4J8TA

Engineered digoxigenin binder dig10.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
MNAKEIVVHALRLLENGDARGWCDLFHPEGVLEYPYPPPGYKTRFEGRETIWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVHTVSGGKLAADYISVLRTRDGQILLYRLFFNPLRVLEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of ligand-binding proteins with high affinity and selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Digoxigenin binding protein
molecule keywords Engineered Digoxigenin binder protein DIG10.2
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4j8tA00
4K1UA 3A76A 5DRVA 3CU3A 1NWWA 4I4KA 5FW5A 1O7HB 3NM2A 4J9AA 2BMRB 2HMJB 2Z76A 1IDPA 2K54A 1NU3A 3MG3A 4L8PA 3H51A 1K41A 2B1XB 5CF1A 3G16A 5D83A 4K1VA 1OUNA 1W00A 4HM5B 4XB5A 1S5AA 5TGNA 2RCDA 3CNXA 1UUWB 2GBXB 4LEHA 3ECFA 3F9SA 1SJWA 2GEXA 3NHXA 3JUPA 3FKAA 3GZRA 3LYGA 3MHEA 2F99A 3NXJA 5D82A 6STDA 3STDA 1EA2A 1E3VA 4H3UA 2RFRA 4XBXA 1Q40B 4X2OA 3FGYA 4GB5A 3EN8A 3F8XA 3GWRA 1W6YA 3OV4A 3EJVA 3F8HA 3KKGA 3FZWA 3WMDA 4Q53A 1NDOB 3NV0B 1JN5B 3DZLA 3HK4A 2GEYA 3MYTA 5AEUB 1ISKA 3FF2A 2YFJB 5IEPA 2I9WA 3DXOA 4R9KA 1OGZA 3EHCA 3MG2A 1UUVB 2UX0A 3MSOA 1DMNA 4R9LA 1OGXA 4HM7B 1JB2A 4IIAA 4L8OA 4U13A 4KVHA 4WWUC 5KP4A 1GYBA 3B8LA 5IENA 3FLJA 3I0YA 1OHPA 4HKVB 3JUNA 1ULIB 3OWYA 3KE7A 3EF8A 4X2HA 3DMCA 2QGUA 3M8CA 5AIIA 4HM6B 4N3VA 1OCVA 3IPTA 5IG3A 3B7CA 3H3HA 5IG5A 1OF5A 5JPUA 2XSHB 3G8ZA 1ASKA 3MKIA 4LGQA 2XSOB 4HM0B 4L7KA 5DREA 1GS3A 1GY5A 2R4IA 3F14A 3DUKA 3E99A 3Q90A 2RGQA 1WQLB 4J8TA 3RGAA 3FF0A 2CHCA 2HMOB 4HM4B 1JKGA 5AIHA 5BXQA 5IEOA 3EBYA 5IF6A 5HGRA 1BUQA 3KZTA 4STDA 1DMQA 1TP6A 1Q40A 3LZAA 4WYKA 2F98A 3G0KA 3GRDA 3ROBA 3SOYA 3HZPA 5IERA 2XRXB 5BVBA 4HZ9B 2QIYA 3K0ZA 3OWUA 1DMMA 4ORLA 3B4OA 4HVNA 3RGRA 2XR8B 3D9RA 3S5CA 4CDLA 1O7GB 3CNMA 1OF5B 3GZXB 1OH0A 3EQQB 2HMMB 3EN1B 2B24B 5KP1A 5AI1A 1JN5A 2GBWB 1O7PB 3EC9A 2BMOB 4HM1B 3F7SA 1GY7A 1QMAA 1HKXA 2STDA 3T8UA 3OWSA 3NUVA 4XDWA 3SOAA 1JKGB 3FSDA 5JPPA 1JB5A 4LMIA 1JB4A 1OHSA 4XBTA 1CQSA 2HMNB 2OWPA 3B4PA 1E3RA 1E97A 1TUHA 2F86B 3JUMA 2BNGA 3NBRA 5KP3A 4MJDA 5CLKA 3SEDA 2CKFB 3JUQA 2Z77A 2Z7AA 5AIFA 3UJMA 2W2CA 3UNLA 1O7WB 5IG4A 4FCMA 5CXOA 5CF2A 1VZZA 3VSYA 3KSPA 1AR0A 3GZBA 4OVMA 4PEJA 2BMQB 4R1KA 1EG9B 3CPOA 4HZBB 1OPYA 3HX8A 3BB9A 3F7XA 3OX9A 2HMLB 2A15A 3GZYB 4HM3B 4HM8B 4OUQA 3T8NA 7STDA 3K7CA 3EX9A 1QJGA 4HM2B 5EVHA 4HJLB 1ULJB 4XDVA 3DM8A 4XBYA 5AIGA 8CHOA 5STDA 1GY6A 4WYKB 1C7HA 1STDA 1OHOA 1Z1SA 1O7NB 4XM4A 5G2GA 2YFIB 1A2KA 2JQ5A 2GXFA 2PZVA 1ZO2A 2YFLB 1O7MB 2INXA 3FH1A 3NV0A 3F40A 3ER7A 1Q42A 1U5OA 4WP5A 5D81A 5AEWB 3VGNA 3EBTA 1W01A 4FCJA 5IG0A 1ZX2A 1W02A 4RZMA 5CK6A 2HMKB 3BLZA 2IMJA 3OXAA 3MG1A 3JUOA
chains in the Genus database with same CATH superfamily
3A76A 3CU3A 1B2XA 5FW5A 2BMRB 2CFLA 3CCL3 1A2PA 1BNGA 1IDPA 1VQ83 1R4YA 1TTOA 1K41A 1LNIA 4H61A 3U1WA 1BIRA 5EQLA 4K1VA 1AVKA 4XB5A 3FG3A 5M1AA 3NM7A 1MWUA 3EE1A 4CJNA 1UUWB 2GBXB 3ECFA 2GEXA 3IJEB 1IQ8A 3BNCA 3FKAA 1UGIA 3NXJA 2F99A 3LH4A 4GSPA 1BSEA 1MGRA 2XH9A 4H3UA 3WA3A 3G4S3 4X2OA 4BTWA 1YIT3 2XEPA 1A2VA 3GWRA 2BO9B 1W6YA 3Q2PA 3TDGA 1N5HA 1LQGC 3SX1A 1BANA 3DH2A 3AMOA 3RNTA 1C54A 4RNZA 1IU7A 4FMDA 1VQP3 3WA2X 1I3IA 3FF2A 2O3OA 1JNQA 3EHCA 1BAOA 2GU3A 3MSOA 3URPA 4BTYA 7RNTA 1JB2A 1DETA 4J5KA 4U13A 1V57A 1GYBA 5IENA 2LQVA 1I0VA 2W6JH 3OWYA 4GL6A 4X2HA 1RHLA 5AIIA 1OCVA 2BIRA 3G8ZA 3SLUA 4L7KA 1AV4A 5DREA 1LOXA 2R4IA 3F14A 4FMBA 2FNQA 1IQXA 2SARA 1TFKA 2RGQA 4KFEA 4LSOA 1LOVA 1JKGA 4O8SA 5G1KA 3X3XA 3CCU3 5HGRA 1ROAA 2W56A 3PCSA 1TP6A 3T0UA 3I563 3HZPA 4AKYA 1FZUA 3PXMA 3S5CA 3RGRA 1RRHA 4CDLA 1LRAA 1OH0A 2WO0A 4OK0A 3EN1B 3CC73 2B24B 3BIRA 2CFGA 5M18A 1JN5A 1YJN3 1YVBI 2BMOB 2CWUA 2F4YA 1GY7A 1HKXA 3AGNA 3V99A 3OWSA 1RGAA 1WNHA 2PNCA 3LT8A 1Q7HA 1YNVX 4EYCA 3S67A 1RN7A 3PGBA 1E3RA 1BRSA 1N5PA 3JUMA 2BNGA 1AVLA 1IVWA 4FMAA 1YIJ3 1RGLA 2W2CA 2WGQA 1V74A 4TX4A 5IG4A 2XFTA 4HAAA 1EUIC 1BGSA 2IY2A 2P09A 4LYLB 3CCJ3 3KFQC 1RGGA 1GOYA 3HX8A 3F7XA 3OX9A 4HZ9B 4KT3B 2A15A 3GZYB 1BRJA 7STDA 2QEX3 1WMNA 2CK3H 1GOVA 3K7CA 4HM2B 3WR2A 4XBYA 1PFPA 1MGWA 1BRIA 3LMLA 5STDA 1W2ZA 3MPHA 1SIHA 1RLSA 1Z1SA 1PY3A 4XM4A 3HI7A 1B20A 1BOXA 2PZVA 1ZO2A 2W04A 3NV0A 4WP5A 1GD4A 5BIRA 1G0TA 3V98A 2CG1A 2HOHA 3CCS3 3VGNA 1WTHA 3EBTA 2CW9A 4RZMA 4NPBA 3BLZA 2IMJA 5M19A 4FCZA 