4J8SA

Crystal structure of human cnot1 mif4g domain in complex with a ttp peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
180
structure length
180
Chain Sequence
b'QQTDLSQVWPEANQHFSKEIDDEANSYFQRIYNHPPHPTMSVDEVLEMLQRFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKELHITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEYIEYGQQSRDPPVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT transcription complex subunit 1
publication title Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 63
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16417 CNOT1_TTP_bind CCR4-NOT transcription complex subunit 1 TTP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.840 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4j8sA00
4J8SA
chains in the Genus database with same CATH superfamily
1N0QA 3FEYA 2RD0A 3V2OA 1Z3YA 3SBTB 3PZ4A 4GCOA 5CBOA 5B3SE 1BD8A 3B7TA 3TJPA 4RG6A 1SW6A 3RIBA 3OXGA 5EKQD 2AXUA 1ZB1A 5CRUA 1HG5A 1DNPA 4DLQA 1S63A 3LEWA 5CEAA 5LX8A 5FZQA 1KZPA 1MZCA 2KXPC 2QYUA 2IONA 5ENOD 1VDYA 1YCSB 4IYPA 4B8AA 5CBNA 3DSVA 4FU3A 5M72A 2XRZA 5CCMA 1LD7A 1E8XA 3CHMA 4DI4A 2GW1A 3VLEA 2GRNB 3O48A 5BPPA 3CEQA 2PQNA 3UQ3A 3D9IA 3CVXA 5T3RA 4I6JA 1OCOE 1HS6A 4DLOA 1FT2A 5CMYA 3X2QE 3CHPA 5AN8A 4G24A 2XQ0A 3NAWA 4B94A 2BUGA 3SO8A 1RZ4A 2A5UA 3PVLA 3TWRA 2J4DA 2PNNA 1O1SA 2FO7A 4J8DA 5BUZA 3URZA 3EHRA 4J8EA 4JXTA 4OVUA 4R7LA 3FTZA 2C0LA 2FEZA 4CDMA 2EQXA 4BWRA 4CT0A 5BXUA 3MKQB 1FT1A 3L13A 3FY4A 1TN8A 4NQ0A 2A4ZA 5EIDA 4U04A 3C3RA 2OCCE 2HE0A 3Q9NC 3ULYA 3GZSA 3ZYLA 3ZGQA 3MV2B 3L9TA 4J8YA 3UTMA 1NFIE 3IEGA 3LYAA 1H6KA 4AY5A 4RLYA 4APOA 2X6JA 4FP7A 2KZTA 5EN5D 4GYYA 3JCKC 4GYOA 2ZGDA 3GZ2A 2KCVA 2R02A 3PE3A 3R9MA 3PDNA 4A3TA 5A7DB 3QKYA 4WNDA 3NZSA 5ITZF 5JJ7A 5LCWC 5AYWD 3DSSA 3ABME 2NSZA 3DPDA 3ZKJA 3WXXA 4L23A 4J6IA 3UMVA 4U0ZA 2J9QA 2OOEA 3ZFWA 5A6CA 4ANVA 3DPYA 4FJYA 3FTVA 5HS0A 3HXFA 1OUVA 3TWVA 3D9MA 4FADA 3UIPC 3EJNA 1EF1C 1UJJA 1B89A 4G8KA 2UY1B 1ZBPA 4TRQA 2XCCA 3TG4A 3RAUA 4U8HA 3PZ3A 5CERB 4KT6B 3CHSA 4GA1A 2P9KG 3TG5A 4EZKA 1E7UA 3Q7AA 4UWKA 3G2VA 2RFMA 3QOUA 2VJ8A 2RG8A 1IXVA 2XGMA 3AS8A 4RG9A 2P9PG 3P2BA 2HR2A 2AXVA 4L2LA 3LKUA 3FFLA 1LTXA 4U63A 4XX5A 3KEZA 3SGHA 5KJKA 3ABKE 5CEDB 4GB9A 3KSQA 3TL5A 1SQMA 2ETBA 2IJGX 2IF4A 1O1TA 5BXOA 2LUHA 3PNTB 4BESA 2GRMA 4AM9A 2VSXE 4O6FA 4FLHA 3I3NA 5EYLA 3C72A 4DRXE 3ULQA 3UT8A 4KZCA 1TEZA 4E6HA 5AAOA 3NOCD 1H6OA 3SFXA 1SVXA 4DX5D 4F53A 1N11A 2WXLA 3VTXA 5KJNA 1BI8B 5G04C 3LY7A 3AU5A 3S7BA 3SQVA 2AXZA 1IQRA 3LJNA 1Z5SC 3D9NA 3ABLE 5EX3A 4GZ3A 1O1RA 3RU0A 3FDHA 5JA4D 2WXIA 2VTBA 4H7XA 3FWVA 4MBGA 4JHRA 5FQ7A 4UWFA 3P1UA 1HX8A 4HS2A 4PUCA 4YNDA 3FHEA 4EBAA 5ENSD 1LF8A 3PUJA 3CV0A 3EUVA 2H6HA 2WXOA 2ETAA 2WB2A 3HVEA 3LVRE 4HOQA 4TV3A 3UKRG 2DWZA 1WM5A 1SA4A 5ANLA 4GMLA 1H19A 4BEPA 4EHMA 5EILA 5KJLA 4JZYA 1KZOA 1E96B 5FZSA 3OTNA 3PE4A 2B6CA 2VQ2A 3Q15A 4WWPA 2DVWA 5CHEE 4YVQC 1TYQG 5JJTA 4DJAA 3ENEA 3QARA 3R7QA 4G25A 3T8KA 3I5PA 3F6QA 1NZNA 4GZ6A 3AG4E 3MV3B 5D2MC 3ZU7B 3G2UA 4ZFHA 3DRAA 3SI5A 5FWQA 3FUHA 2LSUA 4GTRA 3FTXA 3V31A 4EBAG 3PNLB 3CKBA 2KATA 5AIJA 4DX1A 3DWLG 3MGBA 3FTWA 5G2NA 4UWGA 4GPKA 1V55E 2WMNA 5BV1A 4HI8A 4I43A 3MJWA 4HB5A 4AV7A 3JQ0A 4ACKA 3CVWA 2IEJA 3I4RB 5HKPA 3QDNA 1QQEA 4AOFA 3SF4A 3MX3A 4F1PA 5G05C 3C98A 4YDYA 4ME2A 3SD5A 4WNEA 1PC2A 3B95A 2I6HA 2YQ8A 4I1OB 2JEKA 5T4YA 4A55A 3QC1A 1JUQA 4DX2A 4I6EA 2ZISA 3CHOA 1IKND 4P29A 1DC2A 4TUUA 3AG1E 4C48B 4BX9A 2L6BA 5ENQD 5AARA 4Z68A 3V30A 2P9LG 2XGOA 2FI7A 1N95A 2WXRA 2LO6A 4I9EA 1TR4A 4J8SA 2LXLA 5AQ9A 2F8XK 4JHKA 3ASNE 2WXJA 2J07A 2FO1E 4LUNU 5AJLA 2AJAA 2IOLA 4K03A 2FBNA 4PDXA 2DYSE 4ZHBA 3RO3A 3WG7E 2V5QC 3TWXA 4AJWA 2VGYA 3MA5A 2R2LA 2QY7A 3KEAA 4GZCA 5CECB 4W9RA 5KJMA 3IKOB 5DBKA 3R7RA 4DPRA 1MX4A 2RFAA 1QYMA 2VSNA 2C2LA 2VSOE 4K0RA 3HDXA 3ASFA 2DYRE 5B1BE 3SHFA 1WAO1 3CHRA 5ENRD 3ML8A 4O1PA 5LCWJ 5E75A 4BFRA 4HLLA 4JL0A 3PS6A 1TNOA 1Y6IA 4GTSA 5ENPD 4WUYA 3DSWA 4AY6A 4O1OA 1MJ0A 3ESKA 4XI0A 4M7CA 2XGSA 2Y3AA 1N4SA 3AS5A 1Q2ZA 1H2VC 5FQ6A 1E90A 3SZ7A 5HI7A 3APFA 4LNBA 3DXKG 3BQOA 3Q47B 2XPYA 4HNAD 2IY0C 1BLXB 1L5JA 4CCAA 5DIZA 1DVPA 4FULA 4GTTA 4F7AA 2KZTB 4AVXA 1N4RA 1S0PA 2RKKA 2A5EA 3CGHA 3LY9A 2LNIA 3FH5A 4M3OA 2FF4A 1KPSB 2CFUA 2VGEA 5J08A 4LRZA 2H6GA 4E85A 1FVHA 2BF0X 1EDUA 3L6AA 2YNQA 2V8SE 5H7PA 3U9WA 4CGVA 2CHZA 4CDNA 3JUEA 4HRMB 4I17A 3AAAC 2I1KA 4FLBA 2M63A 3JXJA 1HZ4A 4UWLA 4YVOA 4XE0A 4EZJA 4GTOA 3CVYA 2B0OE 5KBAA 2WMOA 3B7RL 2WXPA 4XKBA 1KT0A 4KBQA 5G04J 2GRRB 3ZEFA 4K5BA 4F3VA 3U66A 4N5QA 5HRYA 3B7UX 4U96D 2IQCA 2P9SG 2NYJA 5FTPA 4JA9A 4AEZC 2PM6A 2I2OA 3FU3A 3NB2A 2BKGA 3LXUX 3QAQA 3UT4A 3FTYA 3QK0A 4MS6A 3U4TA 1TJFA 2Y4UA 1SA5A 5G55A 4H7YA 2Y4TA 3TXMA 1WDYA 4MRUA 