRA 1WDYA 1OCCE 4F53A 3EHQA 1IQRA 3U9WA 5BXUA
chains in the Genus database with same CATH topology
4ME2A 4GU5A 2A5UA 3CVQA 3FUFA 4Q94A 1LF8A 2XCBA 1P5QA 2LO6A 3MEKA 4L1BA 4WWOA 3VTYA 1HU3A 4ANXA 1ZU2A 2L9BA 3PUJA 2XPYA 3FTUA 5KJMA 1E8YA 2KCKA 3CVUA 4HVBA 4FJZA 2R5SA 3APCA 1B89A 1WAO1 1YA0A 4JXTA 1HO8A 2ONDA 5EX0A 5BT1A 4E6HA 4UWLA 4R7LA 1E8ZA 3SFZA 3UQ3A 2I9CA 3I4GA 2XGSA 3DBSA 3NQPA 3LKUA 4GB9A 4U8HA 3B7SA 1X5BA 1DNPA 2BUGA 5ENNA 2ZU6B 2HR2A 1HG5A 3OXLA 3R7QA 3SBTB 2BF0X 4FADA 2OV8A 2WXMA 4KYOB 3ZXSA 3QAQA 4YNDA 3S7JA 4EPZA 2C2LA 2YQ8A 1Y6IA 3T5XA 2PZIA 4JHKA 4O6FA 5LX8A 5G05J 2PM6A 3CKCA 4C0MA 4F7AA 3O4ZA 3LPZA 4BY6A 5BV0A 3N71A 2DCPA 2EQXA 3SNXA 3NZSA 2VJ8A 4K03A 3TL5A 3VLDA 4BTBA 1FVFA 1INZA 3CVPA 1MHQA 1HE8A 3CEQA 5G2NA 4G23A 4UQZA 3FEXA 3ZEFA 4MLPA 4A55A 2XCCA 1VDYA 3FU3A 3B7RL 4MRUA 3RKVA 3S7DA 3MKQA 3FWVA 4I6JA 3CGHA 2HO1A 2X6KA 3GZ1A 4I1OB 4JHRA 1WM5A 4WUYA 4EQFA 2MHKA 3R9AB 4Y6WA 3L17A 2J07A 4JZYA 2KCLA 2Y4UA 4G1TA 3TG4A 3Q49B 4YVOA 3LDZA 4RG6A 3JQ1A 3R7RA 4BWRA 4FJYA 1HX8A 3I3NA 1IQUA 3P2BA 3MV2B 3DPDA 3E4BA 2DIWA 3AU5A 4AIFA 2XEVA 3MV3B 4GA0A 4JC8A 4BFRA 4HOUA 3OAWA 4HOSA 5DBKA 4J8EA 3D9MA 1Z3XA 4NURA 4EZLA 4I9CA 4AJWA 2VGYA 4CT0A 5A7DB 1HG2A 5AJLA 3LS8A 5A23A 4W9RA 2VTBB 3LEWA 4J8DA 4N3BA 4QFVA 4GZ6A 4RG9A 5T3RA 4HS2A 1FCHA 2FBNA 5E75A 5CCLA 4H7XA 4FLBA 1ZBPA 2IQCA 4HXIA 2YHCA 3KEZA 3QK0A 1OWNA 3FUIA 3QARA 3ZHEA 2WVIA 2J4BA 2X6FA 2WXFA 4JVSA 1N54A 3PS6A 4JA7A 4I1AA 4BT9A 2WXHA 4LERA 2GGFA 4CGWA 3CIAA 1UJJA 1UW4B 2WXKA 3L22A 1QNFA 1OWLA 4XIFA 4GMLA 4XX5A 3EJNA 3RO2A 5JJTA 5BUZA 3ML8A 3LXUX 5HQ8A 2CG2A 4UI9J 2KATA 4ATGA 2I1KA 1HZ4A 3AS5A 3I4RB 4WNGA 4A1GA 3ZYQA 3EHMA 5FZSA 2MOWA 1QQEA 1IYGA 3FY4A 3ASGA 1Y8MA 2FULA 2CFZA 4FHKA 4HLEA 3QB2A 4ANWA 3QWVA 4CDMA 4M3OA 5JJ7A 1ELRA 4EZJA 2E0IA 4E85A 3D9NA 1WY6A 3K9IA 4BSXA 4L2YA 1E96B 5KJKA 1HH8A 4J8FA 1SQMA 3ASFA 3PE4A 1E7VA 3OTNA 4WNFA 3U64A 4G26A 3NZUA 3QDNA 3PREA 2PM7A 4A3TA 3G2WA 3CHRA 3D9OA 3FUMA 5BNWA 3QWPA 2FEZA 4N2QA 1IHGA 3D9LA 4GYWA 4G24A 2QFCA 4CGVA 3B7UX 4BX9A 4XE0A 3KAEA 4GA2A 4Q69A 2IJGX 3CHSA 3LY9A 3FTSA 1E8XA 3MA5A 5DIZA 2YINA 1JWGA 2VQ2A 4PS8A 1NP7A 2C0MA 1UN9A 4N3AA 3ZIMA 5G05C 4G2VA 4AOFA 3ZYMA 1S0PA 5AYWD 3LJ3A 4ILHB 3IV0A 4DLQA 2QY7A 5CCMA 4JHJA 3Q15A 1EF1C 4OVVA 1SZ9A 2VGXA 3HVEA 4V3IA 2KC7A 3PDNA 4A3VA 5FTPA 3CHPA 2RD0A 4K0RA 3MYVA 4FU3A 5FZRA 3TG5A 2WM9A 1EDUA 3IHYA 1KT1A 2NSZA 1XNFA 1GW6A 5ARFA 2CG3A 2OOEA 2AWIA 3CVLA 3D9IA 2AXVA 2J4DA 2VSOE 4ACLA 3CKBA 5J90A 5FQ8A 3MGBA 4TV3A 2I2OA 2KCVA 3LCAA 5FZQA 3Q47B 3CLJA 3RRUA 3FH7A 4CDNA 3FTYA 5ARGA 1H6KA 4JL0A 4CRWA 3FU0A 2WXIA 3UX4A 5JHAA 1BPOA 2IF4A 4F3VA 2V0PA 2X38A 4U0SA 1JPLA 5KJNA 2CHWA 5EDSA 4APOA 3G2SA 4UWGA 3MKRA 3FTVA 3EIQC 3CR3A 3SD5A 3CHMA 3L13A 5A6CA 3BG1B 2A4ZA 4BX8A 2JLBA 5CMYA 3RU0A 3PEUB 2JEKA 3D9PA 1UN8A 3ULQA 2VSNA 1EYHA 1ELKA 4MKTA 2GW1A 1QZ2A 1XGWA 4N3CA 2XQ0A 4NACA 5AENA 4FLHA 4AY6A 1N52A 4KT6B 5FWQA 2I1JA 3S7BA 2AXZA 4GAAA 3EIJA 4GZDA 3P1UA 4C0EA 3MKQB 5EKQD 2J08A 2IFUA 2NXPA 3OXGA 4FP7A 5T4YA 2WXRA 4I2ZA 4HOTA 3SHFA 4EZKA 4UI9C 2FI7A 3CK7A 4XI9A 3SI5A 3D9KA 4UWHA 3HDXA 3PRZA 4B8AA 2WPVA 3IEGA 4LUNU 3QJZA 3PNTB 3L54A 4B8CB 2X6IA 3ASHA 4CEMA 2WXQA 3CVVA 2X6HA 3CVNA 2WQ7A 4KXKB 3ZYLA 4GMJA 5CMWA 2CFUA 3UUXA 4U63A 3SBSA 1HFAA 3BG0B 3CVYA 3PE3A 4KMOA 3VLEA 4XKCA 4WWNA 3GZSA 3QC1A 3ASDA 1U3CA 3FTZA 5LOZA 3AS8A 4AVXA 4CCAA 3CV0A 4EBAG 4WNDA 2Y4TA 4RSYA 3QNKA 1H2TC 2UWJG 5ANLA 1H19A 4GZ3A 3JCKC 4UI9K 3U4TA 3ZHEB 4G11A 3FUDA 3T8MA 2AVPA 3CSFA 5M72A 1OWMA 4C9BB 4FC8A 3G2UA 2AXUA 3APDA 3CK8A 4FHJA 5C2YA 3CQCB 4U04A 4WWPA 3QWWA 5FQ7A 1H0AA 5G04J 2XRZA 4PUCA 2WXOA 4TUUA 3FU5A 4ANVA 4JEHA 3MZLB 3EDTB 5D0QD 4DLOA 3U66A 3TXNA 4GPKA 1E90A 4H7YA 3LYAA 4PH4B 2WXLA 1OUVA 4XZ4A 2IOSA 4NQ0A 4JEUA 2PQRA 5C1DA 2P58C 2WXNA 2NC9A 2WQHA 4ANUA 4DI4A 4AY5A 5ANRA 4LEUA 4DK5A 2IOLA 2YNQA 5CHEE 2Y3AA 3CHOA 2FF4A 2IU1A 1NZNA 3ENEA 5KJLA 4D10C 3IKOB 2WB2A 