1JBRA 5DRVA 1SIIA 1KC84 3DGLA 4I4KA 1LOYA 3NM2A 1QVF2 1OACA 5ELUA 2RSXA 1GOUA 4L8PA 1S723 1BSCA 3G16A 3CME3 3CCR3 4LEHA 3SXXA 1US1A 4I5QA 1GMPA 3GSPA 1Q9EA 1ROVA 4JRFA 1NNVA 3JUPA 1K734 3GZRA 3LYGA 1RNBA 1TJDA 2IYJA 3QRDA 4XBXA 3ALAA 1B2ZA 3MWZA 2P05A 4EC6A 4EV2A 2IA7A 3X3YA 3OV4A 1YJ93 1UDII 3F8HA 3NBJA 4IT7A 4MMYB 1J2BA 3S28A 1N9EA 4Q53A 1CYVA 1M1K4 1NDOB 2R41A 4MMXB 3DXOA 4R9KA 2UX0A 4J5GA 4R9LA 2ML5A 5KP4A 1MWRA 1JJ22 4IPBA 3FLJA 1EKMA 3I0YA 6RNTA 1IVVA 3EF8A 1YI23 4N6MA 1K28A 1T2IA 3M8CA 1DVDA 3IPTA 1RDSA 1RCLA 3B7CA 1OF5A 3D5GA 1JRQA 3H3HA 4LZIA 4LGQA 1B21A 1RNTA 1W6GA 2J8XB 3FG4A 3KN4A 2OOVA 4AKZA 3CCM3 3DUKA 3E99A 3DGOA 4J8TA 4DKIA 1UCJA 5ELJA 2ZL8A 3FF0A 1VQK3 4HM4B 2OQEA 4NHFA 3K9MC 3EBYA 1B27A 1G96A 1W6CA 2F56A 2IUKA 3KZTA 3LZAA 4WYKA 3ROBA 5IERA 1KSIA 2F98A 5RNTA 4MMZB 4NREA 1JZDA 1W5ZA 1TFOA 1DMMA 1VQ63 2XR8B 4GHOA 2OTL3 3WHOA 3CNMA 3LT9A 1QAKA 1M904 3D5IA 3EQQB 4K61A 5AI1A 2GBWB 1UCKA 1O7PB 1Q824 1MNLA 1BVIA 1HYFA 4XDWA 3PZWA 1JKGB 3FSDA 3NBBA 4EBGA 5JBSA 1UCLA 3KIIA 1VQL3 4G1MB 1JB4A 2Y74A 1RRLA 1CQSA 2HMNB 4N6UA 2CH9A 2RBIA 1N8R4 1SPUA 1T3BA 2F86B 4MJDA 4O3VA 1RGCA 3BNBA 2CKFB 1YGEA 2Z77A 3CMA3 4K90B 1BSDA 1YVSA 1WMOA 3GZBA 3CCE3 1B2MA 5HOHA 3CPOA 1K8A4 2E2UA 2L4VA 1OPYA 2OQEC 4HZBB 5CK6A 4HM3B 1V58A 2HMLB 3K5TA 3HOHA 4N6LA 1AQZA 3ZG0A 1RMSA 1VQQA 1EEJA 2K3DA 1ZS7A 1QJGA 1ULJB 1VQN3 5AIGA 1QALA 2H0HA 1GY6A 4KFFA 1C7HA 1W4NA 1SARA 1OHOA 2CX1A 1Y4KA 1MWSA 1NJI4 3NQYA 1FYSA 2GXFA 2YFLB 3Q3FA 1O7MB 1IV9A 3G6E3 2YX9A 3ER7A 5D81A 1IVXA 1IT7A 4FCJA 1LNHA 5IG0A 1KQS2 4CPKA 1BUJA 1LOWA 3OXAA 4N6TA 1GMQA 1BSBA 2Z6BA 7GSPA 1JBTA 6GSPA 1JBSA 2LYXA 1NWWA 2MC8A 4AEQA 4WHAA 4RBNA 3WDGB 1X1WA 1O7HB 3KSED 1N9JA 2H0IA 2K54A 1X1XA 3MG3A 5G1LA 1I70A 1RJOA 2B1XB 3LTAA 5D83A 1BRKA 1OUNA 2M7OA 2W03A 3IMAB 4HM5B 9RNTA 3WOEB 1S5AA 3L0RA 1UI8A 2C10A 2FGTA 2RCDA 2XFSA 3F9SA 2ML6A 4R80A 1B3SA 1UGHI 1RN1A 3NHXA 6STDA 2P38A 3UB1A 3STDA 3S29A 4QWTA 1G02A 2RFRA 2IUJA 3UL5A 1Q40B 3GAXA 3FGYA 4GB5A 4EXRA 1I2FA 1BNFA 1FGQA 3EJVA 1NB3I 1RGEA 2CIUA 1NB5I 3KKGA 1IYYA 3FZWA 1BRNL 5BU4A 1MOLA 3NV0B 1IV7A 3DZLA 3HK4A 5IW9A 2V1LA 5IEPA 2I9WA 1YJW3 1OGZA 1M1XB 1TRQA 1UUVB 2L1SA 4HM7B 4WWUC 4KVHA 1BRHA 1GD3A 3FG1A 1OHPA 2KF6A 4HKVB 1ULIB 3KE7A 1TU5A 3DMCA 4HYZA 3K63A 4HM6B 5JPUA 3LTDA 2D1WA 1LVNA 2XSHB 2CX0A 1QAFA 3MKIA 1PU4A 3CC43 2XSOB 4HM0B 1GY5A 8RNTA 1BNIA 1FGTA 3Q1CA 2RNTA 1CH0A 3A5EA 2HMOB 3BNEA 3LXUX 5AIHA 3U97A 5BXQA 5IF6A 4STDA 1DMQA 3SOYA 3GRDA 3G0KA 3G713 3WOFB 2XRXB 2QIYA 3K0ZA 3OWUA 1HU9A 1MWTA 3DGNA 3QK9A 4HVNA 1FGRA 1BSAA 2XGLA 3N9HA 1HZ1A 2GU1A 4HM1B 1RGKA 1JV2B 1TRPA 3NUVA 3SOAA 3X42A 1JB5A 4LMIA 1FGMA 1F8NA 1OHSA 3CCQ3 1LXEA 2CFKA 3FCSB 1N8QA 1TUHA 1AY7A 3CD63 2FXTA 1PYLA 3JUQA 4RNYA 2Z7AA 3D4AA 5CXOA 2P0XA 2KXGA 5CF2A 1VZZA 3NX0A 3VSYA 1AR0A 5AYRB 1RN4A 3S27A 3V92A 1U8CB 3KCHA 1EG9B 4BTXA 1I2EA 3PS8A 1Q814 1R4CA 5EVHA 1A90A 4XDVA 3HIIA 8CHOA 1YHQ3 1JZOA 4BL3A 4ZM8A 1FUWA 1STDA 2WOHA 1O7NB 2CC3A 3D79A 4HBRA 5G2GA 4BIRA 2YFIB 5I97A 5AYSC 2JQ5A 5LC7A 3F40A 1Q42A 1U5OA 1W7CA 3BU4A 3VF1A 1FA3A 1I3FA 2KCDA 3AHSA 2XGNA 1W02A 4BU4A 2OOVC 1D6YA 3D3LA 1IK3A 1TIJA 3MG1A 1K9M4 3JUOA 4K1UA 1L5GB 4JF8A 1BNEA 1RTUA 1X1YA 2W9QA 4N6OB 4J9AA 2HMJB 1NO3A 2Z76A 3DY5A 3X41A 2ZHXB 1NU3A 2F5WA 1W2B2 3H51A 5EEOA 5CF1A 1W00A 1RGHA 1EQKA 3UL6A 1CEWI 3DGYA 2H0GA 2MF7A 5FGOA 5TGNA 3CNXA 3CCV3 1I0XA 2QA43 2BT3A 1SJWA 1UI7A 2P0MA 3PYJA 1KWIA 3MHEA 4FR9A 1A67A 2W0QA 2ZDJA 1EA2A 1E3VA 2W56B 2F5MA 3EN8A 1DVCA 3F8XA 1UUGB 3AGOA 3DGMA 4O02B 1IVUA 3JVCA 3LOYA 3CC23 1DYUA 1CYUA 2UUGC 3WMDA 1UCIA 2BU4A 1JN5B 3HIGA 1FW7A 2GEYA 3MYTA 4EW5A 1RSNA 5AEUB 1ISKA 1FGOA 2YFJB 3LTCA 4FMCA 3SVAA 3MG2A 4CCVA 3X40A 3ZFZA 1DMNA 1OGXA 4KZ1A 4IIAA 2KAAA 4L8OA 1VQ73 1VQM3 3CXC2 1SQWA 3B8LA 3WODG 1IT8A 1IQYA 1FUSA 4ILFA 1VQ53 1VQ43 3JUNA 1RCKA 3I553 1I2GA 2QGUA 2E2VA 1Q7Y4 1Q864 4N3VA 5IG3A 5IG5A 2XF3A 1ASKA 3EB8A 1GS3A 1I8VA 2AADA 2KF4A 1WMPA 4MEIA 2CG0A 3Q90A 1WQLB 3RGAA 1T2HA 2CHCA 2CWTA 1BNSA 4HOHA 1RGFA 1VQO3 5IEOA 2Y73A 3CPW2 1BUQA 1BRGA 2GSPA 1D6UA 1Q40A 3LTBA 1BNJA 2BHMA 5BVBA 3O8YA 2OCTA 2CFWA 2KRTA 2WOFA 3B4OA 4ORLA 3AHWA 2WGOA 3D9RA 1O7GB 1OF5B 3GZXB 1GMRA 1DE3A 2HMMB 2W9PA 3AMOB 4R4KA 1QVG2 4N6V0 2K0MA 3EC9A 2KF5A 3N54B 4RNTA 5LC6A 3F7SA 1QMAA 1RKYA 2STDA 3T8UA 3RDEA 5JPPA 3PCRA 5GSPA 4BL2A 1FUTA 1GSPA 1M9GA 4XBTA 1D6ZA 1B2UA 2OWPA 3B4PA 1VQ93 1E97A 3NBRA 2D42A 5KP3A 3X3ZA 2ZA4A 5CLKA 3SEDA 2C4BA 5AIFA 3UJMA 3UNLA 3ZG5A 2JDIH 1O7WB 4FCMA 2KF3A 2O9UX 1UW1A 3BNDA 3KSPA 1BU4A 4O2HA 4OVMA 4PEJA 2AAEA 1ZGXA 2BMQB 4R1KA 5A0OB 1STFI 4WFOA 3BB9A 3NQZA 5D82A 4HM8B 3SYUA 4OUQA 3T8NA 1KD14 3EX9A 1B2SA 4HJLB 2OTJ3 3DM8A 4KFDA 4WYKB 1T5YA 2CFDA 3OW22 3J7Yd 1A2KA 4N6NB 3FH1A 2INXA 1YGWA 2Q07A 2UGIA 2SBLA 5AEWB 2CWVA 1BNRA 1X1UA 2C11A 1W01A 1LQMB 1ZX2A 4EV5A 2HMKB 5KP1A 3N8BA 2E2TA