2WXNA 4G8LA 4KXKB 1IHGA 2J49A 4ANUA 5BW8C 5ENNA 4ATGA 1TNZA 3TWUA 3DSTA 4N2SA 2YHCA 3MCXA 2I1JA 3IHYA 4N2QA 3ASHA 2AW6A 3JUIA 1HE8A 3Q4AB 4YDWA 3MZLB 4ILHB 4ANXA 3CVQA 3FP3A 1HO8A 3Q7FA 4GZ5A 3G2TA 1NL4A 5E76A 1PAQA 4DK5A 2V0PA 4I9CA 5BT1A 3ZUVB 1BU9A 2OEVA 2VGXA 3UM3A 4PS7A 3SFYA 2F37A 1OWNA 5HQ8A 2VTBB 3AG3E 2P9IG 3ESLA 1IYGA 2C0MA 5LP0A 1JCRA 2P58C 2XPIA 2V4HC 2V5FA 4G1TA 4D10C 1NP7A 1PY1A 3HRAA 4IRUA 1OXJA 3C3QA 4JB8P 3KAEA 5BNWA 3KS2A 4GMRA 3LPZA 5C1DA 5JHBA 3UM2A 1N52A 3ASGA 3J5PA 1U3DA 3HVEB 3FUMA 4CT4A 3CVVA 2XEHA 2WVIA 2OV8A 3EHMA 1TN6A 2L0IA 5KNHD 3U3WA 2LSVA 4I2ZA 3D9JA 4NIKA 3D3MA 4L2YA 2WQ7A 4XZ4A 1A5EA 4EPZA 4A1GA 2GROB 2OEWA 3ZIMA 1YMPA 1N4QA 1XNFA 4JD2G 3HYMB 4XKCA 1JCSA 4QFVA 5CCLA 2ZXWE 2ZGGA 4TXPA 4BTAA 4X8QA 2Y0BG 3ZPJA 4CDRA 4BT8A 4HQDA 3AJIA 3HXEA 1X81A 4AXHA 3S2AA 2AWIA 1H2UA 4WNFA 2EIJE 5CRVA 2OVBA 5D66A 3FUIA 5AQAA 2WPVA 1UJKA 2OVFA 2DIWA 1JPLA 1OWMA 3CK8A 1MX6A 1KT1A 4YDOA 4FHJA 3MYVA 3CVPA 1D9SA 4EZLA 4LEUA 1TJCA 4JA7A 3L22A 1D8DA 4G23A 4HBDA 3G2WA 3D9HA 1U3CA 3T9KA 3UT7A 1KLXA 3L16A 2LAHA 2PZIA 3ASDA 3ZXPA 4UQYA 4NURA 3W9GA 4GU5A 1MQSA 2CG3A 2PL2A 2E2EA 4HOTA 2F0YA 3DEOA 3DXMG 3ZHEA 4GA0A 3RO2A 5FT9A 1OWLA 1ELKA 2ZU6B 3FUFA 3TGOA 2XZTG 3GW4A 4K5AB 4NRHB 2QYJA 2F8YA 2XS8A 3CVNA 3QJZA 2R17C 3EHNA 4DI3A 4HRLA 3V2XA 5FJYA 4UI9K 1AWCB 4U8VD 5ARGA 2PQRA 2HYZA 1Z6TA 2ILRA 4GTVA 2EIME 1WG0A 1K1BA 4GMJA 4UI9C 1QNFA 4DUIA 1OCRE 3FH7A 3TWTA 1H6PA 4IN3B 4HVBA 4WAFA 2WXHA 3Q5MA 3UINC 4Y6WA 4I6GA 4L7TA 2XS1A 3E34A 1YYHA 3CVLA 3QNKA 1AP7A 2J08A 1OCZE 2DZOA 1S64A 3DBSA 4PS3A 2WXFA 3CQGB 4KMOA 3TXNA 2GRLA 2IFUA 4GTPA 2P9UG 2XPZA 3TWWA 4KYOB 3BUAA 3PZ1A 3HXCA 4LSZE 4HRNA 4G2VA 4UUCA 3CK7A 1JCQA 3LY8A 4U0UA 2R5SA 3S7JA 1BPOA 4PH4B 4G26A 3NQPA 3ZN3A 3RRMB 4MLPA 2X3MA 3RRNB 3UXGA 3PEVB 3LDZA 4GTMA 1K1AA 2WXMA 3KD7A 4G11A 1W3BA 2QC9A 1N9AA 3E4BA 3LVQE 1K8KG 2Q7FA 4OAUC 3D9KA 2YINA 4I1AA 1MHQA 2P2CP 2XRYA 5FZRA 5EIBE 1A17A 2WXQA 4LNGA 3JXIA 2VSYA 3FU6A 4HORA 3EHQA 3OAWA 4HOUA 1SZAA 2QFCA 4U8YD 3Q49B 4FJZA 4C0MA 1DCEA 2KBXA 1QBQA 4OVVA 3AS4A 3C3OA 5B1AE 4Q96A 1G3NB 3CSFA 3BU8A 2Y1LE 3ZW3A 1K3ZD 1OWPA 2MOWA 2FULA 4BT9A 3Q79A 2XCBA 4UWHA 4N3BA 2X6IA 3O4ZA 2XENA 3FUEA 5KCMA 1TN7A 3PUKA 2J4BA 4U07A 4JHJA 4C9BB 2JLBA 4I1MA 3DSXA 1D8EA 4BTBA 2IU1A 3CLJA 1NA0A 3N71A 3S7DA 1N54A 1JWGA 3LS8A 4RSYA 5CMWA 5J90A 1IQUA 4LNUD 1IHBA 4APFA 3APDA 3ISMC 3FH8A 1GW6A 3RKVA 1HFAA 1UG3A 3UM0A 3L82A 1UOHA 2YHEA 3ZNGA 3EU9A 2DZNA 2IO3C 3AG2E 4K5CA 2I9CA 1V54E 3NF1A 2CG2A 2EILE 3RSEG 1QZ2A 3CQCB 1N4PA 2QZAA 3QB2A 3NBNB 1XGWA 3K9IA 5BV0A 2NC9A 4J0UA 3MEKA 3FUJA 4AP2A 2V4LA 3Q73A 4IULA 2XHEA 3OXFA 3VTYA 3E37A 3PH0C 4GCNA 3UUXA 2J09A 3TWSA 3UIOC 4LERA 1H2TC 4PS8A 3FTSA 3ZYMA 4B8CB 3OXLA 3CSTA 4HOSA 2ETCA 1WY6A 3TWQA 3ULEG 2HO1A 3I4GA 3MKQA 2WXKA 4FC8A 3C5RA 3Q9UC 5AJDA 2WQ6A 3KSLA 4N5CA 3CR3A 3FUKA 4ATZD 1Z3XA 2EINE 3CHQA 3S7FA 2L9BA 2IO2C 4DX7D 4JEUA 3U64A 1X5BA 2VGXB 2MHKA 2H6IA 3NZUA 2X6HA 1OCCE 4L9PA 4KVOA 2BEDA 3R9AB 4BSXA 4F6RD 4JEHA 5IY5E 3DSUA 4XIFA 3QWWA 3EDTB 4GPMA 3W9FA 3UPVA 2HM8A 2X6KA 5LOZA 2BKKB 2LAIA 2P9NG 2UWJG 3HG0D 1BI7B 4OAVB 2X6FA 3PRZA 3PEUB 3QWVA 5AENA 4TXQA 3SFZA 2DBAA 1RW2A 2R59A 3RK6A 3ZYKA 2R05A 4JC8A 3Q75A 3JQ1A 4AIFA 3E30A 3B7SA 1DCQA 2CFZA 4CZ2D 2MYOA 4GZDA 3T5XA 3V79K 4ANWA 3T8MA 4B89A 5FIOA 4UQZA 4XEIG 3CVUA 3JYSA 3L17A 4QQIA 5D0OD 3ONLA 3B13A 3D9LA 1SZ9A 4FHKA 2UY1A 2CHWA 3GYZA 4N3AA 1S70B 1TNUA 3LCAA 1ELWA 4Y6CA 3CIAA 4B0ZA 3J5QB 3UM1A 1LD8A 4EQFA 1N0RA 1O5MA 4DX6D 2KM4A 3IHVA 3UX4A 1JWFA 4HLEA 2Y69E 3ZRHA 3D9PA 4HXIA 2EIKE 1Y8MA 3L54A 4NACA 4Q94A 3D9OA 4TUMA 2L0TB 2WQHA 1ELRA 2KCKA 3Q78A 2CHXA 5T8IA 4U95D 2XZDG 2X38A 3SBSA 4C0EA 3FEXA 3CKCA 1HXIA 1E8YA 2KC7A 4UI9J 1FVFA 1OWOA 4I2WA 3APCA 3HIZA 4N39A 4RVBA 4U7EB 5G05J 4GYWA 2MRIA 4CEMA 3SNXA 1ZU2A 4U0SA 1HH8A 5KWDA 4ILGA 4ILIA 3RRUA 5AQBA 3IV0A 4LCTA 3LJ3A 5D0QD 4Q69A 3ZVVA 3ZHEB 2ONDA 3E32A 5JHAA 5EYPF 1H0AA 4A3VA 3AU4A 4YDEA 3HXBA 2VYIA 3BG0B 3EU5A 4ACLA 4BX8A 3ONKA 5A23A 3ZYQA 3GZ1A 1E8ZA 3ML9A 5C2YA 4ABNA 2E0IA 4UQXA 3TAXA 4XI9A 4BSZB 3FULA 1OY3D 4OYSA 4CYMD 4BY6A 4WWNA 5ARFA 3RJVA 4V3IA 3L08A 2KCLA 4MKTA 4B93B 4KVMA 1UN9A 1UW4B 2PM7A 3FU5A 3FUDA 2BTDA 3SY2A 2NXPA 1E8WA 2WM9A 3UKUG 3PZ2A 5ANRA 2L6JA 4GTQA 4KZ0A 3MKRA 1FPPA 1NA3A 3CK9A 3HHMA 4TXRA 5FQ8A 3FU0A 3G2SA 4JPSA 2J8SD 2JABA 2GGFA 3PZDA 4HI9A 4WWOA 3BG1B 2DCPA 4A1SA 4BETA 1MYOA 5LFAA 3IXEA 1HU3A 1MX2A 4N3CA 4CRWA 3UI2A 5FINA 4CGWA 3B7BA 2AVPA 2WXGA 1NI1A 3NOGD 4EECA 3EIQC 4GAAA 2R03A 1U2VG 4JW1A 3T5VA 4JVSA 2H6FA 3VLDA 1TNBA 2GRQB 3DEPA 5KNGA 5ENTD 4A63B 4L1BA 1FCHA 5EDSA 2IOSA 3EIJA 3FTUA 5AQ7A 1OT8A 4O60A 3ASOE 3VLFA 5JMND 1N94A 4GA2A 3QWPA 2XEVA 2ZIRA 3E33A 1EYHA 1UN8A 1YA0A 5FQ4A 1INZA 2LXMA 4J8FA 1TNYA 4F1SA 1E7VA 3ZXSA 1EPUA 3BEEA 4URKA 5EX0A 4BERA 4WNGA 2GRPB 4HFGA 4J7WA 3FUNA 5JJ6A 2XEEA 1HG2A 3IBEA 4LG6A 4FA6A 4RQIA 3HXDA 1P5QA 3PREA 1HF8A
