4J8TA

Engineered digoxigenin binder dig10.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
MNAKEIVVHALRLLENGDARGWCDLFHPEGVLEYPYPPPGYKTRFEGRETIWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVHTVSGGKLAADYISVLRTRDGQILLYRLFFNPLRVLEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Digoxigenin binder protein DIG10.2
publication title Computational design of ligand-binding proteins with high affinity and selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Digoxigenin binding protein
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4j8tA00
4XBYA 3KKGA 4N3VA 1SJWA 5AI1A 3EBYA 5IF6A 5IG4A 3RGRA 5D83A 4WWUC 4HM1B 1U5OA 3HX8A 4HM4B 4XB5A 5CXOA 3FH1A 3MG3A 1IDPA 4HZBB 5AEUB 4HM3B 1O7MB 4OUQA 3CU3A 2F86B 3G8ZA 4HZ9B 5KP1A 3EF8A 3EN1B 4XDVA 3T8NA 2PZVA 1OHOA 4XM4A 2YFLB 3G0KA 3FSDA 3NUVA 4FCMA 4HM5B 3CPOA 2F98A 3CNXA 1C7HA 1E97A 2GEYA 1JKGA 3WMDA 3K7CA 3NV0B 6STDA 1OHPA 1W02A 3F8HA 3GWRA 3BLZA 4GB5A 1ISKA 3HZPA 5CF1A 3MHEA 3D9RA 2Z77A 3JUOA 2XSHB 1UUWB 3NM2A 4R9LA 4PEJA 4HM7B 2BMOB 1E3RA 5AIHA 1DMMA 5IG0A 3HK4A 3FF2A 2STDA 1OF5B 3MG1A 3EQQB 1K41A 1NU3A 4X2HA 4HVNA 1JKGB 3A76A 3DMCA 3FKAA 2GXFA 3F8XA 5JPPA 2Z7AA 1ULIB 3NHXA 3LZAA 3OXAA 3EX9A 3NXJA 1GY5A 1W00A 3GZYB 4HM2B 4U13A 3DUKA 3ER7A 5CF2A 3IPTA 4STDA 3GZRA 3SOAA 3JUQA 3EBTA 3BB9A 1CQSA 1TP6A 2OWPA 1OCVA 3GZXB 3NV0A 4R9KA 2RGQA 5AEWB 4CDLA 3KE7A 4HM0B 4K1VA 3F14A 4IIAA 3MG2A 5AIGA 3Q90A 3B4OA 5DRVA 2XSOB 1OPYA 5BXQA 4H3UA 1JB5A 1NDOB 1O7WB 2HMJB 3T8UA 2INXA 1DMQA 3FLJA 3DXOA 3RGAA 2QGUA 3OWYA 3H3HA 1VZZA 3OV4A 5IG5A 1HKXA 1GY7A 5D81A 3EN8A 1UUVB 1OF5A 1Z1SA 3LYGA 4K1UA 1DMNA 3B7CA 2I9WA 4J9AA 3KZTA 1QMAA 3JUMA 2JQ5A 1GYBA 3NBRA 4L8OA 1EA2A 2W2CA 3M8CA 5IERA 5AIIA 5CK6A 8CHOA 5IEPA 3MSOA 3JUPA 5FW5A 5JPUA 1GY6A 1OGZA 3EJVA 2K54A 5STDA 1E3VA 5BVBA 3FGYA 4HJLB 5G2GA 3VSYA 3CNMA 4ORLA 2CKFB 2HMKB 2BMQB 3STDA 4L8PA 2XRXB 3OX9A 4R1KA 4Q53A 3EC9A 2GEXA 5CLKA 1O7PB 4X2OA 1ULJB 2YFIB 1O7NB 3F7XA 3UJMA 3SEDA 2YFJB 3ROBA 1OGXA 4OVMA 1TUHA 3MKIA 4L7KA 4HM8B 1JN5B 1ASKA 3S5CA 3FF0A 2QIYA 1O7HB 3I0YA 3ECFA 2R4IA 1Q40A 4LMIA 3FZWA 1OH0A 2B24B 2HMLB 3DZLA 1ZX2A 4MJDA 1JB2A 2GBWB 3G16A 1W01A 1BUQA 1EG9B 2A15A 1JB4A 2UX0A 3MYTA 2BNGA 3UNLA 4XBTA 5EVHA 3K0ZA 3H51A 1GS3A 4HM6B 5DREA 3KSPA 4KVHA 2HMNB 2Z76A 4FCJA 1W6YA 7STDA 1STDA 5KP3A 1O7GB 1Q40B 3B4PA 2XR8B 4LGQA 4WP5A 3OWSA 4I4KA 1AR0A 4XBXA 4LEHA 5TGNA 3GZBA 3OWUA 1QJGA 3F40A 2GBXB 2HMOB 3VGNA 4WYKA 3F9SA 4J8TA 2HMMB 1JN5A 1NWWA 3F7SA 1OUNA 3JUNA 1A2KA 1Q42A 3B8LA 1WQLB 5AIFA 2B1XB 2BMRB 2IMJA 2CHCA 1ZO2A 3EHCA 4XDWA 3E99A 2F99A 5KP4A 5D82A 4RZMA 3SOYA 5IENA 4WYKB 5IEOA 2RFRA 5HGRA 1S5AA 3DM8A 4HKVB 1OHSA 2RCDA 5IG3A 3GRDA
chains in the Genus database with same CATH superfamily
4XBYA 1IT8A 1VQ93 1ZGXA 1WMPA 3KKGA 1BRKA 2KAAA 3DGOA 3SLUA 5JBSA 4N3VA 4MEIA 2CWUA 2ZHXB 1SJWA 2D1WA 3EBYA 5AI1A 1RGLA 1YGWA 5IF6A 5IG4A 4N6V0 5D83A 3RGRA 4WWUC 4HM1B 3N54B 1RMSA 1QALA 1U5OA 3CCS3 1MGRA 1FA3A 2KRTA 4RBNA 1BNEA 1ROAA 1BSEA 3HX8A 4HM4B 4FMCA 1T2HA 4KFDA 4XB5A 3D3LA 3FH1A 3MG3A 1CH0A 1I70A 1IDPA 4HZBB 5CXOA 4NREA 4HM3B 1X1WA 4ZM8A 5AEUB 1KD14 2W56A 1K9M4 2W9QA 6RNTA 2LQVA 2RSXA 3HI7A 1O7MB 4OUQA 3CU3A 1RKYA 1X1XA 1T2IA 4FMAA 1FGTA 2F86B 3G8ZA 1JJ22 3DGNA 1YVSA 3BNEA 1QVF2 4HZ9B 3NM7A 2W03A 5KP1A 3EF8A 1FGRA 2CFKA 1RDSA 3EN1B 4XDVA 3T8NA 1MWUA 3EE1A 2PZVA 3SVAA 1OHOA 4XM4A 1W5ZA 1N5HA 1MGWA 2XH9A 2YFLB 7RNTA 1B3SA 3G0KA 2K0MA 5HOHA 3J7Yd 3Q3FA 1YHQ3 3FSDA 3NUVA 4FCMA 4HM5B 1BSDA 1TU5A 3CPOA 3FG3A 3KIIA 3PS8A 3CCV3 1UI7A 2KF5A 4EV5A 3A5EA 2F98A 1K734 1BU4A 3MWZA 3CNXA 1C7HA 1E97A 2C4BA 2E2UA 2KF3A 4HOHA 2FGTA 4IT7A 4EW5A 1RLSA 1SARA 1GMRA 2GEYA 1BVIA 3NBBA 5BU4A 1G02A 1JKGA 2KCDA 4GHOA 3K7CA 1YVBI 3WMDA 1GOUA 3NV0B 4CPKA 6STDA 1OHPA 1W02A 1JZOA 7GSPA 3CD63 3F8HA 3GWRA 3WA2X 1W4NA 1DETA 3BLZA 4DKIA 1UUGB 1QVG2 2W56B 3BNDA 3K9MC 4GB5A 1ISKA 3HZPA 1X1YA 2OOVC 5G1KA 5CF1A 1WTHA 1EEJA 3CCM3 3SYUA 3MHEA 3D9RA 1JBSA 2Z77A 3X3XA 2XF3A 3DGLA 1LNHA 3CCL3 1RGHA 2C10A 3PZWA 3JUOA 1TRQA 1VQ63 1GD3A 1GOVA 2XSHB 4CCVA 1FUTA 1VQ73 1UUWB 4FCZA 3KN4A 3NM2A 4R9LA 2RBIA 2AAEA 2PNCA 4PEJA 4HM7B 5M18A 1CYUA 2BMOB 1E3RA 2OTJ3 4O02B 1I8VA 3ZG5A 1WMOA 2GU3A 3KCHA 5AIHA 2BU4A 1DMMA 5IG0A 3HK4A 3FF2A 1A2PA 2STDA 1OF5B 1HU9A 3MG1A 5EQLA 9RNTA 1DYUA 3EQQB 