chains in the Genus database with same CATH topology
3A76A 3CU3A 5FW5A 2BMRB 2CFLA 3CCL3 1VQ83 1IDPA 1K41A 4H61A 3U1WA 5EQLA 4K1VA 1AVKA 4XB5A 3FG3A 3NM7A 3EE1A 1UUWB 2GBXB 3ECFA 2GEXA 3IJEB 1IQ8A 3BNCA 3FKAA 3NXJA 2F99A 3LH4A 2XH9A 4H3UA 3WA3A 3G4S3 4X2OA 4BTWA 1YIT3 2XEPA 1A2VA 3GWRA 2BO9B 1W6YA 3Q2PA 3TDGA 1N5HA 3SX1A 3AMOA 4RNZA 1IU7A 4FMDA 1VQP3 3WA2X 3FF2A 2O3OA 1JNQA 3EHCA 2GU3A 3MSOA 4BTYA 1JB2A 4U13A 1GYBA 5IENA 2LQVA 2W6JH 3OWYA 4GL6A 4X2HA 5AIIA 1OCVA 3G8ZA 3SLUA 4L7KA 1AV4A 5DREA 1LOXA 2R4IA 3F14A 4FMBA 2FNQA 1IQXA 1TFKA 2RGQA 4KFEA 4LSOA 1JKGA 4O8SA 3X3XA 3CCU3 5HGRA 1ROAA 2W56A 3PCSA 1TP6A 3T0UA 3I563 3HZPA 4AKYA 3PXMA 3S5CA 3RGRA 1RRHA 4CDLA 1OH0A 2WO0A 4OK0A 3EN1B 3CC73 2B24B 1YJN3 2CFGA 1JN5A 1YVBI 2BMOB 2CWUA 1GY7A 1HKXA 3V99A 3OWSA 1WNHA 2PNCA 3LT8A 4EYCA 3S67A 1RN7A 3PGBA 1E3RA 1N5PA 3JUMA 2BNGA 1AVLA 1IVWA 4FMAA 1YIJ3 5IG4A 2W2CA 2WGQA 1V74A 4TX4A 2XFTA 2P09A 3CCJ3 3KFQC 4HZ9B 3HX8A 3F7XA 3OX9A 7STDA 2QEX3 2A15A 3GZYB 1WMNA 2CK3H 3K7CA 4HM2B 4XBYA 1PFPA 3LMLA 5STDA 1W2ZA 3MPHA 1SIHA 1Z1SA 4XM4A 3HI7A 2W04A 2PZVA 1ZO2A 3NV0A 4WP5A 1GD4A 3V98A 2CG1A 3CCS3 3VGNA 3EBTA 1WTHA 2CW9A 4RZMA 3BLZA 2IMJA 4FCZA 5DRVA 1SIIA 1KC84 3DGLA 4I4KA 3NM2A 1QVF2 1OACA 5ELUA 2RSXA 4L8PA 1S723 3G16A 3CME3 3CCR3 4LEHA 3SXXA 1US1A 4JRFA 1ROVA 3JUPA 1K734 3GZRA 3LYGA 3QRDA 4XBXA 3ALAA 3MWZA 2P05A 4EC6A 4EV2A 2IA7A 3X3YA 3OV4A 1YJ93 3F8HA 3NBJA 4IT7A 4MMYB 1J2BA 3S28A 1N9EA 4Q53A 1CYVA 1M1K4 1NDOB 4MMXB 3DXOA 4R9KA 2UX0A 4R9LA 2ML5A 5KP4A 1JJ22 4IPBA 3FLJA 1EKMA 3I0YA 1IVVA 3EF8A 1YI23 4N6MA 1K28A 3M8CA 1DVDA 3IPTA 3B7CA 3H3HA 1OF5A 1JRQA 4LZIA 4LGQA 1W6GA 3FG4A 2OOVA 3CCM3 3KN4A 4AKZA 3DUKA 3E99A 3DGOA 4J8TA 5ELJA 2ZL8A 3FF0A 1VQK3 4HM4B 2OQEA 4NHFA 3K9MC 3EBYA 1G96A 1W6CA 3KZTA 2IUKA 3LZAA 4WYKA 3ROBA 5IERA 1KSIA 2F98A 4MMZB 4NREA 1W5ZA 1TFOA 1DMMA 1VQ63 2XR8B 2OTL3 3CNMA 3LT9A 1QAKA 1M904 3EQQB 4K61A 5AI1A 2GBWB 1O7PB 1Q824 1MNLA 4XDWA 3PZWA 1JKGB 3FSDA 3NBBA 4EBGA 5JBSA 3KIIA 1VQL3 4G1MB 1JB4A 2Y74A 1RRLA 1CQSA 2HMNB 4N6UA 2CH9A 1N8R4 1SPUA 2F86B 4MJDA 4O3VA 3BNBA 2CKFB 1YGEA 2Z77A 3CMA3 4K90B 1WMOA 3GZBA 3CCE3 3CPOA 1K8A4 2E2UA 2L4VA 1OPYA 2OQEC 4HZBB 5CK6A 4HM3B 2HMLB 3K5TA 4N6LA 1QJGA 1ULJB 1VQN3 5AIGA 1QALA 1GY6A 4KFFA 1C7HA 1W4NA 1OHOA 1Y4KA 1NJI4 3NQYA 2GXFA 2YFLB 1O7MB 1IV9A 3G6E3 2YX9A 3ER7A 5D81A 1IVXA 1IT7A 4FCJA 1LNHA 5IG0A 1KQS2 3OXAA 4N6TA 2Z6BA 2LYXA 1NWWA 2MC8A 4AEQA 4WHAA 4RBNA 3WDGB 1O7HB 3KSED 1N9JA 2K54A 3MG3A 1RJOA 2B1XB 3LTAA 5D83A 2W03A 1OUNA 2M7OA 3IMAB 4HM5B 3WOEB 1S5AA 3L0RA 1UI8A 2C10A 2FGTA 2RCDA 2XFSA 3F9SA 2ML6A 4R80A 3NHXA 6STDA 2P38A 3UB1A 3STDA 3S29A 4QWTA 2RFRA 4EXRA 2IUJA 3UL5A 1Q40B 3GAXA 3FGYA 4GB5A 1FGQA 3EJVA 1NB3I 2CIUA 1NB5I 3KKGA 3FZWA 1MOLA 3NV0B 1IV7A 3DZLA 3HK4A 5IW9A 2V1LA 5IEPA 2I9WA 1YJW3 1OGZA 1M1XB 1UUVB 4HM7B 4WWUC 4KVHA 1GD3A 3FG1A 1OHPA 4HKVB 1ULIB 3KE7A 1TU5A 3DMCA 4HYZA 3K63A 4HM6B 5JPUA 3LTDA 2D1WA 1LVNA 2XSHB 3MKIA 1QAFA 3CC43 1PU4A 2XSOB 4HM0B 1GY5A 1FGTA 3Q1CA 3U97A 3BNEA 2HMOB 3LXUX 5AIHA 5BXQA 5IF6A 4STDA 1DMQA 3SOYA 3GRDA 3G0KA 3G713 3WOFB 2XRXB 2QIYA 3K0ZA 3OWUA 3DGNA 1HU9A 3QK9A 4HVNA 1FGRA 2XGLA 3N9HA 2GU1A 4HM1B 1JV2B 3NUVA 3SOAA 3X42A 1JB5A 4LMIA 1FGMA 1F8NA 1OHSA 3CCQ3 1LXEA 2CFKA 3FCSB 1N8QA 1TUHA 3CD63 2FXTA 3JUQA 4RNYA 2Z7AA 5CXOA 2P0XA 2KXGA 5CF2A 1VZZA 3NX0A 3VSYA 1AR0A 5AYRB 3S27A 3V92A 1U8CB 1EG9B 4BTXA 3PS8A 1Q814 1R4CA 5EVHA 1A90A 4XDVA 3HIIA 8CHOA 1YHQ3 4ZM8A 1FUWA 1STDA 2WOHA 1O7NB 2CC3A 4HBRA 5G2GA 5I97A 2YFIB 5AYSC 2JQ5A 5LC7A 3F40A 1Q42A 1U5OA 1W7CA 3VF1A 1FA3A 2KCDA 2XGNA 1W02A 2OOVC 1D6YA 3D3LA 1IK3A 1TIJA 3MG1A 1K9M4 3JUOA 4K1UA 1L5GB 4JF8A 2W9QA 4N6OB 4J9AA 2HMJB 1NO3A 2Z76A 3DY5A 3X41A 1NU3A 1W2B2 3H51A 5EEOA 5CF1A 1W00A 1EQKA 