chains in the Genus database with same CATH topology
3G2UA 2XHEA 3FEYA 1PY1A 3OXFA 2RD0A 4IRUA 3SI5A 3VTYA 1Z3YA 3SBTB 5FWQA 4GCOA 3FUHA 2LSUA 3FTXA 3KAEA 3PH0C 4GCNA 3UUXA 2J09A 5BNWA 3B7TA 4LERA 3KS2A 3PNLB 1H2TC 4RG6A 3CKBA 3LPZA 3RIBA 3TJPA 4EBAG 3OXGA 4PS8A 5C1DA 1N52A 5JHBA 3ASGA 3FTSA 2KATA 1U3DA 3ZYMA 5EKQD 5AIJA 2AXUA 3HVEB 3FUMA 4B8CB 3OXLA 4CT4A 3CVVA 2WVIA 2OV8A 1HG5A 3CSTA 3EHMA 2L0IA 3MGBA 3FTWA 1DNPA 5G2NA 4DLQA 4HOSA 4UWGA 4GPKA 3U3WA 1WY6A 2LSVA 4I2ZA 2HO1A 3D9JA 3I4GA 3D3MA 4L2YA 2WQ7A 4XZ4A 3MKQA 3LEWA 2WMNA 5LX8A 2WXKA 5FZQA 4EPZA 4FC8A 5BV1A 4A1GA 4I43A 3ZIMA 3MJWA 4AV7A 1XNFA 3JQ0A 4ACKA 5AJDA 3CVWA 3HYMB 2IONA 3I4RB 4XKCA 4QFVA 3QDNA 2WQ6A 4N5CA 5CCLA 1QQEA 3CR3A 1VDYA 3FUKA 4IYPA 4AOFA 4B8AA 3SF4A 1Z3XA 4FU3A 3CHQA 3S7FA 5M72A 2L9BA 2XRZA 3MX3A 5G05C 4BTAA 5CCMA 3C98A 4JEUA 3U64A 1E8XA 3CHMA 4DI4A 1X5BA 2GW1A 3VLEA 3ZPJA 2VGXB 2MHKA 4ME2A 3SD5A 3O48A 4CDRA 5BPPA 3CEQA 4BT8A 3NZUA 4WNEA 1PC2A 2PQNA 2X6HA 3UQ3A 2I6HA 2YQ8A 4I1OB 4KVOA 3R9AB 3S2AA 4AXHA 4BSXA 3D9IA 2AWIA 2JEKA 1H2UA 4JEHA 5T4YA 4A55A 3CVXA 5T3RA 4WNFA 4I6JA 4XIFA 3QWWA 3QC1A 3EDTB 2OVBA 3FUIA 2WPVA 1UJKA 2OVFA 2HM8A 1JUQA 2X6KA 3UPVA 4I6EA 1HS6A 2DIWA 3CHOA 5LOZA 1JPLA 4DLOA 4P29A 4TUUA 2LAIA 2UWJG 5CMYA 1OWMA 2X6FA 3CHPA 3PRZA 4BX9A 3CK8A 3PEUB 1KT1A 4G24A 3QWVA 2XQ0A 5AENA 2XGOA 4FHJA 3MYVA 2FI7A 2BUGA 3CVPA 4B94A 3SFZA 2DBAA 2R59A 2WXRA 4EZLA 4LEUA 2LO6A 4I9EA 3RK6A 3ZYKA 1TJCA 4JC8A 4JA7A 2A5UA 3JQ1A 3PVLA 4J8SA 2J4DA 4AIFA 3L22A 4JHKA 2FO7A 4J8DA 5BUZA 4G23A 3URZA 3G2WA 2WXJA 3B7SA 1U3CA 4J8EA 4JXTA 4OVUA 3FTZA 4R7LA 2J07A 2C0LA 2FEZA 3UT7A 4CDMA 1KLXA 3L16A 2LAHA 2CFZA 4LUNU 2EQXA 5AJLA 2IOLA 4K03A 4BWRA 2FBNA 4CT0A 4PDXA 3MKQB 4GZDA 2PZIA 3RO3A 3ASDA 4UQYA 3T5XA 4NURA 4ANWA 3T8MA 4B89A 3L13A 3FY4A 1MQSA 4GU5A 4AJWA 2VGYA 4UQZA 2CG3A 4NQ0A 3CVUA 2A4ZA 3MA5A 2PL2A 3JYSA 3L17A 5D0OD 4U04A 2E2EA 3ONLA 2QY7A 4GZCA 4HOTA 3B13A 3D9LA 3ZHEA 1SZ9A 3GZSA 3ZYLA 4GA0A 4FHKA 3RO2A 3ZGQA 5FT9A 3MV2B 1OWLA 1ELKA 2ZU6B 2UY1A 3FUFA 2CHWA 3TGOA 4W9RA 3GYZA 5KJMA 4N3AA 3IEGA 3IKOB 3GW4A 1H6KA 3LCAA 1ELWA 3LYAA 4Y6CA 5DBKA 4AY5A 4NRHB 3R7RA 3CIAA 4APOA 4B0ZA 2X6JA 4FP7A 2KZTA 4EQFA 4DPRA 4GYYA 2KM4A 3JCKC 3IHVA 4GYOA 3UX4A 1JWFA 4HLEA 3CVNA 2VSNA 3QJZA 2R17C 2C2LA 2KCVA 3GZ2A 2VSOE 3PE3A 4K0RA 3D9PA 3EHNA 4HXIA 3HDXA 3ZRHA 4DI3A 3ASFA 1Y8MA 3L54A 5FJYA 3PDNA 4UI9K 4A3TA 5A7DB 4NACA 4Q94A 3D9OA 3SHFA 3QKYA 4WNDA 2L0TB 2WQHA 1ELRA 1WAO1 3NZSA 2KCKA 2CHXA 5ARGA 2PQRA 5JJ7A 3CHRA 5AYWD 5LCWC 2HYZA 1Z6TA 5T8IA 2ILRA 2NSZA 3ML8A 4GMJA 4UI9C 1QNFA 5LCWJ 2X38A 3DPDA 3SBSA 4C0EA 5E75A 3FEXA 3CKCA 1HXIA 4BFRA 1E8YA 3FH7A 3WXXA 2KC7A 4UI9J 4L23A 4J6IA 3UMVA 1FVFA 4U0ZA 1OWOA 4I2WA 4JL0A 3APCA 3PS6A 4IN3B 3HIZA 4HVBA 4WAFA 2J9QA 1Y6IA 2OOEA 2WXHA 3Q5MA 4N39A 3ZFWA 5A6CA 4RVBA 4I6GA 4Y6WA 4GYWA 4L7TA 5G05J 4ANVA 4FJYA 3FTVA 4WUYA 3CVLA 1OUVA 4AY6A 2MRIA 4IULA 4CEMA 3SNXA 1ZU2A 4U0SA 1HH8A 3QNKA 4ILGA 2J08A 4ILIA 3D9MA 3ESKA 3RRUA 4XI0A 4FADA 3IV0A 2XGSA 3DBSA 4LCTA 4PS3A 2WXFA 3EJNA 1EF1C 2Y3AA 3LJ3A 3AS5A 1UJJA 3CQGB 4KMOA 1B89A 1H2VC 5D0QD 5FQ6A 4Q69A 3TXNA 3ZVVA 3ZHEB 2GRLA 2IFUA 1E90A 3SZ7A 5HI7A 3APFA 2UY1B 2XPZA 1ZBPA 4KYOB 2ONDA 4TRQA 3Q47B 2XPYA 5JHAA 1H0AA 1L5JA 4A3VA 4CCAA 5DIZA 2XCCA 3AU4A 4G2VA 3TG4A 4U8HA 1DVPA 4FULA 4F7AA 2KZTB 4KT6B 4AVXA 3CHSA 4GA1A 3TG5A 4EZKA 2VYIA 1E7UA 3CK7A 3BG0B 4UWKA 4ACLA 3G2VA 4BX8A 3LY8A 3QOUA 3ONKA 4U0UA 1S0PA 5A23A 2VJ8A 2RG8A 3ZYQA 3GZ1A 1E8ZA 3CGHA 2XGMA 2R5SA 3ML9A 3LY9A 2LNIA 3FH5A 5C2YA 3S7JA 4ABNA 2E0IA 3AS8A 1BPOA 4RG9A 3P2BA 4UQXA 2HR2A 3TAXA 2AXVA 4L2LA 4XI9A 3LKUA 4M3OA 4G26A 4PH4B 2FF4A 3FFLA 3FULA 3NQPA 3ZN3A 3RRMB 2CFUA 4MLPA 4OYSA 4U63A 5J08A 2X3MA 4LRZA 3RRNB 4XX5A 3KEZA 3SGHA 4BY6A 5KJKA 4WWNA 4E85A 3PEVB 5ARFA 3RJVA 3LDZA 4GB9A 4V3IA 1FVHA 3TL5A 3L08A 2WXMA 2KCLA 1SQMA 2BF0X 4MKTA 3KD7A 4KVMA 4G11A 1EDUA 2IJGX 3L6AA 2IF4A 2V8SE 2YNQA 1W3BA 3U9WA 1UN9A 4CGVA 3PNTB 2GRMA 3E4BA 1UW4B 2PM7A 3FU5A 2CHZA 3FUDA 3LVQE 4AM9A 2VSXE 4CDNA 4O6FA 4FLHA 2Q7FA 4I17A 2BTDA 3I3NA 3D9KA 2YINA 2I1KA 2NXPA 4FLBA 2M63A 3ULQA 1E8WA 4KZCA 3UT8A 1TEZA 1HZ4A 4UWLA 2WM9A 4YVOA 4E6HA 4I1AA 5ANRA 2L6JA 1MHQA 4XE0A 4KZ0A 2XRYA 3MKRA 5FZRA 4F53A 4EZJA 3CVYA 1A17A 1NA3A 2WXLA 3CK9A 2WXQA 3VTXA 2VSYA 5KJNA 3HHMA 3FU6A 5G04C 5FQ8A 3FU0A 3G2SA 4JPSA 3LY7A 3AU5A 2WMOA 3B7RL 4HORA 2WXPA 4XKBA 1KT0A 4KBQA 2GGFA 5G04J 3PZDA 3S7BA 3OAWA 3ZEFA 4HOUA 1SZAA 4F3VA 2QFCA 2AXZA 3Q49B 4FJZA 3U66A 1IQRA 3B7UX 4WWOA 2IQCA 3BG1B 2DCPA 4C0MA 5FTPA 4JA9A 4A1SA 4AEZC 3D9NA 2PM6A 