1B20A 1BIRA 1K41A 1NU3A 1W6CA 4O8SA 3CCE3 1AV4A 1RCKA 2CG1A 2K3DA 4X2HA 4HVNA 2CX0A 3LT9A 1JKGB 3A76A 3DMCA 3LTBA 1YGEA 4HBRA 2GXFA 3FKAA 1GMPA 3FG4A 3F8XA 1I2EA 5JPPA 2Z7AA 1ULIB 1UDII 1IVUA 1JNQA 1B27A 3CMA3 3NHXA 3D5GA 1IVVA 1YNVX 1N9JA 3LZAA 3LXUX 4N6UA 2SBLA 3HOHA 1KC84 3RDEA 1QAKA 1G96A 3EX9A 3NXJA 3OXAA 1GY5A 3DY5A 4FMBA 1W00A 3GZYB 1BSCA 1RNBA 1FZUA 4BTYA 4HM2B 1SIHA 3WDGB 1PFPA 4N6MA 4N6LA 2IUKA 4U13A 2WOFA 3DUKA 3ER7A 3U1WA 2LYXA 1B2MA 5CF2A 3CME3 3IPTA 3CPW2 1I0XA 1FW7A 1V74A 3LH4A 1B2SA 4STDA 2KXGA 3GZRA 3SOAA 1RRLA 3JUQA 1D6YA 3NBJA 1MWRA 2OQEA 3EBTA 3BB9A 5A0OB 1BRIA 1CQSA 1HZ1A 3ALAA 1BUJA 4LZIA 2QA43 1TP6A 2OWPA 1BGSA 1OCVA 2XGNA 3K63A 4R4KA 1HYFA 3GZXB 1TFOA 2WOHA 3NV0A 4R9KA 2RGQA 3ZFZA 2XEPA 5AEWB 4CDLA 3UL6A 1T3BA 3LTAA 2CC3A 3KE7A 4HM0B 4AEQA 5ELJA 3PGBA 4K1VA 1IVWA 2CWTA 3VF1A 1BNRA 3F14A 2M7OA 4IIAA 1IK3A 3MG2A 5AIGA 4EV2A 3I563 5GSPA 3LTCA 3Q90A 3B4OA 5DRVA 1Q9EA 3CC43 1LOWA 2XSOB 1OPYA 1I2FA 1L5GB 5BXQA 4KT3B 4H3UA 4MMYB 2JDIH 2E2TA 1IT7A 1JB5A 1NDOB 1RCLA 1VQ83 4G1MB 2V1LA 1O7WB 1SPUA 2HMJB 3T8UA 2INXA 1BANA 1DMQA 2FXTA 1RN1A 1SQWA 3FLJA 2XFSA 5EEOA 3DXOA 1RJOA 3RGAA 3X41A 3I553 2QGUA 2W9PA 3HIIA 3H3HA 1VZZA 3OWYA 3V92A 4BL2A 1PU4A 2Y74A 1W2B2 2YX9A 2O9UX 2CX1A 3OV4A 5IG5A 1LQMB 1HKXA 3X42A 1R4CA 1B2XA 1GY7A 2IYJA 3EN8A 2BHMA 1UUVB 1OF5A 1Z1SA 3LYGA 4KFEA 4K1UA 5D81A 1DMNA 3B7CA 2I9WA 4J9AA 3KZTA 4MMZB 5G1LA 1BSAA 1G0TA 1JZDA 1QMAA 3JUMA 1A67A 4I5QA 1Q7HA 1RGFA 4WHAA 1UCIA 2JQ5A 3V98A 1GYBA 3L0RA 4IPBA 1VQQA 3NBRA 4L8OA 3IMAB 4EBGA 1VQN3 2WGOA 1B2ZA 1CEWI 2ZL8A 4EYCA 1EA2A 1VQP3 3V99A 1RGKA 1S723 1D6ZA 4R80A 2P0XA 2CG0A 3U97A 1VQ43 1VQO3 2W2CA 3M8CA 1RSNA 5IERA 1RNTA 1LRAA 3AGNA 1JV2B 3N8BA 5AIIA 6GSPA 4RNTA 3X3YA 2H0GA 5LC6A 1I2GA 1A90A 5CK6A 2R41A 3LMLA 1TIJA 1NNVA 8CHOA 1N8R4 1UW1A 1YJN3 5IEPA 3MSOA 3JUPA 1BRHA 1BRGA 2O3OA 5FW5A 1WNHA 3S27A 3CCJ3 4OK0A 3DGMA 1GOYA 5JPUA 2IA7A 1GY6A 2AADA 1OGZA 2Y73A 1Q814 3CXC2 1LXEA 2F4YA 3CCU3 2CIUA 3LOYA 2ML6A 2FNQA 2Z6BA 2K54A 3EJVA 4CJNA 3BNBA 3RNTA 5STDA 4RNYA 1W2ZA 3K5TA 1IVXA 3NX0A 1NB3I 1E3VA 4H61A 3BNCA 2W04A 4RNZA 5BVBA 2OTL3 3FGYA 1ROVA 3WR2A 3KSED 1YJ93 4HJLB 1U8CB 1UGHI 5G2GA 3VSYA 3CNMA 4ORLA 4BTXA 1UCKA 1K28A 1IQYA 1WMNA 5FGOA 1AVKA 3FG1A 2CKFB 3WHOA 1SIIA 2HMKB 2IY2A 2BMQB 3WOEB 3STDA 1BRSA 3PCRA 5I97A 1PYLA 4L8PA 1LOVA 2D42A 2XRXB 3OX9A 2P38A 4R1KA 4LSOA 4Q53A 3EC9A 4AKYA 2GEXA 4N6OB 5CLKA 3LT8A 1O7PB 3BIRA 4X2OA 1VQK3 1QAFA 1MOLA 1YJW3 1ULJB 2YFIB 1FUWA 1M9GA 3Q2PA 1O7NB 3F7XA 1NJI4 3UJMA 1IV9A 4JF8A 1VQ53 1OACA 3SEDA 2H0IA 4NPBA 3WODG 3G6E3 2E2VA 3JVCA 2YFJB 3ROBA 1Q824 5RNTA 2C11A 1RTUA 1TFKA 1OGXA 4OVMA 1N5PA 1RGAA 4KFFA 2CFLA 2GU1A 1K8A4 2CWVA 3AHWA 2ML5A 1TUHA 1IU7A 1BNSA 1MNLA 3KFQC 2CH9A 3MKIA 4L7KA 1UGIA 3O8YA 2OOVA 3CC23 3UL5A 3MPHA 1IQ8A 2BO9B 3G4S3 1LNIA 2WGQA 5ELUA 4O3VA 3CC73 3QRDA 2RNTA 4K61A 4JRFA 1FYSA 4HM8B 5AYSC 1JN5B 1M904 2IUJA 3WA3A 1BSBA 1ASKA 1IV7A 1BOXA 3S5CA 4K90B 2F5MA 3AGOA 3D5IA 3FF0A 2QIYA 1Y4KA 3AMOA 1I0VA 1FGMA 4NHFA 3S28A 1O7HB 3I0YA 2BIRA 3ECFA 3S29A 2L4VA 2UUGC 2R4IA 1Q40A 5M1AA 4LMIA 4HYZA 3GSPA 1ZS7A 3FZWA 1US1A 1YIJ3 1FGOA 1OH0A 3T0UA 2B24B 2HMLB 3DZLA 2MC8A 2CFGA 1ZX2A 2QEX3 4TX4A 1RHLA 1I3FA 4MJDA 2F5WA 1JB2A 2UGIA 2W6JH 3TDGA 2GBWB 3G16A 3PXMA 1DE3A 1PY3A 1W01A 1BUQA 4EC6A 3AHSA 1EG9B 2A15A 1JB4A 2UX0A 3MYTA 2BNGA 3UNLA 1JBRA 4MMXB 1B2UA 1VQL3 1JRQA 4XBTA 5EVHA 2XFTA 4FMDA 1N8QA 3K0ZA 1M1K4 4HAAA 1VQM3 1AQZA 3URPA 4BTWA 1M1XB 1GS3A 3H51A 5AYRB 3HIGA 1R4YA 4HM6B 5DREA 3KSPA 4KVHA 3NQYA 3PCSA 2HMNB 2Z76A 4N6TA 4FCJA 1W6YA 3SXXA 1TRPA 7STDA 1STDA 1BAOA 2P05A 1BRJA 1YI23 3LTDA 3AMOB 1YIT3 1KQS2 2CFDA 5KP3A 3WOFB 1FGQA 1EQKA 1W6GA 1O7GB 1Q40B 3OW22 1BNGA 5LC7A 3B4PA 4J5GA 2XR8B 1UCLA 2W0QA 2WO0A 2CK3H 4LGQA 4WP5A 1RRHA 1IYYA 3GAXA 2ZDJA 3Q1CA 4QWTA 3OWSA 4WFOA 4I4KA 3S67A 1AR0A 2OQEC 3N9HA 2J8XB 1V57A 4XBXA 1C54A 1D6UA 2GSPA 1J2BA 1RGEA 4LEHA 5TGNA 1RN7A 2CW9A 1EUIC 1BNJA 2ZA4A 4KZ1A 8RNTA 3DH2A 1RGCA 3GZBA 1EKMA 3OWUA 1QJGA 1KSIA 3F40A 3IJEB 2GBXB 1NO3A 2P0MA 2HMOB 2L1SA 1CYVA 1KWIA 1GMQA 2BT3A 3NQZA 4GL6A 1F8NA 3VGNA 4WYKA 4ILFA 3QK9A 3F9SA 1MWSA 3PYJA 3DGYA 4J8TA 2HMMB 1UI8A 1JN5A 1LVNA 1NWWA 3F7SA 5IW9A 1OUNA 3UB1A 2Q07A 1BNFA 3JUNA 4BL3A 2KF6A 1A2KA 1T5YA 3X40A 1W7CA 1RN4A 1UCJA 1NB5I 1Q42A 1TJDA 3B8LA 4EXRA 4N6NB 3D79A 5M19A 1DVCA 1WQLB 1V58A 1Q7Y4 1N9EA 5AIFA 1FUSA 1MWTA 2OCTA 4O2HA 2B1XB 2BMRB 3CCR3 2F56A 1LQGC 2IMJA 2CHCA 1LOXA 1TTOA 1AVLA 3CCQ3 1ZO2A 1X1UA 3EHCA 2XGLA 1BRNL 3G713 3SX1A 1DVDA 1AY7A 4XDWA 2SARA 1A2VA 1IQXA 1RGGA 3E99A 3FCSB 5BIRA 4BIRA 2KF4A 2P09A 1STFI 2HOHA 3BU4A 2F99A 4J5KA 5D82A 1LOYA 5KP4A 1Q864 4RZMA 4FR9A 1GD4A 3D4AA 3SOYA 2MF7A 5IENA 1JBTA 3ZG0A 2H0HA 4WYKB 5IEOA 2RFRA 5HGRA 2CFWA 1S5AA 3X3ZA 3DM8A 4HKVB 4LYLB 1GSPA 1B21A 1BNIA 1OHSA 2RCDA 1I3IA 5IG3A 3EB8A 4GSPA 4BU4A 3GRDA 4AKZA