3UL6A 1CEWI 3CCV3 2MF7A 5FGOA 5TGNA 3CNXA 2QA43 2BT3A 1SJWA 1UI7A 2P0MA 3PYJA 1KWIA 3MHEA 4FR9A 1A67A 2W0QA 2ZDJA 1EA2A 1E3VA 2W56B 3EN8A 1DVCA 3F8XA 3DGMA 4O02B 3CC23 1IVUA 3JVCA 3LOYA 1DYUA 1CYUA 3WMDA 1JN5B 3HIGA 2GEYA 3MYTA 5AEUB 1ISKA 1FGOA 2YFJB 3LTCA 4FMCA 3SVAA 3MG2A 4CCVA 3X40A 1DMNA 1OGXA 4KZ1A 4IIAA 4L8OA 1VQ73 1VQM3 3CXC2 1SQWA 3B8LA 3WODG 1IT8A 1IQYA 1VQ53 1VQ43 3JUNA 3I553 2QGUA 2E2VA 1Q7Y4 1Q864 4N3VA 5IG3A 5IG5A 2XF3A 1ASKA 3EB8A 1GS3A 1WMPA 4MEIA 2CG0A 3Q90A 1WQLB 3RGAA 2CHCA 2CWTA 1VQO3 5IEOA 2Y73A 3CPW2 1BUQA 3LTBA 1D6UA 1Q40A 2BHMA 5BVBA 3O8YA 2OCTA 2CFWA 2KRTA 2WOFA 3B4OA 4ORLA 3D9RA 2WGOA 1O7GB 1OF5B 3GZXB 2HMMB 2W9PA 3AMOB 4R4KA 1QVG2 4N6V0 2K0MA 3EC9A 3N54B 5LC6A 3F7SA 1QMAA 1RKYA 2STDA 3T8UA 3RDEA 5JPPA 3PCRA 1M9GA 4XBTA 1D6ZA 2OWPA 3B4PA 1VQ93 1E97A 3NBRA 2D42A 5KP3A 3X3ZA 5CLKA 3SEDA 5AIFA 3UJMA 3UNLA 2JDIH 1O7WB 4FCMA 2O9UX 1UW1A 3BNDA 3KSPA 4O2HA 4OVMA 4PEJA 2BMQB 4R1KA 5A0OB 1STFI 4WFOA 3BB9A 3NQZA 5D82A 4HM8B 4OUQA 3T8NA 1KD14 3EX9A 4HJLB 2OTJ3 3DM8A 4KFDA 4WYKB 1T5YA 2CFDA 3OW22 3J7Yd 1A2KA 4N6NB 3FH1A 2INXA 2Q07A 2SBLA 5AEWB 2CWVA 2C11A 1W01A 1ZX2A 4EV5A 2HMKB 5KP1A 3N8BA 2E2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1U A;  3A76 A;  5DRV A;  3CU3 A;  1NWW A;  4I4K A;  5FW5 A;  1O7H B;  3NM2 A;  4J9A A;  2BMR B;  2HMJ B;  2Z76 A;  1IDP A;  2K54 A;  1NU3 A;  3MG3 A;  4L8P A;  3H51 A;  1K41 A;  2B1X B;  5CF1 A;  3G16 A;  5D83 A;  4K1V A;  1OUN A;  1W00 A;  4HM5 B;  4XB5 A;  1S5A A;  5TGN A;  2RCD A;  3CNX A;  1UUW B;  2GBX B;  4LEH A;  3ECF A;  3F9S A;  1SJW A;  2GEX A;  3NHX A;  3JUP A;  3FKA A;  3GZR A;  3LYG A;  3MHE A;  2F99 A;  3NXJ A;  5D82 A;  6STD A;  3STD A;  1EA2 A;  1E3V A;  4H3U A;  2RFR A;  4XBX A;  1Q40 B;  4X2O A;  3FGY A;  4GB5 A;  3EN8 A;  3F8X A;  3GWR A;  1W6Y A;  3OV4 A;  3EJV A;  3F8H A;  3KKG A;  3FZW A;  3WMD A;  4Q53 A;  1NDO B;  3NV0 B;  1JN5 B;  3DZL A;  3HK4 A;  2GEY A;  3MYT A;  5AEU B;  1ISK A;  3FF2 A;  2YFJ B;  5IEP A;  2I9W A;  3DXO A;  4R9K A;  1OGZ A;  3EHC A;  3MG2 A;  1UUV B;  2UX0 A;  3MSO A;  1DMN A;  4R9L A;  1OGX A;  4HM7 B;  1JB2 A;  4IIA A;  4L8O A;  4U13 A;  4KVH A;  4WWU C;  5KP4 A;  1GYB A;  3B8L A;  5IEN A;  3FLJ A;  3I0Y A;  1OHP A;  4HKV B;  3JUN A;  1ULI B;  3OWY A;  3KE7 A;  3EF8 A;  4X2H A;  3DMC A;  2QGU A;  3M8C A;  5AII A;  4HM6 B;  4N3V A;  1OCV A;  3IPT A;  5IG3 A;  3B7C A;  3H3H A;  5IG5 A;  1OF5 A;  5JPU A;  2XSH B;  3G8Z A;  1ASK A;  3MKI A;  4LGQ A;  2XSO B;  4HM0 B;  4L7K A;  5DRE A;  1GS3 A;  1GY5 A;  2R4I A;  3F14 A;  3DUK A;  3E99 A;  3Q90 A;  2RGQ A;  1WQL B;  4J8T A;  3RGA A;  3FF0 A;  2CHC A;  2HMO B;  4HM4 B;  1JKG A;  5AIH A;  5BXQ A;  5IEO A;  3EBY A;  5IF6 A;  5HGR A;  1BUQ A;  3KZT A;  4STD A;  1DMQ A;  1TP6 A;  1Q40 A;  3LZA A;  4WYK A;  2F98 A;  3G0K A;  3GRD A;  3ROB A;  3SOY A;  3HZP A;  5IER A;  2XRX B;  5BVB A;  4HZ9 B;  2QIY A;  3K0Z A;  3OWU A;  1DMM A;  4ORL A;  3B4O A;  4HVN A;  3RGR A;  2XR8 B;  3D9R A;  3S5C A;  4CDL A;  1O7G B;  3CNM A;  1OF5 B;  3GZX B;  1OH0 A;  3EQQ B;  2HMM B;  3EN1 B;  2B24 B;  5KP1 A;  5AI1 A;  1JN5 A;  2GBW B;  1O7P B;  3EC9 A;  2BMO B;  4HM1 B;  3F7S A;  1GY7 A;  1QMA A;  1HKX A;  2STD A;  3T8U A;  3OWS A;  3NUV A;  4XDW A;  3SOA A;  1JKG B;  3FSD A;  5JPP A;  1JB5 A;  4LMI A;  1JB4 A;  1OHS A;  4XBT A;  1CQS A;  2HMN B;  2OWP A;  3B4P A;  1E3R A;  1E97 A;  1TUH A;  2F86 B;  3JUM A;  2BNG A;  3NBR A;  5KP3 A;  4MJD A;  5CLK A;  3SED A;  2CKF B;  3JUQ A;  2Z77 A;  2Z7A A;  5AIF A;  3UJM A;  2W2C A;  3UNL A;  1O7W B;  5IG4 A;  4FCM A;  5CXO A;  5CF2 A;  1VZZ A;  3VSY A;  3KSP A;  1AR0 A;  3GZB A;  4OVM A;  4PEJ A;  2BMQ B;  4R1K A;  1EG9 B;  3CPO A;  4HZB B;  1OPY A;  3HX8 A;  3BB9 A;  3F7X A;  3OX9 A;  2HML B;  2A15 A;  3GZY B;  4HM3 B;  4HM8 B;  4OUQ A;  3T8N A;  7STD A;  3K7C A;  3EX9 A;  1QJG A;  4HM2 B;  5EVH A;  4HJL B;  1ULJ B;  4XDV A;  3DM8 A;  4XBY A;  5AIG A;  8CHO A;  5STD A;  1GY6 A;  4WYK B;  1C7H A;  1STD A;  1OHO A;  1Z1S A;  1O7N B;  4XM4 A;  5G2G A;  2YFI B;  1A2K A;  2JQ5 A;  2GXF A;  2PZV A;  1ZO2 A;  2YFL B;  1O7M B;  2INX A;  3FH1 A;  3NV0 A;  3F40 A;  3ER7 A;  1Q42 A;  1U5O A;  4WP5 A;  5D81 A;  5AEW B;  3VGN A;  3EBT A;  1W01 A;  4FCJ A;  5IG0 A;  1ZX2 A;  1W02 A;  4RZM A;  5CK6 A;  2HMK B;  3BLZ A;  2IMJ A;  3OXA A;  3MG1 A;  3JUO A; 