2I2OA 3FU3A 5EX3A 4OVVA 3AS4A 3LXUX 3QAQA 5LFAA 1HU3A 3UT4A 4GZ3A 3FTYA 3QK0A 4N3CA 4Q96A 3CSFA 4MS6A 3RU0A 3U4TA 1TJFA 4CRWA 3FDHA 2Y4UA 2WXIA 4CGWA 3ZW3A 2VTBA 4H7XA 5G55A 4H7YA 2Y4TA 2AVPA 3FWVA 3TXMA 4MRUA 4JHRA 2WXNA 5FQ7A 4UWFA 1OWPA 2WXGA 4KXKB 4EECA 1IHGA 2MOWA 1HX8A 2FULA 2J49A 3EIQC 3P1UA 4HS2A 2XCBA 4PUCA 4UWHA 4YNDA 4BT9A 3FHEA 4GAAA 4EBAA 4N3BA 1LF8A 2X6IA 3O4ZA 4ANUA 3FUEA 3PUJA 3CV0A 5KCMA 5BW8C 5ENNA 2WXOA 4JW1A 3T5VA 4ATGA 3PUKA 4JVSA 2J4BA 4U07A 4JHJA 3VLDA 4C9BB 2YHCA 4N2SA 2JLBA 4I1MA 4BTBA 2IU1A 3CLJA 1NA0A 3N71A 4L1BA 2WB2A 1FCHA 3MCXA 3HVEA 3LVRE 2IOSA 1N54A 3S7DA 5EDSA 4HOQA 2I1JA 1JWGA 3LS8A 4TV3A 4RSYA 3EIJA 5CMWA 3FTUA 1WM5A 5J90A 1IQUA 5ANLA 3IHYA 3VLFA 4APFA 4N2QA 3APDA 3ASHA 2AW6A 3JUIA 4GA2A 3FH8A 4GMLA 1HE8A 1GW6A 3Q4AB 3RKVA 1H19A 3MZLB 4ILHB 4ANXA 3QWPA 2XEVA 3CVQA 1HFAA 1HO8A 1UG3A 3FP3A 5KJLA 4JZYA 1EYHA 1UN8A 1YA0A 4GZ5A 3G2TA 5FQ4A 1E96B 1INZA 5FZSA 2YHEA 1PAQA 5E76A 3OTNA 4J8FA 4F1SA 1E7VA 3PE4A 4DK5A 2VQ2A 3Q15A 3ZXSA 2V0PA 2I9CA 4WWPA 1EPUA 4I9CA 5BT1A 3BEEA 4URKA 2VGXA 3NF1A 2CG2A 5EX0A 1QZ2A 5CHEE 4PS7A 3CQCB 4WNGA 3QB2A 4YVQC 5JJTA 4HFGA 4DJAA 3ENEA 1XGWA 3FUNA 3K9IA 5JJ6A 1OWNA 5BV0A 3QARA 1HG2A 2NC9A 5HQ8A 3IBEA 3R7QA 2VTBB 3ESLA 4G25A 4J0UA 3I5PA 3MEKA 1IYGA 1NZNA 3FUJA 4GZ6A 2C0MA 4AP2A 5LP0A 2P58C 2XPIA 4FA6A 2V5FA 1P5QA 3PREA 2V4LA 4G1TA 1HF8A 3MV3B 4D10C 1NP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8S A; 
#chains in the Genus database with same CATH topology
 1N0Q A;  3FEY A;  2RD0 A;  3V2O A;  1Z3Y A;  3SBT B;  3PZ4 A;  4GCO A;  5CBO A;  5B3S E;  1BD8 A;  3B7T A;  3TJP A;  4RG6 A;  1SW6 A;  3RIB A;  3OXG A;  5EKQ D;  2AXU A;  1ZB1 A;  5CRU A;  1HG5 A;  1DNP A;  4DLQ A;  1S63 A;  3LEW A;  5CEA A;  5LX8 A;  5FZQ A;  1KZP A;  1MZC A;  2KXP C;  2QYU A;  2ION A;  5ENO D;  1VDY A;  1YCS B;  4IYP A;  4B8A A;  5CBN A;  3DSV A;  4FU3 A;  5M72 A;  2XRZ A;  5CCM A;  1LD7 A;  1E8X A;  3CHM A;  4DI4 A;  2GW1 A;  3VLE A;  2GRN B;  3O48 A;  5BPP A;  3CEQ A;  2PQN A;  3UQ3 A;  3D9I A;  3CVX A;  5T3R A;  4I6J A;  1OCO E;  1HS6 A;  4DLO A;  1FT2 A;  5CMY A;  3X2Q E;  3CHP A;  5AN8 A;  4G24 A;  2XQ0 A;  3NAW A;  4B94 A;  2BUG A;  3SO8 A;  1RZ4 A;  2A5U A;  3PVL A;  3TWR A;  2J4D A;  2PNN A;  1O1S A;  2FO7 A;  4J8D A;  5BUZ A;  3URZ A;  3EHR A;  4J8E A;  4JXT A;  4OVU A;  4R7L A;  3FTZ A;  2C0L A;  2FEZ A;  4CDM A;  2EQX A;  4BWR A;  4CT0 A;  5BXU A;  3MKQ B;  1FT1 A;  3L13 A;  3FY4 A;  1TN8 A;  4NQ0 A;  2A4Z A;  5EID A;  4U04 A;  3C3R A;  2OCC E;  2HE0 A;  3Q9N C;  3ULY A;  3GZS A;  3ZYL A;  3ZGQ A;  3MV2 B;  3L9T A;  4J8Y A;  3UTM A;  1NFI E;  3IEG A;  3LYA A;  1H6K A;  4AY5 A;  4RLY A;  4APO A;  2X6J A;  4FP7 A;  2KZT A;  5EN5 D;  4GYY A;  3JCK C;  4GYO A;  2ZGD A;  3GZ2 A;  2KCV A;  2R02 A;  3PE3 A;  3R9M A;  3PDN A;  4A3T A;  5A7D B;  3QKY A;  4WND A;  3NZS A;  5ITZ F;  5JJ7 A;  5LCW C;  5AYW D;  3DSS A;  3ABM E;  2NSZ A;  3DPD A;  3ZKJ A;  3WXX A;  4L23 A;  4J6I A;  3UMV A;  4U0Z A;  2J9Q A;  2OOE A;  3ZFW A;  5A6C A;  4ANV A;  3DPY A;  4FJY A;  3FTV A;  5HS0 A;  3HXF A;  1OUV A;  3TWV A;  3D9M A;  4FAD A;  3UIP C;  3EJN A;  1EF1 C;  1UJJ A;  1B89 A;  4G8K A;  2UY1 B;  1ZBP A;  4TRQ A;  2XCC A;  3TG4 A;  3RAU A;  4U8H A;  3PZ3 A;  5CER B;  4KT6 B;  3CHS A;  4GA1 A;  2P9K G;  3TG5 A;  4EZK A;  1E7U A;  3Q7A A;  4UWK A;  3G2V A;  2RFM A;  3QOU A;  2VJ8 A;  2RG8 A;  1IXV A;  2XGM A;  3AS8 A;  4RG9 A;  2P9P G;  3P2B A;  2HR2 A;  2AXV A;  4L2L A;  3LKU A;  3FFL A;  1LTX A;  4U63 A;  4XX5 A;  3KEZ A;  3SGH A;  5KJK A;  3ABK E;  5CED B;  4GB9 A;  3KSQ A;  3TL5 A;  1SQM A;  2ETB A;  2IJG X;  2IF4 A;  1O1T A;  5BXO A;  2LUH A;  3PNT B;  4BES A;  2GRM A;  4AM9 A;  2VSX E;  4O6F A;  4FLH A;  3I3N A;  5EYL A;  3C72 A;  4DRX E;  3ULQ A;  3UT8 A;  4KZC A;  1TEZ A;  4E6H A;  5AAO A;  3NOC D;  1H6O A;  3SFX A;  1SVX A;  4DX5 D;  4F53 A;  1N11 A;  2WXL A;  3VTX A;  5KJN A;  1BI8 B;  5G04 C;  3LY7 A;  3AU5 A;  3S7B A;  3SQV A;  2AXZ A;  1IQR A;  3LJN A;  1Z5S C;  3D9N A;  3ABL E;  5EX3 A;  4GZ3 A;  1O1R A;  3RU0 A;  3FDH A;  5JA4 D;  2WXI A;  2VTB A;  4H7X A;  3FWV A;  4MBG A;  4JHR A;  5FQ7 A;  4UWF A;  3P1U A;  1HX8 A;  4HS2 A;  4PUC A;  4YND A;  3FHE A;  4EBA A;  5ENS D;  1LF8 A;  3PUJ A;  3CV0 A;  3EUV A;  2H6H A;  2WXO A;  2ETA A;  2WB2 A;  3HVE A;  3LVR E;  4HOQ A;  4TV3 A;  3UKR G;  2DWZ A;  1WM5 A;  1SA4 A;  5ANL A;  4GML A;  1H19 A;  4BEP A;  4EHM A;  5EIL A;  5KJL A;  4JZY A;  1KZO A;  1E96 B;  5FZS A;  3OTN A;  3PE4 A;  2B6C A;  2VQ2 A;  3Q15 A;  4WWP A;  2DVW A;  5CHE E;  4YVQ C;  1TYQ G;  5JJT A;  4DJA A;  3ENE A;  3QAR A;  3R7Q A;  4G25 A;  3T8K A;  3I5P A;  3F6Q A;  