chains in the Genus database with same CATH topology
4XBYA 1IT8A 1VQ93 1WMPA 3KKGA 3DGOA 3SLUA 5JBSA 4N3VA 4MEIA 2CWUA 1SJWA 2D1WA 3EBYA 5AI1A 5IF6A 5IG4A 4N6V0 5D83A 3RGRA 4WWUC 4HM1B 3N54B 1QALA 1U5OA 3CCS3 1FA3A 2KRTA 4RBNA 1ROAA 3HX8A 4HM4B 4FMCA 4XB5A 4KFDA 5CXOA 3D3LA 3FH1A 3MG3A 1IDPA 1A67A 4ZM8A 4HZBB 5AEUB 4NREA 4HM3B 1KD14 2W56A 1K9M4 2W9QA 2LQVA 2RSXA 3HI7A 1O7MB 4OUQA 3CU3A 1RKYA 4FMAA 1FGTA 2F86B 3G8ZA 1JJ22 3DGNA 1QVF2 3BNEA 4HZ9B 3NM7A 2W03A 5KP1A 3EF8A 1FGRA 2CFKA 3EN1B 4XDVA 3T8NA 3EE1A 2PZVA 1OHOA 4XM4A 1W5ZA 1N5HA 2XH9A 2YFLB 3G0KA 2K0MA 3J7Yd 1YHQ3 3FSDA 3NUVA 4FCMA 4HM5B 1TU5A 3CPOA 3FG3A 3KIIA 3PS8A 3CCV3 1UI7A 4EV5A 2F98A 1K734 3MWZA 3CNXA 1C7HA 1E97A 2E2UA 4IT7A 2FGTA 3NBBA 2GEYA 1JKGA 3WMDA 2KCDA 3K7CA 1YVBI 3NV0B 6STDA 1OHPA 1W02A 3CD63 3F8HA 3GWRA 3WA2X 1W4NA 3BLZA 1QVG2 2W56B 3BNDA 3K9MC 4GB5A 1ISKA 3HZPA 2OOVC 5CF1A 1WTHA 3CCM3 3MHEA 3D9RA 2Z77A 3X3XA 2XF3A 3DGLA 1LNHA 3CCL3 3PZWA 2C10A 3JUOA 1VQ63 1GD3A 2XSHB 4CCVA 1VQ73 1UUWB 4FCZA 3KN4A 3NM2A 4R9LA 3CC73 2PNCA 4PEJA 4HM7B 1CYUA 2BMOB 1E3RA 2OTJ3 4O02B 1WMOA 2GU3A 5AIHA 1DMMA 5IG0A 3HK4A 3FF2A 2STDA 1OF5B 1HU9A 3MG1A 5EQLA 1DYUA 3EQQB 4O8SA 1K41A 1NU3A 1W6CA 3CCE3 1AV4A 2CG1A 4X2HA 4HVNA 3LT9A 1JKGB 3A76A 3DMCA 3LTBA 1YGEA 4HBRA 2GXFA 3FKAA 3FG4A 3F8XA 5JPPA 2Z7AA 1ULIB 1IVUA 1JNQA 3CMA3 3NHXA 1IVVA 1N9JA 3LZAA 3LXUX 4N6UA 2SBLA 1KC84 3RDEA 1QAKA 1G96A 3EX9A 3NXJA 3OXAA 1GY5A 3DY5A 4FMBA 1W00A 3GZYB 4BTYA 4HM2B 1SIHA 3WDGB 1PFPA 4N6MA 4N6LA 2IUKA 4U13A 2WOFA 3DUKA 3ER7A 2LYXA 5CF2A 3CME3 3IPTA 3CPW2 1V74A 3LH4A 4STDA 2KXGA 3GZRA 3SOAA 1RRLA 3JUQA 1D6YA 3NBJA 2OQEA 3EBTA 3BB9A 5A0OB 1CQSA 3ALAA 4LZIA 2QA43 1TP6A 2OWPA 1OCVA 2XGNA 3K63A 4R4KA 3GZXB 3NV0A 1TFOA 2WOHA 4R9KA 2RGQA 2XEPA 5AEWB 4CDLA 3UL6A 3LTAA 2CC3A 3KE7A 4HM0B 4AEQA 5ELJA 3PGBA 4K1VA 1IVWA 2CWTA 3VF1A 3F14A 2M7OA 4IIAA 1IK3A 3MG2A 5AIGA 4EV2A 3I563 3LTCA 3Q90A 3B4OA 5DRVA 3CC43 2XSOB 1OPYA 1L5GB 5BXQA 4H3UA 4MMYB 2JDIH 2E2TA 1IT7A 1JB5A 1NDOB 1VQ83 4G1MB 2V1LA 1O7WB 1SPUA 2HMJB 3T8UA 2INXA 1DMQA 2FXTA 1SQWA 3FLJA 2XFSA 5EEOA 3DXOA 1RJOA 3RGAA 3X41A 3I553 2QGUA 2W9PA 3HIIA 3H3HA 1VZZA 3OWYA 3V92A 1PU4A 2Y74A 1W2B2 2YX9A 2O9UX 3OV4A 5IG5A 1HKXA 3X42A 1R4CA 1GY7A 3EN8A 5D81A 2BHMA 1UUVB 1OF5A 1Z1SA 3LYGA 4KFEA 4K1UA 3U1WA 1DMNA 3B7CA 2I9WA 4J9AA 3KZTA 4MMZB 1QMAA 3JUMA 4WHAA 2JQ5A 3V98A 1GYBA 3L0RA 4IPBA 3NBRA 4L8OA 3IMAB 4EBGA 1VQN3 2WGOA 1CEWI 2ZL8A 4EYCA 1EA2A 1VQP3 3V99A 1S723 1D6ZA 4R80A 2P0XA 2CG0A 3U97A 1VQ43 1VQO3 2W2CA 3M8CA 5IERA 1JV2B 3N8BA 5AIIA 3X3YA 5LC6A 1A90A 5CK6A 3LMLA 8CHOA 1TIJA 1N8R4 1UW1A 1YJN3 5IEPA 3MSOA 3JUPA 2O3OA 5FW5A 1WNHA 3S27A 3CCJ3 4OK0A 3DGMA 5JPUA 2IA7A 1GY6A 1OGZA 2Y73A 1Q814 3CXC2 1LXEA 3CCU3 2CIUA 3LOYA 2ML6A 2FNQA 2Z6BA 2K54A 3EJVA 3BNBA 5STDA 4RNYA 1W2ZA 3K5TA 1IVXA 3NX0A 1NB3I 1E3VA 4H61A 3BNCA 2W04A 4RNZA 5BVBA 2OTL3 3FGYA 1ROVA 1YJ93 3KSED 4HJLB 1U8CB 5G2GA 3VSYA 3CNMA 4ORLA 4BTXA 1K28A 1IQYA 1WMNA 5FGOA 1AVKA 3FG1A 2CKFB 1SIIA 2HMKB 2BMQB 3WOEB 3STDA 3PCRA 5I97A 4L8PA 2XRXB 2D42A 3OX9A 2P38A 4R1KA 4LSOA 4Q53A 3EC9A 4AKYA 2GEXA 4N6OB 5CLKA 3LT8A 1O7PB 4X2OA 1VQK3 1QAFA 1MOLA 1YJW3 1ULJB 2YFIB 1FUWA 1M9GA 3Q2PA 1O7NB 3F7XA 1NJI4 3UJMA 1IV9A 4JF8A 1VQ53 1OACA 3SEDA 3WODG 3G6E3 2E2VA 3JVCA 2YFJB 3ROBA 1Q824 2C11A 1TFKA 1OGXA 4OVMA 1N5PA 4KFFA 2CFLA 2GU1A 1K8A4 2CWVA 2ML5A 1TUHA 1IU7A 1MNLA 3KFQC 2CH9A 3MKIA 4L7KA 3O8YA 2OOVA 3CC23 3UL5A 3MPHA 1IQ8A 2BO9B 3G4S3 2WGQA 5ELUA 4O3VA 3QRDA 4K61A 4JRFA 4HM8B 5AYSC 1JN5B 1M904 2IUJA 3WA3A 1ASKA 1IV7A 3S5CA 4K90B 4NHFA 3FF0A 3SVAA 2QIYA 1Y4KA 3AMOA 1FGMA 3S28A 1O7HB 3I0YA 3ECFA 3S29A 2L4VA 2R4IA 1Q40A 4LMIA 4HYZA 3FZWA 1US1A 1YIJ3 1FGOA 1OH0A 3T0UA 2B24B 2HMLB 3DZLA 2MC8A 2CFGA 