4J8GA

Crystal structure of alpha-cop/e19 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
327
structure length
298
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule keywords coatomer subunit alpha
molecule tags Protein transport
total genus 74
structure length 298
sequence length 327
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j8gA00
1U2VC 3RFHA 4JT6C 5HQGA 5FKRA 5IJ8E 1VYHC 4D6VA 4J84A 4J87A 1R5MA 1NEXB 3VH0A 4A0AB 3DSMA 2AGLA 3AFCA 5CXBB 3MXXA 4J73A 3A0FA 4JSNC 3DM0A 3PSCB 2QC5A 4J77A 3VA6A 4O9DA 5CXBA 3FGBA 3GFCA 3CFVA 5H14A 4L3GD 5IGOA 3UKRC 3E0CA 5EALA 4JT5C 4JXMA 3ORVD 5I5IA 4A11A 4CI1A 2B5NA 2CE9A 5EM2B 2P9NC 2UZYB 2AGWA 1GG2B 3JB9L 3L4MD 2P9SC 4PSXB 5EM2A 1GXRA 3SMRA 2H3XA 2IUQA 2OVQB 4A7JA 2XYIA 1QNIA 3I7LA 5EARA 4K3ID 3UVLA 4FA5D 1XKSA 2TRCB 1JOFA 2CE8A 4FA1D 3PXSD 5SXMA 3P4FA 4J86A 4HDJA 4GQBB 4FA9D 5AJAA 4UI9R 4ERQA 3PVUB 4G56B 3EU7A 3V9FA 5TF2A 3UVKA 4ZN4A 4ZOYA 1ERJA 1MG2A 2PM9A 2I0TA 5HE0B 1OMWB 3ODTA 5HE2B 3ZWLB 2XL2A 1XIPA 2HXCA 5EAPA 2H6NA 3OKYA 2IUVA 4PBYA 4CY5A 3BG0A 3EI2A 2YNOA 3IJ0A 4PNKB 1JMZB 3N0EA 5H1MA 5K19A 2Q7QA 3C75H 3AH8B 5FA5B 1K8KC 4ERZA 3DWLC 4E54B 3CIKB 4U7AA 4H5JA 2XL3A 2AGYA 3C9CA 3SXTD 2IURA 4R7AB 4E54A 1PI6A 3NVXA 4MK0B 3EI4A 3J81g 2G9AA 4FWWA 3MKQA 4ZOVA 3AL8B 4OWRA 3F3GA 2GC4A 3UR4A 2IWKA 4PXWA 5EAMA 2B5LA 4A09B 2XU7A 5EMMB 4OZUA 3RLMD 4FHLA 3UVOA 5AMSA 5C2WB 3SLED 3EI3A 3U4YA 3JZGA 2P9PC 5TDHB 4JSPC 4A08B 4LG8A 1L0QA 1MDAH 2Z2NA 3MZKA 3K26A 3NVNA 4GZ8A 3MKSB 4XYHA 3SVWD 2I3SA 5IC7A 4CI3A 2H68A 4A08A 3PXWD 4J82A 5I5MA 3VGZA 5AFU3 3NVQA 2BCJB 3IIYA 5HE3B 4CI2A 3PSLA 4J79A 1TYQC 4A11B 3UKUC 1N6DA 1N6EA 2OVPB 3KRXB 5THAA 2OK4A 4GQ1A 2B4EA 2YBAA 4EWRA 1OLZA 4L3HD 3OW8A 5K1CC 4GM3A 4J81A 4J8GA 3W15A 1NR0A 2J55H 2H9MA 4CC9A 3KRWB 5EMJB 3B7FA 4O3TB 3F3FA 2YNPA 5C9ZB 3IJ1A 2P9IC 5KDOB 3JAMg 2QXVA 5GMKn 2H9PA 2CN3A 3I7KA 3OKTA 2H6QA 4Y7RA 3PE7A 4CY2A 1XHMA 1TBGA 3HFQA 5GSAA 2PM9B 4AOWA 3UVMA 3I89A 3I7PA 5EMLB 3SWSD 3RN0D 5IT9g 3DXKC 2HJ4A 3OKYB 2Z2PA 2J57G 3SBRA 3L4OD 3EI2B 5FQDA 2HKRA 3BG1A 4FA4D 4IA9A 3SFZA 4L1QD 3RMZD 4GM8A 5A2Qg 2GNQA 3K27A 4BL0A 4N14A 4CZVA 4QQEA 1A0RB 4H5IA 1S4UX 4FAVD 5CYKB 2G99A 3I7NA 4O45A 3C5MA 3EI4B 5TEEA 2PM7B 4CY1A 5CYKA 3C99A 3OL2B 4PBZA 4CZXA 4XEIC 5FXYA 3V7DB 2PBIB 2H14A 4J8BA 3I2NA 3OL2A 2OVRB 2YNNA 4YVDA 3MMYA 3EI3B 3F3PA 3JZNA 3EWEA 5CXCA 3RSEC 2H6KA 4NSXA 3SHFA 2AH1A 4I79A 1P22A 1GP2B 4LGNA 3JRPA 4QT8A 3RN1D 4J0WA 4PC0A 5I5JA 1JJUB 2I0RA 4X61B 3BWSA 2J56H 3AL9A 3PVWB 3SCYA 3I8EA 3SBQA 4ES0A 3N0DA 2CN2A 3EI1A 4CY3A 2CO0C 4O1QD 4FB1D 2P9KC 2IUPA 2H47A 1GOTB 1N6FA 3RFGA 1B9XA 3GREA 5B4WA 4JD2C 5HE1B 4CI8A 3ULEC 4CZYA 4ZOZA 3IKOA 4Y5RD 4A2LA 1PBYB 2YB8B 4FAND 4GM9A 5JWZA 4IMMA 1YFQA 2I3TA 4JSVC 4A0AA 4ERYA 3DXMC 4QRJA 4X3EA 2HKMA 5GXHA 5IJ7E 3J80g 3JZHA 2HJBA 4XYIA 2IWFA 5TEFA 5IGQA 2GC7A 1PEVA 4GGCA 4D0KA 4A0BB 3SBPA 2I0SA 2H13A 5FKQA 3UVNA 4J0XA 5H17A 1PGUA 4A0BA 4BH6A 3I7HA 3RRMC 2CO0A 3I7OA 3JPXA 4KFMB 3IJCA 5HYNB 1U4CA 1MG3A 2H9NA 3MZLA 3EG6A 2UZXB 4TZ4A 2OIZA 3JROA 4L9OA 1FWXA 1RI6A 3IIWA 4GGDA 4E5ZB 4X63B 3CFSB 5EMKB 1Q47A 2AGXA 4GGAA 2AH0A 3PXTD 4E5ZA 3OTTA 2HYEA 4GMBA 4X60B 2MTAH 2Z2OA 4AEZA 4GQ2P 4LG9A 2AQ5A 2P9LC 2P9UC 4Z8LA 1JMXB 4ZOXA 2PM6B 4PSWB 4QL1A 5CXCB 2OK6A 2CNXA 5C2VB 3SN6B 2O9KA 4U1EI 5GXIA 4K3JB 4ESGA 1SHYB 5FKTA 4BUJC 3FRXA 2HESX 4J78A 4O3UB 2OJYA 4A2MA 2EBSA 5FLXg 1K32A 1SQ9A 5FKSA 3V5WB 2YMUA 3EMHA 3I8CA 1B9YA 3EI1B 4JSXC 2IAAA 2B5MA 3SJLD 1SQJA 2AGZA 3AL8A 2H9LA 3OKWA 2BBKH 3FM0A 2W18A 4A09A