1NZN A;  4GZ6 A;  3AG4 E;  3MV3 B;  5D2M C;  3ZU7 B;  3G2U A;  4ZFH A;  3DRA A;  3SI5 A;  5FWQ A;  3FUH A;  2LSU A;  4GTR A;  3FTX A;  3V31 A;  4EBA G;  3PNL B;  3CKB A;  2KAT A;  5AIJ A;  4DX1 A;  3DWL G;  3MGB A;  3FTW A;  5G2N A;  4UWG A;  4GPK A;  1V55 E;  2WMN A;  5BV1 A;  4HI8 A;  4I43 A;  3MJW A;  4HB5 A;  4AV7 A;  3JQ0 A;  4ACK A;  3CVW A;  2IEJ A;  3I4R B;  5HKP A;  3QDN A;  1QQE A;  4AOF A;  3SF4 A;  3MX3 A;  4F1P A;  5G05 C;  3C98 A;  4YDY A;  4ME2 A;  3SD5 A;  4WNE A;  1PC2 A;  3B95 A;  2I6H A;  2YQ8 A;  4I1O B;  2JEK A;  5T4Y A;  4A55 A;  3QC1 A;  1JUQ A;  4DX2 A;  4I6E A;  2ZIS A;  3CHO A;  1IKN D;  4P29 A;  1DC2 A;  4TUU A;  3AG1 E;  4C48 B;  4BX9 A;  2L6B A;  5ENQ D;  5AAR A;  4Z68 A;  3V30 A;  2P9L G;  2XGO A;  2FI7 A;  1N95 A;  2WXR A;  2LO6 A;  4I9E A;  1TR4 A;  4J8S A;  2LXL A;  5AQ9 A;  2F8X K;  4JHK A;  3ASN E;  2WXJ A;  2J07 A;  2FO1 E;  4LUN U;  5AJL A;  2AJA A;  2IOL A;  4K03 A;  2FBN A;  4PDX A;  2DYS E;  4ZHB A;  3RO3 A;  3WG7 E;  2V5Q C;  3TWX A;  4AJW A;  2VGY A;  3MA5 A;  2R2L A;  2QY7 A;  3KEA A;  4GZC A;  5CEC B;  4W9R A;  5KJM A;  3IKO B;  5DBK A;  3R7R A;  4DPR A;  1MX4 A;  2RFA A;  1QYM A;  2VSN A;  2C2L A;  2VSO E;  4K0R A;  3HDX A;  3ASF A;  2DYR E;  5B1B E;  3SHF A;  1WAO 1;  3CHR A;  5ENR D;  3ML8 A;  4O1P A;  5LCW J;  5E75 A;  4BFR A;  4HLL A;  4JL0 A;  3PS6 A;  1TNO A;  1Y6I A;  4GTS A;  5ENP D;  4WUY A;  3DSW A;  4AY6 A;  4O1O A;  1MJ0 A;  3ESK A;  4XI0 A;  4M7C A;  2XGS A;  2Y3A A;  1N4S A;  3AS5 A;  1Q2Z A;  1H2V C;  5FQ6 A;  1E90 A;  3SZ7 A;  5HI7 A;  3APF A;  4LNB A;  3DXK G;  3BQO A;  3Q47 B;  2XPY A;  4HNA D;  2IY0 C;  1BLX B;  1L5J A;  4CCA A;  5DIZ A;  1DVP A;  4FUL A;  4GTT A;  4F7A A;  2KZT B;  4AVX A;  1N4R A;  1S0P A;  2RKK A;  2A5E A;  3CGH A;  3LY9 A;  2LNI A;  3FH5 A;  4M3O A;  2FF4 A;  1KPS B;  2CFU A;  2VGE A;  5J08 A;  4LRZ A;  2H6G A;  4E85 A;  1FVH A;  2BF0 X;  1EDU A;  3L6A A;  2YNQ A;  2V8S E;  5H7P A;  3U9W A;  4CGV A;  2CHZ A;  4CDN A;  3JUE A;  4HRM B;  4I17 A;  3AAA C;  2I1K A;  4FLB A;  2M63 A;  3JXJ A;  1HZ4 A;  4UWL A;  4YVO A;  4XE0 A;  4EZJ A;  4GTO A;  3CVY A;  2B0O E;  5KBA A;  2WMO A;  3B7R L;  2WXP A;  4XKB A;  1KT0 A;  4KBQ A;  5G04 J;  2GRR B;  3ZEF A;  4K5B A;  4F3V A;  3U66 A;  4N5Q A;  5HRY A;  3B7U X;  4U96 D;  2IQC A;  2P9S G;  2NYJ A;  5FTP A;  4JA9 A;  4AEZ C;  2PM6 A;  2I2O A;  3FU3 A;  3NB2 A;  2BKG A;  3LXU X;  3QAQ A;  3UT4 A;  3FTY A;  3QK0 A;  4MS6 A;  3U4T A;  1TJF A;  2Y4U A;  1SA5 A;  5G55 A;  4H7Y A;  2Y4T A;  3TXM A;  1WDY A;  4MRU A;  2WXN A;  4G8L A;  4KXK B;  1IHG A;  2J49 A;  4ANU A;  5BW8 C;  5ENN A;  4ATG A;  1TNZ A;  3TWU A;  3DST A;  4N2S A;  2YHC A;  3MCX A;  2I1J A;  3IHY A;  4N2Q A;  3ASH A;  2AW6 A;  3JUI A;  1HE8 A;  3Q4A B;  4YDW A;  3MZL B;  4ILH B;  4ANX A;  3CVQ A;  3FP3 A;  1HO8 A;  3Q7F A;  4GZ5 A;  3G2T A;  1NL4 A;  5E76 A;  1PAQ A;  4DK5 A;  2V0P A;  4I9C A;  5BT1 A;  3ZUV B;  1BU9 A;  2OEV A;  2VGX A;  3UM3 A;  4PS7 A;  3SFY A;  2F37 A;  1OWN A;  5HQ8 A;  2VTB B;  3AG3 E;  2P9I G;  3ESL A;  1IYG A;  2C0M A;  5LP0 A;  1JCR A;  2P58 C;  2XPI A;  2V4H C;  2V5F A;  4G1T A;  4D10 C;  1NP7 A;  1PY1 A;  3HRA A;  4IRU A;  1OXJ A;  3C3Q A;  4JB8 P;  3KAE A;  5BNW A;  3KS2 A;  4GMR A;  3LPZ A;  5C1D A;  5JHB A;  3UM2 A;  1N52 A;  3ASG A;  3J5P A;  1U3D A;  3HVE B;  3FUM A;  4CT4 A;  3CVV A;  2XEH A;  2WVI A;  2OV8 A;  3EHM A;  1TN6 A;  2L0I A;  5KNH D;  3U3W A;  2LSV A;  4I2Z A;  3D9J A;  4NIK A;  3D3M A;  4L2Y A;  2WQ7 A;  4XZ4 A;  1A5E A;  4EPZ A;  4A1G A;  2GRO B;  2OEW A;  3ZIM A;  1YMP A;  1N4Q A;  1XNF A;  4JD2 G;  3HYM B;  4XKC A;  1JCS A;  4QFV A;  5CCL A;  2ZXW E;  2ZGG A;  4TXP A;  4BTA A;  4X8Q A;  2Y0B G;  3ZPJ A;  4CDR A;  4BT8 A;  4HQD A;  3AJI A;  3HXE A;  1X81 A;  4AXH A;  3S2A A;  2AWI A;  1H2U A;  4WNF A;  2EIJ E;  5CRV A;  2OVB A;  5D66 A;  3FUI A;  5AQA A;  2WPV A;  1UJK A;  2OVF A;  2DIW A;  1JPL A;  1OWM A;  3CK8 A;  1MX6 A;  1KT1 A;  4YDO A;  4FHJ A;  3MYV A;  3CVP A;  1D9S A;  4EZL A;  4LEU A;  1TJC A;  4JA7 A;  3L22 A;  1D8D A;  4G23 A;  4HBD A;  3G2W A;  3D9H A;  1U3C A;  3T9K A;  3UT7 A;  1KLX A;  3L16 A;  2LAH A;  2PZI A;  3ASD A;  3ZXP A;  4UQY A;  4NUR A;  3W9G A;  4GU5 A;  1MQS A;  2CG3 A;  2PL2 A;  2E2E A;  4HOT A;  2F0Y A;  3DEO A;  3DXM G;  3ZHE A;  4GA0 A;  3RO2 A;  5FT9 A;  1OWL A;  1ELK A;  2ZU6 B;  3FUF A;  3TGO A;  2XZT G;  3GW4 A;  4K5A B;  4NRH B;  2QYJ A;  2F8Y A;  2XS8 A;  3CVN A;  3QJZ A;  2R17 C;  3EHN A;  4DI3 A;  4HRL A;  3V2X A;  5FJY A;  4UI9 K;  1AWC B;  4U8V D;  5ARG A;  2PQR A;  2HYZ A;  1Z6T A;  2ILR A;  4GTV A;  2EIM E;  1WG0 A;  1K1B A;  4GMJ A;  4UI9 