1ZX2A 2QEX3 4TX4A 4MJDA 1JB2A 2W6JH 3TDGA 2GBWB 3G16A 3PXMA 1W01A 1BUQA 4EC6A 1EG9B 2A15A 1JB4A 2UX0A 3MYTA 2BNGA 3UNLA 4MMXB 1VQL3 1JRQA 4XBTA 5EVHA 2XFTA 4FMDA 1N8QA 3K0ZA 1M1K4 1VQM3 4BTWA 1M1XB 1GS3A 3H51A 5AYRB 3HIGA 4HM6B 5DREA 3KSPA 4KVHA 3NQYA 3PCSA 2HMNB 2Z76A 4N6TA 4FCJA 1W6YA 3SXXA 7STDA 1STDA 2P05A 1YI23 3LTDA 3AMOB 1YIT3 1KQS2 2CFDA 5KP3A 3WOFB 1FGQA 1EQKA 1W6GA 1O7GB 1Q40B 3OW22 5LC7A 3B4PA 2XR8B 2W0QA 2WO0A 2CK3H 4LGQA 4WP5A 1RRHA 3GAXA 2ZDJA 3Q1CA 4QWTA 3OWSA 4WFOA 4I4KA 3S67A 1AR0A 2OQEC 3N9HA 4XBXA 1D6UA 1J2BA 4LEHA 5TGNA 1RN7A 2CW9A 4KZ1A 3GZBA 1EKMA 3OWUA 1QJGA 1KSIA 3F40A 3IJEB 2GBXB 1NO3A 2P0MA 2HMOB 3NQZA 1CYVA 1KWIA 2BT3A 4GL6A 1F8NA 3VGNA 4WYKA 3QK9A 3F9SA 4J8TA 3PYJA 2HMMB 1UI8A 1JN5A 1LVNA 1NWWA 3F7SA 5IW9A 1OUNA 3UB1A 2Q07A 3JUNA 1A2KA 1T5YA 3X40A 1W7CA 1NB5I 1Q42A 3B8LA 4EXRA 4N6NB 1DVCA 1WQLB 1Q7Y4 1N9EA 5AIFA 2OCTA 4O2HA 2B1XB 2BMRB 3CCR3 2IMJA 2CHCA 1LOXA 1AVLA 3CCQ3 1ZO2A 3EHCA 2XGLA 3G713 3SX1A 1DVDA 4XDWA 1A2VA 1IQXA 3E99A 3FCSB 2P09A 1STFI 2F99A 5KP4A 5D82A 1Q864 4RZMA 4FR9A 1GD4A 3SOYA 2MF7A 5IENA 4WYKB 5IEOA 2RFRA 5HGRA 2CFWA 1S5AA 3X3ZA 3DM8A 4HKVB 1OHSA 2RCDA 5IG3A 3EB8A 3GRDA 4AKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBY A;  3KKG A;  4N3V A;  1SJW A;  5AI1 A;  3EBY A;  5IF6 A;  5IG4 A;  3RGR A;  5D83 A;  4WWU C;  4HM1 B;  1U5O A;  3HX8 A;  4HM4 B;  4XB5 A;  5CXO A;  3FH1 A;  3MG3 A;  1IDP A;  4HZB B;  5AEU B;  4HM3 B;  1O7M B;  4OUQ A;  3CU3 A;  2F86 B;  3G8Z A;  4HZ9 B;  5KP1 A;  3EF8 A;  3EN1 B;  4XDV A;  3T8N A;  2PZV A;  1OHO A;  4XM4 A;  2YFL B;  3G0K A;  3FSD A;  3NUV A;  4FCM A;  4HM5 B;  3CPO A;  2F98 A;  3CNX A;  1C7H A;  1E97 A;  2GEY A;  1JKG A;  3WMD A;  3K7C A;  3NV0 B;  6STD A;  1OHP A;  1W02 A;  3F8H A;  3GWR A;  3BLZ A;  4GB5 A;  1ISK A;  3HZP A;  5CF1 A;  3MHE A;  3D9R A;  2Z77 A;  3JUO A;  2XSH B;  1UUW B;  3NM2 A;  4R9L A;  4PEJ A;  4HM7 B;  2BMO B;  1E3R A;  5AIH A;  1DMM A;  5IG0 A;  3HK4 A;  3FF2 A;  2STD A;  1OF5 B;  3MG1 A;  3EQQ B;  1K41 A;  1NU3 A;  4X2H A;  4HVN A;  1JKG B;  3A76 A;  3DMC A;  3FKA A;  2GXF A;  3F8X A;  5JPP A;  2Z7A A;  1ULI B;  3NHX A;  3LZA A;  3OXA A;  3EX9 A;  3NXJ A;  1GY5 A;  1W00 A;  3GZY B;  4HM2 B;  4U13 A;  3DUK A;  3ER7 A;  5CF2 A;  3IPT A;  4STD A;  3GZR A;  3SOA A;  3JUQ A;  3EBT A;  3BB9 A;  1CQS A;  1TP6 A;  2OWP A;  1OCV A;  3GZX B;  3NV0 A;  4R9K A;  2RGQ A;  5AEW B;  4CDL A;  3KE7 A;  4HM0 B;  4K1V A;  3F14 A;  4IIA A;  3MG2 A;  5AIG A;  3Q90 A;  3B4O A;  5DRV A;  2XSO B;  1OPY A;  5BXQ A;  4H3U A;  1JB5 A;  1NDO B;  1O7W B;  2HMJ B;  3T8U A;  2INX A;  1DMQ A;  3FLJ A;  3DXO A;  3RGA A;  2QGU A;  3OWY A;  3H3H A;  1VZZ A;  3OV4 A;  5IG5 A;  1HKX A;  1GY7 A;  5D81 A;  3EN8 A;  1UUV B;  1OF5 A;  1Z1S A;  3LYG A;  4K1U A;  1DMN A;  3B7C A;  2I9W A;  4J9A A;  3KZT A;  1QMA A;  3JUM A;  2JQ5 A;  1GYB A;  3NBR A;  4L8O A;  1EA2 A;  2W2C A;  3M8C A;  5IER A;  5AII A;  5CK6 A;  8CHO A;  5IEP A;  3MSO A;  3JUP A;  5FW5 A;  5JPU A;  1GY6 A;  1OGZ A;  3EJV A;  2K54 A;  5STD A;  1E3V A;  5BVB A;  3FGY A;  4HJL B;  5G2G A;  3VSY A;  3CNM A;  4ORL A;  2CKF B;  2HMK B;  2BMQ B;  3STD A;  4L8P A;  2XRX B;  3OX9 A;  4R1K A;  4Q53 A;  3EC9 A;  2GEX A;  5CLK A;  1O7P B;  4X2O A;  1ULJ B;  2YFI B;  1O7N B;  3F7X A;  3UJM A;  3SED A;  2YFJ B;  3ROB A;  1OGX A;  4OVM A;  1TUH A;  3MKI A;  4L7K A;  4HM8 B;  1JN5 B;  1ASK A;  3S5C A;  3FF0 A;  2QIY A;  1O7H B;  3I0Y A;  3ECF A;  2R4I A;  1Q40 A;  4LMI A;  3FZW A;  1OH0 A;  2B24 B;  2HML B;  3DZL A;  1ZX2 A;  4MJD A;  1JB2 A;  2GBW B;  3G16 A;  1W01 A;  1BUQ A;  1EG9 B;  2A15 A;  1JB4 A;  2UX0 A;  3MYT A;  2BNG A;  3UNL A;  4XBT A;  5EVH A;  3K0Z A;  3H51 A;  1GS3 A;  4HM6 B;  5DRE A;  3KSP A;  4KVH A;  2HMN B;  2Z76 A;  4FCJ A;  1W6Y A;  7STD A;  1STD A;  5KP3 A;  1O7G B;  1Q40 B;  3B4P A;  2XR8 B;  4LGQ A;  4WP5 A;  3OWS A;  4I4K A;  1AR0 A;  4XBX A;  4LEH A;  5TGN A;  3GZB A;  3OWU A;  1QJG A;  3F40 A;  2GBX B;  2HMO B;  3VGN A;  4WYK A;  3F9S A;  4J8T A;  2HMM B;  1JN5 A;  1NWW A;  3F7S A;  1OUN A;  3JUN A;  1A2K A;  1Q42 A;  3B8L A;  1WQL B;  5AIF A;  2B1X B;  2BMR B;  2IMJ A;  2CHC A;  1ZO2 A;  3EHC A;  4XDW A;  3E99 A;  2F99 A;  5KP4 A;  5D82 A;  4RZM A;  3SOY A;  5IEN A;  4WYK B;  5IEO A;  2RFR A;  5HGR A;  1S5A A;  3DM8 A;  4HKV B;  1OHS A;  2RCD A;  5IG3 A;  3GRD A; 