chains in the Genus database with same CATH superfamily
3IUNA 1U2VC 2VDLA 3RFHA 2WQ8A 4JT6C 5HQGA 5FKRA 5IJ8E 1VYHC 4D6VA 4J84A 4J87A 1R5MA 4QAMA 1NEXB 3VH0A 4A0AB 3DSMA 2AGLA 3AFCA 5CXBB 3MXXA 1QFMA 4J73A 3A0FA 4Z7OA 4JSNC 3KCIA 3DM0A 3PSCB 2QC5A 4BCDA 4J77A 3VA6A 4O9DA 5CXBA 3FGBA 3GFCA 3CFVA 2HU8A 5H14A 4L3GD 5IGOA 3UKRC 1BPOA 3E0CA 5EALA 4JT5C 3IVMA 4JXMA 3ORVD 4AMZA 5I5IA 4A11A 4CI1A 2B5NA 4WK4A 2CE9A 5EM2B 2P9NC 2UZYB 2AGWA 4WK0A 1GG2B 3JB9L 3L4MD 2JKXA 2P9SC 3IJEA 4PSXB 3MUOA 4MMXA 5EM2A 1GXRA 3SMRA 2H3XA 1VE6A 1VZ2A 4AN0A 2IUQA 1H2XA 3EQ8A 2OVQB 2XZGA 4A7JA 2XYIA 5M5SA 1QNIA 4RE5A 3I7LA 5EARA 4K3ID 3UVLA 4FA5D 1XKSA 2TRCB 1JOFA 2CE8A 4FA1D 3PXSD 5SXMA 3P4FA 4J86A 4HDJA 4GQBB 5C86A 4FA9D 3V4PA 5AJAA 4UI9R 4ERQA 3PVUB 3VI4A 4G56B 1UOPA 4WJKA 3EU7A 3V9FA 3NIFA 5TF2A 3UVKA 4ZN4A 4ZOYA 1ERJA 3VI3A 1MG2A 2PM9A 2I0TA 5HE0B 1OMWB 3ODTA 5HE2B 3ZWLB 2XL2A 2XE4A 1XIPA 2HXCA 5EAPA 2H6NA 4MMYA 3OKYA 2IUVA 4PBYA 4CY5A 3BG0A 3EI2A 3ZDXA 4L1MA 2YNOA 3IJ0A 4PNKB 1I2MB 1JMZB 1JV2A 3ZE0A 3N0EA 5H1MA 5M61A 5K19A 2Q7QA 3C75H 3AH8B 5FA5B 1K8KC 2EICA 4ERZA 3DWLC 3K72A 4E54B 3CIKB 4U7AA 2VZ3A 4H5JA 2XL3A 2AGYA 3C9CA 3SXTD 1GOFA 2IURA 4R7AB 4E54A 3DDUA 1PI6A 3NVXA 4MK0B 3IULA 3EI4A 1UOOA 3J81g 2G9AA 4FWWA 3NIGA 3MKQA 4ZOVA 3AL8B 4OWRA 3F3GA 2GC4A 4WK2A 3UR4A 2IWKA 2EIEA 4PXWA 2B5LA 5EAMA 4A09B 2XU7A 4BCBA 5EMMB 4OZUA 3RLMD 4FHLA 3UVOA 4G1EA 5AMSA 5C2WB 3SLED 3EI3A 3U4YA 3FCUA 2P9PC 3JZGA 5TDHB 4JSPC 3K71A 4A08B 4JHPC 4LG8A 1L0QA 1MDAH 2Z2NA 1C9LA 3MZKA 4AN1A 3K26A 1TYEA 3NVNA 4GZ8A 3MKSB 4XYHA 4AX4A 2I3SA 5IC7A 4CI3A 3SVWD 2H68A 3IUQA 1M1XA 3PXWD 4J82A 5I5MA 4A08A 3VGZA 3T3PA 5AFU3 3NVQA 2BCJB 3IIYA 5HE3B 4CI2A 2XDWA 3PSLA 4J79A 1TYQC 4A11B 3GC3B 2BKLA 3UKUC 4Z7NA 1N6DA 1N6EA 2OVPB 3KRXB 5THAA 2OK4A 2VDPA 2B4EA 2YBAA 4GQ1A 1UOQA 2HU7A 4EWRA 1OLZA 4UM8A 4L3HD 3OW8A 5K1CC 4GM3A 4J81A 4J8GA 3W15A 1NR0A 5M5TA 2J55H 2H9MA 4CC9A 3KRWB 5HDBA 3O4JA 5EMJB 3B7FA 4O3TB 5FFOA 3F3FA 2YNPA 5C9ZB 4RE6A 3IJ1A 1H2WA 4DNVA 2P9IC 5KDOB 3JAMg 2QXVA 1E5TA 5GMKn 2H9PA 2CN3A 3I7KA 2VC2A 3OKTA 4G55A 1H2ZA 2H6QA 4O2WA 4Y7RA 3PE7A 4CY2A 1XHMA 1TBGA 1K3IA 3HFQA 3EQ7A 5M5VA 5GSAA 5E6RA 2PM9B 4AOWA 4NBMA 3UVMA 3I89A 3I7PA 5EMLB 3SWSD 3RN0D 5IT9g 1A12A 3DXKC 2HJ4A 1VZ3A 3OKYB 2Z2PA 2J57G 3SBRA 3L4OD 3EI2B 5FQDA 2HKRA 3BG1A 4BP8A 4FA4D 4IA9A 3SFZA 4L1QD 3RMZD 4GM8A 5A2Qg 2GNQA 3K27A 4BL0A 4N14A 2VDMA 1C9IA 4CZVA 3O4IA 5E6UA 4QQEA 4DNUA 1A0RB 4H5IA 1S4UX 4FAVD 5CYKB 3QHYB 1E8NA 2G99A 3I7NA 4O45A 3C5MA 3EI4B 5TEEA 2PM7B 4CY1A 5CYKA 3QI0A 3C99A 3OL2B 4PBZA 4CZXA 4XEIC 5FXYA 3V7DB 2PBIB 1L5GA 1VE7A 2H14A 4J8BA 3I2NA 3OL2A 2OVRB 1QFSA 2YNNA 4YVDA 5FFGA 3MMYA 3EI3B 3F3PA 3JZNA 3EWEA 5CXCA 3RSEC 3MVDK 2H6KA 4NSXA 3SHFA 1YR2A 2AH1A 4I79A 1P22A 1GP2B 1GOHA 1GOGA 4LGNA 4A09A 3JRPA 4QT8A 3RN1D 2VDNA 3EQ9A 4J0WA 4PC0A 5I5JA 1JJUB 2I0RA 4X61B 2EIDA 3BWSA 2J56H 3AL9A 3PVWB 3SCYA 3T3MA 3I8EA 4D9SA 3SBQA 2QZPA 4ES0A 3O4HA 3N0DA 1H2YA 3FCSA 2CN2A 3EI1A 4CY3A 2CO0C 4O1QD 4FB1D 2P9KC 2IUPA 2H47A 1GOTB 1N6FA 3RFGA 1B9XA 3GREA 5B4WA 4JD2C 1E8MA 5HE1B 4CI8A 1UTCA 3ULEC 3NIDA 4CZYA 4ZOZA 3IKOA 4JHNA 4Y5RD 4A2LA 1PBYB 2YB8B 4FAND 4GM9A 5JWZA 4NENA 4DNWA 4IMMA 1YFQA 