#chains in the Genus database with same CATH topology
 3A76 A;  3CU3 A;  1B2X A;  5FW5 A;  2BMR B;  2CFL A;  3CCL 3;  1A2P A;  1BNG A;  1IDP A;  1VQ8 3;  1R4Y A;  1TTO A;  1K41 A;  1LNI A;  4H61 A;  3U1W A;  1BIR A;  5EQL A;  4K1V A;  1AVK A;  4XB5 A;  3FG3 A;  5M1A A;  3NM7 A;  1MWU A;  3EE1 A;  4CJN A;  1UUW B;  2GBX B;  3ECF A;  2GEX A;  3IJE B;  1IQ8 A;  3BNC A;  3FKA A;  1UGI A;  3NXJ A;  2F99 A;  3LH4 A;  4GSP A;  1BSE A;  1MGR A;  2XH9 A;  4H3U A;  3WA3 A;  3G4S 3;  4X2O A;  4BTW A;  1YIT 3;  2XEP A;  1A2V A;  3GWR A;  2BO9 B;  1W6Y A;  3Q2P A;  3TDG A;  1N5H A;  1LQG C;  3SX1 A;  1BAN A;  3DH2 A;  3AMO A;  3RNT A;  1C54 A;  4RNZ A;  1IU7 A;  4FMD A;  1VQP 3;  3WA2 X;  1I3I A;  3FF2 A;  2O3O A;  1JNQ A;  3EHC A;  1BAO A;  2GU3 A;  3MSO A;  3URP A;  4BTY A;  7RNT A;  1JB2 A;  1DET A;  4J5K A;  4U13 A;  1V57 A;  1GYB A;  5IEN A;  2LQV A;  1I0V A;  2W6J H;  3OWY A;  4GL6 A;  4X2H A;  1RHL A;  5AII A;  1OCV A;  2BIR A;  3G8Z A;  3SLU A;  4L7K A;  1AV4 A;  5DRE A;  1LOX A;  2R4I A;  3F14 A;  4FMB A;  2FNQ A;  1IQX A;  2SAR A;  1TFK A;  2RGQ A;  4KFE A;  4LSO A;  1LOV A;  1JKG A;  4O8S A;  5G1K A;  3X3X A;  3CCU 3;  5HGR A;  1ROA A;  2W56 A;  3PCS A;  1TP6 A;  3T0U A;  3I56 3;  3HZP A;  4AKY A;  1FZU A;  3PXM A;  3S5C A;  3RGR A;  1RRH A;  4CDL A;  1LRA A;  1OH0 A;  2WO0 A;  4OK0 A;  3EN1 B;  3CC7 3;  2B24 B;  3BIR A;  2CFG A;  5M18 A;  1JN5 A;  1YJN 3;  1YVB I;  2BMO B;  2CWU A;  2F4Y A;  1GY7 A;  1HKX A;  3AGN A;  3V99 A;  3OWS A;  1RGA A;  1WNH A;  2PNC A;  3LT8 A;  1Q7H A;  1YNV X;  4EYC A;  3S67 A;  1RN7 A;  3PGB A;  1E3R A;  1BRS A;  1N5P A;  3JUM A;  2BNG A;  1AVL A;  1IVW A;  4FMA A;  1YIJ 3;  1RGL A;  2W2C A;  2WGQ A;  1V74 A;  4TX4 A;  5IG4 A;  2XFT A;  4HAA A;  1EUI C;  1BGS A;  2IY2 A;  2P09 A;  4LYL B;  3CCJ 3;  3KFQ C;  1RGG A;  1GOY A;  3HX8 A;  3F7X A;  3OX9 A;  4HZ9 B;  4KT3 B;  2A15 A;  3GZY B;  1BRJ A;  7STD A;  2QEX 3;  1WMN A;  2CK3 H;  1GOV A;  3K7C A;  4HM2 B;  3WR2 A;  4XBY A;  1PFP A;  1MGW A;  1BRI A;  3LML A;  5STD A;  1W2Z A;  3MPH A;  1SIH A;  1RLS A;  1Z1S A;  1PY3 A;  4XM4 A;  3HI7 A;  1B20 A;  1BOX A;  2PZV A;  1ZO2 A;  2W04 A;  3NV0 A;  4WP5 A;  1GD4 A;  5BIR A;  1G0T A;  3V98 A;  2CG1 A;  2HOH A;  3CCS 3;  3VGN A;  1WTH A;  3EBT A;  2CW9 A;  4RZM A;  4NPB A;  3BLZ A;  2IMJ A;  5M19 A;  4FCZ A;  1JBR A;  5DRV A;  1SII A;  1KC8 4;  3DGL A;  4I4K A;  1LOY A;  3NM2 A;  1QVF 2;  1OAC A;  5ELU A;  2RSX A;  1GOU A;  4L8P A;  1S72 3;  1BSC A;  3G16 A;  3CME 3;  3CCR 3;  4LEH A;  3SXX A;  1US1 A;  4I5Q A;  1GMP A;  3GSP A;  1Q9E A;  1ROV A;  4JRF A;  1NNV A;  3JUP A;  1K73 4;  3GZR A;  3LYG A;  1RNB A;  1TJD A;  2IYJ A;  3QRD A;  4XBX A;  3ALA A;  1B2Z A;  3MWZ A;  2P05 A;  4EC6 A;  4EV2 A;  2IA7 A;  3X3Y A;  3OV4 A;  1YJ9 3;  1UDI I;  3F8H A;  3NBJ A;  4IT7 A;  4MMY B;  1J2B A;  3S28 A;  1N9E A;  4Q53 A;  1CYV A;  1M1K 4;  1NDO B;  2R41 A;  4MMX B;  3DXO A;  4R9K A;  2UX0 A;  4J5G A;  4R9L A;  2ML5 A;  5KP4 A;  1MWR A;  1JJ2 2;  4IPB A;  3FLJ A;  1EKM A;  3I0Y A;  6RNT A;  1IVV A;  3EF8 A;  1YI2 3;  4N6M A;  1K28 A;  1T2I A;  3M8C A;  1DVD A;  3IPT A;  1RDS A;  1RCL A;  3B7C A;  1OF5 A;  3D5G A;  1JRQ A;  3H3H A;  4LZI A;  4LGQ A;  1B21 A;  1RNT A;  1W6G A;  2J8X B;  3FG4 A;  3KN4 A;  2OOV A;  4AKZ A;  3CCM 3;  3DUK A;  3E99 A;  3DGO A;  4J8T A;  4DKI A;  1UCJ A;  5ELJ A;  2ZL8 A;  3FF0 A;  1VQK 3;  4HM4 B;  2OQE A;  4NHF A;  3K9M C;  3EBY A;  1B27 A;  1G96 A;  1W6C A;  2F56 A;  2IUK A;  3KZT A;  3LZA A;  4WYK A;  3ROB A;  5IER A;  1KSI A;  2F98 A;  5RNT A;  4MMZ B;  4NRE A;  1JZD A;  1W5Z A;  1TFO A;  1DMM A;  1VQ6 3;  2XR8 B;  4GHO A;  2OTL 3;  3WHO A;  3CNM A;  3LT9 A;  1QAK A;  1M90 4;  3D5I A;  3EQQ B;  4K61 A;  5AI1 A;  2GBW B;  1UCK A;  1O7P B;  1Q82 4;  1MNL A;  1BVI A;  1HYF A;  4XDW A;  3PZW A;  1JKG B;  3FSD A;  3NBB A;  4EBG A;  5JBS A;  1UCL A;  3KII A;  1VQL 3;  4G1M B;  1JB4 A;  2Y74 A;  1RRL A;  1CQS A;  2HMN B;  4N6U A;  2CH9 A;  2RBI A;  1N8R 4;  1SPU A;  1T3B A;  2F86 B;  4MJD A;  4O3V A;  1RGC A;  3BNB A;  2CKF B;  1YGE A;  2Z77 A;  3CMA 3;  4K90 B;  1BSD A;  1YVS A;  