5T8IA 4N39A 3EHNA 1E7UA 3ML9A 2XHEA 3U3WA 2HM8A 5LFAA 4AEZC 3PEVB 5JJ6A 5AIJA 3RIBA 4B0ZA 5J08A 4IRUA 1JWFA 3VLFA 4J6IA 3UPVA 4Q96A 3L16A 1JUQA 3HIZA 3FH8A 4I6GA 3UT4A 4AXHA 3ZW3A 2OVBA 3GZ2A 2XGOA 3TAXA 4JA9A 2WXGA 2CHXA 3WXXA 3HHMA 3ZFWA 2LNIA 1KT0A 3O48A 3ESLA 4UQYA 5EX3A 4DJAA 4KVOA 4WNEA 3NF1A 1HXIA 3B7TA 4GZ5A 3KD7A 3PUKA 4IULA 3SZ7A 2VGXB 3HVEB 1OWPA 2Q7FA 2C0LA 2L0IA 3FUNA 3D3MA 2M63A 3SGHA 2LAIA 3FUEA 3ZRHA 1OWOA 3MCXA 4U0ZA 3BEEA 5HI7A 3PNLB 4AM9A 4TRQA 5LP0A 4ABNA 1EPUA 3TXMA 2FO7A 2I6HA 3ZVVA 2WMNA 1L5JA 3FTXA 2OVFA 2GRMA 3QKYA 1U3DA 4BT8A 3HYMB 4PDXA 5AJDA 5FQ4A 4I17A 1PC2A 2R59A 4LCTA 4FA6A 3C98A 3MJWA 1SZAA 3RRNB 3RO3A 3MX3A 5JHBA 4F1SA 3LVRE 1FVHA 4ILGA 4RVBA 5FT9A 3VTXA 4KVMA 1NA3A 4EECA 4GZCA 3CVWA 5FQ6A 3S7FA 5D0OD 4B89A 3OXFA 1H2UA 4ILIA 5E76A 1DVPA 2PL2A 1HF8A 3APFA 5KCMA 2WXJA 3ONLA 5BPPA 4GA1A 3FUHA 3CVXA 2WXPA 2CHZA 4IN3B 3TJPA 4UWKA 3LY8A 5FJYA 4IYPA 3UMVA 3FH5A 4XI0A 1ELWA 4CDRA 4WAFA 3FU6A 3GYZA 4PS7A 3S2AA 4OYSA 2J09A 2XGMA 5G55A 3CSTA 2XPZA 4UWFA 3ZGQA 2LAHA 3FHEA 3FEYA 2E2EA 3D9JA 3FTWA 3G2TA 3ONKA 4XKBA 3ESKA 3GW4A 4EBAA 2HYZA 3CHQA 2VTBA 3L08A 4I43A 4KZ0A 5G04C 3IHVA 4P29A 1PY1A 1NA0A 4N5CA 2V4LA 3RRMB 1TJFA 4KBQA 3ZN3A 4HOQA 2LSUA 4I2WA 4ACKA 2J9QA 2KM4A 4JPSA 2BTDA 3CK9A 2L0TB 2X3MA 4APFA 1H2VC 1Z6TA 1A17A 2PQNA 2V8SE 1UG3A 3JYSA 4B94A 5BV1A 1PAQA 2VYIA 3RJVA 3B13A 3JQ0A 4I1MA 4JW1A 2VSYA 3RK6A 3T5VA 3URZA 3SF4A 4CT4A 1KLXA 1MQSA 2WMOA 2WQ6A 2R17C 3ZPJA 3CQGB 4OVUA 3TGOA 3L6AA 5LCWC 4I6EA 2UY1A 4J8SA 2XPIA 2VSXE 4GYYA 4LRZA 1E8WA 4PS3A 3IBEA 2V5FA 4L7TA 4DI3A 3FDHA 4GYOA 1TJCA 2KZTA 4I9EA 4HORA 3UT7A 3LVQE 2J49A 4FULA 4L23A 4U0UA 3Q5MA 2DBAA 2RG8A 2MRIA 3I5PA 3KS2A 3PZDA 4UQXA 3UT8A 4MS6A 2UY1B 2YHEA 4KZCA 3JUIA 4URKA 4N2SA 4G25A 2X6JA 4AV7A 4L2LA 3PH0C 1UJKA 4YVQC 4BTAA 1TEZA 1Z3YA 2XRYA 5BW8C 2L6JA 2KZTB 3FULA 4GCOA 4NRHB 5LCWJ 3ZYKA 4Y6CA 3G2VA 4A1SA 2IONA 3AU4A 3FFLA 3PVLA 4AP2A 2GRLA 4U07A 3AS4A 4J0UA 2AW6A 1HS6A 3FP3A 3LY7A 3FUKA 3QOUA 2ILRA 3Q4AB 4GCNA 4F53A 1W3BA 3FUJA 4DPRA 1IQRA 3U9WA 4HFGA 2LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME2 A;  3CVQ A;  2XCB A;  1P5Q A;  3MEK A;  3VTY A;  1ZU2 A;  5KJM A;  2KCK A;  2R5S A;  1B89 A;  1WAO 1;  1YA0 A;  2OND A;  5EX0 A;  5BT1 A;  3UQ3 A;  2XGS A;  3LKU A;  2BUG A;  2HR2 A;  3OXL A;  4KYO B;  4YND A;  3S7J A;  2C2L A;  2YQ8 A;  2PZI A;  4O6F A;  5G05 J;  3CKC A;  3LPZ A;  3N71 A;  4BTB A;  3CVP A;  3CEQ A;  4UQZ A;  2XCC A;  3RKV A;  3S7D A;  3FWV A;  4JHR A;  2HO1 A;  3GZ1 A;  4WUY A;  1WM5 A;  4EQF A;  2MHK A;  3R9A B;  4Y6W A;  2KCL A;  2Y4U A;  4G1T A;  3TG4 A;  3Q49 B;  4YVO A;  4BWR A;  4RG6 A;  3MV2 B;  3E4B A;  4AIF A;  2XEV A;  3MV3 B;  4GA0 A;  4HOU A;  5DBK A;  4J8E A;  4I9C A;  2VGY A;  5A7D B;  4W9R A;  4J8D A;  4N3B A;  4GZ6 A;  4RG9 A;  1FCH A;  2FBN A;  5CCL A;  4H7X A;  1ZBP A;  2YHC A;  3ZHE A;  4JA7 A;  4I1A A;  4BT9 A;  4CGW A;  4XIF A;  3RO2 A;  5JJT A;  5HQ8 A;  4UI9 J;  2KAT A;  1HZ4 A;  3AS5 A;  4WNG A;  5FZS A;  1QQE A;  1IYG A;  3ASG A;  1Y8M A;  3QWV A;  5JJ7 A;  1ELR A;  3K9I A;  1E96 B;  5KJK A;  1HH8 A;  4J8F A;  3ASF A;  3PE4 A;  4WNF A;  4G26 A;  3QDN A;  5BNW A;  3QWP A;  2FEZ A;  4N2Q A;  1IHG A;  4GYW A;  4G24 A;  2QFC A;  4CGV A;  3KAE A;  4GA2 A;  3LY9 A;  3MA5 A;  5DIZ A;  2VQ2 A;  2C0M A;  4N3A A;  5G05 C;  4G2V A;  5AYW D;  5CCM A;  3Q15 A;  2VGX A;  2KC7 A;  3PDN A;  5FTP A;  3TG5 A;  5FZR A;  1KT1 A;  1XNF A;  5ARF A;  2OOE A;  3CVL A;  3CKB A;  2KCV A;  3LCA A;  5FZQ A;  3Q47 B;  5ARG A;  4JL0 A;  2IF4 A;  4F3V A;  4U0S A;  5KJN A;  4APO A;  3MKR A;  5A6C A;  2JLB A;  3RU0 A;  3ULQ A;  2VSN A;  2GW1 A;  1QZ2 A;  4N3C A;  4AY6 A;  3S7B A;  5EKQ D;  2IFU A;  3OXG A;  4I2Z A;  4HOT A;  4UI9 C;  2FI7 A;  3CK7 A;  4XI9 A;  2WPV A;  3IEG A;  3ASH A;  3CVN A;  4KXK B;  3UUX A;  3PE3 A;  3ASD A;  3AS8 A;  3CV0 A;  4WND A;  2Y4T A;  3U4T