4J8TA

Engineered digoxigenin binder dig10.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
MNAKEIVVHALRLLENGDARGWCDLFHPEGVLEYPYPPPGYKTRFEGRETIWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVHTVSGGKLAADYISVLRTRDGQILLYRLFFNPLRVLEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Digoxigenin binder protein DIG10.2
publication title Computational design of ligand-binding proteins with high affinity and selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Digoxigenin binding protein
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4j8tA00
3VGNA 5BVBA 2F99A 2XSHB 2YFJB 3B4PA 1OGXA 2GBXB 4FCJA 4HM5B 3STDA 1VZZA 5IG3A 1ULIB 1ULJB 3OXAA 4L8PA 3CU3A 2GEYA 3SOYA 2Z7AA 4HM4B 2YFIB 1HKXA 1OGZA 2Z76A 5IF6A 6STDA 1A2KA 2HMMB 4WYKA 5JPUA 2YFLB 3WMDA 2RFRA 3B4OA 5CF2A 3EN1B 3LYGA 1NWWA 3CNXA 4XBTA 3D9RA 3FH1A 3LZAA 4HM3B 3NBRA 4J8TA 1Q40B 3IPTA 4WWUC 3FSDA 4XBYA 4K1VA 4HM6B 4WP5A 4L7KA 3MG2A 3I0YA 4HM8B 3T8UA 3HZPA 4WYKB 5AI1A 1GY7A 3F8HA 3F8XA 5KP4A 4HZBB 3UNLA 2RGQA 1DMMA 1O7NB 1JN5B 5BXQA 1EA2A 2BMQB 2XR8B 3NV0A 3KKGA 1Q42A 3B8LA 5AEWB 3NHXA 1E3VA 5D81A 1JKGA 1K41A 3DUKA 4HVNA 5JPPA 4XB5A 7STDA 4CDLA 3EHCA 2QIYA 3F7SA 3DMCA 5DRVA 1DMQA 1O7MB 1OHOA 3RGAA 5CXOA 4R9KA 2IMJA 5CLKA 5D83A 4PEJA 2STDA 3ECFA 1W01A 1E3RA 3S5CA 3GZRA 1NU3A 3JUQA 8CHOA 3NXJA 1ZO2A 3OV4A 3H3HA 2I9WA 1Z1SA 1JKGB 5IG0A 3DXOA 1OH0A 2PZVA 2OWPA 1W6YA 3G0KA 4ORLA 1S5AA 1O7GB 3F14A 2HMNB 3ER7A 1C7HA 4X2OA 3EF8A 2HMLB 1IDPA 4LGQA 4X2HA 5IG5A 1JB4A 2BNGA 1ZX2A 1STDA 4LMIA 5AIHA 1O7WB 1GS3A 3Q90A 3F7XA 3M8CA 4OVMA 5KP3A 1GY6A 4HJLB 1OF5A 2XSOB 3SOAA 4HM2B 2XRXB 2A15A 1O7PB 3FZWA 4XM4A 1UUVB 3KE7A 5CF1A 3K7CA 3GZYB 5IG4A 1U5OA 2GBWB 2INXA 3OWSA 4L8OA 1OPYA 1DMNA 4HKVB 4R9LA 5STDA 1GY5A 4IIAA 5IERA 5CK6A 2UX0A 5IEOA 5AIGA 1SJWA 4H3UA 4K1UA 2QGUA 2RCDA 3BLZA 3NUVA 2GXFA 3NM2A 2HMKB 1ISKA 3UJMA 3T8NA 5G2GA 4FCMA 1W02A 5IENA 4U13A 1CQSA 3F40A 1OHPA 2B24B 2W2CA 3NV0B 3FF0A 5KP1A 1BUQA 4I4KA 1ASKA 3ROBA 4XDVA 2HMJB 4Q53A 3FLJA 3MG3A 5IEPA 3RGRA 1O7HB 5AIFA 2F86B 5HGRA 2CHCA 4N3VA 3EN8A 4HZ9B 1QMAA 4HM0B 3EQQB 1OHSA 3BB9A 4OUQA 3VSYA 1TUHA 1Q40A 3GWRA 3OWYA 3JUOA 1QJGA 1NDOB 2BMOB 2HMOB 1WQLB 3FGYA 2CKFB 3KSPA 3MHEA 4RZMA 5D82A 5AEUB 4XBXA 1OUNA 3JUNA 4R1KA 3EC9A 3CNMA 3H51A 1JN5A 3EJVA 1UUWB 3GRDA 3EX9A 4J9AA 2GEXA 1OCVA 3FF2A 3EBTA 2BMRB 3JUMA 3EBYA 3A76A 1E97A 5AIIA 5DREA 3GZXB 3MYTA 3FKAA 3MSOA 1W00A 4GB5A 3OWUA 5TGNA 3E99A 2Z77A 3G16A 1GYBA 3HK4A 4STDA 1EG9B 1OF5B 3DZLA 3F9SA 1TP6A 3CPOA 2R4IA 3DM8A 3HX8A 4XDWA 4HM1B 3SEDA 4LEHA 1AR0A 2JQ5A 2F98A 3GZBA 4KVHA 3KZTA 2B1XB 3JUPA 2K54A 3B7CA 5EVHA 5FW5A 3MKIA 3OX9A 3MG1A 3K0ZA 1JB2A 4MJDA 4HM7B 1JB5A 3G8ZA
chains in the Genus database with same CATH superfamily
3VGNA 4H61A 3LTBA 5BVBA 1VQ73 1UCJA 2F99A 4AEQA 1QAFA 3Q3FA 2XSHB 2YFJB 3B4PA 4EBGA 2W56A 3X41A 1OGXA 1Q9EA 2GBXB 2P0MA 3BIRA 3PGBA 4FCJA 4HM5B 3STDA 3BU4A 1LQGC 1VZZA 1V74A 3AMOA 3HIGA 3X3ZA 5IG3A 2R41A 3G6E3 1BIRA 1ULIB 1ULJB 1X1WA 1US1A 3OXAA 4L8PA 1B2ZA 3CU3A 1NB3I 3CCV3 1RCKA 2W9PA 1IV7A 1RN4A 2E2VA 4JRFA 1BNGA 1ROAA 1VQK3 1A90A 3BNEA 2GEYA 1VQP3 3SOYA 3L0RA 1D6UA 4K61A 4OK0A 1JBTA 2J8XB 2OTL3 2Z7AA 3URPA 3I553 3N54B 4HM4B 2F4YA 2YFIB 1B20A 1HKXA 5ELJA 1OGZA 4O8SA 1B2MA 1UI7A 1C54A 9RNTA 4LYLB 1I2EA 1TRPA 2Z76A 3S67A 2CFLA 2ZL8A 3IJEB 3FG1A 2L1SA 1IQ8A 3NBJA 4HBRA 1UCIA 3GAXA 1UGIA 3D5GA 2WOHA 1FUTA 4O3VA 2ML5A 1F8NA 5IF6A 4EC6A 2WO0A 3KN4A 2GU1A 2BT3A 1FA3A 3SYUA 1M9GA 3LMLA 1K9M4 2CK3H 2IYJA 6STDA 3I563 1A2KA 2HMMB 1RKYA 4LSOA 3N8BA 1FW7A 3K5TA 1M1K4 4WYKA 2KXGA 3K9MC 5JPUA 5M19A 2YFLB 2W56B 1VQQA 2BO9B 3WMDA 1RN7A 2MF7A 2RFRA 4KZ1A 4KFFA 3AMOB 2KF5A 5AYRB 4RBNA 3B4OA 2H0HA 5CF2A 3EN1B 3LYGA 3S28A 1NWWA 3CNXA 4XBTA 4N6UA 3SX1A 1RCLA 1RGKA 1M1XB 2O9UX 3D9RA 4GSPA 3J7Yd 1IYYA 3FH1A 1T2IA 3LZAA 1LNIA 4HM3B 4N6TA 3WODG 2XF3A 1TU5A 4RNZA 3NBRA 4HYZA 3AGOA 4J8TA 3V98A 2C10A 3G713 3CCM3 1JV2B 4BTXA 2C11A 1Q40B 3IPTA 4WWUC 1SPUA 3NM7A 3FSDA 4XBYA 4K1VA 3DGMA 1RJOA 1UUGB 4HM6B 4N6NB 2CWVA 1EQKA 1RGAA 3LTCA 1FGTA 2CW9A 4WP5A 1N5HA 2MC8A 4L7KA 2LYXA 2KF6A 2KCDA 1BGSA 1STFI 4RNYA 1I0XA 1GOVA 3MG2A 2WGOA 4FMAA 3ZFZA 3I0YA 4HM8B 3T8UA 1ROVA 1AV4A 3DGLA 1VQO3 2XGLA 3HZPA 4WYKB 5AI1A 3UL5A 1CEWI 3KFQC 3HI7A 1GY7A 3F8HA 1WMPA 2CC3A 3F8XA 5KP4A 4FMDA 