4J8SA

Crystal structure of human cnot1 mif4g domain in complex with a ttp peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
180
structure length
180
Chain Sequence
QQTDLSQVWPEANQHFSKEIDDEANSYFQRIYNHPPHPTMSVDEVLEMLQRFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKELHITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEYIEYGQQSRDPPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CCR4-NOT transcription complex subunit 1
total genus 63
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16417 CNOT1_TTP_bind CCR4-NOT transcription complex subunit 1 TTP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.840 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4j8sA00
4J8SA
chains in the Genus database with same CATH superfamily
2H6HA 5FZRA 1ELRA 5CERB 3ZVVA 4I1MA 4C0MA 4XZ4A 4ANWA 2V4LA 2XEHA 4BWRA 2P58C 3B7SA 5LCWC 3FUIA 1MHQA 4YNDA 1HG5A 4XX5A 2VGYA 4U8HA 4U8YD 5AJDA 3I5PA 2WM9A 1PC2A 3U3WA 1DCQA 4CYMD 4GA0A 3UPVA 2ETCA 4Z68A 5LFAA 4DX1A 1U3DA 4I1OB 2C0LA 3DXKG 4KVOA 4XEIG 3CHSA 3Q5MA 4E6HA 3W9FA 3KSLA 3APCA 4RSYA 1H6OA 1RZ4A 2IEJA 1FVHA 2HR2A 3S7DA 1JCSA 3LCAA 1ELWA 3FUDA 4GZ3A 4JXTA 4LUNU 2DZNA 3UMVA 3C5RA 3PZ1A 3Q7AA 1BI8B 1X5BA 2X6JA 2X3MA 3PZ3A 3DEPA 3GW4A 4BTBA 4HBDA 3APFA 3WXXA 4A1GA 4BT9A 3DPYA 2LXMA 2P2CP 5AAOA 4UI9C 3PS6A 4V3IA 3ESLA 2OCCE 1OT8A 3ONLA 5KJNA 3EJNA 1JCQA 1TEZA 5AQAA 3HHMA 2I9CA 1Q2ZA 4RVBA 1O5MA 1SA4A 3SQVA 3RIBA 1OCOE 2FO1E 4OYSA 4ZHBA 3TWQA 5HKPA 1K3ZD 1E8ZA 1D9SA 4B8AA 1E96B 2FEZA 2GRRB 3RKVA 3MV3B 3UX4A 5JJ6A 5FIOA 1OCCE 2XGOA 4WWPA 4FC8A 2VQ2A 4DJAA 2GRNB 1HU3A 4LG6A 3V2XA 4I17A 4J8EA 3E4BA 2P9SG 1QZ2A 2GROB 5AYWD 2IO3C 3EUVA 5ENSD 3TWRA 3TWUA 3TAXA 1N4QA 4UUCA 3PZ4A 4N3CA 3TWVA 2IF4A 2XCCA 3CHOA 4G26A 2CHWA 3B7UX 3Q75A 5T3RA 4EBAG 5FZQA 2BKGA 1Z5SC 3Q9NC 2WXKA 3DSUA 4DX5D 4U0UA 1S64A 3DEOA 5CEAA 1LD7A 4J8DA 3FU6A 2J4BA 3DSVA 4JEUA 1N4PA 3AS4A 2BF0X 3IXEA 4LNGA 5ITZF 1NFIE 4OVUA 4FU3A 3SNXA 3ML9A 4N5QA 3CHPA 3B7TA 5B3SE 3BG0B 4HQDA 1QBQA 3MKQA 5ANRA 1PY1A 5G05C 4NACA 2QZAA 2OOEA 1KZOA 5EX3A 3JUEA 4GYYA 4U63A 5KJLA 2IY0C 2HO1A 2VSOE 3NQPA 4HRNA 2ZISA 3EHNA 5JMND 3AS5A 4JHRA 2WXIA 1V55E 2YNQA 3S2AA 3SBSA 2IO2C 5FWQA 3AAAC 2WMOA 3LY9A 1H2VC 5FQ7A 2Y3AA 3IHYA 3FH5A 3TWXA 1OWMA 4J7WA 2H6FA 5A23A 3CVQA 3O4ZA 2XS1A 3UM1A 4U07A 3D9JA 3SI5A 4O60A 4W9RA 4L2LA 5H7PA 1KT1A 1BPOA 4KYOB 3LEWA 3JUIA 2BTDA 1E8XA 2J07A 4XE0A 5B1BE 3P2BA 4ILIA 2DWZA 2R59A 1NI1A 2CG3A 3GYZA 3MX3A 2DYRE 5AQ9A 5FTPA 5FQ4A 3TXMA 2PQRA 2IONA 4NRHB 1HF8A 2GRMA 4U04A 2IU1A 3QDNA 4QQIA 3PZ2A 5AENA 4F53A 4A3TA 3G2SA 5C1DA 5G04C 3VTYA 2NC9A 3TWTA 3FUMA 4HXIA 3IV0A 4GU5A 3CHMA 4BETA 1H19A 1HO8A 2XPIA 4U0SA 5JHBA 2AVPA 3FULA 1OWOA 4LSZE 2GGFA 2BUGA 3GZ1A 3ULQA 3FTSA 5C2YA 3FTWA 4I1AA 1FVFA 3IHVA 4DX2A 4ILHB 3KSQA 5G05J 3S7FA 2VSYA 5ENPD 4F1PA 4HFGA 3C3QA 4UWLA 5DBKA 1HZ4A 3UM2A 1H6PA 3UTMA 5BUZA 2XEEA 2KCVA 4PS8A 3QAQA 2DYSE 2GW1A 3MYVA 4I2ZA 5EILA 3ULEG 2IJGX 4GMJA 1N4SA 2CHZA 5ENNA 1OUVA 1BU9A 3AG4E 3QARA 2ETBA 4ATZD 1S63A 4WNGA 2VJ8A 4JHKA 4GZDA 4A3VA 5AN8A 2CFUA 4TUMA 3T5XA 3QWWA 5CMYA 4Y6CA 5CRUA 4HLLA 4GYWA 3LVRE 1XGWA 4HOUA 4JA9A 4C9BB 2XENA 3HVEA 5G55A 4HOSA 3JXIA 3SD5A 1QNFA 3EDTB 4GAAA 1TR4A 2RFAA 1PAQA 2BKKB 5JJTA 1TNZA 5EIBE 3U64A 4BX9A 3VTXA 1TN7A 3HRAA 5A7DB 3G2VA 1IHBA 4UQZA 3B13A 5KNHD 1K1AA 1N54A 1Z3XA 1MX4A 1HH8A 2X6KA 4ABNA 5CECB 5LCWJ 3ML8A 2XRZA 1NL4A 4EZLA 4EHMA 5CMWA 3CGHA 3N71A 4HRMB 3K9IA 3ZNGA 3TWSA 4KZ0A 4J0UA 1KLXA 2PM6A 3L08A 2PZIA 4JVSA 3PEVB 4C48B 1FT2A 5KJMA 1BLXB 2P9UG 4H7XA 1WG0A 1YCSB 1H2TC 4UI9K 3IEGA 4O6FA 3D9HA 4ATGA 4K5CA 2KC7A 1NA3A 3CEQA 2WXFA 3SZ7A 3I3NA 3QNKA 1SW6A 5FZSA 4LRZA 3HDXA 4DI3A 4K5AB 5BPPA 4YVQC 4DLQA 2I6HA 4UI9J 4D10C 2WXOA 4GTRA 3PDNA 3UT8A 3ZU7B 3ZFWA 1INZA 5FJYA 5T4YA 1TYQG 2RKKA 4JB8P 1E8YA 1UJKA 5LP0A 4J6IA 2IQCA 3R7QA 3FY4A 5JHAA 2I1KA 2KATA 3G2TA 1MX6A 3MKQB 2P9NG 2LO6A 4X8QA 3IBEA 3MA5A 2KZTA 2P9IG 4KVMA 3ZPJA 4EECA 1O1SA 4GTSA 4WWOA 2UY1B 3ZRHA 4B0ZA 4G23A 3CVYA 3R9AB 4Q94A 4YDEA 5E76A 4CDMA 3FUEA 3QOUA 3CSTA 2AW6A 3UUXA 3FTVA 3HXBA 3U9WA 2L6JA 5B1AE 3C3OA 3FU5A 1N95A 4UWGA 2XPYA 5IY5E 3F6QA 3JQ1A 3AJIA 3FUNA 3EU5A 4HNAD 3JXJA 4JZYA 4TXRA 1LF8A 3ASGA 2XGMA 4P29A 2A5EA 3ABME 1N0RA 4XI0A 4LNUD 2R03A 3RK6A 5EYLA 4AVXA 3O48A 2DVWA 3CK7A 1YA0A 3SFXA 2P9KG 4DLOA 1U2VG 1H6KA 4GYOA 1IHGA 3RAUA 3TL5A 3CVNA 4ACLA 4HOTA 2LNIA 2Y1LE 3T9KA 3V2OA 3C3RA 3FUJA 3PNTB 3D3MA 3E32A 3QJZA 3E37A 3ZKJA 3CIAA 4DUIA 2BEDA 5BXOA 3Q7FA 4A55A 1JWGA 2LSVA 2IOSA 5D66A 4CCAA 4RQIA 4I9CA 4JD2G 1UN8A 3OXGA 3J5PA 3V31A 3CKCA 3FEXA 1HFAA 2E2EA 3AU4A 4JHJA 3CLJA 1MZCA 4EPZA 4BFRA 2F0YA 4XKCA 2ZXWE 5KCMA 2E0IA 3FUFA 1UW4B 2WQHA 3B7RL 4CDRA 2R2LA 2B0OE 4O1OA 2WXLA 3PUKA 5ENRD 