A;  2UWJ G;  4GZ3 A;  4UI9 K;  3ZHE B;  2AVP A;  5M72 A;  3CK8 A;  4U04 A;  3QWW A;  5G04 J;  3EDT B;  5D0Q D;  4GPK A;  4H7Y A;  3LYA A;  1OUV A;  4NQ0 A;  2PQR A;  5C1D A;  2P58 C;  2NC9 A;  2WQH A;  4AY5 A;  4LEU A;  5CHE E;  2FF4 A;  1NZN A;  5KJL A;  4N39 A;  3U3W A;  5JJ6 A;  3RIB A;  3UPV A;  3GZ2 A;  2XGO A;  3TAX A;  4JA9 A;  3WXX A;  3ZFW A;  2LNI A;  1KT0 A;  3O48 A;  4UQY A;  5EX3 A;  4WNE A;  3NF1 A;  1HXI A;  4GZ5 A;  3KD7 A;  3SZ7 A;  2VGX B;  2Q7F A;  2C0L A;  4U0Z A;  3BEE A;  5HI7 A;  4AM9 A;  4ABN A;  2FO7 A;  2I6H A;  3QKY A;  4BT8 A;  3HYM B;  4I17 A;  1PC2 A;  3RO3 A;  5FT9 A;  3VTX A;  1NA3 A;  3S7F A;  5D0O D;  3OXF A;  2PL2 A;  4GA1 A;  4IN3 B;  3LY8 A;  5FJY A;  4XI0 A;  1ELW A;  4CDR A;  3GYZ A;  2XGM A;  3ZGQ A;  2E2E A;  3ESK A;  3GW4 A;  2HYZ A;  5G04 C;  1NA0 A;  4N5C A;  4KBQ A;  3ZN3 A;  4HOQ A;  2LSU A;  4I2W A;  2J9Q A;  3CK9 A;  2PQN A;  1A17 A;  3JYS A;  4B94 A;  2VYI A;  3RJV A;  2VSY A;  3URZ A;  3SF4 A;  1KLX A;  3ZPJ A;  3TGO A;  5LCW C;  2UY1 A;  2XPI A;  4GYY A;  2V5F A;  4GYO A;  1TJC A;  4I9E A;  4HOR A;  4U0U A;  3Q5M A;  2DBA A;  3KS2 A;  4UQX A;  2UY1 B;  4N2S A;  4G25 A;  4YVQ C;  4BTA A;  5BW8 C;  2L6J A;  4GCO A;  4NRH B;  5LCW J;  4Y6C A;  4A1S A;  3FFL A;  4HOS A;  4U07 A;  3AS4 A;  4J0U A;  3LY7 A;  3FP3 A;  3QOU A;  3Q4A B;  4GCN A;  1W3B A;  4G23 A;  2LSV A; 
#chains in the Genus database with same CATH topology
 4GU5 A;  3CVQ A;  4Q94 A;  1P5Q A;  3MEK A;  4L1B A;  4ANX A;  2XPY A;  1E8Y A;  2KCK A;  3CVU A;  4HVB A;  4R7L A;  1BI7 B;  1N4P A;  3I4G A;  4K5B A;  3NOG D;  3ULE G;  4N5Q A;  3B7S A;  3L82 A;  1DNP A;  2ZU6 B;  3R7Q A;  1HG5 A;  3TWS A;  3JUE A;  2OV8 A;  2WXM A;  4YND A;  2YQ8 A;  1Y6I A;  4HQD A;  3T5X A;  4JHK A;  5G05 J;  3CKC A;  4F7A A;  1RW2 A;  4X8Q A;  3LPZ A;  1X81 A;  3SNX A;  2EQX A;  4BTB A;  1INZ A;  2EIM E;  3W9F A;  3ZEF A;  4MLP A;  4A55 A;  1N94 A;  4MRU A;  1VDY A;  3FU3 A;  3MKQ A;  3CGH A;  1WM5 A;  4EQF A;  3R9A B;  4Y6W A;  2J07 A;  4G1T A;  3TG4 A;  3JQ1 A;  5B1B E;  4JC8 A;  2NYJ A;  1DCQ A;  5DBK A;  3UIP C;  2DYR E;  4DRX E;  4NUR A;  4AJW A;  3C3R A;  5A7D B;  5AJL A;  3LS8 A;  4J8D A;  4RG9 A;  1FCH A;  2L6B A;  5CCL A;  4FLB A;  4JB8 P;  1OWN A;  3FUI A;  2WVI A;  2ZXW E;  4OAU C;  2WXH A;  3ASO E;  4CGW A;  2H6G A;  3AG4 E;  1O5M A;  3L22 A;  1QNF A;  4GML A;  1TN7 A;  5BUZ A;  4UI9 J;  4ATG A;  1HZ4 A;  4ZHB A;  3I4R B;  3ZYQ A;  3EHM A;  2MOW A;  4FHK A;  4CDM A;  4EHM A;  4EZJ A;  2E0I A;  4E85 A;  1WY6 A;  2OEV A;  1E96 B;  5KJK A;  1HH8 A;  1SQM A;  4WNF A;  3W9G A;  4YDY A;  3PZ1 A;  3QWP A;  2FEZ A;  1IHG A;  3D9L A;  2QFC A;  4DX1 A;  3HXF A;  3ZU7 B;  3LY9 A;  4RQI A;  1O1T A;  4Z68 A;  2YIN A;  3UKU G;  2C0M A;  1UN9 A;  1LD8 A;  5AYW D;  5CEA A;  3LJ3 A;  4C48 B;  3Q15 A;  1EF1 C;  3UM2 A;  1Q2Z A;  5FTP A;  1N4Q A;  3TG5 A;  3MYV A;  4FU3 A;  2WM9 A;  3IHY A;  1KT1 A;  1XNF A;  1GW6 A;  2HE0 A;  3AJI A;  4LSZ E;  3CKB A;  5J90 A;  4TV3 A;  4HRN A;  5FZQ A;  1LD7 A;  4CDN A;  3TWW A;  3FU0 A;  1BPO A;  2X38 A;  1JPL A;  4APO A;  5A6C A;  2A4Z A;  3RU0 A;  1UN8 A;  2VSN A;  1EYH A;  1TNU A;  5EIB E;  1XGW A;  4AY6 A;  5AEN A;  2AXZ A;  3EIJ A;  3P1U A;  4U8V D;  2NXP A;  4FP7 A;  5T4Y A;  3HXC A;  3SI5 A;  5KNH D;  3HDX A;  1N11 A;  3PNT B;  2ZIS A;  4GMJ A;  5CBN A;  3CVY A;  4XKC A;  5AQ9 A;  5LOZ A;  3FTZ A;  4AVX A;  3BUA A;  4WND A;  4HB5 A;  1H2T C;  3U4T A;  1H19 A;  4GZ3 A;  4UI9 K;  4K5A B;  2GRN B;  1OWM A;  5M72 A;  4OAV B;  4FHJ A;  4U04 A;  4DX2 A;  2WXO A;  3FU5 A;  3DSU A;  3EDT B;  3TXN A;  3LYA A;  2WXL A;  4HLL A;  2IOS A;  4NQ0 A;  2PQR A;  4ANU A;  4AY5 A;  5ANR A;  3ENE A;  3C72 A;  1TNB A;  5J08 A;  4IRU A;  1JWF A;  4J6I A;  4I6G A;  2DYS E;  3DEO A;  4O60 A;  3GZ2 A;  2WXG A;  1H6P A;  2H6H A;  1KZP A;  2BKG A;  4WNE A;  3C5R A;  5CER B;  