5M5UA 2I3TA 4JSVC 4A0AA 4ERYA 3DXMC 4QRJA 3MUNA 4X3EA 2EIBA 2HKMA 5GXHA 5IJ7E 3J80g 3JZHA 2HJBA 4XYIA 2IWFA 5TEFA 5IGQA 2GC7A 5C92A 1PEVA 4GGCA 4D0KA 4A0BB 3SBPA 2I0SA 2H13A 2VDKA 5FKQA 3UVNA 4J0XA 5H17A 1PGUA 3IURA 3IUJA 4A0BA 4BH6A 3I7HA 4MMZA 3RRMC 2CO0A 3I7OA 3V4VA 3JPXA 4KFMB 3IJCA 5HYNB 1U4CA 1MG3A 2H9NA 3MZLA 4BP9A 2QR5A 3EG6A 2UZXB 4TZ4A 2OIZA 3JROA 4L9OA 5E6SA 3O4GA 1FWXA 1RI6A 3IIWA 4GGDA 4E5ZB 4X63B 3CFSB 2VDOA 5EMKB 1Q47A 2AGXA 4GGAA 2AH0A 3PXTD 4E5ZA 2VZ1A 3OTTA 2HYEA 4GMBA 4NAAA 2MTAH 4X60B 4UM9A 1O6GA 2Z2OA 4AEZA 1O6FA 3GD1I 3ZDYA 4GQ2P 4LG9A 2AQ5A 2P9LC 2P9UC 3ZE1A 4Z8LA 1JMXB 4ZOXA 3ZDZA 2PM6B 4PSWB 4QL1A 5CXCB 3ZE2A 2OK6A 2CNXA 5M5RA 5C2VB 3K6SA 3SN6B 2O9KA 4U1EI 5GXIA 4K3JB 4ESGA 4AMYA 4Z7QA 1SHYB 1JTDB 5FKTA 4BUJC 3FRXA 2HESX 4J78A 4O3UB 2OJYA 4A2MA 2EBSA 5FLXg 1K32A 1SQ9A 1T2XA 5FKSA 3V5WB 3IUMA 4G1MA 1U8CA 2YMUA 3EMHA 3I8CA 4BCCA 4NC4A 1B9YA 3EI1B 4O02A 3OF7A 4JSXC 2IAAA 2B5MA 3SJLD 1SQJA 4IRZA 2AGZA 3AL8A 2H9LA 2HU5A 3OKWA 2BBKH 2VDRA 3FM0A 2W18A 2VDQA
chains in the Genus database with same CATH topology
1U2VC 3RFHA 4JT6C 5HQGA 5FKRA 5IJ8E 1VYHC 4D6VA 4J84A 4J87A 1R5MA 1NEXB 3VH0A 4A0AB 3DSMA 2AGLA 3AFCA 5CXBB 3MXXA 4J73A 3A0FA 4JSNC 3DM0A 3PSCB 2QC5A 4J77A 3VA6A 4O9DA 5CXBA 3FGBA 3GFCA 3CFVA 5H14A 4L3GD 5IGOA 3UKRC 3E0CA 5EALA 4JT5C 4JXMA 3ORVD 5I5IA 4A11A 4CI1A 2B5NA 2CE9A 5EM2B 2P9NC 2UZYB 2AGWA 1GG2B 3JB9L 3L4MD 2P9SC 4PSXB 5EM2A 1GXRA 3SMRA 2H3XA 2IUQA 2OVQB 4A7JA 2XYIA 1QNIA 3I7LA 5EARA 4K3ID 3UVLA 4FA5D 1XKSA 2TRCB 1JOFA 2CE8A 4FA1D 3PXSD 5SXMA 3P4FA 4J86A 4HDJA 4GQBB 4FA9D 5AJAA 4UI9R 4ERQA 3PVUB 4G56B 3EU7A 3V9FA 5TF2A 3UVKA 4ZN4A 4ZOYA 1ERJA 1MG2A 2PM9A 2I0TA 5HE0B 1OMWB 3ODTA 5HE2B 3ZWLB 2XL2A 1XIPA 2HXCA 5EAPA 2H6NA 3OKYA 2IUVA 4PBYA 4CY5A 3BG0A 3EI2A 2YNOA 3IJ0A 4PNKB 1JMZB 3N0EA 5H1MA 5K19A 2Q7QA 3C75H 3AH8B 5FA5B 1K8KC 4ERZA 3DWLC 4E54B 3CIKB 4U7AA 4H5JA 2XL3A 2AGYA 3C9CA 3SXTD 2IURA 4R7AB 4E54A 1PI6A 3NVXA 4MK0B 3EI4A 3J81g 2G9AA 4FWWA 3MKQA 4ZOVA 3AL8B 4OWRA 3F3GA 2GC4A 3UR4A 2IWKA 4PXWA 5EAMA 2B5LA 4A09B 2XU7A 5EMMB 4OZUA 3RLMD 4FHLA 3UVOA 5AMSA 5C2WB 3SLED 3EI3A 3U4YA 3JZGA 2P9PC 5TDHB 4JSPC 4A08B 4LG8A 1L0QA 1MDAH 2Z2NA 3MZKA 3K26A 3NVNA 4GZ8A 3MKSB 4XYHA 3SVWD 2I3SA 5IC7A 4CI3A 2H68A 4A08A 3PXWD 4J82A 5I5MA 3VGZA 5AFU3 3NVQA 2BCJB 3IIYA 5HE3B 4CI2A 3PSLA 4J79A 1TYQC 4A11B 3UKUC 1N6DA 1N6EA 2OVPB 3KRXB 5THAA 2OK4A 4GQ1A 2B4EA 2YBAA 4EWRA 1OLZA 4L3HD 3OW8A 5K1CC 4GM3A 4J81A 4J8GA 3W15A 1NR0A 2J55H 2H9MA 4CC9A 3KRWB 5EMJB 3B7FA 4O3TB 3F3FA 2YNPA 5C9ZB 3IJ1A 2P9IC 5KDOB 3JAMg 2QXVA 5GMKn 2H9PA 2CN3A 3I7KA 3OKTA 2H6QA 4Y7RA 3PE7A 4CY2A 1XHMA 1TBGA 3HFQA 5GSAA 2PM9B 4AOWA 3UVMA 3I89A 3I7PA 5EMLB 3SWSD 3RN0D 5IT9g 3DXKC 2HJ4A 3OKYB 2Z2PA 2J57G 3SBRA 3L4OD 3EI2B 5FQDA 2HKRA 3BG1A 4FA4D 4IA9A 3SFZA 4L1QD 3RMZD 4GM8A 5A2Qg 2GNQA 3K27A 4BL0A 4N14A 4CZVA 4QQEA 1A0RB 4H5IA 1S4UX 4FAVD 5CYKB 2G99A 3I7NA 4O45A 3C5MA 3EI4B 5TEEA 2PM7B 4CY1A 5CYKA 3C99A 3OL2B 4PBZA 4CZXA 4XEIC 5FXYA 3V7DB 2PBIB 2H14A 4J8BA 3I2NA 3OL2A 2OVRB 2YNNA 4YVDA 3MMYA 3EI3B 3F3PA 3JZNA 3EWEA 5CXCA 3RSEC 2H6KA 4NSXA 3SHFA 2AH1A 4I79A 1P22A 1GP2B 4LGNA 3JRPA 4QT8A 3RN1D 4J0WA 4PC0A 5I5JA 1JJUB 2I0RA 4X61B 3BWSA 2J56H 3AL9A 3PVWB 3SCYA 3I8EA 3SBQA 4ES0A 3N0DA 2CN2A 3EI1A 4CY3A 2CO0C 4O1QD 4FB1D 2P9KC 2IUPA 2H47A 1GOTB 1N6FA 3RFGA 1B9XA 3GREA 5B4WA 4JD2C 