4WFOA 4HZBB 3CME3 3UNLA 2RGQA 3DGNA 3NX0A 2CIUA 1DMMA 4BL3A 2Y73A 1O7NB 1JN5B 4GL6A 4KFDA 2H0GA 1GMRA 3D3LA 5BXQA 1EA2A 2BMQB 5EEOA 2XR8B 1JBRA 3NV0A 1BSEA 4LZIA 4BTYA 1EKMA 3KKGA 1ZS7A 1BSCA 1VQM3 1YJ93 1JJ22 1Q42A 4NPBA 3B8LA 3WHOA 1RSNA 3DGYA 4RNTA 3WDGB 5AEWB 3NHXA 1E3VA 5D81A 3PYJA 2QA43 3IMAB 3QRDA 1PYLA 3FG3A 1BANA 1K41A 1JKGA 1W4NA 1X1YA 1SARA 3DUKA 1Q824 1VQ63 2OTJ3 1WTHA 2KF4A 4HVNA 4KFEA 3RNTA 3WOEB 3KSED 5JPPA 2D42A 3FCSB 5LC7A 3X3XA 1N5PA 2W04A 5RNTA 4XB5A 7STDA 4QWTA 4CDLA 3EHCA 2QIYA 2D1WA 1CH0A 4NREA 3F7SA 1L5GB 1X1XA 4AKYA 2W9QA 2O3OA 2M7OA 1BRIA 1FUSA 3DMCA 1Q814 1W2ZA 5DRVA 1DMQA 1BAOA 1YIJ3 1VQ53 1MWSA 1O7MB 1OHOA 3ZG0A 3JVCA 4ILFA 3LT8A 3RGAA 1EUIC 1BNEA 4EXRA 5CXOA 1MNLA 4R9KA 1PFPA 1V57A 2IMJA 5CLKA 4PEJA 5D83A 1K734 1OACA 2STDA 3ECFA 1W01A 1E3RA 4MEIA 3S5CA 5I97A 2WGQA 2C4BA 3GZRA 1KQS2 1RGFA 1NU3A 2W6JH 2XFSA 3JUQA 4CPKA 1AY7A 1QAKA 1I8VA 4EYCA 4J5GA 1I70A 4EV5A 8CHOA 3NXJA 1ZO2A 3OV4A 1FGOA 1LVNA 2K0MA 1KC84 2RSXA 3H3HA 2I9WA 4GHOA 1DE3A 1Z1SA 1YGWA 1AVLA 1JKGB 5IG0A 1BRGA 1TRQA 3DXOA 1OH0A 2K3DA 5HOHA 1D6YA 2PZVA 4R4KA 2OWPA 1W6YA 3G0KA 1TIJA 3WA3A 1T2HA 1AVKA 4ORLA 1S5AA 1O7GB 2Q07A 3F14A 1IV9A 1Q864 4BIRA 2HMNB 3ER7A 4HAAA 1IQYA 3CCR3 1C7HA 2KAAA 4X2OA 2Z6BA 1G0TA 3EF8A 2HMLB 1R4CA 1FGQA 2ZDJA 1IDPA 1YVBI 4LGQA 3K63A 4X2HA 5IG5A 1PU4A 1LQMB 2HOHA 1JB4A 2BNGA 4BL2A 3EB8A 1GD4A 3LXUX 2GSPA 1ZX2A 3A5EA 1HZ1A 3FG4A 1PY3A 3PS8A 3CCJ3 1STDA 4LMIA 5AIHA 1O7WB 1GS3A 1YIT3 1NNVA 4FR9A 3Q90A 3F7XA 3M8CA 2OQEC 5GSPA 1LOYA 4OVMA 1RDSA 3Q2PA 4MMZB 5KP3A 1GY6A 1TJDA 7RNTA 4HJLB 2AAEA 3SLUA 1OF5A 4CJNA 2XSOB 1SQWA 5A0OB 1W6GA 1Y4KA 2W0QA 3SOAA 4HM2B 2XRXB 2A15A 1B2SA 2WOFA 1J2BA 1FUWA 1B27A 1W6CA 1NB5I 1IVXA 1RGGA 1O7PB 5ELUA 6GSPA 3FZWA 4TX4A 4XM4A 1CYVA 3Q1CA 1UI8A 1VQL3 1UUVB 3TDGA 1N9JA 1W5ZA 1GD3A 2JDIH 3KE7A 1N8QA 1RTUA 5CF1A 1T3BA 1RHLA 3K7CA 1BNFA 3GZYB 4G1MB 1UGHI 5IG4A 3BNBA 1U5OA 1BVIA 3CPW2 2GBWB 1I0VA 2INXA 3OWSA 3PCRA 3S29A 3G4S3 1X1UA 1N8R4 3LH4A 3NQYA 5G1KA 1KWIA 1IQXA 1YGEA 4FMBA 3KCHA 4JF8A 3S27A 1FGRA 1V58A 2CWTA 2E2TA 4L8OA 1IK3A 1B3SA 3BNDA 1S723 1OPYA 1NO3A 1DMNA 3LT9A 4HKVB 2H0IA 2IUKA 3X40A 1W7CA 1A67A 3AHSA 1BRSA 3AHWA 4R9LA 3CCS3 1BRJA 1MOLA 5STDA 2OOVC 1RGLA 1FYSA 1GY5A 4IIAA 1B2UA 5IERA 1HYFA 2ZHXB 1RN1A 1LOWA 5CK6A 2UX0A 1I3IA 3WR2A 2E2UA 2BIRA 1GOUA 2RBIA 4CCVA 1HU9A 1TFKA 5IEOA 5AIGA 1SJWA 4H3UA 5IW9A 1MWUA 1Q7Y4 3BNCA 1TFOA 4K1UA 2QGUA 5AYSC 4AKZA 1DVCA 2RCDA 3CCE3 2W03A 3BLZA 3NUVA 2GXFA 1LNHA 2OCTA 3NM2A 2HMKB 1YI23 1YHQ3 1ISKA 1KSIA 3UJMA 1WNHA 1ZGXA 4N6V0 1KD14 1VQ43 3T8NA 2QEX3 2FXTA 3EE1A 5G2GA 4FCMA 2V1LA 2IY2A 3MWZA 1W02A 4ZM8A 5IENA 1N9EA 4U13A 3CXC2 3DY5A 3F40A 4FMCA 1OHPA 1BSDA 2B24B 1BRKA 1QALA 1BRHA 2W2CA 1RGCA 1K28A 3NV0B 4R80A 1JBSA 3FF0A 5KP1A 1BUQA 4NHFA 1IVWA 1BNIA 1RRLA 1YJW3 4I4KA 4O02B 2ML6A 2OQEA 1WMOA 3LTAA 4MMYB 1ASKA 1NJI4 3ROBA 2XFTA 1IVUA 4HOHA 1DETA 3NQZA 1UDII 4XDVA 2HMJB 3U97A 1RLSA 2IA7A 4Q53A 3FLJA 2XGNA 3MG3A 1SIIA 3WA2X 5IEPA 5M18A 3RGRA 2CH9A 2CG1A 3CD63 1BUJA 3SVAA 1U8CB 1O7HB 1RMSA 5AIFA 1IT7A 1YVSA 3X42A 3CC73 4BU4A 1K8A4 2F86B 5HGRA 1WMNA 6RNTA 1BNJA 2CHCA 1FZUA 1SIHA 4N3VA 2CX1A 3EN8A 4HZ9B 1VQ83 1QMAA 1DVDA 4HM0B 3EQQB 1CYUA 1OHSA 3BB9A 1YNVX 3D79A 3N9HA 1IT8A 1TUHA 2AADA 4OUQA 3VSYA 1UW1A 1Q40A 2FGTA 5EQLA 3GWRA 3OWYA 4IPBA 1B2XA 3ALAA 3JUOA 3HOHA 3UB1A 1QVF2 3HIIA 1QJGA 4N6LA 2L4VA 1NDOB 2CFKA 2SBLA 3QK9A 2BMOB 2HMOB 1WQLB 3FGYA 2CKFB 2XH9A 1JZOA 3KSPA 3CC43 1RNTA 3MHEA 4K90B 4RZMA 1BNSA 5D82A 3T0UA 5BIRA 1VQN3 5BU4A 2XEPA 3UL6A 5AEUB 2CFGA 2YX9A 5JBSA 1YJN3 2UGIA 4DKIA 3PCSA 4XBXA 1BRNL 1JNQA 5M1AA 1OUNA 3JUNA 1IVVA 4R1KA 1M904 2LQVA 3EC9A 4N6OB 3CNMA 1EEJA 2KF3A 3LTDA 1LRAA 4KT3B 3H51A 1JN5A 3EJVA 1UUWB 2OOVA 3GRDA 3V92A 2UUGC 4IT7A 3EX9A 4FCZA 4J9AA 3ZG5A 1GMPA 3DGOA 4O2HA 1MWRA 2CX0A 4N6MA 1TTOA 2GU3A 2GEXA 3CMA3 1I2GA 1GSPA 1LXEA 1OCVA 4J5KA 3FF2A 3EBTA 2BMRB 3OW22 3JUMA 3MPHA 3EBYA 3PZWA 3SXXA 3KIIA 2PNCA 2BU4A 1UCLA 3A76A 1E97A 3D4AA 5AIIA 5DREA 3GZXB 3MYTA 4MMXB 3PXMA 1VQ93 3AGNA 1A2VA 3FKAA 3MSOA 1BU4A 1W00A 1D6ZA 1I3FA 4GB5A 3OWUA 2P09A 5TGNA 3E99A 4BTWA 1UCKA 2P38A 3VF1A 1I2FA 2Z77A 3G16A 3V99A 1BNRA 1GYBA 1RRHA 3LOYA 3HK4A 4STDA 5LC6A 3U1WA 3CCU3 1R4YA 1EG9B 1OF5B 3DZLA 2F56A 3F9SA 3CCQ3 1DYUA 2P05A 7GSPA 1TP6A 3CPOA 2CFWA 3DH2A 1W2B2 2R4IA 3O8YA 1G02A 1QVG2 2Y74A 3DM8A 3WOFB 2CG0A 1BSBA 3HX8A 3GSPA 2CWUA 1MWTA 4XDWA 4HM1B 1LOXA 3SEDA 4LEHA 2P0XA 2RNTA 1G96A 3NBBA 1AR0A 1GOYA 2JQ5A 2F98A 3GZBA 4KVHA 3KZTA 1B21A 8RNTA 2B1XB 3CCL3 1T5YA 3JUPA 4WHAA 1FGMA 1BSAA 1RGEA 1LOVA 3RDEA 2K54A 3CC23 1BOXA 3B7CA 4EW5A 3D5IA 5EVHA 1AQZA 5FGOA 2IUJA 3X3YA 1A2PA 2ZA4A 1Q7HA 5FW5A 5G1LA 2F5WA 3MKIA 1GMQA 3OX9A 2KRTA 1MGRA 1RNBA 2FNQA 4EV2A 1JZDA 2BHMA 2F5MA 3MG1A 3K0ZA 1MGWA 1JRQA 4I5QA 1JB2A 2SARA 2CFDA 3G8ZA 4HM7B 4MJDA 1RGHA 1JB5A 1CQSA 1IU7A