1WMO A;  3GZB A;  3CCE 3;  1B2M A;  5HOH A;  3CPO A;  1K8A 4;  2E2U A;  2L4V A;  1OPY A;  2OQE C;  4HZB B;  5CK6 A;  4HM3 B;  1V58 A;  2HML B;  3K5T A;  3HOH A;  4N6L A;  1AQZ A;  3ZG0 A;  1RMS A;  1VQQ A;  1EEJ A;  2K3D A;  1ZS7 A;  1QJG A;  1ULJ B;  1VQN 3;  5AIG A;  1QAL A;  2H0H A;  1GY6 A;  4KFF A;  1C7H A;  1W4N A;  1SAR A;  1OHO A;  2CX1 A;  1Y4K A;  1MWS A;  1NJI 4;  3NQY A;  1FYS A;  2GXF A;  2YFL B;  3Q3F A;  1O7M B;  1IV9 A;  3G6E 3;  2YX9 A;  3ER7 A;  5D81 A;  1IVX A;  1IT7 A;  4FCJ A;  1LNH A;  5IG0 A;  1KQS 2;  4CPK A;  1BUJ A;  1LOW A;  3OXA A;  4N6T A;  1GMQ A;  1BSB A;  2Z6B A;  7GSP A;  1JBT A;  6GSP A;  1JBS A;  2LYX A;  1NWW A;  2MC8 A;  4AEQ A;  4WHA A;  4RBN A;  3WDG B;  1X1W A;  1O7H B;  3KSE D;  1N9J A;  2H0I A;  2K54 A;  1X1X A;  3MG3 A;  5G1L A;  1I70 A;  1RJO A;  2B1X B;  3LTA A;  5D83 A;  1BRK A;  1OUN A;  2M7O A;  2W03 A;  3IMA B;  4HM5 B;  9RNT A;  3WOE B;  1S5A A;  3L0R A;  1UI8 A;  2C10 A;  2FGT A;  2RCD A;  2XFS A;  3F9S A;  2ML6 A;  4R80 A;  1B3S A;  1UGH I;  1RN1 A;  3NHX A;  6STD A;  2P38 A;  3UB1 A;  3STD A;  3S29 A;  4QWT A;  1G02 A;  2RFR A;  2IUJ A;  3UL5 A;  1Q40 B;  3GAX A;  3FGY A;  4GB5 A;  4EXR A;  1I2F A;  1BNF A;  1FGQ A;  3EJV A;  1NB3 I;  1RGE A;  2CIU A;  1NB5 I;  3KKG A;  1IYY A;  3FZW A;  1BRN L;  5BU4 A;  1MOL A;  3NV0 B;  1IV7 A;  3DZL A;  3HK4 A;  5IW9 A;  2V1L A;  5IEP A;  2I9W A;  1YJW 3;  1OGZ A;  1M1X B;  1TRQ A;  1UUV B;  2L1S A;  4HM7 B;  4WWU C;  4KVH A;  1BRH A;  1GD3 A;  3FG1 A;  1OHP A;  2KF6 A;  4HKV B;  1ULI B;  3KE7 A;  1TU5 A;  3DMC A;  4HYZ A;  3K63 A;  4HM6 B;  5JPU A;  3LTD A;  2D1W A;  1LVN A;  2XSH B;  2CX0 A;  1QAF A;  3MKI A;  1PU4 A;  3CC4 3;  2XSO B;  4HM0 B;  1GY5 A;  8RNT A;  1BNI A;  1FGT A;  3Q1C A;  2RNT A;  1CH0 A;  3A5E A;  2HMO B;  3BNE A;  3LXU X;  5AIH A;  3U97 A;  5BXQ A;  5IF6 A;  4STD A;  1DMQ A;  3SOY A;  3GRD A;  3G0K A;  3G71 3;  3WOF B;  2XRX B;  2QIY A;  3K0Z A;  3OWU A;  1HU9 A;  1MWT A;  3DGN A;  3QK9 A;  4HVN A;  1FGR A;  1BSA A;  2XGL A;  3N9H A;  1HZ1 A;  2GU1 A;  4HM1 B;  1RGK A;  1JV2 B;  1TRP A;  3NUV A;  3SOA A;  3X42 A;  1JB5 A;  4LMI A;  1FGM A;  1F8N A;  1OHS A;  3CCQ 3;  1LXE A;  2CFK A;  3FCS B;  1N8Q A;  1TUH A;  1AY7 A;  3CD6 3;  2FXT A;  1PYL A;  3JUQ A;  4RNY A;  2Z7A A;  3D4A A;  5CXO A;  2P0X A;  2KXG A;  5CF2 A;  1VZZ A;  3NX0 A;  3VSY A;  1AR0 A;  5AYR B;  1RN4 A;  3S27 A;  3V92 A;  1U8C B;  3KCH A;  1EG9 B;  4BTX A;  1I2E A;  3PS8 A;  1Q81 4;  1R4C A;  5EVH A;  1A90 A;  4XDV A;  3HII A;  8CHO A;  1YHQ 3;  1JZO A;  4BL3 A;  4ZM8 A;  1FUW A;  1STD A;  2WOH A;  1O7N B;  2CC3 A;  3D79 A;  4HBR A;  5G2G A;  4BIR A;  2YFI B;  5I97 A;  5AYS C;  2JQ5 A;  5LC7 A;  3F40 A;  1Q42 A;  1U5O A;  1W7C A;  3BU4 A;  3VF1 A;  1FA3 A;  1I3F A;  2KCD A;  3AHS A;  2XGN A;  1W02 A;  4BU4 A;  2OOV C;  1D6Y A;  3D3L A;  1IK3 A;  1TIJ A;  3MG1 A;  1K9M 4;  3JUO A;  4K1U A;  1L5G B;  4JF8 A;  1BNE A;  1RTU A;  1X1Y A;  2W9Q A;  4N6O B;  4J9A A;  2HMJ B;  1NO3 A;  2Z76 A;  3DY5 A;  3X41 A;  2ZHX B;  1NU3 A;  2F5W A;  1W2B 2;  3H51 A;  5EEO A;  5CF1 A;  1W00 A;  1RGH A;  1EQK A;  3UL6 A;  1CEW I;  3DGY A;  2H0G A;  2MF7 A;  5FGO A;  5TGN A;  3CNX A;  3CCV 3;  1I0X A;  2QA4 3;  2BT3 A;  1SJW A;  1UI7 A;  2P0M A;  3PYJ A;  1KWI A;  3MHE A;  4FR9 A;  1A67 A;  2W0Q A;  2ZDJ A;  1EA2 A;  1E3V A;  2W56 B;  2F5M A;  3EN8 A;  1DVC A;  3F8X A;  1UUG B;  3AGO A;  3DGM A;  4O02 B;  1IVU A;  3JVC A;  3LOY A;  3CC2 3;  1DYU A;  1CYU A;  2UUG C;  3WMD A;  1UCI A;  2BU4 A;  1JN5 B;  3HIG A;  1FW7 A;  2GEY A;  3MYT A;  4EW5 A;  1RSN A;  5AEU B;  1ISK A;  1FGO A;  2YFJ B;  3LTC A;  4FMC A;  3SVA A;  3MG2 A;  4CCV A;  3X40 A;  3ZFZ A;  1DMN A;  1OGX A;  4KZ1 A;  4IIA A;  2KAA A;  4L8O A;  1VQ7 3;  1VQM 3;  3CXC 2;  1SQW A;  3B8L A;  3WOD G;  1IT8 A;  1IQY A;  1FUS A;  4ILF A;  1VQ5 3;  1VQ4 3;  3JUN A;  1RCK A;  3I55 3;  1I2G A;  2QGU A;  2E2V A;  1Q7Y 4;  1Q86 4;  4N3V A;  5IG3 A;  5IG5 A;  2XF3 A;  1ASK A;  3EB8 A;  1GS3 A;  1I8V A;  2AAD A;  2KF4 A;  1WMP A;  4MEI A;  2CG0 A;  3Q90 A;  1WQL B;  3RGA A;  1T2H A;  2CHC A;  2CWT A;  1BNS A;  4HOH A;  1RGF A;  1VQO 3;  5IEO A;  2Y73 A;  3CPW 2;  1BUQ A;  1BRG A;  2GSP A;  1D6U A;  1Q40 A;  3LTB