5HE1B 4CI8A 3ULEC 4CZYA 4ZOZA 3IKOA 4Y5RD 4A2LA 1PBYB 2YB8B 4FAND 4GM9A 5JWZA 4IMMA 1YFQA 2I3TA 4JSVC 4A0AA 4ERYA 3DXMC 4QRJA 4X3EA 2HKMA 5GXHA 5IJ7E 3J80g 3JZHA 2HJBA 4XYIA 2IWFA 5TEFA 5IGQA 2GC7A 1PEVA 4GGCA 4D0KA 4A0BB 3SBPA 2I0SA 2H13A 5FKQA 3UVNA 4J0XA 5H17A 1PGUA 4A0BA 4BH6A 3I7HA 3RRMC 2CO0A 3I7OA 3JPXA 4KFMB 3IJCA 5HYNB 1U4CA 1MG3A 2H9NA 3MZLA 3EG6A 2UZXB 4TZ4A 2OIZA 3JROA 4L9OA 1FWXA 1RI6A 3IIWA 4GGDA 4E5ZB 4X63B 3CFSB 5EMKB 1Q47A 2AGXA 4GGAA 2AH0A 3PXTD 4E5ZA 3OTTA 2HYEA 4GMBA 4X60B 2MTAH 2Z2OA 4AEZA 4GQ2P 4LG9A 2AQ5A 2P9LC 2P9UC 4Z8LA 1JMXB 4ZOXA 2PM6B 4PSWB 4QL1A 5CXCB 2OK6A 2CNXA 5C2VB 3SN6B 2O9KA 4U1EI 5GXIA 4K3JB 4ESGA 1SHYB 5FKTA 4BUJC 3FRXA 2HESX 4J78A 4O3UB 2OJYA 4A2MA 2EBSA 5FLXg 1K32A 1SQ9A 5FKSA 3V5WB 2YMUA 3EMHA 3I8CA 1B9YA 3EI1B 4JSXC 2IAAA 2B5MA 3SJLD 1SQJA 2AGZA 3AL8A 2H9LA 3OKWA 2BBKH 3FM0A 2W18A 4A09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2V C;  3RFH A;  4JT6 C;  5HQG A;  5FKR A;  5IJ8 E;  1VYH C;  4D6V A;  4J84 A;  4J87 A;  1R5M A;  1NEX B;  3VH0 A;  4A0A B;  3DSM A;  2AGL A;  3AFC A;  5CXB B;  3MXX A;  4J73 A;  3A0F A;  4JSN C;  3DM0 A;  3PSC B;  2QC5 A;  4J77 A;  3VA6 A;  4O9D A;  5CXB A;  3FGB A;  3GFC A;  3CFV A;  5H14 A;  4L3G D;  5IGO A;  3UKR C;  3E0C A;  5EAL A;  4JT5 C;  4JXM A;  3ORV D;  5I5I A;  4A11 A;  4CI1 A;  2B5N A;  2CE9 A;  5EM2 B;  2P9N C;  2UZY B;  2AGW A;  1GG2 B;  3JB9 L;  3L4M D;  2P9S C;  4PSX B;  5EM2 A;  1GXR A;  3SMR A;  2H3X A;  2IUQ A;  2OVQ B;  4A7J A;  2XYI A;  1QNI A;  3I7L A;  5EAR A;  4K3I D;  3UVL A;  4FA5 D;  1XKS A;  2TRC B;  1JOF A;  2CE8 A;  4FA1 D;  3PXS D;  5SXM A;  3P4F A;  4J86 A;  4HDJ A;  4GQB B;  4FA9 D;  5AJA A;  4UI9 R;  4ERQ A;  3PVU B;  4G56 B;  3EU7 A;  3V9F A;  5TF2 A;  3UVK A;  4ZN4 A;  4ZOY A;  1ERJ A;  1MG2 A;  2PM9 A;  2I0T A;  5HE0 B;  1OMW B;  3ODT A;  5HE2 B;  3ZWL B;  2XL2 A;  1XIP A;  2HXC A;  5EAP A;  2H6N A;  3OKY A;  2IUV A;  4PBY A;  4CY5 A;  3BG0 A;  3EI2 A;  2YNO A;  3IJ0 A;  4PNK B;  1JMZ B;  3N0E A;  5H1M A;  5K19 A;  2Q7Q A;  3C75 H;  3AH8 B;  5FA5 B;  1K8K C;  4ERZ A;  3DWL C;  4E54 B;  3CIK B;  4U7A A;  4H5J A;  2XL3 A;  2AGY A;  3C9C A;  3SXT D;  2IUR A;  4R7A B;  4E54 A;  1PI6 A;  3NVX A;  4MK0 B;  3EI4 A;  3J81 g;  2G9A A;  4FWW A;  3MKQ A;  4ZOV A;  3AL8 B;  4OWR A;  3F3G A;  2GC4 A;  3UR4 A;  2IWK A;  4PXW A;  5EAM A;  2B5L A;  4A09 B;  2XU7 A;  5EMM B;  4OZU A;  3RLM D;  4FHL A;  3UVO A;  5AMS A;  5C2W B;  3SLE D;  3EI3 A;  3U4Y A;  3JZG A;  2P9P C;  5TDH B;  4JSP C;  4A08 B;  4LG8 A;  1L0Q A;  1MDA H;  2Z2N A;  3MZK A;  3K26 A;  3NVN A;  4GZ8 A;  3MKS B;  4XYH A;  3SVW D;  2I3S A;  5IC7 A;  4CI3 A;  2H68 A;  4A08 A;  3PXW D;  4J82 A;  5I5M A;  3VGZ A;  5AFU 3;  3NVQ A;  2BCJ B;  3IIY A;  5HE3 B;  4CI2 A;  3PSL A;  4J79 A;  1TYQ C;  4A11 B;  3UKU C;  1N6D A;  1N6E A;  2OVP B;  3KRX B;  5THA A;  2OK4 A;  4GQ1 A;  2B4E A;  2YBA A;  4EWR A;  1OLZ A;  4L3H D;  3OW8 A;  5K1C C;  4GM3 A;  4J81 A;  4J8G A;  3W15 A;  1NR0 A;  2J55 H;  2H9M A;  4CC9 A;  3KRW B;  5EMJ B;  3B7F A;  4O3T B;  3F3F A;  2YNP A;  5C9Z B;  3IJ1 A;  2P9I C;  5KDO B;  3JAM g;  2QXV A;  5GMK n;  2H9P A;  2CN3 A;  3I7K A;  3OKT A;  2H6Q A;  4Y7R A;  3PE7 A;  4CY2 A;  1XHM A;  1TBG A;  3HFQ A;  5GSA A;  2PM9 B;  4AOW A;  3UVM A;  3I89 A;  3I7P A;  5EML B;  3SWS D;  3RN0 D;  