chains in the Genus database with same CATH topology
3VGNA 4H61A 3LTBA 5BVBA 1VQ73 2F99A 4AEQA 1QAFA 2XSHB 2YFJB 3B4PA 4EBGA 2W56A 3X41A 1OGXA 2GBXB 2P0MA 4FCJA 3CC43 3PGBA 4HM5B 3STDA 1VZZA 1V74A 3AMOA 3HIGA 3X3ZA 5IG3A 3G6E3 1ULIB 1ULJB 3OXAA 1US1A 4L8PA 3CU3A 1NB3I 3CCV3 2W9PA 1IV7A 2E2VA 4JRFA 1ROAA 1VQK3 1A90A 3BNEA 2GEYA 1VQP3 3SOYA 3L0RA 1D6UA 4K61A 4OK0A 2OTL3 2Z7AA 3I553 3N54B 4HM4B 2YFIB 1HKXA 5ELJA 1OGZA 4O8SA 1UI7A 2Z76A 3S67A 2CFLA 2ZL8A 3IJEB 3FG1A 1IQ8A 3NBJA 4HBRA 3GAXA 2WOHA 4O3VA 2ML5A 1F8NA 5IF6A 4EC6A 2WO0A 3KN4A 2GU1A 2BT3A 1FA3A 1M9GA 3LMLA 1K9M4 2CK3H 6STDA 3I563 1A2KA 2HMMB 1RKYA 4LSOA 3N8BA 3K5TA 1M1K4 4WYKA 2KXGA 3K9MC 5JPUA 2YFLB 2W56B 2BO9B 3WMDA 1RN7A 2MF7A 2RFRA 4KZ1A 4KFFA 3AMOB 5AYRB 4RBNA 3B4OA 5CF2A 3EN1B 3LYGA 3S28A 1NWWA 3CNXA 4XBTA 4N6UA 3SX1A 3J7Yd 1M1XB 2O9UX 3D9RA 3FH1A 3LZAA 4N6TA 4HM3B 3WODG 1TU5A 2XF3A 4RNZA 3NBRA 4HYZA 4J8TA 3V98A 2C10A 3G713 3CCM3 1JV2B 4BTXA 2C11A 1Q40B 3IPTA 4WWUC 1SPUA 3NM7A 3FSDA 4XBYA 4K1VA 3DGMA 1RJOA 4HM6B 4N6NB 2CWVA 1EQKA 3LTCA 1FGTA 2CW9A 4WP5A 1N5HA 2MC8A 4L7KA 2LYXA 2KCDA 4RNYA 1STFI 3MG2A 2WGOA 4FMAA 3I0YA 4HM8B 3T8UA 1ROVA 1AV4A 3DGLA 1VQO3 2XGLA 3HZPA 4WYKB 5AI1A 3UL5A 1CEWI 3KFQC 3HI7A 1GY7A 3F8HA 1WMPA 2CC3A 3F8XA 5KP4A 4FMDA 4WFOA 4HZBB 3CME3 3UNLA 2RGQA 3DGNA 3NX0A 2CIUA 1DMMA 2Y73A 1O7NB 1JN5B 4GL6A 4KFDA 3D3LA 5BXQA 1EA2A 2BMQB 5EEOA 2XR8B 3NV0A 4LZIA 4BTYA 1EKMA 3KKGA 1VQM3 1JJ22 1Q42A 3B8LA 3WDGB 5AEWB 3NHXA 1E3VA 5D81A 3PYJA 2QA43 3IMAB 3QRDA 3FG3A 1JKGA 1K41A 1W4NA 3DUKA 1Q824 1VQ63 2OTJ3 1WTHA 4HVNA 4KFEA 3WOEB 5JPPA 3KSED 2D42A 3FCSB 5LC7A 3X3XA 1N5PA 2W04A 4XB5A 7STDA 4QWTA 4CDLA 3EHCA 2QIYA 2D1WA 4NREA 1L5GB 3F7SA 4AKYA 2W9QA 2O3OA 2M7OA 3DMCA 1Q814 1W2ZA 5DRVA 1DMQA 1YIJ3 1VQ53 1O7MB 1OHOA 3JVCA 3LT8A 3RGAA 4EXRA 5CXOA 1MNLA 4R9KA 1PFPA 2IMJA 5CLKA 4PEJA 5D83A 1K734 1OACA 2STDA 3ECFA 1W01A 1E3RA 4MEIA 3S5CA 5I97A 2WGQA 3GZRA 1KQS2 1NU3A 2W6JH 2XFSA 3JUQA 1QAKA 4EYCA 4EV5A 8CHOA 3NXJA 1ZO2A 3OV4A 1FGOA 1LVNA 2K0MA 1KC84 2RSXA 3H3HA 2I9WA 1Z1SA 1AVLA 1JKGB 5IG0A 3DXOA 1OH0A 1D6YA 2PZVA 4R4KA 2OWPA 1W6YA 3G0KA 1TIJA 3WA3A 1AVKA 4ORLA 1S5AA 1O7GB 2Q07A 3F14A 1IV9A 1Q864 2HMNB 3ER7A 1IQYA 3CCR3 1C7HA 4X2OA 2Z6BA 3EF8A 2HMLB 1R4CA 1FGQA 2ZDJA 1IDPA 1YVBI 4LGQA 3K63A 4X2HA 5IG5A 1PU4A 1JB4A 2BNGA 3EB8A 1GD4A 3LXUX 1ZX2A 3FG4A 3PS8A 3CCJ3 1STDA 4LMIA 5AIHA 1O7WB 1GS3A 1YIT3 4FR9A 3Q90A 3F7XA 3M8CA 2OQEC 4OVMA 3Q2PA 4MMZB 5KP3A 1GY6A 4HJLB 3SLUA 1OF5A 2XSOB 1SQWA 5A0OB 1W6GA 1Y4KA 2W0QA 3SOAA 4HM2B 2XRXB 2A15A 2WOFA 1J2BA 1FUWA 1W6CA 1NB5I 1IVXA 5ELUA 1O7PB 3FZWA 4TX4A 4XM4A 1CYVA 3Q1CA 1UI8A 1VQL3 1UUVB 3TDGA 1N9JA 1W5ZA 1GD3A 2JDIH 3KE7A 1N8QA 5CF1A 3K7CA 3GZYB 4G1MB 5IG4A 3BNBA 1U5OA 3CPW2 2GBWB 2INXA 3PCRA 3OWSA 3S29A 3G4S3 1N8R4 3LH4A 3NQYA 1KWIA 1IQXA 1YGEA 4FMBA 4JF8A 3S27A 1IK3A 1FGRA 2CWTA 2E2TA 4L8OA 1S723 3BNDA 1OPYA 1NO3A 1DMNA 3LT9A 4HKVB 2IUKA 3X40A 1W7CA 1A67A 4R9LA 3CCS3 1MOLA 5STDA 2OOVC 1GY5A 4IIAA 5IERA 5CK6A 2UX0A 2E2UA 4CCVA 1HU9A 1TFKA 5IEOA 5AIGA 1SJWA 4H3UA 5IW9A 1Q7Y4 3BNCA 1TFOA 4K1UA 2QGUA 5AYSC 4AKZA 1DVCA 2RCDA 3CCE3 2W03A 3BLZA 3NUVA 2GXFA 1LNHA 2OCTA 3NM2A 2HMKB 1YI23 1YHQ3 1ISKA 1KSIA 3UJMA 1WNHA 4N6V0 1KD14 1VQ43 3T8NA 2QEX3 2FXTA 3EE1A 5G2GA 4FCMA 2V1LA 3MWZA 1W02A 4ZM8A 5IENA 1N9EA 4U13A 3CXC2 3DY5A 3F40A 4FMCA 1OHPA 2B24B 1QALA 2W2CA 4R80A 1K28A 3NV0B 3FF0A 5KP1A 1BUQA 4NHFA 1IVWA 1RRLA 1YJW3 4I4KA 4O02B 2ML6A 2OQEA 1WMOA 3LTAA 4MMYB 1ASKA 1NJI4 3ROBA 2XFTA 1IVUA 3NQZA 4XDVA 2HMJB 3U97A 2IA7A 4Q53A 3FLJA 2XGNA 3MG3A 1SIIA 3WA2X 5IEPA 3RGRA 2CH9A 2CG1A 3CD63 3SVAA 1U8CB 1O7HB 5AIFA 1IT7A 3X42A 3CC73 1K8A4 2F86B 5HGRA 1WMNA 2CHCA 1SIHA 4N3VA 1VQ83 3EN8A 4HZ9B 1QMAA 1DVDA 4HM0B 3EQQB 