1XNFA 2VSNA 5HI7A 3FTYA 4KT6B 2YHCA 3LVQE 4AM9A 4GTQA 4YDOA 3UIPC 1K8KG 5BV1A 3FHEA 3L16A 3D9NA 4KXKB 1OWLA 2XRYA 1UN9A 1G3NB 3I4GA 3MZLB 3HG0D 3HXDA 4G25A 4AEZC 4FADA 4GA1A 5FINA 3JQ0A 1YMPA 4URKA 2OV8A 4L9PA 4ANVA 2FBNA 2ZGGA 1FT1A 4G1TA 2MOWA 1NP7A 4UQYA 3RRMB 4GPMA 2LXLA 3SGHA 5JJ7A 5J08A 1BD8A 3DSSA 4F1SA 4UQXA 2NYJA 2WXGA 2IOLA 2A4ZA 3Q47B 2L0IA 3OXFA 3Q9UC 2NSZA 1MQSA 4HORA 4XI9A 5FQ6A 3PE3A 3NOGD 4MKTA 3ZHEA 4RG9A 3V79K 2ONDA 3ZXPA 3RU0A 3EIQC 3CV0A 3C98A 3E34A 3ZYMA 5AJLA 3Q49B 4F7AA 1Y8MA 4K0RA 2XHEA 1B89A 5LX8A 2VGEA 3QWVA 1BI7B 3L22A 2DZOA 3APDA 3QKYA 3UI2A 3E30A 1ELKA 4H7YA 1ZBPA 1HX8A 3CQCB 4AJWA 3PH0C 3DRAA 1QQEA 3UXGA 4O1PA 3UT7A 5CCLA 3ZYLA 2CHXA 1JWFA 3FUHA 1SZ9A 3CHRA 4ZFHA 4GPKA 2J09A 2YHEA 2JLBA 2PNNA 2YINA 2UWJG 4FP7A 4MBGA 2DCPA 3LJ3A 1TNBA 1WAO1 2H6IA 4CT4A 3D9LA 4BEPA 3NF1A 4TV3A 3DXMG 2FO7A 2X6IA 3HVEB 3FDHA 1S0PA 3AG3E 2V0PA 4I43A 2MRIA 3DPDA 1SQMA 3D9IA 2R5SA 4IN3B 4AXHA 5G2NA 2XPZA 4GZCA 4IULA 1O1TA 4BT8A 4RLYA 4DK5A 4YDWA 1H0AA 4UWKA 3TG4A 3Q79A 1IQUA 3D9OA 1KT0A 2OVBA 2Y0BG 3CVLA 3P1UA 2L0TB 3PVLA 5EDSA 4B8CB 3T5VA 3T8MA 5D0QD 4BY6A 4OVVA 4FHKA 4FHJA 3MV2B 4N5CA 2P9PG 4XKBA 5EKQD 4RG6A 3RO2A 4DRXE 4CGWA 3ZN3A 4G24A 2QY7A 3BUAA 3FTXA 1EDUA 2ZIRA 3BU8A 4A1SA 2C0MA 3SFYA 3R9MA 2EINE 1HG2A 4OAVB 2FF4A 2PQNA 4B93B 4GTVA 3OAWA 3PRZA 3HIZA 4KBQA 2WXMA 3HXEA 3MEKA 4Q96A 2F8XK 2VGXB 5CCMA 1W3BA 3AS8A 3EIJA 4NURA 3FTZA 3CVWA 1OY3D 2HE0A 3ASOE 4GMRA 1OXJA 4L2YA 1D8EA 1S70B 3FWVA 4JPSA 4FULA 1GW6A 2KZTB 3B7BA 1E8WA 2WMNA 1WDYA 3Q78A 3W9GA 4CZ2D 3CHQA 4WAFA 2JABA 4DX7D 3UM0A 3MJWA 5A6CA 2WQ6A 2KM4A 4Q69A 3RSEG 3D9KA 3PREA 2R05A 4NIKA 3UKUG 4UWHA 2PL2A 2CG2A 2F37A 2QFCA 3TXNA 3OTNA 1O1RA 3SFZA 4PH4B 3AU5A 3L6AA 1JUQA 3AG1E 5EYPF 1KPSB 3DSXA 2M63A 3ESKA 4GCNA 3KS2A 3UKRG 3FU0A 4WNFA 2X6HA 3DBSA 4KMOA 2Y4UA 3UINC 2CFZA 4HVBA 4FA6A 1DVPA 3V30A 4C0EA 3B95A 4FJZA 1TN8A 2WVIA 3RO3A 1SVXA 4TUUA 2QC9A 3ZYKA 3S7BA 4ILGA 5ARGA 3ASDA 3CK9A 1Z6TA 4L23A 4Y6WA 5BW8C 3Q4AB 5AIJA 4GB9A 3LY8A 5BT1A 5BXUA 4EZKA 4TXQA 1H2UA 2MHKA 1DC2A 3D9MA 4ANUA 4MLPA 3ASFA 3T8KA 5FT9A 4AV7A 2V4HC 3SBTB 2L6BA 4HI9A 2XS8A 1MYOA 5AARA 5JA4D 4AIFA 3KAEA 1X81A 5CEDB 4EQFA 3EHRA 2AXVA 2WB2A 4F6RD 5ENQD 5KBAA 2ZGDA 2EQXA 5J90A 3MKRA 3LY7A 3ZYQA 1YYHA 4I6EA 2GRLA 3OXLA 2FULA 3CVUA 2V5FA 5HS0A 4WNEA 4HI8A 3QWPA 2VTBB 3NAWA 2XCBA 4WWNA 1SA5A 2J8SD 2AJAA 3HYMB 3JCKC 2VGXA 1SZAA 4JEHA 3CVVA 2PM7A 2J4DA 4GTTA 4L1BA 4LERA 2AXZA 4OAUC 2WXHA 4U7EB 1WY6A 3NZUA 4WNDA 2KBXA 5HQ8A 3GZSA 3SF4A 4E85A 1KZPA 3SHFA 3NBNB 3ZEFA 5AQBA 2UY1A 3RJVA 3J5QB 4I9EA 4GMLA 4G2VA 3HXCA 2AXUA 4J8FA 4LCTA 1EYHA 4DPRA 1TN6A 3LXUX 2RD0A 1MJ0A 3CSFA 2EIJE 2JEKA 5CBNA 2AWIA 1OWPA 5EN5D 4LNBA 5HRYA 4BSXA 4APFA 3PZDA 3ASNE 1E7VA 3D9PA 3TWWA 2LAIA 4B89A 4JA7A 4F3VA 1AP7A 3PE4A 3EU9A 1N9AA 1WM5A 5D2MC 4PUCA 4EZJA 2VYIA 2WXPA 4NQ0A 3ZW3A 4AOFA 1V54E 5ENTD 3L54A 4HRLA 4AP2A 2F8YA 3G2UA 2VTBA 4JC8A 3SO8A 3TG5A 2KXPC 3NZSA 3QK0A 1HXIA 4N39A 5EX0A 4FLBA 1QYMA 1A5EA 5G04J 1IYGA 1LD8A 1AWCB 3UQ3A 1NA0A 1MX2A 5T8IA 2P9LG 1A17A 3VLDA 3FFLA 3ZUVB 3FUKA 4FJYA 2J08A 1IKND 2V5QC 2WXJA 3NOCD 4CEMA 1Z3YA 2LAHA 2KCKA 2XGSA 4MRUA 4M3OA 3R7RA 5DIZA 4YDYA 3DWLG 3S7JA 4PS7A 3NB2A 3BEEA 3VLEA 2MYOA 3ZGQA 1N52A 5AQ7A 3CR3A 5CHEE 4J8YA 1D8DA 4FLHA 4N3AA 4N3BA 3ONKA 2EILE 4U8VD 3ZHEB 4PDXA 2L9BA 2I2OA 3CKBA 2X38A 4BSZB 3L17A 4CGVA 3BQOA 3ENEA 3CVXA 2ZU6B 1IQRA 5KWDA 1E90A 3ABLE 4G8LA 4APOA 4HLEA 5KNGA 4BERA 5CBOA 1U3CA 1NZNA 2OEVA 2WPVA 3UIOC 1RW2A 1JCRA 4TRQA 4MS6A 3PNLB 3LKUA 4AY5A 2Q7FA 3PUJA 4ACKA 3L9TA 3LJNA 4PS3A 3LPZA 3ZIMA 3ISMC 2I1JA 1OCZE 3ASHA 2J49A 4K03A 4B94A 2GRPB 1IXVA 4N2SA 4DI4A 3C72A 3JYSA 2A5UA 4ANXA 3ABKE 3FP3A 4AY6A 2EIKE 4YVOA 4IYPA 2R17C 2QYUA 2X6FA 2KCLA 3LYAA 4R7LA 3MGBA 5ARFA 1UJJA 3QC1A 4A63B 1E7UA 2LSUA 4ME2A 5BNWA 4JL0A 2XQ0A 3ULYA 1UG3A 5KJKA 1EF1C 4J8SA 4UWFA 5E75A 4KZCA 4GTOA 2NXPA 1UOHA 2V8SE 3DSTA 1OWNA 1TJFA 5LOZA 3VLFA 4CDNA 2WXQA 2ETAA 3G2WA 1HE8A 1K1BA 3ZXSA 2QYJA 3URZA 2WXNA 3FH7A 4G8KA 3Q15A 2RG8A 4IRUA 3LS8A 2J9QA 1JPLA 3MCXA 1N11A 5FQ8A 1HS6A 2OVFA 3UT4A 4L7TA 4EBAA 2WQ7A 3KD7A 1TNOA 3EHMA 1TJCA 4JW1A 2HM8A 4BESA 3HXFA 2WXRA 4I6GA 5EIDA 4CT0A 4GZ6A 2RFMA 3FU3A 2IFUA 2OEWA 4M7CA 1TNUA 4GCOA 2DBAA 2LUHA 4N2QA 3AG2E 4HS2A 5ENOD 2FI7A 2VSXE 2Y4TA 1FPPA 3DSWA 3CK8A 4CRWA 4TXPA 3L82A 1N0QA 4QFVA 3KEZA 3CVPA 4GA2A 3BG1B 4HB5A 3FTUA 3FH8A 4DX6D 3KEAA 4I6JA 3FEYA 4GZ5A 2EIME 4WUYA 1EPUA 1N4RA 3GZ2A 5M72A 1Y6IA 4I2WA 3TJPA 1VDYA 3IKOB 4U96D 1L5JA 3X2QE 1P5QA 2YQ8A 4HOQA 4BX8A 3RRNB 4BTAA 3RRUA 3UM3A 2H6GA 3TGOA 4K5BA 5D0OD 4GTPA 2Y69E 4GTMA 2HYZA 3CQGB 3U4TA 4G11A 3Q73A 2C2LA 1FCHA 4LEUA 1LTXA 4U95D 2DIWA 3WG7E 3E33A 5BV0A 2GRQB 3L13A 1N94A 3SY2A 2R02A 2XZTG 5ANLA 3QB2A 2B6CA 3EHQA 4XIFA 3I4RB 1OCRE 4U0ZA 1DNPA 1TNYA 2XZDG 5CRVA 1DCEA 3LDZA 3U66A 2ILRA 1ZB1A 2XEVA 1ZU2A 3PEUB