3KD7 A;  3HVE B;  2Q7F A;  3FUN A;  2M63 A;  4TRQ A;  4ABN A;  2FO7 A;  2I6H A;  2WMN A;  2OVF A;  1U3D A;  4LCT A;  4LNB A;  4ILG A;  4B89 A;  5E76 A;  1DVP A;  1TN6 A;  4BSZ B;  2WXJ A;  5EYP F;  4GA1 A;  2JAB A;  4IN3 B;  3TJP A;  2P9P G;  4IYP A;  2R02 A;  3BU8 A;  2J09 A;  4MBG A;  3CST A;  2XPZ A;  5BXO A;  4XKB A;  5AAO A;  4QQI A;  5G04 C;  1PY1 A;  1NA0 A;  4GTM A;  1UOH A;  4KBQ A;  2LSU A;  2KM4 A;  1A17 A;  5BV1 A;  5ENT D;  4JW1 A;  2J8S D;  4CT4 A;  1MQS A;  1OCR E;  4GMR A;  5FIN A;  2VSX E;  1OT8 A;  2F0Y A;  4PS3 A;  2V5F A;  4L7T A;  2RKK A;  4L23 A;  4U0U A;  3Q5M A;  3UT8 A;  3JXJ A;  1N9A A;  3JUI A;  4URK A;  4G25 A;  4AV7 A;  4BTA A;  2XEN A;  4GTV A;  4GCO A;  4NRH B;  2ETB A;  4HOS A;  4U07 A;  2AW6 A;  4G23 A;  4HFG A;  2LSV A;  4ME2 A;  2A5U A;  3TWT A;  1HU3 A;  3PUJ A;  4FJZ A;  1B89 A;  1HO8 A;  5BT1 A;  4UWL A;  3SFZ A;  3UQ3 A;  4HRM B;  4YDE A;  3Q7A A;  2XGS A;  2B0O E;  3E37 A;  1X5B A;  2BUG A;  3HXD A;  1MJ0 A;  3C3Q A;  2LXM A;  2BF0 X;  4KYO B;  3S7J A;  5HRY A;  4EPZ A;  3TWU A;  3KSQ A;  5LX8 A;  1QYM A;  3O4Z A;  2DCP A;  4K03 A;  3VLD A;  1FVF A;  1MHQ A;  3CEQ A;  5G2N A;  4UQZ A;  2XCC A;  3S7D A;  3FWV A;  2XEH A;  4WUY A;  1FT2 A;  3L17 A;  2EIJ E;  4YVO A;  3LDZ A;  1N0R A;  1HX8 A;  1ZB1 A;  5EIL A;  4BEP A;  2XEV A;  3MV3 B;  4GA0 A;  3OAW A;  2ETA A;  4J8E A;  4EZL A;  4CT0 A;  1HG2 A;  4W9R A;  2VTB B;  3LEW A;  3DXK G;  4GZ6 A;  5T3R A;  4YDW A;  5E75 A;  3DSW A;  2YHC A;  3KEZ A;  2XS8 A;  3QAR A;  2X6F A;  4JVS A;  3PS6 A;  4JA7 A;  4I1A A;  2Y1L E;  2GGF A;  3CIA A;  4HRL A;  1OWL A;  4XIF A;  3ML8 A;  1G3N B;  3ASG A;  2FUL A;  2CFZ A;  2MYO A;  4ANW A;  4M3O A;  5JJ7 A;  3D9N A;  4DX6 D;  4L2Y A;  3NZU A;  4U95 D;  3G2W A;  3CHR A;  2EIN E;  4GYW A;  4CGV A;  3B7U X;  5D2M C;  3KAE A;  4Q69 A;  2IJG X;  5EN5 D;  2ZGD A;  2IY0 C;  5DIZ A;  2VQ2 A;  4O1P A;  1NL4 A;  4N3A A;  5G05 C;  4G2V A;  4AOF A;  1S0P A;  2QY7 A;  4OVV A;  3CHP A;  4K0R A;  3DPY A;  5KBA A;  2NSZ A;  5ARF A;  3CVL A;  3NBN B;  2AXV A;  3PZ4 A;  4ACL A;  3MGB A;  2I2O A;  3Q47 B;  3CLJ A;  1RZ4 A;  3RRU A;  4JL0 A;  2WXI A;  5JHA A;  2IF4 A;  3SFX A;  4F3V A;  2V0P A;  3C3O A;  5EDS A;  3EIQ C;  3CR3 A;  3SD5 A;  3CHM A;  3L13 A;  2PNN A;  1WG0 A;  2IEJ A;  2IO2 C;  4NAC A;  4HNA D;  1BI8 B;  4GAA A;  3DST A;  3MKQ B;  3OXG A;  4K5C A;  1N0Q A;  4UI9 C;  1NFI E;  4B8A A;  4TXR A;  3PRZ A;  5IY5 E;  4LUN U;  3QJZ A;  2X6I A;  3ASH A;  2WQ7 A;  5CRV A;  3ZKJ A;  2QYJ A;  3Q7F A;  3SBS A;  3VLE A;  4CYM D;  3GZS A;  3B95 A;  1U3C A;  3AS8 A;  3J5Q B;  3QNK A;  4G11 A;  3FUD A;  2AVP A;  4FC8 A;  3G2U A;  3APD A;  4BET A;  5ITZ F;  1H0A A;  4JEH A;  4GTT A;  5D0Q D;  5EID A;  3UM3 A;  4XZ4 A;  2NC9 A;  2WXN A;  2WQH A;  4DI4 A;  3HRA A;  4LEU A;  5CHE E;  2Y3A A;  3UIN C;  5KJL A;  2WB2 A;  5T8I A;  3EHN A;  1E7U A;  3ML9 A;  2HM8 A;  5AQ7 A;  5AIJ A;  1OCZ E;  4Q96 A;  3L16 A;  3HIZ A;  3ZW3 A;  2OVB A;  3Q9N C;  2XGO A;  3UM1 A;  3ZFW A;  4UQY A;  5EX3 A;  4DJA A;  1HXI A;  4GZ5 A;  3PUK A;  4IUL A;  3SZ7 A;  1IHB A;  2L0I A;  2H6F A;  1JCS A;  2LAI A;  1MX4 A;  1OWO A;  3ISM C;  4AM9 A;  5LP0 A;  1EPU A;  1FT1 A;  1L5J A;  4TXP A;  3FTX A;  2GRM A;  4U96 D;  4PDX A;  4I17 A;  2QYU A;  4F1S A;  3LVR E;  2RFM A;  4RVB A;  5FT9 A;  3S7F A;  4ILI A;  2PL2 A;  3UIO C;  2WXP A;  2DWZ A;  4WAF A;  2EIL E;  4OYS A;  3ONK A;  5KWD A;  3G2T A;  3Q79 A;  3HG0 D;  5HKP A;  4EBA A;  2P2C P;  3L08 A;  1BLX B;  3RRM B;  4HOQ A;  2J9Q A;  3E32 A;  4BES A;  4TUM A;  4JPS A;  2BTD A;  2EIK E;  3CK9 A;  1DCE A;  4APF A;  1FPP A;  1H2V C;  2V8S E;  2P9U G;  4B94 A;  2VYI A;  1IKN D;  3RK6 A;  3JQ0 A;  2Y69 E;  2VSY A;  3URZ A;  1TYQ G;  1S64 A;  4OVU A;  3V31 A;  3TGO A;  1TR4 A;  4I6E A;  2RFA A;  2XPI A;  1E8W A;  4HBD A;  3IBE A;  4DI3 A;  3FDH A;  4GYO A;  