C;  1QNF A;  4DUI A;  1OCR E;  3FH7 A;  3TWT A;  1H6P A;  4IN3 B;  4HVB A;  4WAF A;  2WXH A;  3Q5M A;  3UIN C;  4Y6W A;  4I6G A;  4L7T A;  2XS1 A;  3E34 A;  1YYH A;  3CVL A;  3QNK A;  1AP7 A;  2J08 A;  1OCZ E;  2DZO A;  1S64 A;  3DBS A;  4PS3 A;  2WXF A;  3CQG B;  4KMO A;  3TXN A;  2GRL A;  2IFU A;  4GTP A;  2P9U G;  2XPZ A;  3TWW A;  4KYO B;  3BUA A;  3PZ1 A;  3HXC A;  4LSZ E;  4HRN A;  4G2V A;  4UUC A;  3CK7 A;  1JCQ A;  3LY8 A;  4U0U A;  2R5S A;  3S7J A;  1BPO A;  4PH4 B;  4G26 A;  3NQP A;  3ZN3 A;  3RRM B;  4MLP A;  2X3M A;  3RRN B;  3UXG A;  3PEV B;  3LDZ A;  4GTM A;  1K1A A;  2WXM A;  3KD7 A;  4G11 A;  1W3B A;  2QC9 A;  1N9A A;  3E4B A;  3LVQ E;  1K8K G;  2Q7F A;  4OAU C;  3D9K A;  2YIN A;  4I1A A;  1MHQ A;  2P2C P;  2XRY A;  5FZR A;  5EIB E;  1A17 A;  2WXQ A;  4LNG A;  3JXI A;  2VSY A;  3FU6 A;  4HOR A;  3EHQ A;  3OAW A;  4HOU A;  1SZA A;  2QFC A;  4U8Y D;  3Q49 B;  4FJZ A;  4C0M A;  1DCE A;  2KBX A;  1QBQ A;  4OVV A;  3AS4 A;  3C3O A;  5B1A E;  4Q96 A;  1G3N B;  3CSF A;  3BU8 A;  2Y1L E;  3ZW3 A;  1K3Z D;  1OWP A;  2MOW A;  2FUL A;  4BT9 A;  3Q79 A;  2XCB A;  4UWH A;  4N3B A;  2X6I A;  3O4Z A;  2XEN A;  3FUE A;  5KCM A;  1TN7 A;  3PUK A;  2J4B A;  4U07 A;  4JHJ A;  4C9B B;  2JLB A;  4I1M A;  3DSX A;  1D8E A;  4BTB A;  2IU1 A;  3CLJ A;  1NA0 A;  3N71 A;  3S7D A;  1N54 A;  1JWG A;  3LS8 A;  4RSY A;  5CMW A;  5J90 A;  1IQU A;  4LNU D;  1IHB A;  4APF A;  3APD A;  3ISM C;  3FH8 A;  1GW6 A;  3RKV A;  1HFA A;  1UG3 A;  3UM0 A;  3L82 A;  1UOH A;  2YHE A;  3ZNG A;  3EU9 A;  2DZN A;  2IO3 C;  3AG2 E;  4K5C A;  2I9C A;  1V54 E;  3NF1 A;  2CG2 A;  2EIL E;  3RSE G;  1QZ2 A;  3CQC B;  1N4P A;  2QZA A;  3QB2 A;  3NBN B;  1XGW A;  3K9I A;  5BV0 A;  2NC9 A;  4J0U A;  3MEK A;  3FUJ A;  4AP2 A;  2V4L A;  3Q73 A;  4IUL A;  2XHE A;  3OXF A;  3VTY A;  3E37 A;  3PH0 C;  4GCN A;  3UUX A;  2J09 A;  3TWS A;  3UIO C;  4LER A;  1H2T C;  4PS8 A;  3FTS A;  3ZYM A;  4B8C B;  3OXL A;  3CST A;  4HOS A;  2ETC A;  1WY6 A;  3TWQ A;  3ULE G;  2HO1 A;  3I4G A;  3MKQ A;  2WXK A;  4FC8 A;  3C5R A;  3Q9U C;  5AJD A;  2WQ6 A;  3KSL A;  4N5C A;  3CR3 A;  3FUK A;  4ATZ D;  1Z3X A;  2EIN E;  3CHQ A;  3S7F A;  2L9B A;  2IO2 C;  4DX7 D;  4JEU A;  3U64 A;  1X5B A;  2VGX B;  2MHK A;  2H6I A;  3NZU A;  2X6H A;  1OCC E;  4L9P A;  4KVO A;  2BED A;  3R9A B;  4BSX A;  4F6R D;  4JEH A;  5IY5 E;  3DSU A;  4XIF A;  3QWW A;  3EDT B;  4GPM A;  3W9F A;  3UPV A;  2HM8 A;  2X6K A;  5LOZ A;  2BKK B;  2LAI A;  2P9N G;  2UWJ G;  3HG0 D;  1BI7 B;  4OAV B;  2X6F A;  3PRZ A;  3PEU B;  3QWV A;  5AEN A;  4TXQ A;  3SFZ A;  2DBA A;  1RW2 A;  2R59 A;  3RK6 A;  3ZYK A;  2R05 A;  4JC8 A;  3Q75 A;  3JQ1 A;  4AIF A;  3E30 A;  3B7S A;  1DCQ A;  2CFZ A;  4CZ2 D;  2MYO A;  4GZD A;  3T5X A;  3V79 K;  4ANW A;  3T8M A;  4B89 A;  5FIO A;  4UQZ A;  4XEI G;  3CVU A;  3JYS A;  3L17 A;  4QQI A;  5D0O D;  3ONL A;  3B13 A;  3D9L A;  1SZ9 A;  4FHK A;  2UY1 A;  2CHW A;  3GYZ A;  4N3A A;  1S70 B;  1TNU A;  3LCA A;  1ELW A;  4Y6C A;  3CIA A;  4B0Z A;  3J5Q B;  3UM1 A;  1LD8 A;  4EQF A;  1N0R A;  1O5M A;  4DX6 D;  2KM4 A;  3IHV A;  3UX4 A;  1JWF A;  4HLE A;  2Y69 E;  3ZRH A;  3D9P A;  4HXI A;  2EIK E;  1Y8M A;  3L54 A;  4NAC A;  4Q94 A;  3D9O A;  4TUM A;  2L0T B;  2WQH A;  1ELR A;  2KCK A;  3Q78 A;  2CHX A;  5T8I A;  4U95 D;  2XZD G;  2X38 A;  3SBS A;  4C0E A;  3FEX A;  3CKC A;  1HXI A;  1E8Y A;  2KC7 A;  4UI9 J;  1FVF A;  1OWO A;  4I2W A;  3APC A;  3HIZ A;  4N39 A;  4RVB A;  4U7E B;  5G05 J;  4GYW A;  2MRI A;  4CEM A;  3SNX A;  1ZU2 A;  4U0S A;  1HH8 A;  5KWD A;  4ILG A;  4ILI A;  3RRU A;  5AQB A;  3IV0 A;  4LCT A;  3LJ3 A;  5D0Q D;  4Q69 A;  3ZVV A;  3ZHE B;  2OND A;  3E32 A;  5JHA A;  5EYP F;  1H0A A;  4A3V A;  3AU4 A;  4YDE A;  3HXB A;  2VYI A;  3BG0 B;  3EU5 A;  4ACL A;  4BX8 A;  3ONK A;  5A23 A;  3ZYQ A;  3GZ1 A;  1E8Z A;  3ML9 A;  5C2Y A;  4ABN A;  2E0I A;  4UQX A;  3TAX A;  4XI9 A;  4BSZ B;  3FUL A;  1OY3 D;  4OYS A;  4CYM D;  4BY6 A;  4WWN A;  5ARF A;  3RJV A;  4V3I A;  3L08 A;  2KCL A;  4MKT A;  4B93 B;  4KVM A;  1UN9 A;  1UW4 B;  2PM7 A;  3FU5 A;  3FUD A;  2BTD A;  3SY2 A;  2NXP A;  1E8W A;  2WM9 A;  3UKU G;  3PZ2 A;  5ANR A;  2L6J A;  4GTQ A;  4KZ0 A;  3MKR A;  1FPP A;  1NA3 A;  3CK9 A;  3HHM A;  4TXR A;  5FQ8 A;  3FU0 A;  3G2S A;  4JPS A;  2J8S D;  2JAB A;  2GGF A;  3PZD A;  4HI9 A;  4WWO A;  3BG1 B;  2DCP A;  4A1S A;  4BET A;  1MYO A;  5LFA A;  3IXE A;  1HU3 A;  1MX2 A;  4N3C A;  4CRW A;  3UI2 A;  5FIN A;  4CGW A;  3B7B A;  2AVP A;  2WXG A;  1NI1 A;  3NOG D;  4EEC A;  3EIQ C;  4GAA A;  2R03 A;  1U2V G;  4JW1 A;  3T5V A;  4JVS A;  2H6F A;  3VLD A;  1TNB A;  2GRQ B;  3DEP A;  5KNG A;  5ENT D;  4A63 B;  4L1B A;  1FCH A;  5EDS A;  2IOS A;  3EIJ A;  3FTU A;  5AQ7 A;  1OT8 A;  4O60 A;  3ASO E;  3VLF A;  5JMN D;  1N94 A;  4GA2 A;  3QWP A;  2XEV A;  2ZIR A;  3E33 A;  1EYH A;  1UN8 A;  1YA0 A;  5FQ4 A;  1INZ A;  2LXM A;  4J8F A;  1TNY A;  4F1S A;  1E7V A;  3ZXS A;  1EPU A;  3BEE A;  4URK A;  5EX0 A;  4BER A;  4WNG A;  2GRP B;  4HFG A;  4J7W A;  3FUN A;  5JJ6 A;  2XEE A;  1HG2 A;  3IBE A;  4LG6 A;  4FA6 A;  4RQI A;  3HXD A;  1P5Q A;  3PRE A;  1HF8 A; 