chains in the Genus database with same CATH topology
2ONDA 1EYHA 4UWLA 5DBKA 1HZ4A 5FZRA 1ELRA 3RU0A 4DPRA 3EIQC 4I1MA 3CV0A 3ZVVA 3C98A 4C0MA 5BUZA 2KCVA 4PS8A 3LXUX 4XZ4A 3QAQA 4ANWA 3ZYMA 5AJLA 2RD0A 3CSFA 3Q49B 2JEKA 2GW1A 2V4LA 3MYVA 4I2ZA 4F7AA 2AWIA 1Y8MA 4BWRA 2P58C 1OWPA 3B7SA 5LCWC 2IJGX 3FUIA 4GMJA 4K0RA 2XHEA 1B89A 1MHQA 4YNDA 1HG5A 3QWVA 4BSXA 2CHZA 3L22A 3PZDA 5ENNA 1OUVA 4APFA 4XX5A 3APDA 3QARA 1E7VA 3D9PA 2VGYA 4WNGA 4U8HA 2VJ8A 2LAIA 4JHKA 5AJDA 3QKYA 4B89A 3I5PA 4GZDA 4JA7A 4A3VA 2CFUA 4F3VA 1ELKA 3T5XA 4H7YA 2WM9A 3PE4A 1PC2A 1ZBPA 3QWWA 5CMYA 4Y6CA 1HX8A 1WM5A 3U3WA 4PUCA 4EZJA 2VYIA 2WXPA 3CQCB 4AJWA 3PH0C 1QQEA 4GA0A 4GYWA 3LVRE 1XGWA 4HOUA 3UT7A 4JA9A 4C9BB 4NQ0A 5CCLA 3ZW3A 3HVEA 3ZYLA 5G55A 2CHXA 3UPVA 4HOSA 4AOFA 3SD5A 5LFAA 1QNFA 1JWFA 3FUHA 1SZ9A 3EDTB 3CHRA 4GPKA 4GAAA 1U3DA 2J09A 1PAQA 5JJTA 2YHEA 4I1OB 2C0LA 2JLBA 3L54A 4KVOA 3U64A 4BX9A 3CHSA 3Q5MA 4AP2A 4E6HA 2YINA 3VTXA 2UWJG 4FP7A 3G2UA 2VTBA 4JC8A 3APCA 4RSYA 5A7DB 2DCPA 3G2VA 3LJ3A 1FVHA 3B13A 4UQZA 2HR2A 3TG5A 3S7DA 1WAO1 3NZSA 3LCAA 1ELWA 4CT4A 3D9LA 1N54A 3FUDA 1HXIA 3QK0A 1Z3XA 4GZ3A 4JXTA 4N39A 4LUNU 5LX8A 5EX0A 4FLBA 3NF1A 4TV3A 2FO7A 2X6IA 1HH8A 3HVEB 2X6KA 3FDHA 1S0PA 3UMVA 5G04J 1IYGA 4ABNA 1X5BA 2V0PA 2X6JA 5LCWJ 3UQ3A 1NA0A 3ML8A 4I43A 2XRZA 2MRIA 3DPDA 5T8IA 1SQMA 2X3MA 3D9IA 2R5SA 4IN3B 1A17A 3VLDA 4AXHA 4EZLA 5G2NA 5CMWA 2XPZA 3GW4A 3FFLA 3CGHA 4GZCA 4BTBA 3N71A 3FUKA 3K9IA 4FJYA 2J08A 4IULA 4BT8A 4KZ0A 3APFA 4J0UA 4DK5A 1KLXA 2WXJA 3WXXA 4CEMA 1H0AA 2PM6A 3L08A 4A1GA 1Z3YA 2PZIA 4UWKA 3TG4A 4JVSA 1IQUA 2LAHA 4BT9A 3D9OA 3PEVB 1KT0A 2OVBA 3CVLA 3P1UA 2L0TB 4UI9C 3PVLA 5EDSA 4B8CB 5KJMA 2KCKA 2XGSA 4MRUA 4M3OA 3T5VA 4H7XA 3R7RA 3T8MA 3PS6A 4V3IA 5DIZA 3ESLA 3ONLA 5D0QD 5KJNA 4BY6A 3S7JA 1H2TC 4OVVA 4PS7A 4UI9K 4FHKA 3IEGA 3BEEA 3EJNA 3VLEA 4FHJA 3MV2B 4O6FA 3ZGQA 1N52A 1TEZA 3CR3A 4N5CA 5CHEE 4ATGA 4FLHA 4XKBA 2KC7A 1NA3A 3HHMA 3CEQA 2WXFA 2I9CA 5EKQD 4RG6A 4N3AA 3I3NA 3SZ7A 3RO2A 3QNKA 4N3BA 4RVBA 3ONKA 4CGWA 5FZSA 4LRZA 3RIBA 3ZHEB 4PDXA 3ZN3A 2L9BA 4OYSA 3HDXA 4DI3A 2I2OA 4G24A 3CKBA 2QY7A 2X38A 3L17A 4CGVA 5BPPA 4YVQC 4DLQA 1E8ZA 2I6HA 3ENEA 4B8AA 3FTXA 1EDUA 1E96B 4UI9J 2FEZA 2WXOA 4A1SA 4D10C 2ZU6B 3PDNA 3UT8A 1IQRA 2C0MA 3RKVA 3ZFWA 1E90A 1INZA 5FJYA 3MV3B 5T4YA 3UX4A 4APOA 5JJ6A 4HLEA 1E8YA 1U3CA 1UJKA 5LP0A 4J6IA 1NZNA 2IQCA 3R7QA 3FY4A 5JHAA 1HG2A 2WPVA 2XGOA 4WWPA 2FF4A 2I1KA 2KATA 3G2TA 4TRQA 3MKQB 4MS6A 2PQNA 4FC8A 2LO6A 3PNLB 3LKUA 2VQ2A 4DJAA 1HU3A 4I17A 3IBEA 2Q7FA 3OAWA 4J8EA 3PRZA 3HIZA 4AY5A 4KBQA 3E4BA 3MA5A 3PUJA 2WXMA 4ACKA 2KZTA 1QZ2A 3MEKA 4Q96A 4PS3A 2VGXB 4KVMA 3LPZA 3ZPJA 4EECA 5CCMA 3ZIMA 5AYWD 4WWOA 2UY1B 1W3BA 2I1JA 3AS8A 3ASHA 3TAXA 2J49A 4K03A 3ZRHA 4B94A 4B0ZA 3EIJA 4G23A 4NURA 3CVYA 3FTZA 3R9AB 4N3CA 4Q94A 4N2SA 2IF4A 4DI4A 2XCCA 3CVWA 3JYSA 5E76A 4CDMA 2A5UA 3CHOA 4ANXA 3FUEA 3FP3A 4G26A 3QOUA 2CHWA 3CSTA 3B7UX 2AW6A 4AY6A 4L2YA 4IYPA 3FTVA 4YVOA 5T3RA 2R17C 3UUXA 3FWVA 3U9WA 2L6JA 5FZQA 4EBAG 2X6FA 4JPSA 2KCLA 4FULA 1GW6A 3LYAA 2KZTB 3FU5A 1E8WA 2WMNA 4R7LA 3MGBA 4UWGA 2XPYA 3CHQA 5ARFA 1UJJA 3QC1A 4WAFA 2WXKA 1E7UA 2LSUA 3JQ1A 4U0UA 3FUNA 4ME2A 5BNWA 3MJWA 4J8DA 3FU6A 4JL0A 2J4BA 5A6CA 2WQ6A 4JEUA 2KM4A 2XQ0A 4Q69A 1UG3A 5KJKA 1EF1C 3AS4A 3D9KA 3PREA 1LF8A 4J8SA 4JZYA 2BF0X 3ASGA 2XGMA 4P29A 4UWFA 4UWHA 5E75A 4KZCA 2PL2A 2CG2A 2QFCA 3TXNA 3OTNA 2NXPA 4XI0A 4OVUA 4FU3A 3SNXA 2V8SE 3SFZA 3ML9A 4PH4B 1OWNA 3AU5A 3CHPA 1TJFA 5LOZA 3RK6A 3VLFA 3B7TA 2WXQA 3L6AA 1JUQA 4CDNA 3G2WA 1HE8A 3BG0B 4AVXA 3ZXSA 3URZA 3MKQA 3O48A 2M63A 3CK7A 2WXNA 1YA0A 3ESKA 3FH7A 3Q15A 4GCNA 4DLOA 1H6KA 5ANRA 4GYOA 1PY1A 1IHGA 3KS2A 3TL5A 2RG8A 4IRUA 4NACA 3FU0A 5G05C 3LS8A 2J9QA 1JPLA 3CVNA 4WNFA 2X6HA 3DBSA 4ACLA 3MCXA 4KMOA 4HOTA 2Y4UA 2OOEA 2LNIA 5EX3A 4GYYA 2CFZA 5FQ8A 4U63A 4HVBA 5KJLA 2HO1A 2VSOE 1HS6A 2OVFA 3UT4A 3FUJA 3NQPA 3PNTB 4FA6A 3D3MA 1DVPA 4L7TA 4C0EA 4EBAA 2WQ7A 4FJZA 3QJZA 3EHNA 3AS5A 4JHRA 2WXIA 2WVIA 2YNQA 3S2AA 3KD7A 3CIAA 3RO3A 3EHMA 3SBSA 4TUUA 3ZYKA 5FWQA 3S7BA 1TJCA 4JW1A 2HM8A 4ILGA 5ARGA 4A55A 2WMOA 1JWGA 2LSVA 1Z6TA 2IOSA 3ASDA 3CK9A 4L23A 4Y6WA 3LY9A 3Q4AB 5BW8C 4CCAA 5AIJA 1H2VC 3LY8A 4GB9A 2WXRA 1UN8A 4I9CA 5FQ7A 3OXGA 4EZKA 5BT1A 4I6GA 4CT0A 3CKCA 4GZ6A 3FEXA 1H2UA 2Y3AA 1HFAA 2E2EA 2MHKA 3FU3A 2IFUA 3IHYA 3AU4A 3D9MA 3FH5A 4JHJA 4ANUA 4GCOA 2DBAA 4MLPA 4N2QA 3CLJA 3ASFA 4HS2A 1OWMA 5A23A 4EPZA 4BFRA 3CVQA 2FI7A 4XKCA 5FT9A 5KCMA 3O4ZA 4AV7A 2VSXE 2Y4TA 3SBTB 2E0IA 3FUFA 3CK8A 1UW4B 2WQHA 3B7RL 4CRWA 4CDRA 4U07A 3D9JA 3SI5A 4W9RA 2WXLA 4L2LA 3PUKA 