#chains in the Genus database with same CATH topology
 4XBY A;  1IT8 A;  1VQ9 3;  1ZGX A;  1WMP A;  3KKG A;  1BRK A;  2KAA A;  3DGO A;  3SLU A;  5JBS A;  4N3V A;  4MEI A;  2CWU A;  2ZHX B;  1SJW A;  2D1W A;  3EBY A;  5AI1 A;  1RGL A;  1YGW A;  5IF6 A;  5IG4 A;  4N6V 0;  5D83 A;  3RGR A;  4WWU C;  4HM1 B;  3N54 B;  1RMS A;  1QAL A;  1U5O A;  3CCS 3;  1MGR A;  1FA3 A;  2KRT A;  4RBN A;  1BNE A;  1ROA A;  1BSE A;  3HX8 A;  4HM4 B;  4FMC A;  1T2H A;  4KFD A;  4XB5 A;  3D3L A;  3FH1 A;  3MG3 A;  1CH0 A;  1I70 A;  1IDP A;  4HZB B;  5CXO A;  4NRE A;  4HM3 B;  1X1W A;  4ZM8 A;  5AEU B;  1KD1 4;  2W56 A;  1K9M 4;  2W9Q A;  6RNT A;  2LQV A;  2RSX A;  3HI7 A;  1O7M B;  4OUQ A;  3CU3 A;  1RKY A;  1X1X A;  1T2I A;  4FMA A;  1FGT A;  2F86 B;  3G8Z A;  1JJ2 2;  3DGN A;  1YVS A;  3BNE A;  1QVF 2;  4HZ9 B;  3NM7 A;  2W03 A;  5KP1 A;  3EF8 A;  1FGR A;  2CFK A;  1RDS A;  3EN1 B;  4XDV A;  3T8N A;  1MWU A;  3EE1 A;  2PZV A;  3SVA A;  1OHO A;  4XM4 A;  1W5Z A;  1N5H A;  1MGW A;  2XH9 A;  2YFL B;  7RNT A;  1B3S A;  3G0K A;  2K0M A;  5HOH A;  3J7Y d;  3Q3F A;  1YHQ 3;  3FSD A;  3NUV A;  4FCM A;  4HM5 B;  1BSD A;  1TU5 A;  3CPO A;  3FG3 A;  3KII A;  3PS8 A;  3CCV 3;  1UI7 A;  2KF5 A;  4EV5 A;  3A5E A;  2F98 A;  1K73 4;  1BU4 A;  3MWZ A;  3CNX A;  1C7H A;  1E97 A;  2C4B A;  2E2U A;  2KF3 A;  4HOH A;  2FGT A;  4IT7 A;  4EW5 A;  1RLS A;  1SAR A;  1GMR A;  2GEY A;  1BVI A;  3NBB A;  5BU4 A;  1G02 A;  1JKG A;  2KCD A;  4GHO A;  3K7C A;  1YVB I;  3WMD A;  1GOU A;  3NV0 B;  4CPK A;  6STD A;  1OHP A;  1W02 A;  1JZO A;  7GSP A;  3CD6 3;  3F8H A;  3GWR A;  3WA2 X;  1W4N A;  1DET A;  3BLZ A;  4DKI A;  1UUG B;  1QVG 2;  2W56 B;  3BND A;  3K9M C;  4GB5 A;  1ISK A;  3HZP A;  1X1Y A;  2OOV C;  5G1K A;  5CF1 A;  1WTH A;  1EEJ A;  3CCM 3;  3SYU A;  3MHE A;  3D9R A;  1JBS A;  2Z77 A;  3X3X A;  2XF3 A;  3DGL A;  1LNH A;  3CCL 3;  1RGH A;  2C10 A;  3PZW A;  3JUO A;  1TRQ A;  1VQ6 3;  1GD3 A;  1GOV A;  2XSH B;  4CCV A;  1FUT A;  1VQ7 3;  1UUW B;  4FCZ A;  3KN4 A;  3NM2 A;  4R9L A;  2RBI A;  2AAE A;  2PNC A;  4PEJ A;  4HM7 B;  5M18 A;  1CYU A;  2BMO B;  1E3R A;  2OTJ 3;  4O02 B;  1I8V A;  3ZG5 A;  1WMO A;  2GU3 A;  3KCH A;  5AIH A;  2BU4 A;  1DMM A;  5IG0 A;  3HK4 A;  3FF2 A;  1A2P A;  2STD A;  1OF5 B;  1HU9 A;  3MG1 A;  5EQL A;  9RNT A;  1DYU A;  3EQQ B;  1B20 A;  1BIR A;  1K41 A;  1NU3 A;  1W6C A;  4O8S A;  3CCE 3;  1AV4 A;  1RCK A;  2CG1 A;  2K3D A;  4X2H A;  4HVN A;  2CX0 A;  3LT9 A;  1JKG B;  3A76 A;  3DMC A;  3LTB A;  1YGE A;  4HBR A;  2GXF A;  3FKA A;  1GMP A;  3FG4 A;  3F8X A;  1I2E A;  5JPP A;  2Z7A A;  1ULI B;  1UDI I;  1IVU A;  1JNQ A;  1B27 A;  3CMA 3;  3NHX A;  3D5G A;  1IVV A;  1YNV X;  1N9J A;  3LZA A;  3LXU X;  4N6U A;  2SBL A;  3HOH A;  1KC8 4;  3RDE A;  1QAK A;  1G96 A;  3EX9 A;  3NXJ A;  3OXA A;  1GY5 A;  3DY5 A;  4FMB A;  1W00 A;  3GZY B;  1BSC A;  1RNB A;  1FZU A;  4BTY A;  4HM2 B;  1SIH A;  3WDG B;  1PFP A;  4N6M A;  4N6L A;  2IUK A;  4U13 A;  2WOF A;  3DUK A;  3ER7 A;  3U1W A;  2LYX A;  1B2M A;  5CF2 A;  3CME 3;  3IPT A;  3CPW 2;  1I0X A;  1FW7 A;  1V74 A;  3LH4 A;  1B2S A;  4STD A;  2KXG A;  3GZR A;  3SOA A;  1RRL A;  3JUQ A;  1D6Y A;  3NBJ A;  1MWR A;  2OQE A;  3EBT A;  3BB9 A;  5A0O B;  1BRI A;  1CQS A;  1HZ1 A;  3ALA A;  1BUJ A;  4LZI A;  2QA4 3;  1TP6 A;  2OWP A;  1BGS A;  1OCV A;  2XGN A;  3K63 A;  4R4K A;  1HYF A;  3GZX B;  1TFO A;  2WOH A;  3NV0 A;  4R9K A;  2RGQ A;  3ZFZ A;  2XEP A;  5AEW B;  4CDL A;  3UL6 A;  1T3B A;  3LTA A;  2CC3 A;  3KE7 A;  4HM0 B;  4AEQ A;  5ELJ A;  3PGB A;  4K1V A;  1IVW A;  2CWT A;  3VF1 A;  1BNR A;  3F14 A;  2M7O A;  4IIA A;  1IK3 A;  3MG2 A;  5AIG A;  4EV2 A;  3I56 3;  5GSP A;  3LTC A;  3Q90 A;  3B4O A;  5DRV A;  1Q9E A;  3CC4 3;  1LOW A;  2XSO B;  1OPY A;  1I2F A;  1L5G B;  5BXQ A;  4KT3 B;  4H3U A;  4MMY B;  2JDI H;  2E2T A;  1IT7 A;  1JB5 A;  1NDO B;  1RCL A;  1VQ8 3;  4G1M B;  2V1L A;  1O7W B;  1SPU A;  2HMJ B;  3T8U A;  2INX A;  1BAN A;  1DMQ A;  2FXT A;  1RN1 A;  1SQW A;  3FLJ A;  2XFS A;  5EEO A;  3DXO A;  1RJO A;  3RGA A;  3X41 A;  3I55 3;  2QGU A;  2W9P A;  3HII A;  3H3H A;  1VZZ A;  3OWY A;  