#chains in the Genus database with same CATH homology
 3G2U A;  2XHE A;  3FEY A;  1PY1 A;  3OXF A;  2RD0 A;  4IRU A;  3SI5 A;  3VTY A;  1Z3Y A;  3SBT B;  5FWQ A;  4GCO A;  3FUH A;  2LSU A;  3FTX A;  3KAE A;  3PH0 C;  4GCN A;  3UUX A;  2J09 A;  5BNW A;  3B7T A;  4LER A;  3KS2 A;  3PNL B;  1H2T C;  4RG6 A;  3CKB A;  3LPZ A;  3RIB A;  3TJP A;  4EBA G;  3OXG A;  4PS8 A;  5C1D A;  1N52 A;  5JHB A;  3ASG A;  3FTS A;  2KAT A;  1U3D A;  3ZYM A;  5EKQ D;  5AIJ A;  2AXU A;  3HVE B;  3FUM A;  4B8C B;  3OXL A;  4CT4 A;  3CVV A;  2WVI A;  2OV8 A;  1HG5 A;  3CST A;  3EHM A;  2L0I A;  3MGB A;  3FTW A;  1DNP A;  5G2N A;  4DLQ A;  4HOS A;  4UWG A;  4GPK A;  3U3W A;  1WY6 A;  2LSV A;  4I2Z A;  2HO1 A;  3D9J A;  3I4G A;  3D3M A;  4L2Y A;  2WQ7 A;  4XZ4 A;  3MKQ A;  3LEW A;  2WMN A;  5LX8 A;  2WXK A;  5FZQ A;  4EPZ A;  4FC8 A;  5BV1 A;  4A1G A;  4I43 A;  3ZIM A;  3MJW A;  4AV7 A;  1XNF A;  3JQ0 A;  4ACK A;  5AJD A;  3CVW A;  3HYM B;  2ION A;  3I4R B;  4XKC A;  4QFV A;  3QDN A;  2WQ6 A;  4N5C A;  5CCL A;  1QQE A;  3CR3 A;  1VDY A;  3FUK A;  4IYP A;  4AOF A;  4B8A A;  3SF4 A;  1Z3X A;  4FU3 A;  3CHQ A;  3S7F A;  5M72 A;  2L9B A;  2XRZ A;  3MX3 A;  5G05 C;  4BTA A;  5CCM A;  3C98 A;  4JEU A;  3U64 A;  1E8X A;  3CHM A;  4DI4 A;  1X5B A;  2GW1 A;  3VLE A;  3ZPJ A;  2VGX B;  2MHK A;  4ME2 A;  3SD5 A;  3O48 A;  4CDR A;  5BPP A;  3CEQ A;  4BT8 A;  3NZU A;  4WNE A;  1PC2 A;  2PQN A;  2X6H A;  3UQ3 A;  2I6H A;  2YQ8 A;  4I1O B;  4KVO A;  3R9A B;  3S2A A;  4AXH A;  4BSX A;  3D9I A;  2AWI A;  2JEK A;  1H2U A;  4JEH A;  5T4Y A;  4A55 A;  3CVX A;  5T3R A;  4WNF A;  4I6J A;  4XIF A;  3QWW A;  3QC1 A;  3EDT B;  2OVB A;  3FUI A;  2WPV A;  1UJK A;  2OVF A;  2HM8 A;  1JUQ A;  2X6K A;  3UPV A;  4I6E A;  1HS6 A;  2DIW A;  3CHO A;  5LOZ A;  1JPL A;  4DLO A;  4P29 A;  4TUU A;  2LAI A;  2UWJ G;  5CMY A;  1OWM A;  2X6F A;  3CHP A;  3PRZ A;  4BX9 A;  3CK8 A;  3PEU B;  1KT1 A;  4G24 A;  3QWV A;  2XQ0 A;  5AEN A;  2XGO A;  4FHJ A;  3MYV A;  2FI7 A;  2BUG A;  3CVP A;  4B94 A;  3SFZ A;  2DBA A;  2R59 A;  2WXR A;  4EZL A;  4LEU A;  2LO6 A;  4I9E A;  3RK6 A;  3ZYK A;  1TJC A;  4JC8 A;  4JA7 A;  2A5U A;  3JQ1 A;  3PVL A;  4J8S A;  2J4D A;  4AIF A;  3L22 A;  4JHK A;  2FO7 A;  4J8D A;  5BUZ A;  4G23 A;  3URZ A;  3G2W A;  2WXJ A;  3B7S A;  1U3C A;  4J8E A;  4JXT A;  4OVU A;  3FTZ A;  4R7L A;  2J07 A;  2C0L A;  2FEZ A;  3UT7 A;  4CDM A;  1KLX A;  3L16 A;  2LAH A;  2CFZ A;  4LUN U;  2EQX A;  5AJL A;  2IOL A;  4K03 A;  4BWR A;  2FBN A;  4CT0 A;  4PDX A;  3MKQ B;  4GZD A;  2PZI A;  3RO3 A;  3ASD A;  4UQY A;  3T5X A;  4NUR A;  4ANW A;  3T8M A;  4B89 A;  3L13 A;  3FY4 A;  1MQS A;  4GU5 A;  4AJW A;  2VGY A;  4UQZ A;  2CG3 A;  4NQ0 A;  3CVU A;  2A4Z A;  3MA5 A;  2PL2 A;  3JYS A;  3L17 A;  5D0O D;  4U04 A;  2E2E A;  3ONL A;  2QY7 A;  4GZC A;  4HOT A;  3B13 A;  3D9L A;  3ZHE A;  1SZ9 A;  3GZS A;  3ZYL A;  4GA0 A;  4FHK A;  3RO2 A;  3ZGQ A;  5FT9 A;  3MV2 B;  1OWL A;  1ELK A;  2ZU6 B;  2UY1 A;  3FUF A;  2CHW A;  3TGO A;  4W9R A;  3GYZ A;  5KJM A;  4N3A A;  3IEG A;  3IKO B;  3GW4 A;  1H6K A;  3LCA A;  1ELW A;  3LYA A;  4Y6C A;  5DBK A;  4AY5 A;  4NRH B;  3R7R A;  3CIA A;  4APO A;  4B0Z A;  2X6J A;  4FP7 A;  2KZT A;  4EQF A;  4DPR A;  4GYY A;  2KM4 A;  3JCK C;  3IHV A;  4GYO A;  3UX4 A;  1JWF A;  4HLE A;  3CVN A;  2VSN A;  3QJZ A;  2R17 C;  2C2L A;  2KCV A;  3GZ2 A;  2VSO E;  3PE3 A;  4K0R A;  3D9P A;  3EHN A;  4HXI A;  3HDX A;  3ZRH A;  4DI3 A;  3ASF A;  1Y8M A;  3L54 A;  5FJY A;  3PDN A;  4UI9 K;  4A3T A;  5A7D B;  4NAC A;  4Q94 A;  3D9O A;  3SHF A;  3QKY A;  4WND A;  2L0T B;  2WQH A;  1ELR A;  1WAO 1;  3NZS A;  2KCK A;  2CHX A;  5ARG A;  2PQR A;  5JJ7 A;  3CHR A;  5AYW D;  5LCW C;  2HYZ A;  1Z6T A;  5T8I A;  2ILR A;  2NSZ A;  3ML8 A;  4GMJ A;  4UI9 C;  1QNF A;  5LCW J;  2X38 A;  3DPD A;  3SBS A;  4C0E A;  5E75 A;  3FEX A;  3CKC A;  1HXI A;  4BFR A;  1E8Y A;  3FH7 A;  3WXX A;  2KC7 A;  4UI9 J;  4L23 A;  4J6I A;  3UMV A;  1FVF A;  4U0Z A;  1OWO A;  4I2W A;  4JL0 A;  3APC A;  3PS6 A;  4IN3 B;  3HIZ A;  4HVB A;  4WAF A;  2J9Q A;  1Y6I A;  2OOE A;  2WXH A;  3Q5M A;  4N39 A;  3ZFW A;  5A6C A;  4RVB A;  4I6G A;  4Y6W A;  