4J8WA

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Structural protein/dna
source organism Xenopus laevis
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
total genus 29
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wA00
1P3FC 1TZYA 3C1BD 4M6BA 3C1CB 5B40D 3AZHB 4E45A 5B31C 1P3LD 3WA9B 1P3LA 4J8UA 4WU9B 3WA9A 5GT0A 1P3OD 3X1SC 3W97A 1KX5B 3W96A 5DNMB 5GT0B 4YS3D 3AZLA 3W98A 5B40C 1P3BC 5B33D 3MGRD 1AOIB 2HIOC 2LY8A 3MGRA 5JRGA 4NE5A 3MNNB 5B1MD 5AV5C 1M18B 3W99B 3UTBB 3AFAD 4WZSB 2F8ND 3AZFD 3MNND 5AV8B 5BT1D 5BS7A 5B32B 3MGPA 5KDMB 5B1LD 3MGQB 1TZYD 5DNMD 1U35B 2L5AA 5AV6B 1M19A 1KX5D 4WU8A 3W97C 2CV5B 4WU8C 1JFIA 4Z5TA 4J8VD 3REJA 4H9PB 2IO5C 3C1BB 3C1CD 4YS3A 1P34D 3NQUB 3TU4D 3AZGB 3B6FB 5B33A 3X1UB 3AZEC 1Q9CA 5AV9A 3AZMC 3MNNC 3AZFB 5B32C 1P3GA 3R45B 5DNMA 3AZFA 3W99D 3V9RA 5CPIC 5E5AB 5AVBB 2PYOB 2JSSA 3NQJA 3W98C 5BNXB 3AZJD 1P3BD 3LZ0D 3REHD 1KU5A 3X1TA 2HUEC 3AN2C 3C1CA 3KWQA 4H9PA 3UT9B 5CPIA 1WWIA 3LZ0B 3REHB 3AZNC 3MGPB 3AV2A 3AZHA 3AZHD 1B67A 1F66A 4J8XD 2AROB 5B0ZC 4XZQB 1M1AC 2HIOD 2BYMA 1KX4C 5B0ZA 3LJAB 3RELA 4DRAA 3LELC 3TU4B 3MGQC 3AZGD 4UUZA 5AY8C 3AZGA 1P34B 3W99A 2CV5D 1P3AD 5CPJB 3AN2D 1U35D 3LELA 3AV2D 1P3KD 3X1TC 4WNNB 4QLCC 5AY8D 4YM6B 3AV1B 5B0YB 1M1AB 4ZUXA 1P3IA 3X1UC 5B2JD 1KX4B 1M18D 2F8NK 1ZLAA 5CP6C 5AV8D 5GT3D 1AOID 3AZEA 4CAYA 4JJNB 3AZIA 4ZUXC 3LZ1B 3AZID 5CPKD 3C1CC 4NFTA 3O62A 1P3PC 5AVCA 3WTPE 1P3OB 3AV1D 3A6NB 4YM6C 1ID3B 4QLCB 3A6NA 4J8UC 4QLCA 3B6GB 3AZLB 3KWQD 3AZJC 5GXQC 5G49B 3V9RB 3LELD 4J8WD 1P3KA 5B1LC 3RELC 1M18A 5AV9C 3MGSA 3AZMA 4HGAC 3MGSD 3UTBC 3WKJB 4LD9A 5B40B 5AV5B 1M18C 5B2JC 2HIOB 4XZQC 1P3PB 3KUYD 3MGSC 5B1LA 5B1MC 3KSYA 3REJC 1ZLAD 1F66C 3AV1A 4J8XB 1KX3C 3AZKC 4J8UB 4KUDD 5B0YA 3B6GD 4Z5TC 4QLCD 5JA4B 5CPKA 3REIA 3A6NC 2CV5A 3B0DB 3KXBD 4WU8B 3W97B 5AV6A 1M19B 3X1SD 2CV5C 4KUDC 4G91C 5AV6C 4KGCB 3LZ1D 3AZIB 3LJAA 3MVDC 3B0BA 1BH8B 3AZKA 5CP6A 4R8PB 4G92B 5CPKC 1P3LC 3RELB 5GT3B 1P3FD 3VH5T 3AZMD 4KHAB 1P3GB 4LD9C 1BH9A 5FUGB 2YFVB 3REKB 5CHLB 5F99C 