1TJC A;  4FUL A;  2LUH A;  3KS2 A;  1TNY A;  4N2S A;  5CRU A;  1TEZ A;  5BW8 C;  1TNZ A;  4Y6C A;  3G2V A;  5AQA A;  3PZ2 A;  2ION A;  3FFL A;  3PVL A;  4AP2 A;  2XS1 A;  1HS6 A;  3Q9U C;  3Q4A B;  4GCN A;  1W3B A;  3UTM A;  3FUJ A;  4O1O A;  3FUF A;  1LF8 A;  4WWO A;  4F1P A;  1ZU2 A;  2L9B A;  4G8K A;  2R5S A;  1WAO 1;  2OND A;  4E6H A;  1E8Z A;  2I9C A;  4U8Y D;  3DBS A;  3NQP A;  4U8H A;  5ENS D;  3X2Q E;  2HR2 A;  3OXL A;  3AAA C;  3JXI A;  4FAD A;  1JCR A;  3NAW A;  3ZUV B;  3UXG A;  2C2L A;  4O6F A;  2PM6 A;  5BV0 A;  4XEI G;  3NZS A;  4U7E B;  2R2L A;  3DRA A;  3CVP A;  5ENP D;  3FEX A;  1YMP A;  3B7R L;  3RKV A;  1N4S A;  2KCL A;  4RG6 A;  3R7R A;  4FJY A;  3I3N A;  4JD2 G;  3MV2 B;  3DPD A;  3E4B A;  2DIW A;  3AU5 A;  3LJN A;  4BFR A;  4HOU A;  3D9M A;  1Z3X A;  3TWR A;  4HS2 A;  2FBN A;  4H7X A;  1KZO A;  1D8D A;  2IQC A;  3QK0 A;  4A63 B;  3ZHE A;  2J4B A;  2WXF A;  4BT9 A;  1UJJ A;  2VGE A;  5JJT A;  1Z5S C;  4L9P A;  3DSV A;  2KAT A;  2I1K A;  4WNG A;  1V54 E;  3FY4 A;  5ENR D;  4HI8 A;  1E7V A;  4G26 A;  3KSL A;  2GRP B;  3PRE A;  4A3T A;  3D9O A;  3FUM A;  3BQO A;  5BNW A;  4G24 A;  2ZIR A;  3E30 A;  4XE0 A;  4GA2 A;  4F6R D;  4J8Y A;  2P9K G;  3R9M A;  3FTS A;  3MA5 A;  1JWG A;  3DXM G;  3ZIM A;  3ZYM A;  3AG3 E;  4ILH B;  4DLQ A;  1MX2 A;  4JHJ A;  3Q73 A;  1DC2 A;  2VGX A;  4V3I A;  1MZC A;  4LNU D;  3PDN A;  5JA4 D;  2OOE A;  2AWI A;  3D9I A;  2J4D A;  3TWV A;  5FQ8 A;  3FH7 A;  2GRR B;  2XZT G;  3FTY A;  1H6K A;  3G2S A;  4LG6 A;  3DWL G;  5FIO A;  3BG1 B;  4GTS A;  2JLB A;  5CMY A;  2JEK A;  3ULQ A;  4MKT A;  3NB2 A;  4N3C A;  2XQ0 A;  2I1J A;  4GZD A;  3RSE G;  4C0E A;  4DX7 D;  2IFU A;  4TXQ A;  2WXR A;  5CEC B;  2FI7 A;  4XI9 A;  3D9K A;  4UWH A;  3ULY A;  2WPV A;  3IEG A;  3L54 A;  4B8C B;  4CEM A;  3CVV A;  2X6H A;  2DZO A;  4KXK B;  2CFU A;  3UUX A;  1HFA A;  3BG0 B;  4WWN A;  1MYO A;  3UKR G;  2P9S G;  4CCA A;  3D9H A;  2Y4T A;  1AP7 A;  2UWJ G;  2F8X K;  3JCK C;  2F8Y A;  3DSX A;  4J7W A;  4C9B B;  2AXU A;  3CK8 A;  5C2Y A;  1SVX A;  3EUV A;  4WWP A;  3QWW A;  5FQ7 A;  3L9T A;  2XRZ A;  4CZ2 D;  4ANV A;  3DEP A;  5EYL A;  1SA5 A;  3ZXP A;  4DLO A;  1S63 A;  4H7Y A;  4PH4 B;  1YCS B;  5C1D A;  2P58 C;  3V30 A;  1SA4 A;  4DK5 A;  1NZN A;  3IKO B;  4N39 A;  4AEZ C;  5JJ6 A;  5B1A E;  3UPV A;  1JUQ A;  2OCC E;  3FH8 A;  1BU9 A;  4GTO A;  1AWC B;  3TAX A;  4JA9 A;  4B93 B;  2CHX A;  3HHM A;  1KT0 A;  3O48 A;  4KVO A;  3NF1 A;  1OWP A;  1D8E A;  2C0L A;  1YYH A;  3D3M A;  3SGH A;  3ZRH A;  3Q78 A;  3MCX A;  3BEE A;  5HI7 A;  2V4H C;  3TXM A;  3ZVV A;  4ZFH A;  3QKY A;  3V79 K;  3HYM B;  5AJD A;  4FA6 A;  2R59 A;  3C98 A;  3MJW A;  1SZA A;  3RRN B;  4GTR A;  3ASN E;  1K8K G;  2XEE A;  1TNO A;  4EEC A;  4GZC A;  5FQ6 A;  5D0O D;  3SFY A;  5BPP A;  3APF A;  3CVX A;  3FUH A;  4UWK A;  3LY8 A;  3FU6 A;  3GYZ A;  4PS7 A;  5G55 A;  1LTX A;  3FTW A;  3ESK A;  3GW4 A;  2HYZ A;  3CHQ A;  3DSS A;  4I43 A;  4KZ0 A;  4P29 A;  4I2W A;  4ACK A;  2IO3 C;  2X3M A;  3J5P A;  2PQN A;  2DZN A;  1UG3 A;  1PAQ A;  3HXE A;  3B13 A;  4I1M A;  3T5V A;  2WQ6 A;  2R17 C;  4LRZ A;  3WG7 E;  2KZT A;  4LNG A;  4ATZ D;  2J49 A;  3PZD A;  2MRI A;  2GRQ B;  4MS6 A;  2R05 A;  1OY3 D;  3PH0 C;  1OXJ A;  1UJK A;  1Z3Y A;  2KZT B;  3ZYK A;  1OCO E;  3AS4 A;  3LY7 A;  3FP3 A;  3FUK A;  3QOU A;  4DPR A;  1KPS B;  2XCB A;  2LO6 A;  2ZGG A;  3VTY A;  2F37 A;  3V2O A;  5KJM A;  3FTU A;  3APC A;  1YA0 A;  4JXT A;  5EX0 A;  3ABM E;  3T9K A;  3TWX A;  3LKU A;  4GB9 A;  1BD8 A;  5ENN A;  3RAU A;  3SBT B;  3ZXS A;  3QAQ A;  3T8K A;  2PZI A;  2FO1 E;  1JCQ A;  4C0M A;  1TN8 A;  2BED A;  4BY6 A;  3N71 A;  2R03 A;  2VJ8 A;  3TL5 A;  1HE8 A;  2OEW A;  2KBX A;  3EU5 A;  4I6J A;  2HO1 A;  4I1O B;  2X6K A;  3GZ1 A;  4JHR A;  3UM0 A;  2MHK A;  4JZY A;  2Y4U A;  3Q49 B;  4BWR A;  1IQU A;  3P2B A;  