3V92 A;  4BL2 A;  1PU4 A;  2Y74 A;  1W2B 2;  2YX9 A;  2O9U X;  2CX1 A;  3OV4 A;  5IG5 A;  1LQM B;  1HKX A;  3X42 A;  1R4C A;  1B2X A;  1GY7 A;  2IYJ A;  3EN8 A;  2BHM A;  1UUV B;  1OF5 A;  1Z1S A;  3LYG A;  4KFE A;  4K1U A;  5D81 A;  1DMN A;  3B7C A;  2I9W A;  4J9A A;  3KZT A;  4MMZ B;  5G1L A;  1BSA A;  1G0T A;  1JZD A;  1QMA A;  3JUM A;  1A67 A;  4I5Q A;  1Q7H A;  1RGF A;  4WHA A;  1UCI A;  2JQ5 A;  3V98 A;  1GYB A;  3L0R A;  4IPB A;  1VQQ A;  3NBR A;  4L8O A;  3IMA B;  4EBG A;  1VQN 3;  2WGO A;  1B2Z A;  1CEW I;  2ZL8 A;  4EYC A;  1EA2 A;  1VQP 3;  3V99 A;  1RGK A;  1S72 3;  1D6Z A;  4R80 A;  2P0X A;  2CG0 A;  3U97 A;  1VQ4 3;  1VQO 3;  2W2C A;  3M8C A;  1RSN A;  5IER A;  1RNT A;  1LRA A;  3AGN A;  1JV2 B;  3N8B A;  5AII A;  6GSP A;  4RNT A;  3X3Y A;  2H0G A;  5LC6 A;  1I2G A;  1A90 A;  5CK6 A;  2R41 A;  3LML A;  1TIJ A;  1NNV A;  8CHO A;  1N8R 4;  1UW1 A;  1YJN 3;  5IEP A;  3MSO A;  3JUP A;  1BRH A;  1BRG A;  2O3O A;  5FW5 A;  1WNH A;  3S27 A;  3CCJ 3;  4OK0 A;  3DGM A;  1GOY A;  5JPU A;  2IA7 A;  1GY6 A;  2AAD A;  1OGZ A;  2Y73 A;  1Q81 4;  3CXC 2;  1LXE A;  2F4Y A;  3CCU 3;  2CIU A;  3LOY A;  2ML6 A;  2FNQ A;  2Z6B A;  2K54 A;  3EJV A;  4CJN A;  3BNB A;  3RNT A;  5STD A;  4RNY A;  1W2Z A;  3K5T A;  1IVX A;  3NX0 A;  1NB3 I;  1E3V A;  4H61 A;  3BNC A;  2W04 A;  4RNZ A;  5BVB A;  2OTL 3;  3FGY A;  1ROV A;  3WR2 A;  3KSE D;  1YJ9 3;  4HJL B;  1U8C B;  1UGH I;  5G2G A;  3VSY A;  3CNM A;  4ORL A;  4BTX A;  1UCK A;  1K28 A;  1IQY A;  1WMN A;  5FGO A;  1AVK A;  3FG1 A;  2CKF B;  3WHO A;  1SII A;  2HMK B;  2IY2 A;  2BMQ B;  3WOE B;  3STD A;  1BRS A;  3PCR A;  5I97 A;  1PYL A;  4L8P A;  1LOV A;  2D42 A;  2XRX B;  3OX9 A;  2P38 A;  4R1K A;  4LSO A;  4Q53 A;  3EC9 A;  4AKY A;  2GEX A;  4N6O B;  5CLK A;  3LT8 A;  1O7P B;  3BIR A;  4X2O A;  1VQK 3;  1QAF A;  1MOL A;  1YJW 3;  1ULJ B;  2YFI B;  1FUW A;  1M9G A;  3Q2P A;  1O7N B;  3F7X A;  1NJI 4;  3UJM A;  1IV9 A;  4JF8 A;  1VQ5 3;  1OAC A;  3SED A;  2H0I A;  4NPB A;  3WOD G;  3G6E 3;  2E2V A;  3JVC A;  2YFJ B;  3ROB A;  1Q82 4;  5RNT A;  2C11 A;  1RTU A;  1TFK A;  1OGX A;  4OVM A;  1N5P A;  1RGA A;  4KFF A;  2CFL A;  2GU1 A;  1K8A 4;  2CWV A;  3AHW A;  2ML5 A;  1TUH A;  1IU7 A;  1BNS A;  1MNL A;  3KFQ C;  2CH9 A;  3MKI A;  4L7K A;  1UGI A;  3O8Y A;  2OOV A;  3CC2 3;  3UL5 A;  3MPH A;  1IQ8 A;  2BO9 B;  3G4S 3;  1LNI A;  2WGQ A;  5ELU A;  4O3V A;  3CC7 3;  3QRD A;  2RNT A;  4K61 A;  4JRF A;  1FYS A;  4HM8 B;  5AYS C;  1JN5 B;  1M90 4;  2IUJ A;  3WA3 A;  1BSB A;  1ASK A;  1IV7 A;  1BOX A;  3S5C A;  4K90 B;  2F5M A;  3AGO A;  3D5I A;  3FF0 A;  2QIY A;  1Y4K A;  3AMO A;  1I0V A;  1FGM A;  4NHF A;  3S28 A;  1O7H B;  3I0Y A;  2BIR A;  3ECF A;  3S29 A;  2L4V A;  2UUG C;  2R4I A;  1Q40 A;  5M1A A;  4LMI A;  4HYZ A;  3GSP A;  1ZS7 A;  3FZW A;  1US1 A;  1YIJ 3;  1FGO A;  1OH0 A;  3T0U A;  2B24 B;  2HML B;  3DZL A;  2MC8 A;  2CFG A;  1ZX2 A;  2QEX 3;  4TX4 A;  1RHL A;  1I3F A;  4MJD A;  2F5W A;  1JB2 A;  2UGI A;  2W6J H;  3TDG A;  2GBW B;  3G16 A;  3PXM A;  1DE3 A;  1PY3 A;  1W01 A;  1BUQ A;  4EC6 A;  3AHS A;  1EG9 B;  2A15 A;  1JB4 A;  2UX0 A;  3MYT A;  2BNG A;  3UNL A;  1JBR A;  4MMX B;  1B2U A;  1VQL 3;  1JRQ A;  4XBT A;  5EVH A;  2XFT A;  4FMD A;  1N8Q A;  3K0Z A;  1M1K 4;  4HAA A;  1VQM 3;  1AQZ A;  3URP A;  4BTW A;  1M1X B;  1GS3 A;  3H51 A;  5AYR B;  3HIG A;  1R4Y A;  4HM6 B;  5DRE A;  3KSP A;  4KVH A;  3NQY A;  3PCS A;  2HMN B;  2Z76 A;  4N6T A;  4FCJ A;  1W6Y A;  3SXX A;  1TRP A;  7STD A;  1STD A;  1BAO A;  2P05 A;  1BRJ A;  1YI2 3;  3LTD A;  3AMO B;  1YIT 3;  1KQS 2;  2CFD A;  5KP3 A;  3WOF B;  1FGQ A;  1EQK A;  1W6G A;  1O7G B;  1Q40 B;  3OW2 2;  1BNG A;  5LC7 A;  3B4P A;  4J5G A;  2XR8 B;  1UCL A;  2W0Q A;  2WO0 A;  2CK3 H;  4LGQ A;  4WP5 A;  1RRH A;  1IYY A;  3GAX A;  2ZDJ A;  3Q1C A;  4QWT A;  3OWS A;  4WFO A;  4I4K A;  3S67 A;  1AR0 A;  2OQE C;  3N9H A;  2J8X B;  1V57 A;  4XBX A;  1C54 A;  1D6U A;  2GSP A;  1J2B A;  1RGE A;  4LEH A;  5TGN A;  1RN7 A;  2CW9 A;  1EUI C;  1BNJ A;  2ZA4 A;  4KZ1 A;  8RNT A;  3DH2 A;  1RGC A;  3GZB A;  1EKM A;  3OWU A;  1QJG A;  1KSI A;  3F40 A;  3IJE B;  2GBX B;  1NO3 A;  2P0M A;  2HMO B;  2L1S A;  1CYV A;  1KWI A;  1GMQ A;  2BT3 A;  