3WTPB 3WKJC 2YFVA 3REID 1S32D 3W98B 1P3IB 5C3IB 1P3KB 5GXQA 3B0CW 3X1TD 4J8VC 5JRGB 1P3MB 2BYKB 3VH5W 5B31A 1ID3C 5DNNB 5B31B 3WA9C 3W98D 4JJNA 4H9RB 5AVCC 5B1MA 1KX3D 4J8VA 3REJD 5JRGD 1TZYB 1WWSA 4E44A 3O62B 4Z66C 3KUYC 4XZQD 1R4VA 5B32D 4H9SC 1P3FB 3REIB 2AROD 2NZDB 4Z2MH 1BH9B 5FUGA 1S32A 2BYMB 3AZNA 5AV9D 4J8XC 3AZHC 2NQBC 1H3OB 1P34C 1P3IC 3C1BA 5DNNC 4R8PA 3MGRB 3VH5A 5B40A 3KWQC 3REKC 4WU8D 3WTPC 5B2ID 1EQZA 1P3BB 5DNNA 1P3BA 5GT0D 3AZLC 2YFWA 3AYWB 3X1SB 1KX5C 4R8PC 4G92C 3REKA 3REIC 4WU9D 4ZBJB 5B32A 4ZUXD 3AZIC 1HTAA 3MVDB 5CPID 1P3LB 4CSRA 3UTAB 1P3MA 4CSRB 1S32C 4H9OB 3AZED 4XZQA 2F8NH 1KX4A 4J8WB 4KGCA 4H9OA 4H9QB 4CAYB 4JJNC 3WAAC 3REJB 1N1JB 5B2IA 4J8VB 3AZND 1P3MC 1BH8A 3AZKB 5CP6B 3NQUA 1P3KC 1ID3D 4H9NA 3AV2C 1P3OA 5BO0B 5B32G 1P3AC 3KXBC 1U35C 4WU9A 4EO5B 5GSUC 4X23C 3AZLD 1KX5A 4YM6A 4JJND 4AWLB 1F66D 4ZBJC 3NQJB 3B6FC 5AVBA 1HQ3B 2PYOA 3REKD 4LD9D 3AYWC 5E5AA 3B6GC 2BYKA 3C1BC 5B2JB 1KX4D 5GXQB 3WAAD 3AZMB 1P34A 3AZFC 5B0ZD 2HIOA 5B24D 4XUJC 5B24A 1P3GC 4LD9B 4H9RA 5AV5A 2YFWB 3RELD 3LJAC 3AYWA 5B24B 4KUDA 2NQBB 2AROC 4WV4B 4NE3A 3AV2B 3MVDA 4KGCD 5GT0C 4YS3C 4WU9C 4YM6D 1U35A 3LZ0C 3REHC 1F66B 1ID3A 1P3OC 5DNND 3UT9C 3WA9D 3AZKD 5B31G 1M19C 3W96B 3AZNB 1TZYC 2HUEB 3AN2B 5G49A 3WAAA 4H9QA 3TU4A 5B2JA 1P3ID 1ULYA 5AV8C 1P3PD 1EQZB 3UTBA 5BS7C 3X1VA 5GT3A 3VH6A 5AV8A 3X1VB 1P3GD 1TAFB 3TU4C 4XUJD 5GT3C 4WNNA 5CPIB 4XUJA 1TAFA 5AVCD 5F99B 3LELB 3MGRC 3R45A 3UTAD 3AYWD 4Z66D 3UTAA 1F1EA 3MGPD 5CPJC 3MVDD 3W96C 4ZUXB 3LZ1C 3UT9D 3AN2A 4J8WA 3MGPC 3O62C 1P3PA 1JFIB 1B6WA 4NE6A 3LZ1A 3UTAC 2NQBA 1N1JA 5B2IB 4KUDB 4Z5TD 4J8XA 4Z66B 5E5AD 5B0YC 3X1UA 2NZDD 2RVQC 3X1UD 4KHAA 5AVCB 5F99D 2NZDA 1ZLAC 2FJ7B 1P3FA 3AFAC 4H9SA 4XUJB 5AV9B 3X1VD 1M1AD 5AV5D 2RVQD 1KX3B 1HQ3A 5E5AC 5B0YD 3B6GA 1A7WA 5B33C 2CWEA 3MGSB 1AOIA 5BNVA 5AY8B 1EQZD 3B6FD 5BNXA 3O62D 5GSUB 4X23B 1P3AA 5AV6D 5GSUA 4X23A 1P3AB 3KWQB 5GSUD 4X23D 3X1TB 3W96D 3VH6T 5B1LB 3MGQD 3AZJA 5B31D 3LZ0A 3REHA 1HQ3C 5B2IC 3A6ND 3UT9A 3WTPD 4AWLC 1BFMA 3WTPA 1EQZC 