4AIF A;  2QZA A;  3V2X A;  4I9C A;  2VGY A;  3B7B A;  5A23 A;  4N3B A;  4QFV A;  5H7P A;  1ZBP A;  4HXI A;  1N54 A;  3EU9 A;  4LER A;  1UW4 B;  2WXK A;  5D66 A;  4XX5 A;  3EJN A;  3RO2 A;  3LXU X;  5HQ8 A;  2CG2 A;  3AS5 A;  1K1B A;  4A1G A;  5FZS A;  1QQE A;  1IYG A;  1D9S A;  5ENQ D;  1Y8M A;  4HLE A;  3QB2 A;  3QWV A;  1ELR A;  3K9I A;  4BSX A;  4J8F A;  3ASF A;  3PE4 A;  3U64 A;  3OTN A;  3SY2 A;  3SQV A;  3QDN A;  2PM7 A;  3EHR A;  4N2Q A;  2QC9 A;  2LXL A;  4BX9 A;  3CHS A;  1MX6 A;  1E8X A;  4PS8 A;  1NP7 A;  3IV0 A;  5CCM A;  1H6O A;  1SZ9 A;  3HVE A;  2KC7 A;  4HI9 A;  4A3V A;  2RD0 A;  1K3Z D;  5FZR A;  1EDU A;  2CG3 A;  2P9L G;  4GTP A;  2VSO E;  3PZ3 A;  2B6C A;  2KCV A;  3LCA A;  4CRW A;  5ARG A;  3AG1 E;  3UX4 A;  4U0S A;  5KJN A;  2CHW A;  4UWG A;  5AN8 A;  3MKR A;  3FTV A;  3AG2 E;  1O1S A;  4BX8 A;  4M7C A;  4DX5 D;  3PEU B;  3D9P A;  1ELK A;  2GW1 A;  2V5Q C;  1QZ2 A;  1N95 A;  4FLH A;  1N52 A;  3UI2 A;  4KT6 B;  5FWQ A;  5B3S E;  3S7B A;  5EKQ D;  2J08 A;  5AQB A;  4I2Z A;  1O1R A;  4HOT A;  3SHF A;  4EZK A;  3CK7 A;  2A5E A;  3ABK E;  2WXQ A;  3CVN A;  3ZYL A;  5CMW A;  4U63 A;  3PE3 A;  4KMO A;  3NOC D;  3QC1 A;  3ASD A;  3CV0 A;  2P9N G;  4EBA G;  4GTQ A;  4RSY A;  5ANL A;  3ZHE B;  3T8M A;  3E34 A;  3CSF A;  2DVW A;  3F6Q A;  3CQC B;  5G04 J;  5CED B;  4PUC A;  2P9I G;  4TUU A;  3MZL B;  3U66 A;  4GPK A;  1E90 A;  1OUV A;  4JEU A;  2BKK B;  2IOL A;  2YNQ A;  4YDO A;  3CHO A;  2FF4 A;  2IU1 A;  2GRO B;  1SW6 A;  4D10 C;  2Y0B G;  1V55 E;  2XHE A;  3U3W A;  5KNG A;  5LFA A;  3PEV B;  4GPM A;  3RIB A;  4B0Z A;  1S70 B;  3VLF A;  3UT4 A;  4AXH A;  2ETC A;  4UUC A;  3WXX A;  2LNI A;  3SO8 A;  1A5E A;  3ESL A;  3TWQ A;  3B7T A;  2VGX B;  5AAR A;  4NIK A;  3FUE A;  4U0Z A;  3ZNG A;  3PNL B;  3Q75 A;  2H6I A;  1K1A A;  4BER A;  3ABL E;  5ENO D;  4BT8 A;  5FQ4 A;  3HXB A;  1PC2 A;  3RO3 A;  3MX3 A;  5JHB A;  1FVH A;  3VTX A;  4KVM A;  1NA3 A;  3IXE A;  3CVW A;  3OXF A;  1H2U A;  5KCM A;  1HF8 A;  3ONL A;  2CHZ A;  4DUI A;  3UMV A;  5FJY A;  3FH5 A;  4XI0 A;  1ELW A;  4CDR A;  3S2A A;  2XGM A;  4UWF A;  3ZGQ A;  2LAH A;  3FHE A;  3FEY A;  2E2E A;  3D9J A;  2VTB A;  3E33 A;  3IHV A;  2AJA A;  1QBQ A;  1IXV A;  4N5C A;  2V4L A;  1TJF A;  3ZN3 A;  1U2V G;  2L0T B;  2KXP C;  1Z6T A;  3JYS A;  1NI1 A;  3RJV A;  3SF4 A;  1KLX A;  2WMO A;  1N4R A;  5HS0 A;  3ZPJ A;  3CQG B;  3L6A A;  5LCW C;  2UY1 A;  4J8S A;  4GYY A;  5JMN D;  4I9E A;  4HOR A;  3UT7 A;  3LVQ E;  4UQX A;  2DBA A;  2RG8 A;  3I5P A;  4RLY A;  4G8L A;  3KEA A;  2UY1 B;  2YHE A;  4KZC A;  2X6J A;  4L2L A;  2XZD G;  4YVQ C;  2XRY A;  2L6J A;  3FUL A;  5LCW J;  5CBO A;  4A1S A;  3AU4 A;  2GRL A;  4J0U A;  2ILR A;  1WDY A;  1OCC E;  4F53 A;  3EHQ A;  1IQR A;  3U9W A;  5BXU A; 
#chains in the Genus database with same CATH homology
 4ME2 A;  4GU5 A;  2A5U A;  3CVQ A;  3FUF A;  4Q94 A;  1LF8 A;  2XCB A;  1P5Q A;  2LO6 A;  3MEK A;  4L1B A;  4WWO A;  3VTY A;  1HU3 A;  4ANX A;  1ZU2 A;  2L9B A;  3PUJ A;  2XPY A;  3FTU A;  5KJM A;  1E8Y A;  2KCK A;  3CVU A;  4HVB A;  4FJZ A;  2R5S A;  3APC A;  1B89 A;  1WAO 1;  1YA0 A;  4JXT A;  1HO8 A;  2OND A;  5EX0 A;  5BT1 A;  4E6H A;  4UWL A;  4R7L A;  1E8Z A;  3SFZ A;  3UQ3 A;  2I9C A;  3I4G A;  2XGS A;  3DBS A;  3NQP A;  3LKU A;  4GB9 A;  4U8H A;  3B7S A;  1X5B A;  1DNP A;  2BUG A;  5ENN A;  2ZU6 B;  2HR2 A;  1HG5 A;  3OXL A;  3R7Q A;  3SBT B;  2BF0 X;  4FAD A;  2OV8 A;  2WXM A;  4KYO B;  3ZXS A;  3QAQ A;  4YND A;  3S7J A;  4EPZ A;  2C2L A;  2YQ8 A;  1Y6I A;  3T5X A;  2PZI A;  4JHK A;  4O6F A;  5LX8 A;  5G05 J;  2PM6 A;  3CKC A;  4C0M A;  4F7A A;  3O4Z A;  3LPZ A;  4BY6 A;  5BV0 A;  3N71 A;  2DCP A;  2EQX A;  3SNX A;  3NZS A;  2VJ8 A;  4K03 A;  3TL5 A;  3VLD A;  4BTB A;  1FVF A;  1INZ A;  3CVP A;  1MHQ A;  1HE8 A;  3CEQ A;  5G2N A;  4G23 A;  4UQZ A;  3FEX A;  3ZEF A;  