A;  1BNJ A;  2BHM A;  5BVB A;  3O8Y A;  2OCT A;  2CFW A;  2KRT A;  2WOF A;  3B4O A;  4ORL A;  3AHW A;  2WGO A;  3D9R A;  1O7G B;  1OF5 B;  3GZX B;  1GMR A;  1DE3 A;  2HMM B;  2W9P A;  3AMO B;  4R4K A;  1QVG 2;  4N6V 0;  2K0M A;  3EC9 A;  2KF5 A;  3N54 B;  4RNT A;  5LC6 A;  3F7S A;  1QMA A;  1RKY A;  2STD A;  3T8U A;  3RDE A;  5JPP A;  3PCR A;  5GSP A;  4BL2 A;  1FUT A;  1GSP A;  1M9G A;  4XBT A;  1D6Z A;  1B2U A;  2OWP A;  3B4P A;  1VQ9 3;  1E97 A;  3NBR A;  2D42 A;  5KP3 A;  3X3Z A;  2ZA4 A;  5CLK A;  3SED A;  2C4B A;  5AIF A;  3UJM A;  3UNL A;  3ZG5 A;  2JDI H;  1O7W B;  4FCM A;  2KF3 A;  2O9U X;  1UW1 A;  3BND A;  3KSP A;  1BU4 A;  4O2H A;  4OVM A;  4PEJ A;  2AAE A;  1ZGX A;  2BMQ B;  4R1K A;  5A0O B;  1STF I;  4WFO A;  3BB9 A;  3NQZ A;  5D82 A;  4HM8 B;  3SYU A;  4OUQ A;  3T8N A;  1KD1 4;  3EX9 A;  1B2S A;  4HJL B;  2OTJ 3;  3DM8 A;  4KFD A;  4WYK B;  1T5Y A;  2CFD A;  3OW2 2;  3J7Y d;  1A2K A;  4N6N B;  3FH1 A;  2INX A;  1YGW A;  2Q07 A;  2UGI A;  2SBL A;  5AEW B;  2CWV A;  1BNR A;  1X1U A;  2C11 A;  1W01 A;  1LQM B;  1ZX2 A;  4EV5 A;  2HMK B;  5KP1 A;  3N8B A;  2E2T A; 
#chains in the Genus database with same CATH homology
 3A76 A;  3CU3 A;  5FW5 A;  2BMR B;  2CFL A;  3CCL 3;  1VQ8 3;  1IDP A;  1K41 A;  4H61 A;  3U1W A;  5EQL A;  4K1V A;  1AVK A;  4XB5 A;  3FG3 A;  3NM7 A;  3EE1 A;  1UUW B;  2GBX B;  3ECF A;  2GEX A;  3IJE B;  1IQ8 A;  3BNC A;  3FKA A;  3NXJ A;  2F99 A;  3LH4 A;  2XH9 A;  4H3U A;  3WA3 A;  3G4S 3;  4X2O A;  4BTW A;  1YIT 3;  2XEP A;  1A2V A;  3GWR A;  2BO9 B;  1W6Y A;  3Q2P A;  3TDG A;  1N5H A;  3SX1 A;  3AMO A;  4RNZ A;  1IU7 A;  4FMD A;  1VQP 3;  3WA2 X;  3FF2 A;  2O3O A;  1JNQ A;  3EHC A;  2GU3 A;  3MSO A;  4BTY A;  1JB2 A;  4U13 A;  1GYB A;  5IEN A;  2LQV A;  2W6J H;  3OWY A;  4GL6 A;  4X2H A;  5AII A;  1OCV A;  3G8Z A;  3SLU A;  4L7K A;  1AV4 A;  5DRE A;  1LOX A;  2R4I A;  3F14 A;  4FMB A;  2FNQ A;  1IQX A;  1TFK A;  2RGQ A;  4KFE A;  4LSO A;  1JKG A;  4O8S A;  3X3X A;  3CCU 3;  5HGR A;  1ROA A;  2W56 A;  3PCS A;  1TP6 A;  3T0U A;  3I56 3;  3HZP A;  4AKY A;  3PXM A;  3S5C A;  3RGR A;  1RRH A;  4CDL A;  1OH0 A;  2WO0 A;  4OK0 A;  3EN1 B;  3CC7 3;  2B24 B;  1YJN 3;  2CFG A;  1JN5 A;  1YVB I;  2BMO B;  2CWU A;  1GY7 A;  1HKX A;  3V99 A;  3OWS A;  1WNH A;  2PNC A;  3LT8 A;  4EYC A;  3S67 A;  1RN7 A;  3PGB A;  1E3R A;  1N5P A;  3JUM A;  2BNG A;  1AVL A;  1IVW A;  4FMA A;  1YIJ 3;  5IG4 A;  2W2C A;  2WGQ A;  1V74 A;  4TX4 A;  2XFT A;  2P09 A;  3CCJ 3;  3KFQ C;  4HZ9 B;  3HX8 A;  3F7X A;  3OX9 A;  7STD A;  2QEX 3;  2A15 A;  3GZY B;  1WMN A;  2CK3 H;  3K7C A;  4HM2 B;  4XBY A;  1PFP A;  3LML A;  5STD A;  1W2Z A;  3MPH A;  1SIH A;  1Z1S A;  4XM4 A;  3HI7 A;  2W04 A;  2PZV A;  1ZO2 A;  3NV0 A;  4WP5 A;  1GD4 A;  3V98 A;  2CG1 A;  3CCS 3;  3VGN A;  3EBT A;  1WTH A;  2CW9 A;  4RZM A;  3BLZ A;  2IMJ A;  4FCZ A;  5DRV A;  1SII A;  1KC8 4;  3DGL A;  4I4K A;  3NM2 A;  1QVF 2;  1OAC A;  5ELU A;  2RSX A;  4L8P A;  1S72 3;  3G16 A;  3CME 3;  3CCR 3;  4LEH A;  3SXX A;  1US1 A;  4JRF A;  1ROV A;  3JUP A;  1K73 4;  3GZR A;  3LYG A;  3QRD A;  4XBX A;  3ALA A;  3MWZ A;  2P05 A;  4EC6 A;  4EV2 A;  2IA7 A;  3X3Y A;  3OV4 A;  1YJ9 3;  3F8H A;  3NBJ A;  4IT7 A;  4MMY B;  1J2B A;  3S28 A;  1N9E A;  4Q53 A;  1CYV A;  1M1K 4;  1NDO B;  4MMX B;  3DXO A;  4R9K A;  2UX0 A;  4R9L A;  2ML5 A;  5KP4 A;  1JJ2 2;  4IPB A;  3FLJ A;  1EKM A;  3I0Y A;  1IVV A;  3EF8 A;  1YI2 3;  4N6M A;  1K28 A;  3M8C A;  1DVD A;  3IPT A;  3B7C A;  3H3H A;  1OF5 A;  1JRQ A;  4LZI A;  4LGQ A;  1W6G A;  3FG4 A;  2OOV A;  3CCM 3;  3KN4 A;  4AKZ A;  3DUK A;  3E99 A;  3DGO A;  4J8T A;  5ELJ A;  2ZL8 A;  3FF0 A;  1VQK 3;  4HM4 B;  2OQE A;  4NHF A;  3K9M C;  3EBY A;  1G96 A;  1W6C A;  3KZT A;  2IUK A;  3LZA A;  4WYK A;  3ROB A;  5IER A;  1KSI A;  2F98 A;  4MMZ B;  4NRE A;  1W5Z A;  1TFO A;  1DMM A;  1VQ6 3;  2XR8 B;  2OTL 3;  3CNM A;  3LT9 A;  1QAK A;  1M90 4;  3EQQ B;  4K61 A;  5AI1 A;  2GBW B;  1O7P B;  1Q82 4;  1MNL A;  4XDW A;  3PZW A;  1JKG B;  3FSD A;  3NBB A;  4EBG A;  5JBS A;  3KII A;  1VQL 3;  4G1M B;  1JB4 A;  2Y74 A;  1RRL A;  1CQS A;  2HMN B;  4N6U A;  2CH9 A;  1N8R 4;  1SPU A;  2F86 B;  4MJD A;  4O3V A;  3BNB A;  2CKF B;  1YGE A;  2Z77 