5F99A 1P3MD 4KGCC 2F8NB 5CPKB 3AFAB 2FJ7A 4G91B 1M1AA 3AFAA 3UTBD 2F8NG 2FJ7D 2NQBD 1S32B 2F8NA 2AROA 5B24C 3VH6W 4Z5TB 5B0ZB 3B0DC 5GXQD 3WAAB 4YS3B 5JRGC 5B1MB 5AVBC 2PYOC 4J8WC 4Z66A 1HQ3D 3B0CT 1M19D 5C3IC 4UUZB 4R8PD 5B33B 5BO0A 3B6FA 4H9NB 3AZJB 5CPJA 4EO5C 4J8UD 5CPJD 3X1SA 3KXBA 5AVBD 2PYOD 1KX3A 3W99C 3W97D 3AV1C 3MGQA 3KXBB 1H3OA 4HGAB 5KDMA 1AOIC 4DRBA 5DNMC 5CP6D 5JA4A 5AY8A 5BNVB 3AZGC 3LJAD 2IO5B 4Z2MG 3X1VC 3MNNA 3WKJD 3WKJA 1ZLAB 2FJ7C 3KUYA 5BT1C 3KUYB 2NZDC 3AZEB
chains in the Genus database with same CATH superfamily
1P3FC 1TZYA 3C1BD 4M6BA 3C1CB 5B40D 3EPJA 3AZHB 2Y2PA 4E45A 5B31C 1P3LD 3WA9B 1P3LA 4J8UA 4WU9B 3WA9A 2W8SA 5GT0A 1P3OD 3X1SC 3W97A 1KX5B 3W96A 5DNMB 5GT0B 4YS3D 3AZLA 3W98A 5B40C 1P3BC 5B33D 3MGRD 1AOIB 2HIOC 2LY8A 3MGRA 5JRGA 4NE5A 3MNNB 5B1MD 5AV5C 1M18B 3W99B 3EPKA 3UTBB 2ZY5A 3AFAD 4WZSB 2F8ND 3AZFD 3MNND 5AV8B 5BT1D 5BS7A 5B32B 3MGPA 5KDMB 5B1LD 3MGQB 1TZYD 5DNMD 1U35B 2L5AA 5AV6B 1M19A 1KX5D 4WU8A 3W97C 2CV5B 4WJ3C 4WU8C 1JFIA 4Z5TA 4J8VD 3REJA 4H9PB 2IO5C 3C1BB 3C1CD 4YS3A 1P34D 3NQUB 3TU4D 3AZGB 3B6FB 5B33A 3X1UB 3AZEC 1Q9CA 5AV9A 3AZMC 3H0LC 3MNNC 3AZFB 5B32C 1P3GA 2Y2JA 3R45B 5DNMA 3AZFA 3W99D 3V9RA 5CPIC 5E5AB 3EPLA 5AVBB 2ZY4A 2XD1A 2PYOB 2JSSA 3NQJA 3W98C 5BNXB 3AZJD 1P3BD 3LZ0D 3REHD 1KU5A 3X1TA 2HUEC 3AN2C 3C1CA 3KWQA 2ZM5A 4H9PA 3UT9B 2XD5A 5CPIA 1WWIA 3LZ0B 3REHB 3AZNC 2Y2LA 3MGPB 3AV2A 3AZHA 3AZHD 1B67A 1F66A 4J8XD 2AROB 5B0ZC 4XZQB 1M1AC 2HIOD 2BYMA 1KX4C 5B0ZA 3LJAB 3RELA 4DRAA 3LELC 3TU4B 3MGQC 3AZGD 4UUZA 5AY8C 3AZGA 1P34B 3W99A 2CV5D 2Y2IA 1P3AD 2F2AC 2Y2NA 3AN2D 5CPJB 1U35D 3LELA 3AV2D 1P3KD 3X1TC 4WNNB 4QLCC 5AY8D 4YM6B 3AV1B 5B0YB 1M1AB 4ZUXA 1P3IA 3EG5B 3X1UC 5B2JD 1KX4B 3KFUG 1M18D 2F8NK 1ZLAA 5CP6C 5AV8D 5GT3D 1AOID 3AZEA 4CAYA 4JJNB 3AZIA 4ZUXC 3H0RC 3LZ1B 3AZID 5CPKD 3C1CC 4NFTA 3O62A 1P3PC 5AVCA 3WTPE 1P3OB 3AV1D 3A6NB 4YM6C 1ID3B 4QLCB 3A6NA 4J8UC 4QLCA 3B6GB 3AZLB 3KWQD 3AZJC 5GXQC 5G49B 3V9RB 3LELD 4J8WD 1P3KA 5B1LC 3RELC 1M18A 5AV9C 3MGSA 3AZMA 4HGAC 3MGSD 