4AIFA 1XNFA 1KT1A 2VSNA 1BPOA 4QFVA 5HI7A 3FTYA 3KAEA 3KEZA 3LEWA 4KYOB 4KT6B 2YHCA 3JUIA 4EQFA 3CVPA 4GA2A 3LVQE 2AXVA 2BTDA 1E8XA 3BG1B 4AM9A 2WB2A 2J07A 4XE0A 3P2BA 3FTUA 3FH8A 4ILIA 3FHEA 5BV1A 2EQXA 5J90A 2R59A 3MKRA 3LY7A 4I6JA 2CG3A 3FEYA 3L16A 3ZYQA 3GYZA 4GZ5A 4I6EA 3D9NA 3MX3A 4KXKB 5FTPA 1OWLA 2GRLA 1EPUA 2FULA 2XRYA 3GZ2A 3OXLA 2V5FA 4WUYA 5M72A 3CVUA 1Y6IA 4I2WA 5FQ4A 3TXMA 1VDYA 2PQRA 3TJPA 2IONA 1UN9A 4NRHB 1HF8A 3IKOB 4WNEA 1L5JA 2GRMA 4U04A 1P5QA 2YQ8A 3QWPA 2IU1A 3QDNA 2VTBB 3I4GA 4HOQA 5AENA 3MZLB 4G25A 3RRNB 2XCBA 4AEZC 4BX8A 4GA1A 4FADA 3JQ0A 4F53A 4A3TA 4BTAA 3G2SA 5C1DA 4URKA 5G04C 3RRUA 2OV8A 3VTYA 4WWNA 2NC9A 3HYMB 3JCKC 3TGOA 2VGXA 1SZAA 4ANVA 4JEHA 5D0OD 2FBNA 4G1TA 3FUMA 2HYZA 2MOWA 3CVVA 4HXIA 3CQGB 3U4TA 3IV0A 4G11A 2PM7A 4GU5A 3CHMA 2J4DA 1H19A 2C2LA 4L1BA 1FCHA 4LERA 2AXZA 4LEUA 1HO8A 2WXHA 1NP7A 1WY6A 3NZUA 2DIWA 4UQYA 4WNDA 2XPIA 3RRMB 5BV0A 3L13A 4U0SA 5JHBA 3SGHA 5JJ7A 5HQ8A 2AVPA 5J08A 3GZSA 3SF4A 3FULA 4F1SA 1OWOA 4UQXA 5ANLA 2WXGA 4E85A 2IOLA 2GGFA 3QB2A 2A4ZA 2BUGA 3Q47B 2L0IA 3SHFA 3OXFA 4XIFA 2NSZA 3GZ1A 3I4RB 3ULQA 3ZEFA 4U0ZA 1MQSA 3FTSA 4HORA 5C2YA 2UY1A 4XI9A 3FTWA 3RJVA 5FQ6A 1DNPA 4I1AA 3PE3A 1FVFA 4MKTA 3IHVA 4I9EA 4ILHB 3ZHEA 4RG9A 3LDZA 4GMLA 4G2VA 5G05J 3S7FA 3U66A 2VSYA 2ILRA 3CVXA 2AXUA 4HFGA 4J8FA 4LCTA 2XEVA 1ZU2A 3PEUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8S A; 
#chains in the Genus database with same CATH topology
 2H6H A;  5FZR A;  1ELR A;  5CER B;  3ZVV A;  4I1M A;  4C0M A;  4XZ4 A;  4ANW A;  2V4L A;  2XEH A;  4BWR A;  2P58 C;  3B7S A;  5LCW C;  3FUI A;  1MHQ A;  4YND A;  1HG5 A;  4XX5 A;  2VGY A;  4U8H A;  4U8Y D;  5AJD A;  3I5P A;  2WM9 A;  1PC2 A;  3U3W A;  1DCQ A;  4CYM D;  4GA0 A;  3UPV A;  2ETC A;  4Z68 A;  5LFA A;  4DX1 A;  1U3D A;  4I1O B;  2C0L A;  3DXK G;  4KVO A;  4XEI G;  3CHS A;  3Q5M A;  4E6H A;  3W9F A;  3KSL A;  3APC A;  4RSY A;  1H6O A;  1RZ4 A;  2IEJ A;  1FVH A;  2HR2 A;  3S7D A;  1JCS A;  3LCA A;  1ELW A;  3FUD A;  4GZ3 A;  4JXT A;  4LUN U;  2DZN A;  3UMV A;  3C5R A;  3PZ1 A;  3Q7A A;  1BI8 B;  1X5B A;  2X6J A;  2X3M A;  3PZ3 A;  3DEP A;  3GW4 A;  4BTB A;  4HBD A;  3APF A;  3WXX A;  4A1G A;  4BT9 A;  3DPY A;  2LXM A;  2P2C P;  5AAO A;  4UI9 C;  3PS6 A;  4V3I A;  3ESL A;  2OCC E;  1OT8 A;  3ONL A;  5KJN A;  3EJN A;  1JCQ A;  1TEZ A;  5AQA A;  3HHM A;  2I9C A;  1Q2Z A;  4RVB A;  1O5M A;  1SA4 A;  3SQV A;  3RIB A;  1OCO E;  2FO1 E;  4OYS A;  4ZHB A;  3TWQ A;  5HKP A;  1K3Z D;  1E8Z A;  1D9S A;  4B8A A;  1E96 B;  2FEZ A;  2GRR B;  3RKV A;  3MV3 B;  3UX4 A;  5JJ6 A;  5FIO A;  1OCC E;  2XGO A;  4WWP A;  4FC8 A;  2VQ2 A;  4DJA A;  2GRN B;  1HU3 A;  4LG6 A;  3V2X A;  4I17 A;  4J8E A;  3E4B A;  2P9S G;  1QZ2 A;  2GRO B;  5AYW D;  2IO3 C;  3EUV A;  5ENS D;  3TWR A;  3TWU A;  3TAX A;  1N4Q A;  4UUC A;  3PZ4 A;  4N3C A;  3TWV A;  2IF4 A;  2XCC A;  3CHO A;  4G26 A;  2CHW A;  3B7U X;  3Q75 A;  5T3R A;  4EBA G;  5FZQ A;  2BKG A;  1Z5S C;  3Q9N C;  2WXK A;  3DSU A;  4DX5 D;  4U0U A;  1S64 A;  3DEO A;  5CEA A;  1LD7 A;  4J8D A;  3FU6 A;  2J4B A;  3DSV A;  4JEU A;  1N4P A;  3AS4 A;  2BF0 X;  3IXE A;  4LNG A;  5ITZ F;  1NFI E;  4OVU A;  4FU3 A;  3SNX A;  3ML9 A;  4N5Q A;  3CHP A;  3B7T A;  5B3S E;  3BG0 B;  4HQD A;  1QBQ A;  3MKQ A;  5ANR A;  1PY1 A;  5G05 C;  4NAC A;  2QZA A;  2OOE A;  1KZO A;  5EX3 A;  3JUE A;  4GYY A;  4U63 A;  5KJL A;  2IY0 C;  2HO1 A;  2VSO E;  3NQP A;  4HRN A;  2ZIS A;  3EHN A;  5JMN D;  3AS5 A;  4JHR A;  2WXI A;  1V55 E;  2YNQ A;  3S2A A;  3SBS A;  2IO2 C;  5FWQ A;  3AAA C;  2WMO A;  3LY9 A;  1H2V C;  5FQ7 A;  2Y3A A;  3IHY A;  3FH5 A;  3TWX A;  1OWM A;  4J7W A;  2H6F A;  5A23 A;  3CVQ A;  3O4Z A;  2XS1 A;  3UM1 A;  4U07 A;  3D9J A;  3SI5 A;  4O60 A;  4W9R A;  4L2L A;  5H7P A;  1KT1 A;  1BPO A;  4KYO B;  3LEW A;  3JUI A;  2BTD A;  1E8X A;  2J07 A;  4XE0 A;  5B1B E;  3P2B A;  4ILI A;  2DWZ A;  2R59 A;  1NI1 A;  2CG3 A;  3GYZ A;  3MX3 A;  2DYR E;  5AQ9 A;  5FTP A;  5FQ4 A;  3TXM A;  2PQR A;  2ION A;  4NRH B;  1HF8 A;  2GRM A;  4U04 A;  2IU1 A;  3QDN A;  4QQI A;  3PZ2 A;  5AEN A;  4F53 A;  4A3T A;  3G2S A;  5C1D A;  5G04 C;  3VTY A;  2NC9 A;  3TWT A;  3FUM A;  4HXI A;  3IV0 A;  4GU5 A;  3CHM A;  4BET A;  1H19 A;  1HO8 A;  2XPI A;  4U0S A;  5JHB A;  2AVP A;  3FUL A;  1OWO A;  4LSZ E;  2GGF A;  2BUG A;  3GZ1 A;  3ULQ A;  3FTS A;  5C2Y A;  3FTW A;  4I1A A;  1FVF A;  3IHV A;  4DX2 A;  4ILH B;  3KSQ A;  5G05 J;  3S7F A;  2VSY A;  5ENP D;  4F1P A;  4HFG A;  3C3Q A;  4UWL A;  5DBK A;  1HZ4 A;  3UM2 A;  1H6P A;  3UTM A;  5BUZ A;  2XEE A;  2KCV A;  4PS8 A;  3QAQ A;  2DYS E;  2GW1 A;  3MYV A;  4I2Z A;  5EIL A;  3ULE G;  