4GYW A;  4L7T A;  5G05 J;  4ANV A;  4FJY A;  3FTV A;  4WUY A;  3CVL A;  1OUV A;  4AY6 A;  2MRI A;  4IUL A;  4CEM A;  3SNX A;  1ZU2 A;  4U0S A;  1HH8 A;  3QNK A;  4ILG A;  2J08 A;  4ILI A;  3D9M A;  3ESK A;  3RRU A;  4XI0 A;  4FAD A;  3IV0 A;  2XGS A;  3DBS A;  4LCT A;  4PS3 A;  2WXF A;  3EJN A;  1EF1 C;  2Y3A A;  3LJ3 A;  3AS5 A;  1UJJ A;  3CQG B;  4KMO A;  1B89 A;  1H2V C;  5D0Q D;  5FQ6 A;  4Q69 A;  3TXN A;  3ZVV A;  3ZHE B;  2GRL A;  2IFU A;  1E90 A;  3SZ7 A;  5HI7 A;  3APF A;  2UY1 B;  2XPZ A;  1ZBP A;  4KYO B;  2OND A;  4TRQ A;  3Q47 B;  2XPY A;  5JHA A;  1H0A A;  1L5J A;  4A3V A;  4CCA A;  5DIZ A;  2XCC A;  3AU4 A;  4G2V A;  3TG4 A;  4U8H A;  1DVP A;  4FUL A;  4F7A A;  2KZT B;  4KT6 B;  4AVX A;  3CHS A;  4GA1 A;  3TG5 A;  4EZK A;  2VYI A;  1E7U A;  3CK7 A;  3BG0 B;  4UWK A;  4ACL A;  3G2V A;  4BX8 A;  3LY8 A;  3QOU A;  3ONK A;  4U0U A;  1S0P A;  5A23 A;  2VJ8 A;  2RG8 A;  3ZYQ A;  3GZ1 A;  1E8Z A;  3CGH A;  2XGM A;  2R5S A;  3ML9 A;  3LY9 A;  2LNI A;  3FH5 A;  5C2Y A;  3S7J A;  4ABN A;  2E0I A;  3AS8 A;  1BPO A;  4RG9 A;  3P2B A;  4UQX A;  2HR2 A;  3TAX A;  2AXV A;  4L2L A;  4XI9 A;  3LKU A;  4M3O A;  4G26 A;  4PH4 B;  2FF4 A;  3FFL A;  3FUL A;  3NQP A;  3ZN3 A;  3RRM B;  2CFU A;  4MLP A;  4OYS A;  4U63 A;  5J08 A;  2X3M A;  4LRZ A;  3RRN B;  4XX5 A;  3KEZ A;  3SGH A;  4BY6 A;  5KJK A;  4WWN A;  4E85 A;  3PEV B;  5ARF A;  3RJV A;  3LDZ A;  4GB9 A;  4V3I A;  1FVH A;  3TL5 A;  3L08 A;  2WXM A;  2KCL A;  1SQM A;  2BF0 X;  4MKT A;  3KD7 A;  4KVM A;  4G11 A;  1EDU A;  2IJG X;  3L6A A;  2IF4 A;  2V8S E;  2YNQ A;  1W3B A;  3U9W A;  1UN9 A;  4CGV A;  3PNT B;  2GRM A;  3E4B A;  1UW4 B;  2PM7 A;  3FU5 A;  2CHZ A;  3FUD A;  3LVQ E;  4AM9 A;  2VSX E;  4CDN A;  4O6F A;  4FLH A;  2Q7F A;  4I17 A;  2BTD A;  3I3N A;  3D9K A;  2YIN A;  2I1K A;  2NXP A;  4FLB A;  2M63 A;  3ULQ A;  1E8W A;  4KZC A;  3UT8 A;  1TEZ A;  1HZ4 A;  4UWL A;  2WM9 A;  4YVO A;  4E6H A;  4I1A A;  5ANR A;  2L6J A;  1MHQ A;  4XE0 A;  4KZ0 A;  2XRY A;  3MKR A;  5FZR A;  4F53 A;  4EZJ A;  3CVY A;  1A17 A;  1NA3 A;  2WXL A;  3CK9 A;  2WXQ A;  3VTX A;  2VSY A;  5KJN A;  3HHM A;  3FU6 A;  5G04 C;  5FQ8 A;  3FU0 A;  3G2S A;  4JPS A;  3LY7 A;  3AU5 A;  2WMO A;  3B7R L;  4HOR A;  2WXP A;  4XKB A;  1KT0 A;  4KBQ A;  2GGF A;  5G04 J;  3PZD A;  3S7B A;  3OAW A;  3ZEF A;  4HOU A;  1SZA A;  4F3V A;  2QFC A;  2AXZ A;  3Q49 B;  4FJZ A;  3U66 A;  1IQR A;  3B7U X;  4WWO A;  2IQC A;  3BG1 B;  2DCP A;  4C0M A;  5FTP A;  4JA9 A;  4A1S A;  4AEZ C;  3D9N A;  2PM6 A;  2I2O A;  3FU3 A;  5EX3 A;  4OVV A;  3AS4 A;  3LXU X;  3QAQ A;  5LFA A;  1HU3 A;  3UT4 A;  4GZ3 A;  3FTY A;  3QK0 A;  4N3C A;  4Q96 A;  3CSF A;  4MS6 A;  3RU0 A;  3U4T A;  1TJF A;  4CRW A;  3FDH A;  2Y4U A;  2WXI A;  4CGW A;  3ZW3 A;  2VTB A;  4H7X A;  5G55 A;  4H7Y A;  2Y4T A;  2AVP A;  3FWV A;  3TXM A;  4MRU A;  4JHR A;  2WXN A;  5FQ7 A;  4UWF A;  1OWP A;  2WXG A;  4KXK B;  4EEC A;  1IHG A;  2MOW A;  1HX8 A;  2FUL A;  2J49 A;  3EIQ C;  3P1U A;  4HS2 A;  2XCB A;  4PUC A;  4UWH A;  4YND A;  4BT9 A;  3FHE A;  4GAA A;  4EBA A;  4N3B A;  1LF8 A;  2X6I A;  3O4Z A;  4ANU A;  3FUE A;  3PUJ A;  3CV0 A;  5KCM A;  5BW8 C;  5ENN A;  2WXO A;  4JW1 A;  3T5V A;  4ATG A;  3PUK A;  4JVS A;  2J4B A;  4U07 A;  4JHJ A;  3VLD A;  4C9B B;  2YHC A;  4N2S A;  2JLB A;  4I1M A;  4BTB A;  2IU1 A;  3CLJ A;  1NA0 A;  3N71 A;  4L1B A;  2WB2 A;  1FCH A;  3MCX A;  3HVE A;  3LVR E;  2IOS A;  1N54 A;  3S7D A;  5EDS A;  4HOQ A;  2I1J A;  1JWG A;  3LS8 A;  4TV3 A;  4RSY A;  3EIJ A;  5CMW A;  3FTU A;  1WM5 A;  5J90 A;  1IQU A;  5ANL A;  3IHY A;  3VLF A;  4APF A;  4N2Q A;  3APD A;  3ASH A;  2AW6 A;  3JUI A;  4GA2 A;  3FH8 A;  4GML A;  1HE8 A;  1GW6 A;  3Q4A B;  3RKV A;  1H19 A;  3MZL B;  4ILH B;  4ANX A;  3QWP A;  2XEV A;  3CVQ A;  1HFA A;  1HO8 A;  1UG3 A;  3FP3 A;  5KJL A;  4JZY A;  1EYH A;  1UN8 A;  1YA0 A;  4GZ5 A;  3G2T A;  5FQ4 A;  1E96 B;  1INZ A;  5FZS A;  2YHE A;  1PAQ A;  5E76 A;  3OTN A;  4J8F A;  4F1S A;  1E7V A;  3PE4 A;  4DK5 A;  2VQ2 A;  3Q15 A;  3ZXS A;  2V0P A;  2I9C A;  4WWP A;  1EPU A;  4I9C A;  5BT1 A;  3BEE A;  4URK A;  2VGX A;  3NF1 A;  2CG2 A;  5EX0 A;  1QZ2 A;  5CHE E;  4PS7 A;  3CQC B;  4WNG A;  3QB2 A;  4YVQ C;  5JJT A;  4HFG A;  4DJA A;  3ENE A;  1XGW A;  3FUN A;  3K9I A;  5JJ6 A;  1OWN A;  5BV0 A;  3QAR A;  1HG2 A;  2NC9 A;  5HQ8 A;  3IBE A;  3R7Q A;  2VTB B;  3ESL A;  4G25 A;  4J0U A;  3I5P A;  3MEK A;  1IYG A;  1NZN A;  3FUJ A;  4GZ6 A;  2C0M A;  4AP2 A;  5LP0 A;  2P58 C;  2XPI A;  4FA6 A;  2V5F A;  1P5Q A;  3PRE A;  2V4L A;  4G1T A;  1HF8 A;  3MV3 B;  4D10 C;  1NP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...