5IT9 g;  3DXK C;  2HJ4 A;  3OKY B;  2Z2P A;  2J57 G;  3SBR A;  3L4O D;  3EI2 B;  5FQD A;  2HKR A;  3BG1 A;  4FA4 D;  4IA9 A;  3SFZ A;  4L1Q D;  3RMZ D;  4GM8 A;  5A2Q g;  2GNQ A;  3K27 A;  4BL0 A;  4N14 A;  4CZV A;  4QQE A;  1A0R B;  4H5I A;  1S4U X;  4FAV D;  5CYK B;  2G99 A;  3I7N A;  4O45 A;  3C5M A;  3EI4 B;  5TEE A;  2PM7 B;  4CY1 A;  5CYK A;  3C99 A;  3OL2 B;  4PBZ A;  4CZX A;  4XEI C;  5FXY A;  3V7D B;  2PBI B;  2H14 A;  4J8B A;  3I2N A;  3OL2 A;  2OVR B;  2YNN A;  4YVD A;  3MMY A;  3EI3 B;  3F3P A;  3JZN A;  3EWE A;  5CXC A;  3RSE C;  2H6K A;  4NSX A;  3SHF A;  2AH1 A;  4I79 A;  1P22 A;  1GP2 B;  4LGN A;  3JRP A;  4QT8 A;  3RN1 D;  4J0W A;  4PC0 A;  5I5J A;  1JJU B;  2I0R A;  4X61 B;  3BWS A;  2J56 H;  3AL9 A;  3PVW B;  3SCY A;  3I8E A;  3SBQ A;  4ES0 A;  3N0D A;  2CN2 A;  3EI1 A;  4CY3 A;  2CO0 C;  4O1Q D;  4FB1 D;  2P9K C;  2IUP A;  2H47 A;  1GOT B;  1N6F A;  3RFG A;  1B9X A;  3GRE A;  5B4W A;  4JD2 C;  5HE1 B;  4CI8 A;  3ULE C;  4CZY A;  4ZOZ A;  3IKO A;  4Y5R D;  4A2L A;  1PBY B;  2YB8 B;  4FAN D;  4GM9 A;  5JWZ A;  4IMM A;  1YFQ A;  2I3T A;  4JSV C;  4A0A A;  4ERY A;  3DXM C;  4QRJ A;  4X3E A;  2HKM A;  5GXH A;  5IJ7 E;  3J80 g;  3JZH A;  2HJB A;  4XYI A;  2IWF A;  5TEF A;  5IGQ A;  2GC7 A;  1PEV A;  4GGC A;  4D0K A;  4A0B B;  3SBP A;  2I0S A;  2H13 A;  5FKQ A;  3UVN A;  4J0X A;  5H17 A;  1PGU A;  4A0B A;  4BH6 A;  3I7H A;  3RRM C;  2CO0 A;  3I7O A;  3JPX A;  4KFM B;  3IJC A;  5HYN B;  1U4C A;  1MG3 A;  2H9N A;  3MZL A;  3EG6 A;  2UZX B;  4TZ4 A;  2OIZ A;  3JRO A;  4L9O A;  1FWX A;  1RI6 A;  3IIW A;  4GGD A;  4E5Z B;  4X63 B;  3CFS B;  5EMK B;  1Q47 A;  2AGX A;  4GGA A;  2AH0 A;  3PXT D;  4E5Z A;  3OTT A;  2HYE A;  4GMB A;  4X60 B;  2MTA H;  2Z2O A;  4AEZ A;  4GQ2 P;  4LG9 A;  2AQ5 A;  2P9L C;  2P9U C;  4Z8L A;  1JMX B;  4ZOX A;  2PM6 B;  4PSW B;  4QL1 A;  5CXC B;  2OK6 A;  2CNX A;  5C2V B;  3SN6 B;  2O9K A;  4U1E I;  5GXI A;  4K3J B;  4ESG A;  1SHY B;  5FKT A;  4BUJ C;  3FRX A;  2HES X;  4J78 A;  4O3U B;  2OJY A;  4A2M A;  2EBS A;  5FLX g;  1K32 A;  1SQ9 A;  5FKS A;  3V5W B;  2YMU A;  3EMH A;  3I8C A;  1B9Y A;  3EI1 B;  4JSX C;  2IAA A;  2B5M A;  3SJL D;  1SQJ A;  2AGZ A;  3AL8 A;  2H9L A;  3OKW A;  2BBK H;  3FM0 A;  2W18 A;  4A09 A; 
#chains in the Genus database with same CATH topology
 3IUN A;  1U2V C;  2VDL A;  3RFH A;  2WQ8 A;  4JT6 C;  5HQG A;  5FKR A;  5IJ8 E;  1VYH C;  4D6V A;  4J84 A;  4J87 A;  1R5M A;  4QAM A;  1NEX B;  3VH0 A;  4A0A B;  3DSM A;  2AGL A;  3AFC A;  5CXB B;  3MXX A;  1QFM A;  4J73 A;  3A0F A;  4Z7O A;  4JSN C;  3KCI A;  3DM0 A;  3PSC B;  2QC5 A;  4BCD A;  4J77 A;  3VA6 A;  4O9D A;  5CXB A;  3FGB A;  3GFC A;  3CFV A;  2HU8 A;  5H14 A;  4L3G D;  5IGO A;  3UKR C;  1BPO A;  3E0C A;  5EAL A;  4JT5 C;  3IVM A;  4JXM A;  3ORV D;  4AMZ A;  5I5I A;  4A11 A;  4CI1 A;  2B5N A;  4WK4 A;  2CE9 A;  5EM2 B;  2P9N C;  2UZY B;  2AGW A;  4WK0 A;  1GG2 B;  3JB9 L;  3L4M D;  2JKX A;  2P9S C;  3IJE A;  4PSX B;  3MUO A;  4MMX A;  5EM2 A;  1GXR A;  3SMR A;  2H3X A;  1VE6 A;  1VZ2 A;  4AN0 A;  2IUQ A;  1H2X A;  3EQ8 A;  2OVQ B;  2XZG A;  4A7J A;  2XYI A;  5M5S A;  1QNI A;  4RE5 A;  3I7L A;  5EAR A;  4K3I D;  3UVL A;  4FA5 D;  1XKS A;  2TRC B;  1JOF A;  2CE8 A;  4FA1 D;  3PXS D;  5SXM A;  3P4F A;  4J86 A;  4HDJ A;  4GQB B;  5C86 A;  4FA9 