1CYUA 1OHSA 3BB9A 4OUQA 3N9HA 3VSYA 1IT8A 1TUHA 1UW1A 1Q40A 2FGTA 5EQLA 3GWRA 3OWYA 4IPBA 3JUOA 3ALAA 3UB1A 1QVF2 3HIIA 1QJGA 4N6LA 2L4VA 1NDOB 2CFKA 2SBLA 3QK9A 2BMOB 2HMOB 1WQLB 3FGYA 2CKFB 2XH9A 3KSPA 3MHEA 4K90B 4RZMA 5D82A 1VQN3 3T0UA 2XEPA 3UL6A 5AEUB 2CFGA 2YX9A 5JBSA 1YJN3 3PCSA 4XBXA 1JNQA 1OUNA 3JUNA 1IVVA 4R1KA 1M904 2LQVA 3EC9A 4N6OB 3CNMA 3LTDA 2OOVA 1YJ93 3H51A 1JN5A 3EJVA 1UUWB 3V92A 3GRDA 4IT7A 3EX9A 4FCZA 4J9AA 3DGOA 4O2HA 4N6MA 2GU3A 2GEXA 3CMA3 1OCVA 1LXEA 3FF2A 3EBTA 2BMRB 3OW22 3JUMA 3MPHA 3EBYA 3PZWA 3SXXA 3KIIA 2PNCA 3A76A 1E97A 5AIIA 5DREA 3GZXB 3MYTA 4MMXB 3PXMA 1VQ93 1A2VA 3FKAA 3MSOA 1W00A 1D6ZA 4GB5A 3OWUA 2P09A 5TGNA 3E99A 4BTWA 3VF1A 2P38A 2Z77A 3G16A 3V99A 1GYBA 1RRHA 3LOYA 3HK4A 4STDA 5LC6A 3U1WA 3CCU3 1EG9B 1OF5B 3DZLA 3F9SA 3CCQ3 1DYUA 2P05A 1TP6A 3CPOA 2CFWA 1W2B2 2R4IA 3O8YA 1QVG2 2Y74A 3DM8A 3WOFB 2CG0A 3HX8A 2CWUA 4XDWA 4HM1B 1LOXA 3SEDA 4LEHA 2P0XA 1G96A 3NBBA 1AR0A 2JQ5A 2F98A 3GZBA 4KVHA 3KZTA 2B1XB 3CCL3 1T5YA 3JUPA 4WHAA 1FGMA 3RDEA 3CC23 2K54A 3B7CA 5EVHA 5FGOA 2IUJA 3X3YA 5FW5A 3MKIA 3OX9A 2KRTA 2FNQA 4EV2A 2BHMA 3MG1A 3K0ZA 1JRQA 1JB2A 4MJDA 2CFDA 3G8ZA 4HM7B 1JB5A 1CQSA 1IU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGN A;  5BVB A;  2F99 A;  2XSH B;  2YFJ B;  3B4P A;  1OGX A;  2GBX B;  4FCJ A;  4HM5 B;  3STD A;  1VZZ A;  5IG3 A;  1ULI B;  1ULJ B;  3OXA A;  4L8P A;  3CU3 A;  2GEY A;  3SOY A;  2Z7A A;  4HM4 B;  2YFI B;  1HKX A;  1OGZ A;  2Z76 A;  5IF6 A;  6STD A;  1A2K A;  2HMM B;  4WYK A;  5JPU A;  2YFL B;  3WMD A;  2RFR A;  3B4O A;  5CF2 A;  3EN1 B;  3LYG A;  1NWW A;  3CNX A;  4XBT A;  3D9R A;  3FH1 A;  3LZA A;  4HM3 B;  3NBR A;  4J8T A;  1Q40 B;  3IPT A;  4WWU C;  3FSD A;  4XBY A;  4K1V A;  4HM6 B;  4WP5 A;  4L7K A;  3MG2 A;  3I0Y A;  4HM8 B;  3T8U A;  3HZP A;  4WYK B;  5AI1 A;  1GY7 A;  3F8H A;  3F8X A;  5KP4 A;  4HZB B;  3UNL A;  2RGQ A;  1DMM A;  1O7N B;  1JN5 B;  5BXQ A;  1EA2 A;  2BMQ B;  2XR8 B;  3NV0 A;  3KKG A;  1Q42 A;  3B8L A;  5AEW B;  3NHX A;  1E3V A;  5D81 A;  1JKG A;  1K41 A;  3DUK A;  4HVN A;  5JPP A;  4XB5 A;  7STD A;  4CDL A;  3EHC A;  2QIY A;  3F7S A;  3DMC A;  5DRV A;  1DMQ A;  1O7M B;  1OHO A;  3RGA A;  5CXO A;  4R9K A;  2IMJ A;  5CLK A;  5D83 A;  4PEJ A;  2STD A;  3ECF A;  1W01 A;  1E3R A;  3S5C A;  3GZR A;  1NU3 A;  3JUQ A;  8CHO A;  3NXJ A;  1ZO2 A;  3OV4 A;  3H3H A;  2I9W A;  1Z1S A;  1JKG B;  5IG0 A;  3DXO A;  1OH0 A;  2PZV A;  2OWP A;  1W6Y A;  3G0K A;  4ORL A;  1S5A A;  1O7G B;  3F14 A;  2HMN B;  3ER7 A;  1C7H A;  4X2O A;  3EF8 A;  2HML B;  1IDP A;  4LGQ A;  4X2H A;  5IG5 A;  1JB4 A;  2BNG A;  1ZX2 A;  1STD A;  4LMI A;  5AIH A;  1O7W B;  1GS3 A;  3Q90 A;  3F7X A;  3M8C A;  4OVM A;  5KP3 A;  1GY6 A;  4HJL B;  1OF5 A;  2XSO B;  3SOA A;  4HM2 B;  2XRX B;  2A15 A;  1O7P B;  3FZW A;  4XM4 A;  1UUV B;  3KE7 A;  5CF1 A;  3K7C A;  3GZY B;  5IG4 A;  1U5O A;  2GBW B;  2INX A;  3OWS A;  4L8O A;  1OPY A;  1DMN A;  4HKV B;  4R9L A;  5STD A;  1GY5 A;  4IIA A;  5IER A;  5CK6 A;  2UX0 A;  5IEO A;  5AIG A;  1SJW A;  4H3U A;  4K1U A;  2QGU A;  2RCD A;  3BLZ A;  3NUV A;  2GXF A;  3NM2 A;  2HMK B;  1ISK A;  3UJM A;  3T8N A;  5G2G A;  4FCM A;  1W02 A;  5IEN A;  4U13 A;  1CQS A;  3F40 A;  1OHP A;  2B24 B;  2W2C A;  3NV0 B;  3FF0 A;  5KP1 A;  1BUQ A;  4I4K A;  1ASK A;  3ROB A;  4XDV A;  2HMJ B;  4Q53 A;  3FLJ A;  3MG3 A;  5IEP A;  3RGR A;  1O7H B;  5AIF A;  2F86 B;  5HGR A;  2CHC A;  4N3V A;  3EN8 A;  4HZ9 B;  1QMA A;  4HM0 B;  3EQQ B;  1OHS A;  3BB9 A;  4OUQ A;  3VSY A;  1TUH A;  1Q40 A;  3GWR A;  3OWY A;  3JUO A;  1QJG A;  1NDO B;  2BMO B;  2HMO B;  1WQL B;  3FGY A;  2CKF B;  3KSP A;  3MHE A;  4RZM A;  5D82 A;  5AEU B;  4XBX A;  1OUN A;  3JUN A;  4R1K A;  3EC9 A;  3CNM A;  3H51 A;  1JN5 A;  3EJV A;  1UUW B;  3GRD A;  3EX9 A;  4J9A A;  2GEX A;  1OCV A;  3FF2 A;  3EBT A;  2BMR B;  3JUM A;  3EBY A;  3A76 A;  1E97 A;  5AII A;  5DRE A;  3GZX B;  3MYT A;  3FKA A;  3MSO A;  1W00 A;  4GB5 A;  3OWU A;  5TGN A;  3E99 A;  2Z77 A;  3G16 A;  1GYB A;  3HK4 A;  4STD A;  1EG9 B;  1OF5 B;  3DZL A;  3F9S A;  1TP6 A;  3CPO A;  2R4I A;  3DM8 A;  3HX8 A;  4XDW A;  4HM1 B;  3SED A;  4LEH A;  1AR0 A;  2JQ5 A;  2F98 A;  3GZB A;  4KVH A;  3KZT A;  2B1X B;  3JUP A;  2K54 A;  3B7C A;  5EVH A;  5FW5 A;  3MKI A;  3OX9 A;  3MG1 A;  3K0Z A;  1JB2 A;  4MJD A;  4HM7 B;  1JB5 A;  3G8Z A; 