4MLP A;  4A55 A;  2XCC A;  1VDY A;  3FU3 A;  3B7R L;  4MRU A;  3RKV A;  3S7D A;  3MKQ A;  3FWV A;  4I6J A;  3CGH A;  2HO1 A;  2X6K A;  3GZ1 A;  4I1O B;  4JHR A;  1WM5 A;  4WUY A;  4EQF A;  2MHK A;  3R9A B;  4Y6W A;  3L17 A;  2J07 A;  4JZY A;  2KCL A;  2Y4U A;  4G1T A;  3TG4 A;  3Q49 B;  4YVO A;  3LDZ A;  4RG6 A;  3JQ1 A;  3R7R A;  4BWR A;  4FJY A;  1HX8 A;  3I3N A;  1IQU A;  3P2B A;  3MV2 B;  3DPD A;  3E4B A;  2DIW A;  3AU5 A;  4AIF A;  2XEV A;  3MV3 B;  4GA0 A;  4JC8 A;  4BFR A;  4HOU A;  3OAW A;  4HOS A;  5DBK A;  4J8E A;  3D9M A;  1Z3X A;  4NUR A;  4EZL A;  4I9C A;  4AJW A;  2VGY A;  4CT0 A;  5A7D B;  1HG2 A;  5AJL A;  3LS8 A;  5A23 A;  4W9R A;  2VTB B;  3LEW A;  4J8D A;  4N3B A;  4QFV A;  4GZ6 A;  4RG9 A;  5T3R A;  4HS2 A;  1FCH A;  2FBN A;  5E75 A;  5CCL A;  4H7X A;  4FLB A;  1ZBP A;  2IQC A;  4HXI A;  2YHC A;  3KEZ A;  3QK0 A;  1OWN A;  3FUI A;  3QAR A;  3ZHE A;  2WVI A;  2J4B A;  2X6F A;  2WXF A;  4JVS A;  1N54 A;  3PS6 A;  4JA7 A;  4I1A A;  4BT9 A;  2WXH A;  4LER A;  2GGF A;  4CGW A;  3CIA A;  1UJJ A;  1UW4 B;  2WXK A;  3L22 A;  1QNF A;  1OWL A;  4XIF A;  4GML A;  4XX5 A;  3EJN A;  3RO2 A;  5JJT A;  5BUZ A;  3ML8 A;  3LXU X;  5HQ8 A;  2CG2 A;  4UI9 J;  2KAT A;  4ATG A;  2I1K A;  1HZ4 A;  3AS5 A;  3I4R B;  4WNG A;  4A1G A;  3ZYQ A;  3EHM A;  5FZS A;  2MOW A;  1QQE A;  1IYG A;  3FY4 A;  3ASG A;  1Y8M A;  2FUL A;  2CFZ A;  4FHK A;  4HLE A;  3QB2 A;  4ANW A;  3QWV A;  4CDM A;  4M3O A;  5JJ7 A;  1ELR A;  4EZJ A;  2E0I A;  4E85 A;  3D9N A;  1WY6 A;  3K9I A;  4BSX A;  4L2Y A;  1E96 B;  5KJK A;  1HH8 A;  4J8F A;  1SQM A;  3ASF A;  3PE4 A;  1E7V A;  3OTN A;  4WNF A;  3U64 A;  4G26 A;  3NZU A;  3QDN A;  3PRE A;  2PM7 A;  4A3T A;  3G2W A;  3CHR A;  3D9O A;  3FUM A;  5BNW A;  3QWP A;  2FEZ A;  4N2Q A;  1IHG A;  3D9L A;  4GYW A;  4G24 A;  2QFC A;  4CGV A;  3B7U X;  4BX9 A;  4XE0 A;  3KAE A;  4GA2 A;  4Q69 A;  2IJG X;  3CHS A;  3LY9 A;  3FTS A;  1E8X A;  3MA5 A;  5DIZ A;  2YIN A;  1JWG A;  2VQ2 A;  4PS8 A;  1NP7 A;  2C0M A;  1UN9 A;  4N3A A;  3ZIM A;  5G05 C;  4G2V A;  4AOF A;  3ZYM A;  1S0P A;  5AYW D;  3LJ3 A;  4ILH B;  3IV0 A;  4DLQ A;  2QY7 A;  5CCM A;  4JHJ A;  3Q15 A;  1EF1 C;  4OVV A;  1SZ9 A;  2VGX A;  3HVE A;  4V3I A;  2KC7 A;  3PDN A;  4A3V A;  5FTP A;  3CHP A;  2RD0 A;  4K0R A;  3MYV A;  4FU3 A;  5FZR A;  3TG5 A;  2WM9 A;  1EDU A;  3IHY A;  1KT1 A;  2NSZ A;  1XNF A;  1GW6 A;  5ARF A;  2CG3 A;  2OOE A;  2AWI A;  3CVL A;  3D9I A;  2AXV A;  2J4D A;  2VSO E;  4ACL A;  3CKB A;  5J90 A;  5FQ8 A;  3MGB A;  4TV3 A;  2I2O A;  2KCV A;  3LCA A;  5FZQ A;  3Q47 B;  3CLJ A;  3RRU A;  3FH7 A;  4CDN A;  3FTY A;  5ARG A;  1H6K A;  4JL0 A;  4CRW A;  3FU0 A;  2WXI A;  3UX4 A;  5JHA A;  1BPO A;  2IF4 A;  4F3V A;  2V0P A;  2X38 A;  4U0S A;  1JPL A;  5KJN A;  2CHW A;  5EDS A;  4APO A;  3G2S A;  4UWG A;  3MKR A;  3FTV A;  3EIQ C;  3CR3 A;  3SD5 A;  3CHM A;  3L13 A;  5A6C A;  3BG1 B;  2A4Z A;  4BX8 A;  2JLB A;  5CMY A;  3RU0 A;  3PEU B;  2JEK A;  3D9P A;  1UN8 A;  3ULQ A;  2VSN A;  1EYH A;  1ELK A;  4MKT A;  2GW1 A;  1QZ2 A;  1XGW A;  4N3C A;  2XQ0 A;  4NAC A;  5AEN A;  4FLH A;  4AY6 A;  1N52 A;  4KT6 B;  5FWQ A;  2I1J A;  3S7B A;  2AXZ A;  4GAA A;  3EIJ A;  4GZD A;  3P1U A;  4C0E A;  3MKQ B;  5EKQ D;  2J08 A;  2IFU A;  2NXP A;  3OXG A;  4FP7 A;  5T4Y A;  2WXR A;  4I2Z A;  4HOT A;  3SHF A;  4EZK A;  4UI9 C;  2FI7 A;  3CK7 A;  4XI9 A;  3SI5 A;  3D9K A;  4UWH A;  3HDX A;  3PRZ A;  4B8A A;  2WPV A;  3IEG A;  4LUN U;  3QJZ A;  3PNT B;  3L54 A;  4B8C B;  2X6I A;  3ASH A;  4CEM A;  2WXQ A;  3CVV A;  2X6H A;  3CVN A;  2WQ7 A;  4KXK B;  3ZYL A;  4GMJ A;  5CMW A;  2CFU A;  3UUX A;  4U63 A;  3SBS A;  1HFA A;  3BG0 B;  3CVY A;  3PE3 A;  4KMO A;  3VLE A;  4XKC A;  4WWN A;  3GZS A;  3QC1 A;  3ASD A;  1U3C A;  3FTZ A;  5LOZ A;  3AS8 A;  4AVX A;  4CCA A;  3CV0 A;  4EBA G;  4WND A;  2Y4T A;  4RSY A;  3QNK