D;  3V4P A;  5AJA A;  4UI9 R;  4ERQ A;  3PVU B;  3VI4 A;  4G56 B;  1UOP A;  4WJK A;  3EU7 A;  3V9F A;  3NIF A;  5TF2 A;  3UVK A;  4ZN4 A;  4ZOY A;  1ERJ A;  3VI3 A;  1MG2 A;  2PM9 A;  2I0T A;  5HE0 B;  1OMW B;  3ODT A;  5HE2 B;  3ZWL B;  2XL2 A;  2XE4 A;  1XIP A;  2HXC A;  5EAP A;  2H6N A;  4MMY A;  3OKY A;  2IUV A;  4PBY A;  4CY5 A;  3BG0 A;  3EI2 A;  3ZDX A;  4L1M A;  2YNO A;  3IJ0 A;  4PNK B;  1I2M B;  1JMZ B;  1JV2 A;  3ZE0 A;  3N0E A;  5H1M A;  5M61 A;  5K19 A;  2Q7Q A;  3C75 H;  3AH8 B;  5FA5 B;  1K8K C;  2EIC A;  4ERZ A;  3DWL C;  3K72 A;  4E54 B;  3CIK B;  4U7A A;  2VZ3 A;  4H5J A;  2XL3 A;  2AGY A;  3C9C A;  3SXT D;  1GOF A;  2IUR A;  4R7A B;  4E54 A;  3DDU A;  1PI6 A;  3NVX A;  4MK0 B;  3IUL A;  3EI4 A;  1UOO A;  3J81 g;  2G9A A;  4FWW A;  3NIG A;  3MKQ A;  4ZOV A;  3AL8 B;  4OWR A;  3F3G A;  2GC4 A;  4WK2 A;  3UR4 A;  2IWK A;  2EIE A;  4PXW A;  2B5L A;  5EAM A;  4A09 B;  2XU7 A;  4BCB A;  5EMM B;  4OZU A;  3RLM D;  4FHL A;  3UVO A;  4G1E A;  5AMS A;  5C2W B;  3SLE D;  3EI3 A;  3U4Y A;  3FCU A;  2P9P C;  3JZG A;  5TDH B;  4JSP C;  3K71 A;  4A08 B;  4JHP C;  4LG8 A;  1L0Q A;  1MDA H;  2Z2N A;  1C9L A;  3MZK A;  4AN1 A;  3K26 A;  1TYE A;  3NVN A;  4GZ8 A;  3MKS B;  4XYH A;  4AX4 A;  2I3S A;  5IC7 A;  4CI3 A;  3SVW D;  2H68 A;  3IUQ A;  1M1X A;  3PXW D;  4J82 A;  5I5M A;  4A08 A;  3VGZ A;  3T3P A;  5AFU 3;  3NVQ A;  2BCJ B;  3IIY A;  5HE3 B;  4CI2 A;  2XDW A;  3PSL A;  4J79 A;  1TYQ C;  4A11 B;  3GC3 B;  2BKL A;  3UKU C;  4Z7N A;  1N6D A;  1N6E A;  2OVP B;  3KRX B;  5THA A;  2OK4 A;  2VDP A;  2B4E A;  2YBA A;  4GQ1 A;  1UOQ A;  2HU7 A;  4EWR A;  1OLZ A;  4UM8 A;  4L3H D;  3OW8 A;  5K1C C;  4GM3 A;  4J81 A;  4J8G A;  3W15 A;  1NR0 A;  5M5T A;  2J55 H;  2H9M A;  4CC9 A;  3KRW B;  5HDB A;  3O4J A;  5EMJ B;  3B7F A;  4O3T B;  5FFO A;  3F3F A;  2YNP A;  5C9Z B;  4RE6 A;  3IJ1 A;  1H2W A;  4DNV A;  2P9I C;  5KDO B;  3JAM g;  2QXV A;  1E5T A;  5GMK n;  2H9P A;  2CN3 A;  3I7K A;  2VC2 A;  3OKT A;  4G55 A;  1H2Z A;  2H6Q A;  4O2W A;  4Y7R A;  3PE7 A;  4CY2 A;  1XHM A;  1TBG A;  1K3I A;  3HFQ A;  3EQ7 A;  5M5V A;  5GSA A;  5E6R A;  2PM9 B;  4AOW A;  4NBM A;  3UVM A;  3I89 A;  3I7P A;  5EML B;  3SWS D;  3RN0 D;  5IT9 g;  1A12 A;  3DXK C;  2HJ4 A;  1VZ3 A;  3OKY B;  2Z2P A;  2J57 G;  3SBR A;  3L4O D;  3EI2 B;  5FQD A;  2HKR A;  3BG1 A;  4BP8 A;  4FA4 D;  4IA9 A;  3SFZ A;  4L1Q D;  3RMZ D;  4GM8 A;  5A2Q g;  2GNQ A;  3K27 A;  4BL0 A;  4N14 A;  2VDM A;  1C9I A;  4CZV A;  3O4I A;  5E6U A;  4QQE A;  4DNU A;  1A0R B;  4H5I A;  1S4U X;  4FAV D;  5CYK B;  3QHY B;  1E8N A;  2G99 A;  3I7N A;  4O45 A;  3C5M A;  3EI4 B;  5TEE A;  2PM7 B;  4CY1 A;  5CYK A;  3QI0 A;  3C99 A;  3OL2 B;  4PBZ A;  4CZX A;  4XEI C;  5FXY A;  3V7D B;  2PBI B;  1L5G A;  1VE7 A;  2H14 A;  4J8B A;  3I2N A;  3OL2 A;  2OVR B;  1QFS A;  2YNN A;  4YVD A;  5FFG A;  3MMY A;  3EI3 B;  3F3P A;  3JZN A;  3EWE A;  5CXC A;  3RSE C;  3MVD K;  2H6K A;  4NSX A;  3SHF A;  1YR2 A;  2AH1 A;  4I79 A;  1P22 A;  1GP2 B;  1GOH A;  1GOG A;  4LGN A;  4A09 A;  3JRP A;  4QT8 A;  3RN1 D;  2VDN A;  3EQ9 A;  4J0W A;  4PC0 A;  5I5J A;  1JJU B;  2I0R A;  4X61 B;  2EID A;  3BWS A;  2J56 H;  3AL9 A;  3PVW B;  3SCY A;  3T3M A;  3I8E A;  4D9S A;  3SBQ A;  2QZP A;  4ES0 A;  3O4H A;  3N0D A;  1H2Y A;  3FCS A;  2CN2 A;  3EI1 A;  