#chains in the Genus database with same CATH topology
 3VGN A;  4H61 A;  3LTB A;  5BVB A;  1VQ7 3;  1UCJ A;  2F99 A;  4AEQ A;  1QAF A;  3Q3F A;  2XSH B;  2YFJ B;  3B4P A;  4EBG A;  2W56 A;  3X41 A;  1OGX A;  1Q9E A;  2GBX B;  2P0M A;  3BIR A;  3PGB A;  4FCJ A;  4HM5 B;  3STD A;  3BU4 A;  1LQG C;  1VZZ A;  1V74 A;  3AMO A;  3HIG A;  3X3Z A;  5IG3 A;  2R41 A;  3G6E 3;  1BIR A;  1ULI B;  1ULJ B;  1X1W A;  1US1 A;  3OXA A;  4L8P A;  1B2Z A;  3CU3 A;  1NB3 I;  3CCV 3;  1RCK A;  2W9P A;  1IV7 A;  1RN4 A;  2E2V A;  4JRF A;  1BNG A;  1ROA A;  1VQK 3;  1A90 A;  3BNE A;  2GEY A;  1VQP 3;  3SOY A;  3L0R A;  1D6U A;  4K61 A;  4OK0 A;  1JBT A;  2J8X B;  2OTL 3;  2Z7A A;  3URP A;  3I55 3;  3N54 B;  4HM4 B;  2F4Y A;  2YFI B;  1B20 A;  1HKX A;  5ELJ A;  1OGZ A;  4O8S A;  1B2M A;  1UI7 A;  1C54 A;  9RNT A;  4LYL B;  1I2E A;  1TRP A;  2Z76 A;  3S67 A;  2CFL A;  2ZL8 A;  3IJE B;  3FG1 A;  2L1S A;  1IQ8 A;  3NBJ A;  4HBR A;  1UCI A;  3GAX A;  1UGI A;  3D5G A;  2WOH A;  1FUT A;  4O3V A;  2ML5 A;  1F8N A;  5IF6 A;  4EC6 A;  2WO0 A;  3KN4 A;  2GU1 A;  2BT3 A;  1FA3 A;  3SYU A;  1M9G A;  3LML A;  1K9M 4;  2CK3 H;  2IYJ A;  6STD A;  3I56 3;  1A2K A;  2HMM B;  1RKY A;  4LSO A;  3N8B A;  1FW7 A;  3K5T A;  1M1K 4;  4WYK A;  2KXG A;  3K9M C;  5JPU A;  5M19 A;  2YFL B;  2W56 B;  1VQQ A;  2BO9 B;  3WMD A;  1RN7 A;  2MF7 A;  2RFR A;  4KZ1 A;  4KFF A;  3AMO B;  2KF5 A;  5AYR B;  4RBN A;  3B4O A;  2H0H A;  5CF2 A;  3EN1 B;  3LYG A;  3S28 A;  1NWW A;  3CNX A;  4XBT A;  4N6U A;  3SX1 A;  1RCL A;  1RGK A;  1M1X B;  2O9U X;  3D9R A;  4GSP A;  3J7Y d;  1IYY A;  3FH1 A;  1T2I A;  3LZA A;  1LNI A;  4HM3 B;  4N6T A;  3WOD G;  2XF3 A;  1TU5 A;  4RNZ A;  3NBR A;  4HYZ A;  3AGO A;  4J8T A;  3V98 A;  2C10 A;  3G71 3;  3CCM 3;  1JV2 B;  4BTX A;  2C11 A;  1Q40 B;  3IPT A;  4WWU C;  1SPU A;  3NM7 A;  3FSD A;  4XBY A;  4K1V A;  3DGM A;  1RJO A;  1UUG B;  4HM6 B;  4N6N B;  2CWV A;  1EQK A;  1RGA A;  3LTC A;  1FGT A;  2CW9 A;  4WP5 A;  1N5H A;  2MC8 A;  4L7K A;  2LYX A;  2KF6 A;  2KCD A;  1BGS A;  1STF I;  4RNY A;  1I0X A;  1GOV A;  3MG2 A;  2WGO A;  4FMA A;  3ZFZ A;  3I0Y A;  4HM8 B;  3T8U A;  1ROV A;  1AV4 A;  3DGL A;  1VQO 3;  2XGL A;  3HZP A;  4WYK B;  5AI1 A;  3UL5 A;  1CEW I;  3KFQ C;  3HI7 A;  1GY7 A;  3F8H A;  1WMP A;  2CC3 A;  3F8X A;  5KP4 A;  4FMD A;  4WFO A;  4HZB B;  3CME 3;  3UNL A;  2RGQ A;  3DGN A;  3NX0 A;  2CIU A;  1DMM A;  4BL3 A;  2Y73 A;  1O7N B;  1JN5 B;  4GL6 A;  4KFD A;  2H0G A;  1GMR A;  3D3L A;  5BXQ A;  1EA2 A;  2BMQ B;  5EEO A;  2XR8 B;  1JBR A;  3NV0 A;  1BSE A;  4LZI A;  4BTY A;  1EKM A;  3KKG A;  1ZS7 A;  1BSC A;  1VQM 3;  1YJ9 3;  1JJ2 2;  1Q42 A;  4NPB A;  3B8L A;  3WHO A;  1RSN A;  3DGY A;  4RNT A;  3WDG B;  5AEW B;  3NHX A;  1E3V A;  5D81 A;  3PYJ A;  2QA4 3;  3IMA B;  3QRD A;  1PYL A;  3FG3 A;  1BAN A;  1K41 A;  1JKG A;  1W4N A;  1X1Y A;  1SAR A;  3DUK A;  1Q82 4;  1VQ6 3;  2OTJ 3;  1WTH A;  2KF4 A;  4HVN A;  4KFE A;  3RNT A;  3WOE B;  3KSE D;  5JPP A;  2D42 A;  3FCS B;  5LC7 A;  3X3X A;  1N5P A;  2W04 A;  5RNT A;  4XB5 A;  7STD A;  4QWT A;  4CDL A;  3EHC A;  2QIY A;  2D1W A;  1CH0 A;  4NRE A;  3F7S A;  1L5G B;  1X1X A;  4AKY A;  2W9Q A;  2O3O A;  2M7O A;  1BRI A;  1FUS A;  3DMC A;  1Q81 4;  1W2Z A;  5DRV A;  1DMQ A;  1BAO A;  1YIJ 3;  1VQ5 3;  1MWS A;  1O7M B;  1OHO A;  3ZG0 A;  3JVC A;  4ILF A;  3LT8 A;  3RGA A;  1EUI C;  1BNE A;  4EXR A;  5CXO A;  1MNL A;  4R9K A;  1PFP A;  1V57 A;  2IMJ A;  5CLK A;  4PEJ A;  5D83 A;  1K73 4;  1OAC A;  2STD A;  3ECF A;  1W01 A;  1E3R A;  4MEI A;  3S5C A;  5I97 A;  2WGQ A;  2C4B A;  3GZR A;  1KQS 2;  1RGF A;  1NU3 A;  2W6J H;  2XFS A;  3JUQ A;  4CPK A;  1AY7 A;  1QAK A;  1I8V A;  4EYC A;  4J5G A;  1I70 A;  4EV5 A;  8CHO A;  3NXJ A;  1ZO2 A;  3OV4 A;  1FGO A;  1LVN A;  2K0M A;  1KC8 4;  2RSX A;  3H3H A;  2I9W A;  4GHO A;  1DE3 A;  1Z1S A;  1YGW A;  1AVL A;  1JKG B;  5IG0 A;  1BRG A;  1TRQ A;  3DXO A;  1OH0 A;  2K3D A;  5HOH A;  1D6Y A;  2PZV A;  4R4K A;  2OWP A;  1W6Y A;  3G0K A;  1TIJ A;  3WA3 A;  1T2H A;  1AVK A;  4ORL A;  1S5A A;  1O7G B;  2Q07 A;  3F14 A;  1IV9 A;  1Q86 4;  4BIR A;  2HMN B;  