2IJG X;  4GMJ A;  1N4S A;  2CHZ A;  5ENN A;  1OUV A;  1BU9 A;  3AG4 E;  3QAR A;  2ETB A;  4ATZ D;  1S63 A;  4WNG A;  2VJ8 A;  4JHK A;  4GZD A;  4A3V A;  5AN8 A;  2CFU A;  4TUM A;  3T5X A;  3QWW A;  5CMY A;  4Y6C A;  5CRU A;  4HLL A;  4GYW A;  3LVR E;  1XGW A;  4HOU A;  4JA9 A;  4C9B B;  2XEN A;  3HVE A;  5G55 A;  4HOS A;  3JXI A;  3SD5 A;  1QNF A;  3EDT B;  4GAA A;  1TR4 A;  2RFA A;  1PAQ A;  2BKK B;  5JJT A;  1TNZ A;  5EIB E;  3U64 A;  4BX9 A;  3VTX A;  1TN7 A;  3HRA A;  5A7D B;  3G2V A;  1IHB A;  4UQZ A;  3B13 A;  5KNH D;  1K1A A;  1N54 A;  1Z3X A;  1MX4 A;  1HH8 A;  2X6K A;  4ABN A;  5CEC B;  5LCW J;  3ML8 A;  2XRZ A;  1NL4 A;  4EZL A;  4EHM A;  5CMW A;  3CGH A;  3N71 A;  4HRM B;  3K9I A;  3ZNG A;  3TWS A;  4KZ0 A;  4J0U A;  1KLX A;  2PM6 A;  3L08 A;  2PZI A;  4JVS A;  3PEV B;  4C48 B;  1FT2 A;  5KJM A;  1BLX B;  2P9U G;  4H7X A;  1WG0 A;  1YCS B;  1H2T C;  4UI9 K;  3IEG A;  4O6F A;  3D9H A;  4ATG A;  4K5C A;  2KC7 A;  1NA3 A;  3CEQ A;  2WXF A;  3SZ7 A;  3I3N A;  3QNK A;  1SW6 A;  5FZS A;  4LRZ A;  3HDX A;  4DI3 A;  4K5A B;  5BPP A;  4YVQ C;  4DLQ A;  2I6H A;  4UI9 J;  4D10 C;  2WXO A;  4GTR A;  3PDN A;  3UT8 A;  3ZU7 B;  3ZFW A;  1INZ A;  5FJY A;  5T4Y A;  1TYQ G;  2RKK A;  4JB8 P;  1E8Y A;  1UJK A;  5LP0 A;  4J6I A;  2IQC A;  3R7Q A;  3FY4 A;  5JHA A;  2I1K A;  2KAT A;  3G2T A;  1MX6 A;  3MKQ B;  2P9N G;  2LO6 A;  4X8Q A;  3IBE A;  3MA5 A;  2KZT A;  2P9I G;  4KVM A;  3ZPJ A;  4EEC A;  1O1S A;  4GTS A;  4WWO A;  2UY1 B;  3ZRH A;  4B0Z A;  4G23 A;  3CVY A;  3R9A B;  4Q94 A;  4YDE A;  5E76 A;  4CDM A;  3FUE A;  3QOU A;  3CST A;  2AW6 A;  3UUX A;  3FTV A;  3HXB A;  3U9W A;  2L6J A;  5B1A E;  3C3O A;  3FU5 A;  1N95 A;  4UWG A;  2XPY A;  5IY5 E;  3F6Q A;  3JQ1 A;  3AJI A;  3FUN A;  3EU5 A;  4HNA D;  3JXJ A;  4JZY A;  4TXR A;  1LF8 A;  3ASG A;  2XGM A;  4P29 A;  2A5E A;  3ABM E;  1N0R A;  4XI0 A;  4LNU D;  2R03 A;  3RK6 A;  5EYL A;  4AVX A;  3O48 A;  2DVW A;  3CK7 A;  1YA0 A;  3SFX A;  2P9K G;  4DLO A;  1U2V G;  1H6K A;  4GYO A;  1IHG A;  3RAU A;  3TL5 A;  3CVN A;  4ACL A;  4HOT A;  2LNI A;  2Y1L E;  3T9K A;  3V2O A;  3C3R A;  3FUJ A;  3PNT B;  3D3M A;  3E32 A;  3QJZ A;  3E37 A;  3ZKJ A;  3CIA A;  4DUI A;  2BED A;  5BXO A;  3Q7F A;  4A55 A;  1JWG A;  2LSV A;  2IOS A;  5D66 A;  4CCA A;  4RQI A;  4I9C A;  4JD2 G;  1UN8 A;  3OXG A;  3J5P A;  3V31 A;  3CKC A;  3FEX A;  1HFA A;  2E2E A;  3AU4 A;  4JHJ A;  3CLJ A;  1MZC A;  4EPZ A;  4BFR A;  2F0Y A;  4XKC A;  2ZXW E;  5KCM A;  2E0I A;  3FUF A;  1UW4 B;  2WQH A;  3B7R L;  4CDR A;  2R2L A;  2B0O E;  4O1O A;  2WXL A;  3PUK A;  5ENR D;  1XNF A;  2VSN A;  5HI7 A;  3FTY A;  4KT6 B;  2YHC A;  3LVQ E;  4AM9 A;  4GTQ A;  4YDO A;  3UIP C;  1K8K G;  5BV1 A;  3FHE A;  3L16 A;  3D9N A;  4KXK B;  1OWL A;  2XRY A;  1UN9 A;  1G3N B;  3I4G A;  3MZL B;  3HG0 D;  3HXD A;  4G25 A;  4AEZ C;  4FAD A;  4GA1 A;  5FIN A;  3JQ0 A;  1YMP A;  4URK A;  2OV8 A;  4L9P A;  4ANV A;  2FBN A;  2ZGG A;  1FT1 A;  4G1T A;  2MOW A;  1NP7 A;  4UQY A;  3RRM B;  4GPM A;  2LXL A;  3SGH A;  5JJ7 A;  5J08 A;  1BD8 A;  3DSS A;  4F1S A;  4UQX A;  2NYJ A;  2WXG A;  2IOL A;  2A4Z A;  3Q47 B;  2L0I A;  3OXF A;  3Q9U C;  2NSZ A;  1MQS A;  4HOR A;  4XI9 A;  5FQ6 A;  3PE3 A;  3NOG D;  4MKT A;  3ZHE A;  4RG9 A;  3V79 K;  2OND A;  3ZXP A;  3RU0 A;  3EIQ C;  3CV0 A;  3C98 A;  3E34 A;  3ZYM A;  5AJL A;  3Q49 B;  4F7A A;  1Y8M A;  4K0R A;  2XHE A;  1B89 A;  5LX8 A;  2VGE A;  3QWV A;  1BI7 B;  3L22 A;  2DZO A;  3APD A;  3QKY A;  3UI2 A;  3E30 A;  1ELK A;  4H7Y A;  1ZBP A;  1HX8 A;  3CQC B;  4AJW A;  3PH0 C;  3DRA A;  1QQE A;  3UXG A;  4O1P A;  3UT7 A;  5CCL A;  3ZYL A;  2CHX A;  1JWF A;  3FUH A;  1SZ9 A;  3CHR A;  4ZFH A;  4GPK A;  2J09 A;  2YHE A;  2JLB A;  2PNN A;  2YIN A;  2UWJ G;  4FP7 A;  4MBG A;  2DCP A;  3LJ3 A;  1TNB A;  1WAO 1;  2H6I A;  4CT4 A;  3D9L A;  4BEP A;  3NF1 A;  4TV3 A;  3DXM G;  2FO7 A;  2X6I A;  3HVE B;  3FDH A;  1S0P A;  3AG3 E;  2V0P A;  4I43 A;  2MRI A;  3DPD A;  1SQM A;  3D9I A;  2R5S A;  4IN3 B;  4AXH A;  5G2N A;  2XPZ A;  4GZC A;  4IUL A;  1O1T A;  4BT8 A;  4RLY A;  4DK5 A;  4YDW A;  1H0A A;  4UWK A;  3TG4 A;  3Q79 A;  1IQU A;  3D9O A;  1KT0 A;  2OVB A;  2Y0B G;  3CVL A;  3P1U A;  2L0T B;  3PVL A;  5EDS A;  4B8C B;  3T5V A;  3T8M A;  5D0Q D;  4BY6 A;  4OVV A;  4FHK A;  4FHJ A;  3MV2 B;  4N5C A;  2P9P G;  4XKB A;  5EKQ D;  4RG6 A;  3RO2 A;  4DRX E;  4CGW A;  3ZN3 A;  4G24 A;  2QY7 A;  3BUA A;  3FTX A;  1EDU A;  2ZIR A;  3BU8 A;  4A1S A;  2C0M A;  3SFY A;  3R9M A;  2EIN E;  1HG2 A;  4OAV B;  2FF4 A;  2PQN A;  4B93 B;  4GTV A;  3OAW A;  3PRZ A;  3HIZ A;  4KBQ A;  2WXM A;  3HXE A;  3MEK A;  4Q96 A;  