4CY3 A;  2CO0 C;  4O1Q D;  4FB1 D;  2P9K C;  2IUP A;  2H47 A;  1GOT B;  1N6F A;  3RFG A;  1B9X A;  3GRE A;  5B4W A;  4JD2 C;  1E8M A;  5HE1 B;  4CI8 A;  1UTC A;  3ULE C;  3NID A;  4CZY A;  4ZOZ A;  3IKO A;  4JHN A;  4Y5R D;  4A2L A;  1PBY B;  2YB8 B;  4FAN D;  4GM9 A;  5JWZ A;  4NEN A;  4DNW A;  4IMM A;  1YFQ A;  5M5U A;  2I3T A;  4JSV C;  4A0A A;  4ERY A;  3DXM C;  4QRJ A;  3MUN A;  4X3E A;  2EIB A;  2HKM A;  5GXH A;  5IJ7 E;  3J80 g;  3JZH A;  2HJB A;  4XYI A;  2IWF A;  5TEF A;  5IGQ A;  2GC7 A;  5C92 A;  1PEV A;  4GGC A;  4D0K A;  4A0B B;  3SBP A;  2I0S A;  2H13 A;  2VDK A;  5FKQ A;  3UVN A;  4J0X A;  5H17 A;  1PGU A;  3IUR A;  3IUJ A;  4A0B A;  4BH6 A;  3I7H A;  4MMZ A;  3RRM C;  2CO0 A;  3I7O A;  3V4V A;  3JPX A;  4KFM B;  3IJC A;  5HYN B;  1U4C A;  1MG3 A;  2H9N A;  3MZL A;  4BP9 A;  2QR5 A;  3EG6 A;  2UZX B;  4TZ4 A;  2OIZ A;  3JRO A;  4L9O A;  5E6S A;  3O4G A;  1FWX A;  1RI6 A;  3IIW A;  4GGD A;  4E5Z B;  4X63 B;  3CFS B;  2VDO A;  5EMK B;  1Q47 A;  2AGX A;  4GGA A;  2AH0 A;  3PXT D;  4E5Z A;  2VZ1 A;  3OTT A;  2HYE A;  4GMB A;  4NAA A;  2MTA H;  4X60 B;  4UM9 A;  1O6G A;  2Z2O A;  4AEZ A;  1O6F A;  3GD1 I;  3ZDY A;  4GQ2 P;  4LG9 A;  2AQ5 A;  2P9L C;  2P9U C;  3ZE1 A;  4Z8L A;  1JMX B;  4ZOX A;  3ZDZ A;  2PM6 B;  4PSW B;  4QL1 A;  5CXC B;  3ZE2 A;  2OK6 A;  2CNX A;  5M5R A;  5C2V B;  3K6S A;  3SN6 B;  2O9K A;  4U1E I;  5GXI A;  4K3J B;  4ESG A;  4AMY A;  4Z7Q A;  1SHY B;  1JTD B;  5FKT A;  4BUJ C;  3FRX A;  2HES X;  4J78 A;  4O3U B;  2OJY A;  4A2M A;  2EBS A;  5FLX g;  1K32 A;  1SQ9 A;  1T2X A;  5FKS A;  3V5W B;  3IUM A;  4G1M A;  1U8C A;  2YMU A;  3EMH A;  3I8C A;  4BCC A;  4NC4 A;  1B9Y A;  3EI1 B;  4O02 A;  3OF7 A;  4JSX C;  2IAA A;  2B5M A;  3SJL D;  1SQJ A;  4IRZ A;  2AGZ A;  3AL8 A;  2H9L A;  2HU5 A;  3OKW A;  2BBK H;  2VDR A;  3FM0 A;  2W18 A;  2VDQ A; 
#chains in the Genus database with same CATH homology
 1U2V C;  3RFH A;  4JT6 C;  5HQG A;  5FKR A;  5IJ8 E;  1VYH C;  4D6V A;  4J84 A;  4J87 A;  1R5M A;  1NEX B;  3VH0 A;  4A0A B;  3DSM A;  2AGL A;  3AFC A;  5CXB B;  3MXX A;  4J73 A;  3A0F A;  4JSN C;  3DM0 A;  3PSC B;  2QC5 A;  4J77 A;  3VA6 A;  4O9D A;  5CXB A;  3FGB A;  3GFC A;  3CFV A;  5H14 A;  4L3G D;  5IGO A;  3UKR C;  3E0C A;  5EAL A;  4JT5 C;  4JXM A;  3ORV D;  5I5I A;  4A11 A;  4CI1 A;  2B5N A;  2CE9 A;  5EM2 B;  2P9N C;  2UZY B;  2AGW A;  1GG2 B;  3JB9 L;  3L4M D;  2P9S C;  4PSX B;  5EM2 A;  1GXR A;  3SMR A;  2H3X A;  2IUQ A;  2OVQ B;  4A7J A;  2XYI A;  1QNI A;  3I7L A;  5EAR A;  4K3I D;  3UVL A;  4FA5 D;  1XKS A;  2TRC B;  1JOF A;  2CE8 A;  4FA1 D;  3PXS D;  5SXM A;  3P4F A;  4J86 A;  4HDJ A;  4GQB B;  4FA9 D;  5AJA A;  4UI9 R;  4ERQ A;  3PVU B;  4G56 B;  3EU7 A;  3V9F A;  5TF2 A;  3UVK A;  4ZN4 A;  4ZOY A;  1ERJ A;  1MG2 A;  2PM9 A;  2I0T A;  5HE0 B;  1OMW B;  3ODT A;  5HE2 B;  3ZWL B;  2XL2 A;  1XIP A;  2HXC A;  5EAP A;  2H6N A;  3OKY A;  2IUV A;  4PBY A;  4CY5 A;  3BG0 A;  3EI2 A;  2YNO A;  3IJ0 A;  4PNK B;  1JMZ B;  3N0E A;  5H1M A;  5K19 A;  2Q7Q A;  3C75 H;  3AH8 B;  5FA5 B;  1K8K C;  4ERZ A;  3DWL C;  4E54 B;  3CIK B;  4U7A A;  4H5J A;  2XL3 A;  2AGY A;  3C9C A;  3SXT D;  2IUR A;  4R7A B;  4E54 A;  1PI6 A;  3NVX A;  4MK0 B;  3EI4 A;  3J81 g;  2G9A A;  4FWW A;  3MKQ A;  4ZOV A;  3AL8 B;  4OWR A;  3F3G A;  2GC4 A;  