3ER7 A;  4HAA A;  1IQY A;  3CCR 3;  1C7H A;  2KAA A;  4X2O A;  2Z6B A;  1G0T A;  3EF8 A;  2HML B;  1R4C A;  1FGQ A;  2ZDJ A;  1IDP A;  1YVB I;  4LGQ A;  3K63 A;  4X2H A;  5IG5 A;  1PU4 A;  1LQM B;  2HOH A;  1JB4 A;  2BNG A;  4BL2 A;  3EB8 A;  1GD4 A;  3LXU X;  2GSP A;  1ZX2 A;  3A5E A;  1HZ1 A;  3FG4 A;  1PY3 A;  3PS8 A;  3CCJ 3;  1STD A;  4LMI A;  5AIH A;  1O7W B;  1GS3 A;  1YIT 3;  1NNV A;  4FR9 A;  3Q90 A;  3F7X A;  3M8C A;  2OQE C;  5GSP A;  1LOY A;  4OVM A;  1RDS A;  3Q2P A;  4MMZ B;  5KP3 A;  1GY6 A;  1TJD A;  7RNT A;  4HJL B;  2AAE A;  3SLU A;  1OF5 A;  4CJN A;  2XSO B;  1SQW A;  5A0O B;  1W6G A;  1Y4K A;  2W0Q A;  3SOA A;  4HM2 B;  2XRX B;  2A15 A;  1B2S A;  2WOF A;  1J2B A;  1FUW A;  1B27 A;  1W6C A;  1NB5 I;  1IVX A;  1RGG A;  1O7P B;  5ELU A;  6GSP A;  3FZW A;  4TX4 A;  4XM4 A;  1CYV A;  3Q1C A;  1UI8 A;  1VQL 3;  1UUV B;  3TDG A;  1N9J A;  1W5Z A;  1GD3 A;  2JDI H;  3KE7 A;  1N8Q A;  1RTU A;  5CF1 A;  1T3B A;  1RHL A;  3K7C A;  1BNF A;  3GZY B;  4G1M B;  1UGH I;  5IG4 A;  3BNB A;  1U5O A;  1BVI A;  3CPW 2;  2GBW B;  1I0V A;  2INX A;  3OWS A;  3PCR A;  3S29 A;  3G4S 3;  1X1U A;  1N8R 4;  3LH4 A;  3NQY A;  5G1K A;  1KWI A;  1IQX A;  1YGE A;  4FMB A;  3KCH A;  4JF8 A;  3S27 A;  1FGR A;  1V58 A;  2CWT A;  2E2T A;  4L8O A;  1IK3 A;  1B3S A;  3BND A;  1S72 3;  1OPY A;  1NO3 A;  1DMN A;  3LT9 A;  4HKV B;  2H0I A;  2IUK A;  3X40 A;  1W7C A;  1A67 A;  3AHS A;  1BRS A;  3AHW A;  4R9L A;  3CCS 3;  1BRJ A;  1MOL A;  5STD A;  2OOV C;  1RGL A;  1FYS A;  1GY5 A;  4IIA A;  1B2U A;  5IER A;  1HYF A;  2ZHX B;  1RN1 A;  1LOW A;  5CK6 A;  2UX0 A;  1I3I A;  3WR2 A;  2E2U A;  2BIR A;  1GOU A;  2RBI A;  4CCV A;  1HU9 A;  1TFK A;  5IEO A;  5AIG A;  1SJW A;  4H3U A;  5IW9 A;  1MWU A;  1Q7Y 4;  3BNC A;  1TFO A;  4K1U A;  2QGU A;  5AYS C;  4AKZ A;  1DVC A;  2RCD A;  3CCE 3;  2W03 A;  3BLZ A;  3NUV A;  2GXF A;  1LNH A;  2OCT A;  3NM2 A;  2HMK B;  1YI2 3;  1YHQ 3;  1ISK A;  1KSI A;  3UJM A;  1WNH A;  1ZGX A;  4N6V 0;  1KD1 4;  1VQ4 3;  3T8N A;  2QEX 3;  2FXT A;  3EE1 A;  5G2G A;  4FCM A;  2V1L A;  2IY2 A;  3MWZ A;  1W02 A;  4ZM8 A;  5IEN A;  1N9E A;  4U13 A;  3CXC 2;  3DY5 A;  3F40 A;  4FMC A;  1OHP A;  1BSD A;  2B24 B;  1BRK A;  1QAL A;  1BRH A;  2W2C A;  1RGC A;  1K28 A;  3NV0 B;  4R80 A;  1JBS A;  3FF0 A;  5KP1 A;  1BUQ A;  4NHF A;  1IVW A;  1BNI A;  1RRL A;  1YJW 3;  4I4K A;  4O02 B;  2ML6 A;  2OQE A;  1WMO A;  3LTA A;  4MMY B;  1ASK A;  1NJI 4;  3ROB A;  2XFT A;  1IVU A;  4HOH A;  1DET A;  3NQZ A;  1UDI I;  4XDV A;  2HMJ B;  3U97 A;  1RLS A;  2IA7 A;  4Q53 A;  3FLJ A;  2XGN A;  3MG3 A;  1SII A;  3WA2 X;  5IEP A;  5M18 A;  3RGR A;  2CH9 A;  2CG1 A;  3CD6 3;  1BUJ A;  3SVA A;  1U8C B;  1O7H B;  1RMS A;  5AIF A;  1IT7 A;  1YVS A;  3X42 A;  3CC7 3;  4BU4 A;  1K8A 4;  2F86 B;  5HGR A;  1WMN A;  6RNT A;  1BNJ A;  2CHC A;  1FZU A;  1SIH A;  4N3V A;  2CX1 A;  3EN8 A;  4HZ9 B;  1VQ8 3;  1QMA A;  1DVD A;  4HM0 B;  3EQQ B;  1CYU A;  1OHS A;  3BB9 A;  1YNV X;  3D79 A;  3N9H A;  1IT8 A;  1TUH A;  2AAD A;  4OUQ A;  3VSY A;  1UW1 A;  1Q40 A;  2FGT A;  5EQL A;  3GWR A;  3OWY A;  4IPB A;  1B2X A;  3ALA A;  3JUO A;  3HOH A;  3UB1 A;  1QVF 2;  3HII A;  1QJG A;  4N6L A;  2L4V A;  1NDO B;  2CFK A;  2SBL A;  3QK9 A;  2BMO B;  2HMO B;  1WQL B;  3FGY A;  2CKF B;  2XH9 A;  1JZO A;  3KSP A;  3CC4 3;  1RNT A;  3MHE A;  4K90 B;  4RZM A;  1BNS A;  5D82 A;  3T0U A;  5BIR A;  1VQN 3;  5BU4 A;  2XEP A;  3UL6 A;  5AEU B;  2CFG A;  2YX9 A;  5JBS A;  1YJN 3;  2UGI A;  4DKI A;  3PCS A;  4XBX A;  1BRN L;  1JNQ A;  5M1A A;  1OUN A;  3JUN A;  1IVV A;  4R1K A;  1M90 4;  2LQV A;  3EC9 A;  4N6O B;  3CNM A;  1EEJ A;  2KF3 A;  3LTD A;  1LRA A;  4KT3 B;  3H51 A;  1JN5 A;  3EJV A;  1UUW B;  2OOV A;  3GRD A;  3V92 A;  2UUG C;  4IT7 A;  3EX9 A;  4FCZ A;  4J9A A;  3ZG5 A;  1GMP A;  3DGO A;  4O2H A;  1MWR A;  2CX0 A;  4N6M A;  1TTO A;  2GU3 A;  2GEX A;  3CMA 3;  1I2G A;  1GSP A;  1LXE A;  1OCV A;  4J5K A;  3FF2 A;  3EBT A;  2BMR B;  3OW2 2;  3JUM A;  3MPH A;  3EBY A;  3PZW A;  3SXX A;  3KII A;  2PNC A;  2BU4 A;  1UCL A;  3A76 A;  1E97 A;  3D4A A;  5AII A;  5DRE A;  3GZX B;  3MYT A;  4MMX B;  3PXM A;  1VQ9 3;  3AGN A;  1A2V A;  3FKA A;  3MSO A;  1BU4 A;  1W00 A;  1D6Z A;  