3NQZ A;  4GL6 A;  1F8N A;  3VGN A;  4WYK A;  4ILF A;  3QK9 A;  3F9S A;  1MWS A;  3PYJ A;  3DGY A;  4J8T A;  2HMM B;  1UI8 A;  1JN5 A;  1LVN A;  1NWW A;  3F7S A;  5IW9 A;  1OUN A;  3UB1 A;  2Q07 A;  1BNF A;  3JUN A;  4BL3 A;  2KF6 A;  1A2K A;  1T5Y A;  3X40 A;  1W7C A;  1RN4 A;  1UCJ A;  1NB5 I;  1Q42 A;  1TJD A;  3B8L A;  4EXR A;  4N6N B;  3D79 A;  5M19 A;  1DVC A;  1WQL B;  1V58 A;  1Q7Y 4;  1N9E A;  5AIF A;  1FUS A;  1MWT A;  2OCT A;  4O2H A;  2B1X B;  2BMR B;  3CCR 3;  2F56 A;  1LQG C;  2IMJ A;  2CHC A;  1LOX A;  1TTO A;  1AVL A;  3CCQ 3;  1ZO2 A;  1X1U A;  3EHC A;  2XGL A;  1BRN L;  3G71 3;  3SX1 A;  1DVD A;  1AY7 A;  4XDW A;  2SAR A;  1A2V A;  1IQX A;  1RGG A;  3E99 A;  3FCS B;  5BIR A;  4BIR A;  2KF4 A;  2P09 A;  1STF I;  2HOH A;  3BU4 A;  2F99 A;  4J5K A;  5D82 A;  1LOY A;  5KP4 A;  1Q86 4;  4RZM A;  4FR9 A;  1GD4 A;  3D4A A;  3SOY A;  2MF7 A;  5IEN A;  1JBT A;  3ZG0 A;  2H0H A;  4WYK B;  5IEO A;  2RFR A;  5HGR A;  2CFW A;  1S5A A;  3X3Z A;  3DM8 A;  4HKV B;  4LYL B;  1GSP A;  1B21 A;  1BNI A;  1OHS A;  2RCD A;  1I3I A;  5IG3 A;  3EB8 A;  4GSP A;  4BU4 A;  3GRD A;  4AKZ A; 
#chains in the Genus database with same CATH homology
 4XBY A;  1IT8 A;  1VQ9 3;  1WMP A;  3KKG A;  3DGO A;  3SLU A;  5JBS A;  4N3V A;  4MEI A;  2CWU A;  1SJW A;  2D1W A;  3EBY A;  5AI1 A;  5IF6 A;  5IG4 A;  4N6V 0;  5D83 A;  3RGR A;  4WWU C;  4HM1 B;  3N54 B;  1QAL A;  1U5O A;  3CCS 3;  1FA3 A;  2KRT A;  4RBN A;  1ROA A;  3HX8 A;  4HM4 B;  4FMC A;  4XB5 A;  4KFD A;  5CXO A;  3D3L A;  3FH1 A;  3MG3 A;  1IDP A;  1A67 A;  4ZM8 A;  4HZB B;  5AEU B;  4NRE A;  4HM3 B;  1KD1 4;  2W56 A;  1K9M 4;  2W9Q A;  2LQV A;  2RSX A;  3HI7 A;  1O7M B;  4OUQ A;  3CU3 A;  1RKY A;  4FMA A;  1FGT A;  2F86 B;  3G8Z A;  1JJ2 2;  3DGN A;  1QVF 2;  3BNE A;  4HZ9 B;  3NM7 A;  2W03 A;  5KP1 A;  3EF8 A;  1FGR A;  2CFK A;  3EN1 B;  4XDV A;  3T8N A;  3EE1 A;  2PZV A;  1OHO A;  4XM4 A;  1W5Z A;  1N5H A;  2XH9 A;  2YFL B;  3G0K A;  2K0M A;  3J7Y d;  1YHQ 3;  3FSD A;  3NUV A;  4FCM A;  4HM5 B;  1TU5 A;  3CPO A;  3FG3 A;  3KII A;  3PS8 A;  3CCV 3;  1UI7 A;  4EV5 A;  2F98 A;  1K73 4;  3MWZ A;  3CNX A;  1C7H A;  1E97 A;  2E2U A;  4IT7 A;  2FGT A;  3NBB A;  2GEY A;  1JKG A;  3WMD A;  2KCD A;  3K7C A;  1YVB I;  3NV0 B;  6STD A;  1OHP A;  1W02 A;  3CD6 3;  3F8H A;  3GWR A;  3WA2 X;  1W4N A;  3BLZ A;  1QVG 2;  2W56 B;  3BND A;  3K9M C;  4GB5 A;  1ISK A;  3HZP A;  2OOV C;  5CF1 A;  1WTH A;  3CCM 3;  3MHE A;  3D9R A;  2Z77 A;  3X3X A;  2XF3 A;  3DGL A;  1LNH A;  3CCL 3;  3PZW A;  2C10 A;  3JUO A;  1VQ6 3;  1GD3 A;  2XSH B;  4CCV A;  1VQ7 3;  1UUW B;  4FCZ A;  3KN4 A;  3NM2 A;  4R9L A;  3CC7 3;  2PNC A;  4PEJ A;  4HM7 B;  1CYU A;  2BMO B;  1E3R A;  2OTJ 3;  4O02 B;  1WMO A;  2GU3 A;  5AIH A;  1DMM A;  5IG0 A;  3HK4 A;  3FF2 A;  2STD A;  1OF5 B;  1HU9 A;  3MG1 A;  5EQL A;  1DYU A;  3EQQ B;  4O8S A;  1K41 A;  1NU3 A;  1W6C A;  3CCE 3;  1AV4 A;  2CG1 A;  4X2H A;  4HVN A;  3LT9 A;  1JKG B;  3A76 A;  3DMC A;  3LTB A;  1YGE A;  4HBR A;  2GXF A;  3FKA A;  3FG4 A;  3F8X A;  5JPP A;  2Z7A A;  1ULI B;  1IVU A;  1JNQ A;  3CMA 3;  3NHX A;  1IVV A;  1N9J A;  3LZA A;  3LXU X;  4N6U A;  2SBL A;  1KC8 4;  3RDE A;  1QAK A;  1G96 A;  3EX9 A;  3NXJ A;  3OXA A;  1GY5 A;  3DY5 A;  4FMB A;  1W00 A;  3GZY B;  4BTY A;  4HM2 B;  1SIH A;  3WDG B;  1PFP A;  4N6M A;  4N6L A;  2IUK A;  4U13 A;  2WOF A;  3DUK A;  3ER7 A;  2LYX A;  5CF2 A;  3CME 3;  3IPT A;  3CPW 2;  1V74 A;  3LH4 A;  4STD A;  2KXG A;  3GZR A;  3SOA A;  1RRL A;  3JUQ A;  1D6Y A;  3NBJ A;  2OQE A;  3EBT A;  3BB9 A;  5A0O B;  1CQS A;  3ALA A;  4LZI A;  2QA4 3;  1TP6 A;  2OWP A;  1OCV A;  2XGN A;  3K63 A;  4R4K A;  3GZX B;  3NV0 A;  1TFO A;  2WOH A;  4R9K A;  2RGQ A;  2XEP A;  5AEW B;  4CDL A;  3UL6 A;  3LTA A;  2CC3 A;  3KE7 A;  4HM0 B;  4AEQ A;  5ELJ A;  3PGB A;  4K1V A;  1IVW A;  2CWT A;  3VF1 A;  3F14 A;  2M7O A;  4IIA A;  1IK3 A;  3MG2 A;  5AIG A;  4EV2 A;  3I56 3;  3LTC A;  3Q90 A;  3B4O A;  5DRV A;  3CC4 3;  2XSO B;  1OPY A;  1L5G B;  5BXQ A;  4H3U A;  4MMY B;  2JDI H;  2E2T A;  1IT7 A;  1JB5 A;  1NDO B;  1VQ8 3;  4G1M B;  2V1L A;  1O7W B;  1SPU A;  2HMJ B;  3T8U A;  2INX A;  1DMQ A;  2FXT A;  1SQW A;  3FLJ A;  2XFS A;  5EEO A;  3DXO A;  