A;  1H2T C;  2UWJ G;  5ANL A;  1H19 A;  4GZ3 A;  3JCK C;  4UI9 K;  3U4T A;  3ZHE B;  4G11 A;  3FUD A;  3T8M A;  2AVP A;  3CSF A;  5M72 A;  1OWM A;  4C9B B;  4FC8 A;  3G2U A;  2AXU A;  3APD A;  3CK8 A;  4FHJ A;  5C2Y A;  3CQC B;  4U04 A;  4WWP A;  3QWW A;  5FQ7 A;  1H0A A;  5G04 J;  2XRZ A;  4PUC A;  2WXO A;  4TUU A;  3FU5 A;  4ANV A;  4JEH A;  3MZL B;  3EDT B;  5D0Q D;  4DLO A;  3U66 A;  3TXN A;  4GPK A;  1E90 A;  4H7Y A;  3LYA A;  4PH4 B;  2WXL A;  1OUV A;  4XZ4 A;  2IOS A;  4NQ0 A;  4JEU A;  2PQR A;  5C1D A;  2P58 C;  2WXN A;  2NC9 A;  2WQH A;  4ANU A;  4DI4 A;  4AY5 A;  5ANR A;  4LEU A;  4DK5 A;  2IOL A;  2YNQ A;  5CHE E;  2Y3A A;  3CHO A;  2FF4 A;  2IU1 A;  1NZN A;  3ENE A;  5KJL A;  4D10 C;  3IKO B;  2WB2 A;  5T8I A;  4N39 A;  3EHN A;  1E7U A;  3ML9 A;  2XHE A;  3U3W A;  2HM8 A;  5LFA A;  4AEZ C;  3PEV B;  5JJ6 A;  5AIJ A;  3RIB A;  4B0Z A;  5J08 A;  4IRU A;  1JWF A;  3VLF A;  4J6I A;  3UPV A;  4Q96 A;  3L16 A;  1JUQ A;  3HIZ A;  3FH8 A;  4I6G A;  3UT4 A;  4AXH A;  3ZW3 A;  2OVB A;  3GZ2 A;  2XGO A;  3TAX A;  4JA9 A;  2WXG A;  2CHX A;  3WXX A;  3HHM A;  3ZFW A;  2LNI A;  1KT0 A;  3O48 A;  3ESL A;  4UQY A;  5EX3 A;  4DJA A;  4KVO A;  4WNE A;  3NF1 A;  1HXI A;  3B7T A;  4GZ5 A;  3KD7 A;  3PUK A;  4IUL A;  3SZ7 A;  2VGX B;  3HVE B;  1OWP A;  2Q7F A;  2C0L A;  2L0I A;  3FUN A;  3D3M A;  2M63 A;  3SGH A;  2LAI A;  3FUE A;  3ZRH A;  1OWO A;  3MCX A;  4U0Z A;  3BEE A;  5HI7 A;  3PNL B;  4AM9 A;  4TRQ A;  5LP0 A;  4ABN A;  1EPU A;  3TXM A;  2FO7 A;  2I6H A;  3ZVV A;  2WMN A;  1L5J A;  3FTX A;  2OVF A;  2GRM A;  3QKY A;  1U3D A;  4BT8 A;  3HYM B;  4PDX A;  5AJD A;  5FQ4 A;  4I17 A;  1PC2 A;  2R59 A;  4LCT A;  4FA6 A;  3C98 A;  3MJW A;  1SZA A;  3RRN B;  3RO3 A;  3MX3 A;  5JHB A;  4F1S A;  3LVR E;  1FVH A;  4ILG A;  4RVB A;  5FT9 A;  3VTX A;  4KVM A;  1NA3 A;  4EEC A;  4GZC A;  3CVW A;  5FQ6 A;  3S7F A;  5D0O D;  4B89 A;  3OXF A;  1H2U A;  4ILI A;  5E76 A;  1DVP A;  2PL2 A;  1HF8 A;  3APF A;  5KCM A;  2WXJ A;  3ONL A;  5BPP A;  4GA1 A;  3FUH A;  3CVX A;  2WXP A;  2CHZ A;  4IN3 B;  3TJP A;  4UWK A;  3LY8 A;  5FJY A;  4IYP A;  3UMV A;  3FH5 A;  4XI0 A;  1ELW A;  4CDR A;  4WAF A;  3FU6 A;  3GYZ A;  4PS7 A;  3S2A A;  4OYS A;  2J09 A;  2XGM A;  5G55 A;  3CST A;  2XPZ A;  4UWF A;  3ZGQ A;  2LAH A;  3FHE A;  3FEY A;  2E2E A;  3D9J A;  3FTW A;  3G2T A;  3ONK A;  4XKB A;  3ESK A;  3GW4 A;  4EBA A;  2HYZ A;  3CHQ A;  2VTB A;  3L08 A;  4I43 A;  4KZ0 A;  5G04 C;  3IHV A;  4P29 A;  1PY1 A;  1NA0 A;  4N5C A;  2V4L A;  3RRM B;  1TJF A;  4KBQ A;  3ZN3 A;  4HOQ A;  2LSU A;  4I2W A;  4ACK A;  2J9Q A;  2KM4 A;  4JPS A;  2BTD A;  3CK9 A;  2L0T B;  2X3M A;  4APF A;  1H2V C;  1Z6T A;  1A17 A;  2PQN A;  2V8S E;  1UG3 A;  3JYS A;  4B94 A;  5BV1 A;  1PAQ A;  2VYI A;  3RJV A;  3B13 A;  3JQ0 A;  4I1M A;  4JW1 A;  2VSY A;  3RK6 A;  3T5V A;  3URZ A;  3SF4 A;  4CT4 A;  1KLX A;  1MQS A;  2WMO A;  2WQ6 A;  2R17 C;  3ZPJ A;  3CQG B;  4OVU A;  3TGO A;  3L6A A;  5LCW C;  4I6E A;  2UY1 A;  4J8S A;  2XPI A;  2VSX E;  4GYY A;  4LRZ A;  1E8W A;  4PS3 A;  3IBE A;  2V5F A;  4L7T A;  4DI3 A;  3FDH A;  4GYO A;  1TJC A;  2KZT A;  4I9E A;  4HOR A;  3UT7 A;  3LVQ E;  2J49 A;  4FUL A;  4L23 A;  4U0U A;  3Q5M A;  2DBA A;  2RG8 A;  2MRI A;  3I5P A;  3KS2 A;  3PZD A;  4UQX A;  3UT8 A;  4MS6 A;  2UY1 B;  2YHE A;  4KZC A;  3JUI A;  4URK A;  4N2S A;  4G25 A;  2X6J A;  4AV7 A;  4L2L A;  3PH0 C;  1UJK A;  4YVQ C;  4BTA A;  1TEZ A;  1Z3Y A;  2XRY A;  5BW8 C;  2L6J A;  2KZT B;  3FUL A;  4GCO A;  4NRH B;  5LCW J;  3ZYK A;  4Y6C A;  3G2V A;  4A1S A;  2ION A;  3AU4 A;  3FFL A;  3PVL A;  4AP2 A;  2GRL A;  4U07 A;  3AS4 A;  4J0U A;  2AW6 A;  1HS6 A;  3FP3 A;  3LY7 A;  3FUK A;  3QOU A;  2ILR A;  3Q4A B;  4GCN A;  4F53 A;  1W3B A;  3FUJ A;  4DPR A;  1IQR A;  3U9W A;  4HFG A;  2LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...