1I3F A;  4GB5 A;  3OWU A;  2P09 A;  5TGN A;  3E99 A;  4BTW A;  1UCK A;  2P38 A;  3VF1 A;  1I2F A;  2Z77 A;  3G16 A;  3V99 A;  1BNR A;  1GYB A;  1RRH A;  3LOY A;  3HK4 A;  4STD A;  5LC6 A;  3U1W A;  3CCU 3;  1R4Y A;  1EG9 B;  1OF5 B;  3DZL A;  2F56 A;  3F9S A;  3CCQ 3;  1DYU A;  2P05 A;  7GSP A;  1TP6 A;  3CPO A;  2CFW A;  3DH2 A;  1W2B 2;  2R4I A;  3O8Y A;  1G02 A;  1QVG 2;  2Y74 A;  3DM8 A;  3WOF B;  2CG0 A;  1BSB A;  3HX8 A;  3GSP A;  2CWU A;  1MWT A;  4XDW A;  4HM1 B;  1LOX A;  3SED A;  4LEH A;  2P0X A;  2RNT A;  1G96 A;  3NBB A;  1AR0 A;  1GOY A;  2JQ5 A;  2F98 A;  3GZB A;  4KVH A;  3KZT A;  1B21 A;  8RNT A;  2B1X B;  3CCL 3;  1T5Y A;  3JUP A;  4WHA A;  1FGM A;  1BSA A;  1RGE A;  1LOV A;  3RDE A;  2K54 A;  3CC2 3;  1BOX A;  3B7C A;  4EW5 A;  3D5I A;  5EVH A;  1AQZ A;  5FGO A;  2IUJ A;  3X3Y A;  1A2P A;  2ZA4 A;  1Q7H A;  5FW5 A;  5G1L A;  2F5W A;  3MKI A;  1GMQ A;  3OX9 A;  2KRT A;  1MGR A;  1RNB A;  2FNQ A;  4EV2 A;  1JZD A;  2BHM A;  2F5M A;  3MG1 A;  3K0Z A;  1MGW A;  1JRQ A;  4I5Q A;  1JB2 A;  2SAR A;  2CFD A;  3G8Z A;  4HM7 B;  4MJD A;  1RGH A;  1JB5 A;  1CQS A;  1IU7 A; 
#chains in the Genus database with same CATH homology
 3VGN A;  4H61 A;  3LTB A;  5BVB A;  1VQ7 3;  2F99 A;  4AEQ A;  1QAF A;  2XSH B;  2YFJ B;  3B4P A;  4EBG A;  2W56 A;  3X41 A;  1OGX A;  2GBX B;  2P0M A;  4FCJ A;  3CC4 3;  3PGB A;  4HM5 B;  3STD A;  1VZZ A;  1V74 A;  3AMO A;  3HIG A;  3X3Z A;  5IG3 A;  3G6E 3;  1ULI B;  1ULJ B;  3OXA A;  1US1 A;  4L8P A;  3CU3 A;  1NB3 I;  3CCV 3;  2W9P A;  1IV7 A;  2E2V A;  4JRF A;  1ROA A;  1VQK 3;  1A90 A;  3BNE A;  2GEY A;  1VQP 3;  3SOY A;  3L0R A;  1D6U A;  4K61 A;  4OK0 A;  2OTL 3;  2Z7A A;  3I55 3;  3N54 B;  4HM4 B;  2YFI B;  1HKX A;  5ELJ A;  1OGZ A;  4O8S A;  1UI7 A;  2Z76 A;  3S67 A;  2CFL A;  2ZL8 A;  3IJE B;  3FG1 A;  1IQ8 A;  3NBJ A;  4HBR A;  3GAX A;  2WOH A;  4O3V A;  2ML5 A;  1F8N A;  5IF6 A;  4EC6 A;  2WO0 A;  3KN4 A;  2GU1 A;  2BT3 A;  1FA3 A;  1M9G A;  3LML A;  1K9M 4;  2CK3 H;  6STD A;  3I56 3;  1A2K A;  2HMM B;  1RKY A;  4LSO A;  3N8B A;  3K5T A;  1M1K 4;  4WYK A;  2KXG A;  3K9M C;  5JPU A;  2YFL B;  2W56 B;  2BO9 B;  3WMD A;  1RN7 A;  2MF7 A;  2RFR A;  4KZ1 A;  4KFF A;  3AMO B;  5AYR B;  4RBN A;  3B4O A;  5CF2 A;  3EN1 B;  3LYG A;  3S28 A;  1NWW A;  3CNX A;  4XBT A;  4N6U A;  3SX1 A;  3J7Y d;  1M1X B;  2O9U X;  3D9R A;  3FH1 A;  3LZA A;  4N6T A;  4HM3 B;  3WOD G;  1TU5 A;  2XF3 A;  4RNZ A;  3NBR A;  4HYZ A;  4J8T A;  3V98 A;  2C10 A;  3G71 3;  3CCM 3;  1JV2 B;  4BTX A;  2C11 A;  1Q40 B;  3IPT A;  4WWU C;  1SPU A;  3NM7 A;  3FSD A;  4XBY A;  4K1V A;  3DGM A;  1RJO A;  4HM6 B;  4N6N B;  2CWV A;  1EQK A;  3LTC A;  1FGT A;  2CW9 A;  4WP5 A;  1N5H A;  2MC8 A;  4L7K A;  2LYX A;  2KCD A;  4RNY A;  1STF I;  3MG2 A;  2WGO A;  4FMA A;  3I0Y A;  4HM8 B;  3T8U A;  1ROV A;  1AV4 A;  3DGL A;  1VQO 3;  2XGL A;  3HZP A;  4WYK B;  5AI1 A;  3UL5 A;  1CEW I;  3KFQ C;  3HI7 A;  1GY7 A;  3F8H A;  1WMP A;  2CC3 A;  3F8X A;  5KP4 A;  4FMD A;  4WFO A;  4HZB B;  3CME 3;  3UNL A;  2RGQ A;  3DGN A;  3NX0 A;  2CIU A;  1DMM A;  2Y73 A;  1O7N B;  1JN5 B;  4GL6 A;  4KFD A;  3D3L A;  5BXQ A;  1EA2 A;  2BMQ B;  5EEO A;  2XR8 B;  3NV0 A;  4LZI A;  4BTY A;  1EKM A;  3KKG A;  1VQM 3;  1JJ2 2;  1Q42 A;  3B8L A;  3WDG B;  5AEW B;  3NHX A;  1E3V A;  5D81 A;  3PYJ A;  2QA4 3;  3IMA B;  3QRD A;  3FG3 A;  1JKG A;  1K41 A;  1W4N A;  3DUK A;  1Q82 4;  1VQ6 3;  2OTJ 3;  1WTH A;  4HVN A;  4KFE A;  3WOE B;  5JPP A;  3KSE D;  2D42 A;  3FCS B;  5LC7 A;  3X3X A;  1N5P A;  2W04 A;  4XB5 A;  7STD A;  4QWT A;  4CDL A;  3EHC A;  2QIY A;  2D1W A;  4NRE A;  1L5G B;  3F7S A;  4AKY A;  2W9Q A;  2O3O A;  2M7O A;  3DMC A;  1Q81 4;  1W2Z A;  5DRV A;  1DMQ A;  1YIJ 3;  1VQ5 3;  1O7M B;  1OHO A;  3JVC A;  3LT8 A;  3RGA A;  4EXR A;  5CXO A;  1MNL A;  4R9K A;  1PFP A;  2IMJ A;  5CLK A;  4PEJ A;  5D83 A;  1K73 4;  1OAC A;  2STD A;  3ECF A;  1W01 A;  1E3R A;  4MEI A;  3S5C A;  5I97 A;  2WGQ A;  3GZR A;  1KQS 2;  1NU3 A;  2W6J H;  2XFS A;  3JUQ A;  1QAK A;  4EYC A;  4EV5 A;  8CHO A;  3NXJ A;  1ZO2 A;  3OV4 A;  1FGO A;  1LVN A;  2K0M A;  1KC8 4;  2RSX A;  3H3H A;  2I9W A;  1Z1S A;  1AVL A;  1JKG B;  5IG0 A;  3DXO A;  1OH0 A;  1D6Y A;  2PZV A;  