2F8X K;  2VGX B;  5CCM A;  1W3B A;  3AS8 A;  3EIJ A;  4NUR A;  3FTZ A;  3CVW A;  1OY3 D;  2HE0 A;  3ASO E;  4GMR A;  1OXJ A;  4L2Y A;  1D8E A;  1S70 B;  3FWV A;  4JPS A;  4FUL A;  1GW6 A;  2KZT B;  3B7B A;  1E8W A;  2WMN A;  1WDY A;  3Q78 A;  3W9G A;  4CZ2 D;  3CHQ A;  4WAF A;  2JAB A;  4DX7 D;  3UM0 A;  3MJW A;  5A6C A;  2WQ6 A;  2KM4 A;  4Q69 A;  3RSE G;  3D9K A;  3PRE A;  2R05 A;  4NIK A;  3UKU G;  4UWH A;  2PL2 A;  2CG2 A;  2F37 A;  2QFC A;  3TXN A;  3OTN A;  1O1R A;  3SFZ A;  4PH4 B;  3AU5 A;  3L6A A;  1JUQ A;  3AG1 E;  5EYP F;  1KPS B;  3DSX A;  2M63 A;  3ESK A;  4GCN A;  3KS2 A;  3UKR G;  3FU0 A;  4WNF A;  2X6H A;  3DBS A;  4KMO A;  2Y4U A;  3UIN C;  2CFZ A;  4HVB A;  4FA6 A;  1DVP A;  3V30 A;  4C0E A;  3B95 A;  4FJZ A;  1TN8 A;  2WVI A;  3RO3 A;  1SVX A;  4TUU A;  2QC9 A;  3ZYK A;  3S7B A;  4ILG A;  5ARG A;  3ASD A;  3CK9 A;  1Z6T A;  4L23 A;  4Y6W A;  5BW8 C;  3Q4A B;  5AIJ A;  4GB9 A;  3LY8 A;  5BT1 A;  5BXU A;  4EZK A;  4TXQ A;  1H2U A;  2MHK A;  1DC2 A;  3D9M A;  4ANU A;  4MLP A;  3ASF A;  3T8K A;  5FT9 A;  4AV7 A;  2V4H C;  3SBT B;  2L6B A;  4HI9 A;  2XS8 A;  1MYO A;  5AAR A;  5JA4 D;  4AIF A;  3KAE A;  1X81 A;  5CED B;  4EQF A;  3EHR A;  2AXV A;  2WB2 A;  4F6R D;  5ENQ D;  5KBA A;  2ZGD A;  2EQX A;  5J90 A;  3MKR A;  3LY7 A;  3ZYQ A;  1YYH A;  4I6E A;  2GRL A;  3OXL A;  2FUL A;  3CVU A;  2V5F A;  5HS0 A;  4WNE A;  4HI8 A;  3QWP A;  2VTB B;  3NAW A;  2XCB A;  4WWN A;  1SA5 A;  2J8S D;  2AJA A;  3HYM B;  3JCK C;  2VGX A;  1SZA A;  4JEH A;  3CVV A;  2PM7 A;  2J4D A;  4GTT A;  4L1B A;  4LER A;  2AXZ A;  4OAU C;  2WXH A;  4U7E B;  1WY6 A;  3NZU A;  4WND A;  2KBX A;  5HQ8 A;  3GZS A;  3SF4 A;  4E85 A;  1KZP A;  3SHF A;  3NBN B;  3ZEF A;  5AQB A;  2UY1 A;  3RJV A;  3J5Q B;  4I9E A;  4GML A;  4G2V A;  3HXC A;  2AXU A;  4J8F A;  4LCT A;  1EYH A;  4DPR A;  1TN6 A;  3LXU X;  2RD0 A;  1MJ0 A;  3CSF A;  2EIJ E;  2JEK A;  5CBN A;  2AWI A;  1OWP A;  5EN5 D;  4LNB A;  5HRY A;  4BSX A;  4APF A;  3PZD A;  3ASN E;  1E7V A;  3D9P A;  3TWW A;  2LAI A;  4B89 A;  4JA7 A;  4F3V A;  1AP7 A;  3PE4 A;  3EU9 A;  1N9A A;  1WM5 A;  5D2M C;  4PUC A;  4EZJ A;  2VYI A;  2WXP A;  4NQ0 A;  3ZW3 A;  4AOF A;  1V54 E;  5ENT D;  3L54 A;  4HRL A;  4AP2 A;  2F8Y A;  3G2U A;  2VTB A;  4JC8 A;  3SO8 A;  3TG5 A;  2KXP C;  3NZS A;  3QK0 A;  1HXI A;  4N39 A;  5EX0 A;  4FLB A;  1QYM A;  1A5E A;  5G04 J;  1IYG A;  1LD8 A;  1AWC B;  3UQ3 A;  1NA0 A;  1MX2 A;  5T8I A;  2P9L G;  1A17 A;  3VLD A;  3FFL A;  3ZUV B;  3FUK A;  4FJY A;  2J08 A;  1IKN D;  2V5Q C;  2WXJ A;  3NOC D;  4CEM A;  1Z3Y A;  2LAH A;  2KCK A;  2XGS A;  4MRU A;  4M3O A;  3R7R A;  5DIZ A;  4YDY A;  3DWL G;  3S7J A;  4PS7 A;  3NB2 A;  3BEE A;  3VLE A;  2MYO A;  3ZGQ A;  1N52 A;  5AQ7 A;  3CR3 A;  5CHE E;  4J8Y A;  1D8D A;  4FLH A;  4N3A A;  4N3B A;  3ONK A;  2EIL E;  4U8V D;  3ZHE B;  4PDX A;  2L9B A;  2I2O A;  3CKB A;  2X38 A;  4BSZ B;  3L17 A;  4CGV A;  3BQO A;  3ENE A;  3CVX A;  2ZU6 B;  1IQR A;  5KWD A;  1E90 A;  3ABL E;  4G8L A;  4APO A;  4HLE A;  5KNG A;  4BER A;  5CBO A;  1U3C A;  1NZN A;  2OEV A;  2WPV A;  3UIO C;  1RW2 A;  1JCR A;  4TRQ A;  4MS6 A;  3PNL B;  3LKU A;  4AY5 A;  2Q7F A;  3PUJ A;  4ACK A;  3L9T A;  3LJN A;  4PS3 A;  3LPZ A;  3ZIM A;  3ISM C;  2I1J A;  1OCZ E;  3ASH A;  2J49 A;  4K03 A;  4B94 A;  2GRP B;  1IXV A;  4N2S A;  4DI4 A;  3C72 A;  3JYS A;  2A5U A;  4ANX A;  3ABK E;  3FP3 A;  4AY6 A;  2EIK E;  4YVO A;  4IYP A;  2R17 C;  2QYU A;  2X6F A;  2KCL A;  3LYA A;  4R7L A;  3MGB A;  5ARF A;  1UJJ A;  3QC1 A;  4A63 B;  1E7U A;  2LSU A;  4ME2 A;  5BNW A;  4JL0 A;  2XQ0 A;  3ULY A;  1UG3 A;  5KJK A;  1EF1 C;  4J8S A;  4UWF A;  5E75 A;  4KZC A;  4GTO A;  2NXP A;  1UOH A;  2V8S E;  3DST A;  1OWN A;  1TJF A;  5LOZ A;  3VLF A;  4CDN A;  2WXQ A;  2ETA A;  3G2W A;  1HE8 A;  1K1B A;  3ZXS A;  2QYJ A;  3URZ A;  2WXN A;  3FH7 A;  4G8K A;  3Q15 A;  2RG8 A;  4IRU A;  3LS8 A;  2J9Q A;  1JPL A;  3MCX A;  1N11 A;  5FQ8 A;  1HS6 A;  2OVF A;  3UT4 A;  4L7T A;  4EBA A;  2WQ7 A;  3KD7 A;  1TNO A;  3EHM A;  1TJC A;  4JW1 A;  2HM8 A;  4BES A;  3HXF A;  2WXR A;  4I6G A;  5EID A;  4CT0 A;  4GZ6 A;  2RFM A;  3FU3 A;  2IFU A;  2OEW A;  4M7C A;  1TNU A;  4GCO A;  2DBA A;  2LUH A;  4N2Q A;  3AG2 E;  4HS2 A;  5ENO D;  2FI7 A;  2VSX E;  2Y4T A;  1FPP A;  3DSW A;  3CK8 A;  4CRW A;  4TXP A;  3L82 A;  1N0Q A;  4QFV A;  3KEZ A;  3CVP A;  4GA2 A;  3BG1 B;  4HB5 A;  3FTU A;  3FH8 A;  4DX6 D;  3KEA A;  4I6J A;  3FEY A;  4GZ5 A;  2EIM E;  4WUY A;  1EPU A;  1N4R A;  3GZ2 A;  5M72 A;  1Y6I A;  4I2W A;  3TJP A;  1VDY A;  3IKO B;  4U96 D;  1L5J A;  3X2Q E;  1P5Q A;  2YQ8 A;  4HOQ A;  4BX8 A;  3RRN B;  4BTA A;  3RRU A;  3UM3 A;  2H6G A;  3TGO A;  4K5B A;  5D0O D;  4GTP A;  2Y69 E;  4GTM A;  2HYZ A;  3CQG B;  3U4T A;  4G11 A;  3Q73 A;  2C2L A;  1FCH A;  4LEU A;  1LTX A;  4U95 D;  2DIW A;  3WG7 E;  3E33 A;  5BV0 A;  2GRQ B;  3L13 A;  1N94 A;  3SY2 A;  2R02 A;  2XZT G;  5ANL A;  3QB2 A;  2B6C A;  3EHQ A;  4XIF A;  3I4R B;  1OCR E;  4U0Z A;  1DNP A;  1TNY A;  2XZD G;  5CRV A;  1DCE A;  3LDZ A;  3U66 A;  2ILR A;  1ZB1 A;  2XEV A;  1ZU2 A;  3PEU B; 