3UR4 A;  2IWK A;  4PXW A;  5EAM A;  2B5L A;  4A09 B;  2XU7 A;  5EMM B;  4OZU A;  3RLM D;  4FHL A;  3UVO A;  5AMS A;  5C2W B;  3SLE D;  3EI3 A;  3U4Y A;  3JZG A;  2P9P C;  5TDH B;  4JSP C;  4A08 B;  4LG8 A;  1L0Q A;  1MDA H;  2Z2N A;  3MZK A;  3K26 A;  3NVN A;  4GZ8 A;  3MKS B;  4XYH A;  3SVW D;  2I3S A;  5IC7 A;  4CI3 A;  2H68 A;  4A08 A;  3PXW D;  4J82 A;  5I5M A;  3VGZ A;  5AFU 3;  3NVQ A;  2BCJ B;  3IIY A;  5HE3 B;  4CI2 A;  3PSL A;  4J79 A;  1TYQ C;  4A11 B;  3UKU C;  1N6D A;  1N6E A;  2OVP B;  3KRX B;  5THA A;  2OK4 A;  4GQ1 A;  2B4E A;  2YBA A;  4EWR A;  1OLZ A;  4L3H D;  3OW8 A;  5K1C C;  4GM3 A;  4J81 A;  4J8G A;  3W15 A;  1NR0 A;  2J55 H;  2H9M A;  4CC9 A;  3KRW B;  5EMJ B;  3B7F A;  4O3T B;  3F3F A;  2YNP A;  5C9Z B;  3IJ1 A;  2P9I C;  5KDO B;  3JAM g;  2QXV A;  5GMK n;  2H9P A;  2CN3 A;  3I7K A;  3OKT A;  2H6Q A;  4Y7R A;  3PE7 A;  4CY2 A;  1XHM A;  1TBG A;  3HFQ A;  5GSA A;  2PM9 B;  4AOW A;  3UVM A;  3I89 A;  3I7P A;  5EML B;  3SWS D;  3RN0 D;  5IT9 g;  3DXK C;  2HJ4 A;  3OKY B;  2Z2P A;  2J57 G;  3SBR A;  3L4O D;  3EI2 B;  5FQD A;  2HKR A;  3BG1 A;  4FA4 D;  4IA9 A;  3SFZ A;  4L1Q D;  3RMZ D;  4GM8 A;  5A2Q g;  2GNQ A;  3K27 A;  4BL0 A;  4N14 A;  4CZV A;  4QQE A;  1A0R B;  4H5I A;  1S4U X;  4FAV D;  5CYK B;  2G99 A;  3I7N A;  4O45 A;  3C5M A;  3EI4 B;  5TEE A;  2PM7 B;  4CY1 A;  5CYK A;  3C99 A;  3OL2 B;  4PBZ A;  4CZX A;  4XEI C;  5FXY A;  3V7D B;  2PBI B;  2H14 A;  4J8B A;  3I2N A;  3OL2 A;  2OVR B;  2YNN A;  4YVD A;  3MMY A;  3EI3 B;  3F3P A;  3JZN A;  3EWE A;  5CXC A;  3RSE C;  2H6K A;  4NSX A;  3SHF A;  2AH1 A;  4I79 A;  1P22 A;  1GP2 B;  4LGN A;  3JRP A;  4QT8 A;  3RN1 D;  4J0W A;  4PC0 A;  5I5J A;  1JJU B;  2I0R A;  4X61 B;  3BWS A;  2J56 H;  3AL9 A;  3PVW B;  3SCY A;  3I8E A;  3SBQ A;  4ES0 A;  3N0D A;  2CN2 A;  3EI1 A;  4CY3 A;  2CO0 C;  4O1Q D;  4FB1 D;  2P9K C;  2IUP A;  2H47 A;  1GOT B;  1N6F A;  3RFG A;  1B9X A;  3GRE A;  5B4W A;  4JD2 C;  5HE1 B;  4CI8 A;  3ULE C;  4CZY A;  4ZOZ A;  3IKO A;  4Y5R D;  4A2L A;  1PBY B;  2YB8 B;  4FAN D;  4GM9 A;  5JWZ A;  4IMM A;  1YFQ A;  2I3T A;  4JSV C;  4A0A A;  4ERY A;  3DXM C;  4QRJ A;  4X3E A;  2HKM A;  5GXH A;  5IJ7 E;  3J80 g;  3JZH A;  2HJB A;  4XYI A;  2IWF A;  5TEF A;  5IGQ A;  2GC7 A;  1PEV A;  4GGC A;  4D0K A;  4A0B B;  3SBP A;  2I0S A;  2H13 A;  5FKQ A;  3UVN A;  4J0X A;  5H17 A;  1PGU A;  4A0B A;  4BH6 A;  3I7H A;  3RRM C;  2CO0 A;  3I7O A;  3JPX A;  4KFM B;  3IJC A;  5HYN B;  1U4C A;  1MG3 A;  2H9N A;  3MZL A;  3EG6 A;  2UZX B;  4TZ4 A;  2OIZ A;  3JRO A;  4L9O A;  1FWX A;  1RI6 A;  3IIW A;  4GGD A;  4E5Z B;  4X63 B;  3CFS B;  5EMK B;  1Q47 A;  2AGX A;  4GGA A;  2AH0 A;  3PXT D;  4E5Z A;  3OTT A;  2HYE A;  4GMB A;  4X60 B;  2MTA H;  2Z2O A;  4AEZ A;  4GQ2 P;  4LG9 A;  2AQ5 A;  2P9L C;  2P9U C;  4Z8L A;  1JMX B;  4ZOX A;  2PM6 B;  4PSW B;  4QL1 A;  5CXC B;  2OK6 A;  2CNX A;  5C2V B;  3SN6 B;  2O9K A;  4U1E I;  5GXI A;  4K3J B;  4ESG A;  1SHY B;  5FKT A;  4BUJ C;  3FRX A;  2HES X;  4J78 A;  4O3U B;  2OJY A;  4A2M A;  2EBS A;  5FLX g;  1K32 A;  1SQ9 A;  5FKS A;  3V5W B;  2YMU A;  3EMH A;  3I8C A;  1B9Y A;  3EI1 B;  4JSX C;  2IAA A;  2B5M A;  3SJL D;  1SQJ A;  2AGZ A;  3AL8 A;  2H9L A;  3OKW A;  2BBK H;  3FM0 A;  2W18 A;  4A09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...