4R4K A;  2OWP A;  1W6Y A;  3G0K A;  1TIJ A;  3WA3 A;  1AVK A;  4ORL A;  1S5A A;  1O7G B;  2Q07 A;  3F14 A;  1IV9 A;  1Q86 4;  2HMN B;  3ER7 A;  1IQY A;  3CCR 3;  1C7H A;  4X2O A;  2Z6B A;  3EF8 A;  2HML B;  1R4C A;  1FGQ A;  2ZDJ A;  1IDP A;  1YVB I;  4LGQ A;  3K63 A;  4X2H A;  5IG5 A;  1PU4 A;  1JB4 A;  2BNG A;  3EB8 A;  1GD4 A;  3LXU X;  1ZX2 A;  3FG4 A;  3PS8 A;  3CCJ 3;  1STD A;  4LMI A;  5AIH A;  1O7W B;  1GS3 A;  1YIT 3;  4FR9 A;  3Q90 A;  3F7X A;  3M8C A;  2OQE C;  4OVM A;  3Q2P A;  4MMZ B;  5KP3 A;  1GY6 A;  4HJL B;  3SLU A;  1OF5 A;  2XSO B;  1SQW A;  5A0O B;  1W6G A;  1Y4K A;  2W0Q A;  3SOA A;  4HM2 B;  2XRX B;  2A15 A;  2WOF A;  1J2B A;  1FUW A;  1W6C A;  1NB5 I;  1IVX A;  5ELU A;  1O7P B;  3FZW A;  4TX4 A;  4XM4 A;  1CYV A;  3Q1C A;  1UI8 A;  1VQL 3;  1UUV B;  3TDG A;  1N9J A;  1W5Z A;  1GD3 A;  2JDI H;  3KE7 A;  1N8Q A;  5CF1 A;  3K7C A;  3GZY B;  4G1M B;  5IG4 A;  3BNB A;  1U5O A;  3CPW 2;  2GBW B;  2INX A;  3PCR A;  3OWS A;  3S29 A;  3G4S 3;  1N8R 4;  3LH4 A;  3NQY A;  1KWI A;  1IQX A;  1YGE A;  4FMB A;  4JF8 A;  3S27 A;  1IK3 A;  1FGR A;  2CWT A;  2E2T A;  4L8O A;  1S72 3;  3BND A;  1OPY A;  1NO3 A;  1DMN A;  3LT9 A;  4HKV B;  2IUK A;  3X40 A;  1W7C A;  1A67 A;  4R9L A;  3CCS 3;  1MOL A;  5STD A;  2OOV C;  1GY5 A;  4IIA A;  5IER A;  5CK6 A;  2UX0 A;  2E2U A;  4CCV A;  1HU9 A;  1TFK A;  5IEO A;  5AIG A;  1SJW A;  4H3U A;  5IW9 A;  1Q7Y 4;  3BNC A;  1TFO A;  4K1U A;  2QGU A;  5AYS C;  4AKZ A;  1DVC A;  2RCD A;  3CCE 3;  2W03 A;  3BLZ A;  3NUV A;  2GXF A;  1LNH A;  2OCT A;  3NM2 A;  2HMK B;  1YI2 3;  1YHQ 3;  1ISK A;  1KSI A;  3UJM A;  1WNH A;  4N6V 0;  1KD1 4;  1VQ4 3;  3T8N A;  2QEX 3;  2FXT A;  3EE1 A;  5G2G A;  4FCM A;  2V1L A;  3MWZ A;  1W02 A;  4ZM8 A;  5IEN A;  1N9E A;  4U13 A;  3CXC 2;  3DY5 A;  3F40 A;  4FMC A;  1OHP A;  2B24 B;  1QAL A;  2W2C A;  4R80 A;  1K28 A;  3NV0 B;  3FF0 A;  5KP1 A;  1BUQ A;  4NHF A;  1IVW A;  1RRL A;  1YJW 3;  4I4K A;  4O02 B;  2ML6 A;  2OQE A;  1WMO A;  3LTA A;  4MMY B;  1ASK A;  1NJI 4;  3ROB A;  2XFT A;  1IVU A;  3NQZ A;  4XDV A;  2HMJ B;  3U97 A;  2IA7 A;  4Q53 A;  3FLJ A;  2XGN A;  3MG3 A;  1SII A;  3WA2 X;  5IEP A;  3RGR A;  2CH9 A;  2CG1 A;  3CD6 3;  3SVA A;  1U8C B;  1O7H B;  5AIF A;  1IT7 A;  3X42 A;  3CC7 3;  1K8A 4;  2F86 B;  5HGR A;  1WMN A;  2CHC A;  1SIH A;  4N3V A;  1VQ8 3;  3EN8 A;  4HZ9 B;  1QMA A;  1DVD A;  4HM0 B;  3EQQ B;  1CYU A;  1OHS A;  3BB9 A;  4OUQ A;  3N9H A;  3VSY A;  1IT8 A;  1TUH A;  1UW1 A;  1Q40 A;  2FGT A;  5EQL A;  3GWR A;  3OWY A;  4IPB A;  3JUO A;  3ALA A;  3UB1 A;  1QVF 2;  3HII A;  1QJG A;  4N6L A;  2L4V A;  1NDO B;  2CFK A;  2SBL A;  3QK9 A;  2BMO B;  2HMO B;  1WQL B;  3FGY A;  2CKF B;  2XH9 A;  3KSP A;  3MHE A;  4K90 B;  4RZM A;  5D82 A;  1VQN 3;  3T0U A;  2XEP A;  3UL6 A;  5AEU B;  2CFG A;  2YX9 A;  5JBS A;  1YJN 3;  3PCS A;  4XBX A;  1JNQ A;  1OUN A;  3JUN A;  1IVV A;  4R1K A;  1M90 4;  2LQV A;  3EC9 A;  4N6O B;  3CNM A;  3LTD A;  2OOV A;  1YJ9 3;  3H51 A;  1JN5 A;  3EJV A;  1UUW B;  3V92 A;  3GRD A;  4IT7 A;  3EX9 A;  4FCZ A;  4J9A A;  3DGO A;  4O2H A;  4N6M A;  2GU3 A;  2GEX A;  3CMA 3;  1OCV A;  1LXE A;  3FF2 A;  3EBT A;  2BMR B;  3OW2 2;  3JUM A;  3MPH A;  3EBY A;  3PZW A;  3SXX A;  3KII A;  2PNC A;  3A76 A;  1E97 A;  5AII A;  5DRE A;  3GZX B;  3MYT A;  4MMX B;  3PXM A;  1VQ9 3;  1A2V A;  3FKA A;  3MSO A;  1W00 A;  1D6Z A;  4GB5 A;  3OWU A;  2P09 A;  5TGN A;  3E99 A;  4BTW A;  3VF1 A;  2P38 A;  2Z77 A;  3G16 A;  3V99 A;  1GYB A;  1RRH A;  3LOY A;  3HK4 A;  4STD A;  5LC6 A;  3U1W A;  3CCU 3;  1EG9 B;  1OF5 B;  3DZL A;  3F9S A;  3CCQ 3;  1DYU A;  2P05 A;  1TP6 A;  3CPO A;  2CFW A;  1W2B 2;  2R4I A;  3O8Y A;  1QVG 2;  2Y74 A;  3DM8 A;  3WOF B;  2CG0 A;  3HX8 A;  2CWU A;  4XDW A;  4HM1 B;  1LOX A;  3SED A;  4LEH A;  2P0X A;  1G96 A;  3NBB A;  1AR0 A;  2JQ5 A;  2F98 A;  3GZB A;  4KVH A;  3KZT A;  2B1X B;  3CCL 3;  1T5Y A;  3JUP A;  4WHA A;  1FGM A;  3RDE A;  3CC2 3;  2K54 A;  3B7C A;  5EVH A;  5FGO A;  2IUJ A;  3X3Y A;  5FW5 A;  3MKI A;  3OX9 A;  2KRT A;  2FNQ A;  4EV2 A;  2BHM A;  3MG1 A;  3K0Z A;  1JRQ A;  1JB2 A;  4MJD A;  2CFD A;  3G8Z A;  4HM7 B;  1JB5 A;  1CQS A;  1IU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...