#chains in the Genus database with same CATH homology
 2OND A;  1EYH A;  4UWL A;  5DBK A;  1HZ4 A;  5FZR A;  1ELR A;  3RU0 A;  4DPR A;  3EIQ C;  4I1M A;  3CV0 A;  3ZVV A;  3C98 A;  4C0M A;  5BUZ A;  2KCV A;  4PS8 A;  3LXU X;  4XZ4 A;  3QAQ A;  4ANW A;  3ZYM A;  5AJL A;  2RD0 A;  3CSF A;  3Q49 B;  2JEK A;  2GW1 A;  2V4L A;  3MYV A;  4I2Z A;  4F7A A;  2AWI A;  1Y8M A;  4BWR A;  2P58 C;  1OWP A;  3B7S A;  5LCW C;  2IJG X;  3FUI A;  4GMJ A;  4K0R A;  2XHE A;  1B89 A;  1MHQ A;  4YND A;  1HG5 A;  3QWV A;  4BSX A;  2CHZ A;  3L22 A;  3PZD A;  5ENN A;  1OUV A;  4APF A;  4XX5 A;  3APD A;  3QAR A;  1E7V A;  3D9P A;  2VGY A;  4WNG A;  4U8H A;  2VJ8 A;  2LAI A;  4JHK A;  5AJD A;  3QKY A;  4B89 A;  3I5P A;  4GZD A;  4JA7 A;  4A3V A;  2CFU A;  4F3V A;  1ELK A;  3T5X A;  4H7Y A;  2WM9 A;  3PE4 A;  1PC2 A;  1ZBP A;  3QWW A;  5CMY A;  4Y6C A;  1HX8 A;  1WM5 A;  3U3W A;  4PUC A;  4EZJ A;  2VYI A;  2WXP A;  3CQC B;  4AJW A;  3PH0 C;  1QQE A;  4GA0 A;  4GYW A;  3LVR E;  1XGW A;  4HOU A;  3UT7 A;  4JA9 A;  4C9B B;  4NQ0 A;  5CCL A;  3ZW3 A;  3HVE A;  3ZYL A;  5G55 A;  2CHX A;  3UPV A;  4HOS A;  4AOF A;  3SD5 A;  5LFA A;  1QNF A;  1JWF A;  3FUH A;  1SZ9 A;  3EDT B;  3CHR A;  4GPK A;  4GAA A;  1U3D A;  2J09 A;  1PAQ A;  5JJT A;  2YHE A;  4I1O B;  2C0L A;  2JLB A;  3L54 A;  4KVO A;  3U64 A;  4BX9 A;  3CHS A;  3Q5M A;  4AP2 A;  4E6H A;  2YIN A;  3VTX A;  2UWJ G;  4FP7 A;  3G2U A;  2VTB A;  4JC8 A;  3APC A;  4RSY A;  5A7D B;  2DCP A;  3G2V A;  3LJ3 A;  1FVH A;  3B13 A;  4UQZ A;  2HR2 A;  3TG5 A;  3S7D A;  1WAO 1;  3NZS A;  3LCA A;  1ELW A;  4CT4 A;  3D9L A;  1N54 A;  3FUD A;  1HXI A;  3QK0 A;  1Z3X A;  4GZ3 A;  4JXT A;  4N39 A;  4LUN U;  5LX8 A;  5EX0 A;  4FLB A;  3NF1 A;  4TV3 A;  2FO7 A;  2X6I A;  1HH8 A;  3HVE B;  2X6K A;  3FDH A;  1S0P A;  3UMV A;  5G04 J;  1IYG A;  4ABN A;  1X5B A;  2V0P A;  2X6J A;  5LCW J;  3UQ3 A;  1NA0 A;  3ML8 A;  4I43 A;  2XRZ A;  2MRI A;  3DPD A;  5T8I A;  1SQM A;  2X3M A;  3D9I A;  2R5S A;  4IN3 B;  1A17 A;  3VLD A;  4AXH A;  4EZL A;  5G2N A;  5CMW A;  2XPZ A;  3GW4 A;  3FFL A;  3CGH A;  4GZC A;  4BTB A;  3N71 A;  3FUK A;  3K9I A;  4FJY A;  2J08 A;  4IUL A;  4BT8 A;  4KZ0 A;  3APF A;  4J0U A;  4DK5 A;  1KLX A;  2WXJ A;  3WXX A;  4CEM A;  1H0A A;  2PM6 A;  3L08 A;  4A1G A;  1Z3Y A;  2PZI A;  4UWK A;  3TG4 A;  4JVS A;  1IQU A;  2LAH A;  4BT9 A;  3D9O A;  3PEV B;  1KT0 A;  2OVB A;  3CVL A;  3P1U A;  2L0T B;  4UI9 C;  3PVL A;  5EDS A;  4B8C B;  5KJM A;  2KCK A;  2XGS A;  4MRU A;  4M3O A;  3T5V A;  4H7X A;  3R7R A;  3T8M A;  3PS6 A;  4V3I A;  5DIZ A;  3ESL A;  3ONL A;  5D0Q D;  5KJN A;  4BY6 A;  3S7J A;  1H2T C;  4OVV A;  4PS7 A;  4UI9 K;  4FHK A;  3IEG A;  3BEE A;  3EJN A;  3VLE A;  4FHJ A;  3MV2 B;  4O6F A;  3ZGQ A;  1N52 A;  1TEZ A;  3CR3 A;  4N5C A;  5CHE E;  4ATG A;  4FLH A;  4XKB A;  2KC7 A;  1NA3 A;  3HHM A;  3CEQ A;  2WXF A;  2I9C A;  5EKQ D;  4RG6 A;  4N3A A;  3I3N A;  3SZ7 A;  3RO2 A;  3QNK A;  4N3B A;  4RVB A;  3ONK A;  4CGW A;  5FZS A;  4LRZ A;  3RIB A;  3ZHE B;  4PDX A;  3ZN3 A;  2L9B A;  4OYS A;  3HDX A;  4DI3 A;  2I2O A;  4G24 A;  3CKB A;  2QY7 A;  2X38 A;  3L17 A;  4CGV A;  5BPP A;  4YVQ C;  4DLQ A;  1E8Z A;  2I6H A;  3ENE A;  4B8A A;  3FTX A;  1EDU A;  1E96 B;  4UI9 J;  2FEZ A;  2WXO A;  4A1S A;  4D10 C;  2ZU6 B;  3PDN A;  3UT8 A;  1IQR A;  2C0M A;  3RKV A;  3ZFW A;  1E90 A;  1INZ A;  5FJY A;  3MV3 B;  5T4Y A;  3UX4 A;  4APO A;  5JJ6 A;  4HLE A;  1E8Y A;  1U3C A;  1UJK A;  5LP0 A;  4J6I A;  1NZN A;  2IQC A;  3R7Q A;  3FY4 A;  5JHA A;  1HG2 A;  2WPV A;  2XGO A;  4WWP A;  2FF4 A;  2I1K A;  2KAT A;  3G2T A;  4TRQ A;  3MKQ B;  4MS6 A;  2PQN A;  4FC8 A;  2LO6 A;  3PNL B;  3LKU A;  2VQ2 A;  4DJA A;  1HU3 A;  4I17 A;  3IBE A;  2Q7F A;  3OAW A;  4J8E A;  3PRZ A;  3HIZ A;  4AY5 A;  4KBQ A;  3E4B A;  3MA5 A;  3PUJ A;  2WXM A;  4ACK A;  2KZT A;  1QZ2 A;  3MEK A;  4Q96 A;  4PS3 A;  2VGX B;  4KVM A;  3LPZ A;  3ZPJ A;  4EEC A;  5CCM A;  3ZIM A;  5AYW D;  4WWO A;  2UY1 B;  1W3B A;  2I1J A;  3AS8 A;  3ASH A;  3TAX A;  2J49 A;  4K03 A;  3ZRH A;  4B94 A;  4B0Z A;  3EIJ A;  4G23 A;  4NUR A;  3CVY A;  3FTZ A;  3R9A B;  4N3C A;  4Q94 A;  4N2S A;  2IF4 A;  4DI4 A;  