A;  3CMA 3;  4K90 B;  1WMO A;  3GZB A;  3CCE 3;  3CPO A;  1K8A 4;  2E2U A;  2L4V A;  1OPY A;  2OQE C;  4HZB B;  5CK6 A;  4HM3 B;  2HML B;  3K5T A;  4N6L A;  1QJG A;  1ULJ B;  1VQN 3;  5AIG A;  1QAL A;  1GY6 A;  4KFF A;  1C7H A;  1W4N A;  1OHO A;  1Y4K A;  1NJI 4;  3NQY A;  2GXF A;  2YFL B;  1O7M B;  1IV9 A;  3G6E 3;  2YX9 A;  3ER7 A;  5D81 A;  1IVX A;  1IT7 A;  4FCJ A;  1LNH A;  5IG0 A;  1KQS 2;  3OXA A;  4N6T A;  2Z6B A;  2LYX A;  1NWW A;  2MC8 A;  4AEQ A;  4WHA A;  4RBN A;  3WDG B;  1O7H B;  3KSE D;  1N9J A;  2K54 A;  3MG3 A;  1RJO A;  2B1X B;  3LTA A;  5D83 A;  2W03 A;  1OUN A;  2M7O A;  3IMA B;  4HM5 B;  3WOE B;  1S5A A;  3L0R A;  1UI8 A;  2C10 A;  2FGT A;  2RCD A;  2XFS A;  3F9S A;  2ML6 A;  4R80 A;  3NHX A;  6STD A;  2P38 A;  3UB1 A;  3STD A;  3S29 A;  4QWT A;  2RFR A;  4EXR A;  2IUJ A;  3UL5 A;  1Q40 B;  3GAX A;  3FGY A;  4GB5 A;  1FGQ A;  3EJV A;  1NB3 I;  2CIU A;  1NB5 I;  3KKG A;  3FZW A;  1MOL A;  3NV0 B;  1IV7 A;  3DZL A;  3HK4 A;  5IW9 A;  2V1L A;  5IEP A;  2I9W A;  1YJW 3;  1OGZ A;  1M1X B;  1UUV B;  4HM7 B;  4WWU C;  4KVH A;  1GD3 A;  3FG1 A;  1OHP A;  4HKV B;  1ULI B;  3KE7 A;  1TU5 A;  3DMC A;  4HYZ A;  3K63 A;  4HM6 B;  5JPU A;  3LTD A;  2D1W A;  1LVN A;  2XSH B;  3MKI A;  1QAF A;  3CC4 3;  1PU4 A;  2XSO B;  4HM0 B;  1GY5 A;  1FGT A;  3Q1C A;  3U97 A;  3BNE A;  2HMO B;  3LXU X;  5AIH A;  5BXQ A;  5IF6 A;  4STD A;  1DMQ A;  3SOY A;  3GRD A;  3G0K A;  3G71 3;  3WOF B;  2XRX B;  2QIY A;  3K0Z A;  3OWU A;  3DGN A;  1HU9 A;  3QK9 A;  4HVN A;  1FGR A;  2XGL A;  3N9H A;  2GU1 A;  4HM1 B;  1JV2 B;  3NUV A;  3SOA A;  3X42 A;  1JB5 A;  4LMI A;  1FGM A;  1F8N A;  1OHS A;  3CCQ 3;  1LXE A;  2CFK A;  3FCS B;  1N8Q A;  1TUH A;  3CD6 3;  2FXT A;  3JUQ A;  4RNY A;  2Z7A A;  5CXO A;  2P0X A;  2KXG A;  5CF2 A;  1VZZ A;  3NX0 A;  3VSY A;  1AR0 A;  5AYR B;  3S27 A;  3V92 A;  1U8C B;  1EG9 B;  4BTX A;  3PS8 A;  1Q81 4;  1R4C A;  5EVH A;  1A90 A;  4XDV A;  3HII A;  8CHO A;  1YHQ 3;  4ZM8 A;  1FUW A;  1STD A;  2WOH A;  1O7N B;  2CC3 A;  4HBR A;  5G2G A;  5I97 A;  2YFI B;  5AYS C;  2JQ5 A;  5LC7 A;  3F40 A;  1Q42 A;  1U5O A;  1W7C A;  3VF1 A;  1FA3 A;  2KCD A;  2XGN A;  1W02 A;  2OOV C;  1D6Y A;  3D3L A;  1IK3 A;  1TIJ A;  3MG1 A;  1K9M 4;  3JUO A;  4K1U A;  1L5G B;  4JF8 A;  2W9Q A;  4N6O B;  4J9A A;  2HMJ B;  1NO3 A;  2Z76 A;  3DY5 A;  3X41 A;  1NU3 A;  1W2B 2;  3H51 A;  5EEO A;  5CF1 A;  1W00 A;  1EQK A;  3UL6 A;  1CEW I;  3CCV 3;  2MF7 A;  5FGO A;  5TGN A;  3CNX A;  2QA4 3;  2BT3 A;  1SJW A;  1UI7 A;  2P0M A;  3PYJ A;  1KWI A;  3MHE A;  4FR9 A;  1A67 A;  2W0Q A;  2ZDJ A;  1EA2 A;  1E3V A;  2W56 B;  3EN8 A;  1DVC A;  3F8X A;  3DGM A;  4O02 B;  3CC2 3;  1IVU A;  3JVC A;  3LOY A;  1DYU A;  1CYU A;  3WMD A;  1JN5 B;  3HIG A;  2GEY A;  3MYT A;  5AEU B;  1ISK A;  1FGO A;  2YFJ B;  3LTC A;  4FMC A;  3SVA A;  3MG2 A;  4CCV A;  3X40 A;  1DMN A;  1OGX A;  4KZ1 A;  4IIA A;  4L8O A;  1VQ7 3;  1VQM 3;  3CXC 2;  1SQW A;  3B8L A;  3WOD G;  1IT8 A;  1IQY A;  1VQ5 3;  1VQ4 3;  3JUN A;  3I55 3;  2QGU A;  2E2V A;  1Q7Y 4;  1Q86 4;  4N3V A;  5IG3 A;  5IG5 A;  2XF3 A;  1ASK A;  3EB8 A;  1GS3 A;  1WMP A;  4MEI A;  2CG0 A;  3Q90 A;  1WQL B;  3RGA A;  2CHC A;  2CWT A;  1VQO 3;  5IEO A;  2Y73 A;  3CPW 2;  1BUQ A;  3LTB A;  1D6U A;  1Q40 A;  2BHM A;  5BVB A;  3O8Y A;  2OCT A;  2CFW A;  2KRT A;  2WOF A;  3B4O A;  4ORL A;  3D9R A;  2WGO A;  1O7G B;  1OF5 B;  3GZX B;  2HMM B;  2W9P A;  3AMO B;  4R4K A;  1QVG 2;  4N6V 0;  2K0M A;  3EC9 A;  3N54 B;  5LC6 A;  3F7S A;  1QMA A;  1RKY A;  2STD A;  3T8U A;  3RDE A;  5JPP A;  3PCR A;  1M9G A;  4XBT A;  1D6Z A;  2OWP A;  3B4P A;  1VQ9 3;  1E97 A;  3NBR A;  2D42 A;  5KP3 A;  3X3Z A;  5CLK A;  3SED A;  5AIF A;  3UJM A;  3UNL A;  2JDI H;  1O7W B;  4FCM A;  2O9U X;  1UW1 A;  3BND A;  3KSP A;  4O2H A;  4OVM A;  4PEJ A;  2BMQ B;  4R1K A;  5A0O B;  1STF I;  4WFO A;  3BB9 A;  3NQZ A;  5D82 A;  4HM8 B;  4OUQ A;  3T8N A;  1KD1 4;  3EX9 A;  4HJL B;  2OTJ 3;  3DM8 A;  4KFD A;  4WYK B;  1T5Y A;  2CFD A;  3OW2 2;  3J7Y d;  1A2K A;  4N6N B;  3FH1 A;  2INX A;  2Q07 A;  2SBL A;  5AEW B;  2CWV A;  2C11 A;  1W01 A;  1ZX2 A;  4EV5 A;  2HMK B;  5KP1 A;  3N8B A;  2E2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...