1RJO A;  3RGA A;  3X41 A;  3I55 3;  2QGU A;  2W9P A;  3HII A;  3H3H A;  1VZZ A;  3OWY A;  3V92 A;  1PU4 A;  2Y74 A;  1W2B 2;  2YX9 A;  2O9U X;  3OV4 A;  5IG5 A;  1HKX A;  3X42 A;  1R4C A;  1GY7 A;  3EN8 A;  5D81 A;  2BHM A;  1UUV B;  1OF5 A;  1Z1S A;  3LYG A;  4KFE A;  4K1U A;  3U1W A;  1DMN A;  3B7C A;  2I9W A;  4J9A A;  3KZT A;  4MMZ B;  1QMA A;  3JUM A;  4WHA A;  2JQ5 A;  3V98 A;  1GYB A;  3L0R A;  4IPB A;  3NBR A;  4L8O A;  3IMA B;  4EBG A;  1VQN 3;  2WGO A;  1CEW I;  2ZL8 A;  4EYC A;  1EA2 A;  1VQP 3;  3V99 A;  1S72 3;  1D6Z A;  4R80 A;  2P0X A;  2CG0 A;  3U97 A;  1VQ4 3;  1VQO 3;  2W2C A;  3M8C A;  5IER A;  1JV2 B;  3N8B A;  5AII A;  3X3Y A;  5LC6 A;  1A90 A;  5CK6 A;  3LML A;  8CHO A;  1TIJ A;  1N8R 4;  1UW1 A;  1YJN 3;  5IEP A;  3MSO A;  3JUP A;  2O3O A;  5FW5 A;  1WNH A;  3S27 A;  3CCJ 3;  4OK0 A;  3DGM A;  5JPU A;  2IA7 A;  1GY6 A;  1OGZ A;  2Y73 A;  1Q81 4;  3CXC 2;  1LXE A;  3CCU 3;  2CIU A;  3LOY A;  2ML6 A;  2FNQ A;  2Z6B A;  2K54 A;  3EJV A;  3BNB A;  5STD A;  4RNY A;  1W2Z A;  3K5T A;  1IVX A;  3NX0 A;  1NB3 I;  1E3V A;  4H61 A;  3BNC A;  2W04 A;  4RNZ A;  5BVB A;  2OTL 3;  3FGY A;  1ROV A;  1YJ9 3;  3KSE D;  4HJL B;  1U8C B;  5G2G A;  3VSY A;  3CNM A;  4ORL A;  4BTX A;  1K28 A;  1IQY A;  1WMN A;  5FGO A;  1AVK A;  3FG1 A;  2CKF B;  1SII A;  2HMK B;  2BMQ B;  3WOE B;  3STD A;  3PCR A;  5I97 A;  4L8P A;  2XRX B;  2D42 A;  3OX9 A;  2P38 A;  4R1K A;  4LSO A;  4Q53 A;  3EC9 A;  4AKY A;  2GEX A;  4N6O B;  5CLK A;  3LT8 A;  1O7P B;  4X2O A;  1VQK 3;  1QAF A;  1MOL A;  1YJW 3;  1ULJ B;  2YFI B;  1FUW A;  1M9G A;  3Q2P A;  1O7N B;  3F7X A;  1NJI 4;  3UJM A;  1IV9 A;  4JF8 A;  1VQ5 3;  1OAC A;  3SED A;  3WOD G;  3G6E 3;  2E2V A;  3JVC A;  2YFJ B;  3ROB A;  1Q82 4;  2C11 A;  1TFK A;  1OGX A;  4OVM A;  1N5P A;  4KFF A;  2CFL A;  2GU1 A;  1K8A 4;  2CWV A;  2ML5 A;  1TUH A;  1IU7 A;  1MNL A;  3KFQ C;  2CH9 A;  3MKI A;  4L7K A;  3O8Y A;  2OOV A;  3CC2 3;  3UL5 A;  3MPH A;  1IQ8 A;  2BO9 B;  3G4S 3;  2WGQ A;  5ELU A;  4O3V A;  3QRD A;  4K61 A;  4JRF A;  4HM8 B;  5AYS C;  1JN5 B;  1M90 4;  2IUJ A;  3WA3 A;  1ASK A;  1IV7 A;  3S5C A;  4K90 B;  4NHF A;  3FF0 A;  3SVA A;  2QIY A;  1Y4K A;  3AMO A;  1FGM A;  3S28 A;  1O7H B;  3I0Y A;  3ECF A;  3S29 A;  2L4V A;  2R4I A;  1Q40 A;  4LMI A;  4HYZ A;  3FZW A;  1US1 A;  1YIJ 3;  1FGO A;  1OH0 A;  3T0U A;  2B24 B;  2HML B;  3DZL A;  2MC8 A;  2CFG A;  1ZX2 A;  2QEX 3;  4TX4 A;  4MJD A;  1JB2 A;  2W6J H;  3TDG A;  2GBW B;  3G16 A;  3PXM A;  1W01 A;  1BUQ A;  4EC6 A;  1EG9 B;  2A15 A;  1JB4 A;  2UX0 A;  3MYT A;  2BNG A;  3UNL A;  4MMX B;  1VQL 3;  1JRQ A;  4XBT A;  5EVH A;  2XFT A;  4FMD A;  1N8Q A;  3K0Z A;  1M1K 4;  1VQM 3;  4BTW A;  1M1X B;  1GS3 A;  3H51 A;  5AYR B;  3HIG A;  4HM6 B;  5DRE A;  3KSP A;  4KVH A;  3NQY A;  3PCS A;  2HMN B;  2Z76 A;  4N6T A;  4FCJ A;  1W6Y A;  3SXX A;  7STD A;  1STD A;  2P05 A;  1YI2 3;  3LTD A;  3AMO B;  1YIT 3;  1KQS 2;  2CFD A;  5KP3 A;  3WOF B;  1FGQ A;  1EQK A;  1W6G A;  1O7G B;  1Q40 B;  3OW2 2;  5LC7 A;  3B4P A;  2XR8 B;  2W0Q A;  2WO0 A;  2CK3 H;  4LGQ A;  4WP5 A;  1RRH A;  3GAX A;  2ZDJ A;  3Q1C A;  4QWT A;  3OWS A;  4WFO A;  4I4K A;  3S67 A;  1AR0 A;  2OQE C;  3N9H A;  4XBX A;  1D6U A;  1J2B A;  4LEH A;  5TGN A;  1RN7 A;  2CW9 A;  4KZ1 A;  3GZB A;  1EKM A;  3OWU A;  1QJG A;  1KSI A;  3F40 A;  3IJE B;  2GBX B;  1NO3 A;  2P0M A;  2HMO B;  3NQZ A;  1CYV A;  1KWI A;  2BT3 A;  4GL6 A;  1F8N A;  3VGN A;  4WYK A;  3QK9 A;  3F9S A;  4J8T A;  3PYJ A;  2HMM B;  1UI8 A;  1JN5 A;  1LVN A;  1NWW A;  3F7S A;  5IW9 A;  1OUN A;  3UB1 A;  2Q07 A;  3JUN A;  1A2K A;  1T5Y A;  3X40 A;  1W7C A;  1NB5 I;  1Q42 A;  3B8L A;  4EXR A;  4N6N B;  1DVC A;  1WQL B;  1Q7Y 4;  1N9E A;  5AIF A;  2OCT A;  4O2H A;  2B1X B;  2BMR B;  3CCR 3;  2IMJ A;  2CHC A;  1LOX A;  1AVL A;  3CCQ 3;  1ZO2 A;  3EHC A;  2XGL A;  3G71 3;  3SX1 A;  1DVD A;  4XDW A;  1A2V A;  1IQX A;  3E99 A;  3FCS B;  2P09 A;  1STF I;  2F99 A;  5KP4 A;  5D82 A;  1Q86 4;  4RZM A;  4FR9 A;  1GD4 A;  3SOY A;  2MF7 A;  5IEN A;  4WYK B;  5IEO A;  2RFR A;  5HGR A;  2CFW A;  1S5A A;  3X3Z A;  3DM8 A;  4HKV B;  1OHS A;  2RCD A;  5IG3 A;  3EB8 A;  3GRD A;  4AKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...