2XCC A;  3CVW A;  3JYS A;  5E76 A;  4CDM A;  2A5U A;  3CHO A;  4ANX A;  3FUE A;  3FP3 A;  4G26 A;  3QOU A;  2CHW A;  3CST A;  3B7U X;  2AW6 A;  4AY6 A;  4L2Y A;  4IYP A;  3FTV A;  4YVO A;  5T3R A;  2R17 C;  3UUX A;  3FWV A;  3U9W A;  2L6J A;  5FZQ A;  4EBA G;  2X6F A;  4JPS A;  2KCL A;  4FUL A;  1GW6 A;  3LYA A;  2KZT B;  3FU5 A;  1E8W A;  2WMN A;  4R7L A;  3MGB A;  4UWG A;  2XPY A;  3CHQ A;  5ARF A;  1UJJ A;  3QC1 A;  4WAF A;  2WXK A;  1E7U A;  2LSU A;  3JQ1 A;  4U0U A;  3FUN A;  4ME2 A;  5BNW A;  3MJW A;  4J8D A;  3FU6 A;  4JL0 A;  2J4B A;  5A6C A;  2WQ6 A;  4JEU A;  2KM4 A;  2XQ0 A;  4Q69 A;  1UG3 A;  5KJK A;  1EF1 C;  3AS4 A;  3D9K A;  3PRE A;  1LF8 A;  4J8S A;  4JZY A;  2BF0 X;  3ASG A;  2XGM A;  4P29 A;  4UWF A;  4UWH A;  5E75 A;  4KZC A;  2PL2 A;  2CG2 A;  2QFC A;  3TXN A;  3OTN A;  2NXP A;  4XI0 A;  4OVU A;  4FU3 A;  3SNX A;  2V8S E;  3SFZ A;  3ML9 A;  4PH4 B;  1OWN A;  3AU5 A;  3CHP A;  1TJF A;  5LOZ A;  3RK6 A;  3VLF A;  3B7T A;  2WXQ A;  3L6A A;  1JUQ A;  4CDN A;  3G2W A;  1HE8 A;  3BG0 B;  4AVX A;  3ZXS A;  3URZ A;  3MKQ A;  3O48 A;  2M63 A;  3CK7 A;  2WXN A;  1YA0 A;  3ESK A;  3FH7 A;  3Q15 A;  4GCN A;  4DLO A;  1H6K A;  5ANR A;  4GYO A;  1PY1 A;  1IHG A;  3KS2 A;  3TL5 A;  2RG8 A;  4IRU A;  4NAC A;  3FU0 A;  5G05 C;  3LS8 A;  2J9Q A;  1JPL A;  3CVN A;  4WNF A;  2X6H A;  3DBS A;  4ACL A;  3MCX A;  4KMO A;  4HOT A;  2Y4U A;  2OOE A;  2LNI A;  5EX3 A;  4GYY A;  2CFZ A;  5FQ8 A;  4U63 A;  4HVB A;  5KJL A;  2HO1 A;  2VSO E;  1HS6 A;  2OVF A;  3UT4 A;  3FUJ A;  3NQP A;  3PNT B;  4FA6 A;  3D3M A;  1DVP A;  4L7T A;  4C0E A;  4EBA A;  2WQ7 A;  4FJZ A;  3QJZ A;  3EHN A;  3AS5 A;  4JHR A;  2WXI A;  2WVI A;  2YNQ A;  3S2A A;  3KD7 A;  3CIA A;  3RO3 A;  3EHM A;  3SBS A;  4TUU A;  3ZYK A;  5FWQ A;  3S7B A;  1TJC A;  4JW1 A;  2HM8 A;  4ILG A;  5ARG A;  4A55 A;  2WMO A;  1JWG A;  2LSV A;  1Z6T A;  2IOS A;  3ASD A;  3CK9 A;  4L23 A;  4Y6W A;  3LY9 A;  3Q4A B;  5BW8 C;  4CCA A;  5AIJ A;  1H2V C;  3LY8 A;  4GB9 A;  2WXR A;  1UN8 A;  4I9C A;  5FQ7 A;  3OXG A;  4EZK A;  5BT1 A;  4I6G A;  4CT0 A;  3CKC A;  4GZ6 A;  3FEX A;  1H2U A;  2Y3A A;  1HFA A;  2E2E A;  2MHK A;  3FU3 A;  2IFU A;  3IHY A;  3AU4 A;  3D9M A;  3FH5 A;  4JHJ A;  4ANU A;  4GCO A;  2DBA A;  4MLP A;  4N2Q A;  3CLJ A;  3ASF A;  4HS2 A;  1OWM A;  5A23 A;  4EPZ A;  4BFR A;  3CVQ A;  2FI7 A;  4XKC A;  5FT9 A;  5KCM A;  3O4Z A;  4AV7 A;  2VSX E;  2Y4T A;  3SBT B;  2E0I A;  3FUF A;  3CK8 A;  1UW4 B;  2WQH A;  3B7R L;  4CRW A;  4CDR A;  4U07 A;  3D9J A;  3SI5 A;  4W9R A;  2WXL A;  4L2L A;  3PUK A;  4AIF A;  1XNF A;  1KT1 A;  2VSN A;  1BPO A;  4QFV A;  5HI7 A;  3FTY A;  3KAE A;  3KEZ A;  3LEW A;  4KYO B;  4KT6 B;  2YHC A;  3JUI A;  4EQF A;  3CVP A;  4GA2 A;  3LVQ E;  2AXV A;  2BTD A;  1E8X A;  3BG1 B;  4AM9 A;  2WB2 A;  2J07 A;  4XE0 A;  3P2B A;  3FTU A;  3FH8 A;  4ILI A;  3FHE A;  5BV1 A;  2EQX A;  5J90 A;  2R59 A;  3MKR A;  3LY7 A;  4I6J A;  2CG3 A;  3FEY A;  3L16 A;  3ZYQ A;  3GYZ A;  4GZ5 A;  4I6E A;  3D9N A;  3MX3 A;  4KXK B;  5FTP A;  1OWL A;  2GRL A;  1EPU A;  2FUL A;  2XRY A;  3GZ2 A;  3OXL A;  2V5F A;  4WUY A;  5M72 A;  3CVU A;  1Y6I A;  4I2W A;  5FQ4 A;  3TXM A;  1VDY A;  2PQR A;  3TJP A;  2ION A;  1UN9 A;  4NRH B;  1HF8 A;  3IKO B;  4WNE A;  1L5J A;  2GRM A;  4U04 A;  1P5Q A;  2YQ8 A;  3QWP A;  2IU1 A;  3QDN A;  2VTB B;  3I4G A;  4HOQ A;  5AEN A;  3MZL B;  4G25 A;  3RRN B;  2XCB A;  4AEZ C;  4BX8 A;  4GA1 A;  4FAD A;  3JQ0 A;  4F53 A;  4A3T A;  4BTA A;  3G2S A;  5C1D A;  4URK A;  5G04 C;  3RRU A;  2OV8 A;  3VTY A;  4WWN A;  2NC9 A;  3HYM B;  3JCK C;  3TGO A;  2VGX A;  1SZA A;  4ANV A;  4JEH A;  5D0O D;  2FBN A;  4G1T A;  3FUM A;  2HYZ A;  2MOW A;  3CVV A;  4HXI A;  3CQG B;  3U4T A;  3IV0 A;  4G11 A;  2PM7 A;  4GU5 A;  3CHM A;  2J4D A;  1H19 A;  2C2L A;  4L1B A;  1FCH A;  4LER A;  2AXZ A;  4LEU A;  1HO8 A;  2WXH A;  1NP7 A;  1WY6 A;  3NZU A;  2DIW A;  4UQY A;  4WND A;  2XPI A;  3RRM B;  5BV0 A;  3L13 A;  4U0S A;  5JHB A;  3SGH A;  5JJ7 A;  5HQ8 A;  2AVP A;  5J08 A;  3GZS A;  3SF4 A;  3FUL A;  4F1S A;  1OWO A;  4UQX A;  5ANL A;  2WXG A;  4E85 A;  2IOL A;  2GGF A;  3QB2 A;  2A4Z A;  2BUG A;  3Q47 B;  2L0I A;  3SHF A;  3OXF A;  4XIF A;  2NSZ A;  3GZ1 A;  3I4R B;  3ULQ A;  3ZEF A;  4U0Z A;  1MQS A;  3FTS A;  4HOR A;  5C2Y A;  2UY1 A;  4XI9 A;  3FTW A;  3RJV A;  5FQ6 A;  1DNP A;  4I1A A;  3PE3 A;  1FVF A;  4MKT A;  3IHV A;  4I9E A;  4ILH B;  3ZHE A;  4RG9 A;  3LDZ A;  4GML A;  4G2V A;  5G05 J;  3S7F A;  3U66 A;  2VSY A;  2ILR A;  3CVX A;  2AXU A;  4HFG A;  4J8F A;  4LCT A;  2XEV A;  1ZU2 A;  3PEU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...