3UTBC 3WKJB 4LD9A 5B40B 5AV5B 1M18C 5B2JC 2HIOB 4XZQC 2ZY3A 1P3PB 3KUYD 3MGSC 5B1LA 5B1MC 3KSYA 3REJC 1ZLAD 1F66C 3AV1A 4J8XB 1KX3C 3AZKC 4J8UB 4KUDD 5B0YA 3B6GD 2Y2KA 4Z5TC 4QLCD 5JA4B 5CPKA 3REIA 3A6NC 2CV5A 3B0DB 3KXBD 3H0MC 4WU8B 3W97B 5AV6A 1M19B 3X1SD 2DQNC 2CV5C 4KUDC 4G91C 5AV6C 4KGCB 3LZ1D 3AZIB 3LJAA 3MVDC 3B0BA 1BH8B 3AZKA 5CP6A 4R8PB 4G92B 5CPKC 1P3LC 3RELB 5GT3B 3A1IA 1P3FD 3VH5T 3AZMD 4KHAB 1P3GB 4LD9C 1BH9A 5FUGB 1T3UA 2YFVB 3REKB 5CHLB 5F99C 3WTPB 3WKJC 2YFVA 3REID 1S32D 3W98B 1P3IB 5C3IB 1P3KB 3B0CW 5GXQA 3X1TD 4J8VC 2G5HC 5JRGB 1P3MB 2BYKB 3VH5W 1W2EA 5B31A 1ID3C 5DNNB 5B31B 3WA9C 3W98D 4JJNA 4H9RB 5AVCC 5B1MA 1KX3D 4J8VA 3REJD 5JRGD 1TZYB 1WWSA 2JE5A 4E44A 4Z66C 3O62B 3KUYC 4XZQD 1R4VA 5B32D 4H9SC 1P3FB 3REIB 2AROD 2NZDB 4Z2MH 1BH9B 5FUGA 1S32A 2BYMB 3AZNA 5AV9D 4J8XC 2Y2HA 3AZHC 2NQBC 1H3OB 1P34C 1P3IC 3C1BA 5DNNC 4R8PA 3MGRB 3VH5A 5B40A 3KWQC 3REKC 4WU8D 3WTPC 5B2ID 1EQZA 2Y2GA 1P3BB 5DNNA 1P3BA 5GT0D 3AZLC 2YFWA 3AYWB 3X1SB 1KX5C 4R8PC 4G92C 3REKA 3REIC 4WU9D 4ZBJB 5B32A 4ZUXD 3AZIC 1HTAA 3MVDB 5CPID 1P3LB 4CSRA 3UTAB 1P3MA 4CSRB 1S32C 4H9OB 3AZED 4XZQA 2F8NH 1KX4A 4J8WB 4KGCA 4H9OA 4H9QB 4CAYB 4JJNC 3WAAC 3REJB 1N1JB 5B2IA 4J8VB 3AZND 1P3MC 1BH8A 3AZKB 3AL0C 5CP6B 3NQUA 4UPKA 1P3KC 1ID3D 2RIQA 3IP4C 4H9NA 3AV2C 1P3OA 5BO0B 5B32G 1P3AC 3KXBC 1U35C 4WU9A 4EO5B 5GSUC 4X23C 3AZLD 1KX5A 4YM6A 4JJND 4AWLB 1F66D 4ZBJC 3NQJB 3B6FC 5AVBA 1HQ3B 2PYOA 3REKD 4LD9D 3AYWC 5E5AA 3B6GC 2BYKA 3C1BC 5B2JB 1KX4D 5GXQB 3WAAD 3AZMB 1P34A 3AZFC 5B0ZD 2HIOA 5B24D 4XUJC 5B24A 1P3GC 4LD9B 4H9RA 5AV5A 2YFWB 3RELD 3LJAC 3AYWA 5B24B 4KUDA 2NQBB 2AROC 4WV4B 4NE3A 3AV2B 3MVDA 4KGCD 1Z2CB 5GT0C 4YS3C 4WU9C 4YM6D 1U35A 3LZ0C 3REHC 1F66B 1ID3A 1P3OC 5DNND 3UT9C 3WA9D 3AZKD 5B31G 1M19C 3W96B 3AZNB 1TZYC 2HUEB 3AN2B 5G49A 3WAAA 4H9QA 3TU4A 5B2JA 1P3ID 1ULYA 5AV8C 1P3PD 2Y2MA 1EQZB 2G5IC 3UTBA 5BS7C 3X1VA 5GT3A 3VH6A 5AV8A 3X1VB 1P3GD 1TAFB 3TU4C 4XUJD 5GT3C 4WNNA 5CPIB 4XUJA 2FFFB 1TAFA 3FDDA 5AVCD 5F99B 3LELB 3MGRC 3R45A 3EPHA 3UTAD 3AYWD 4Z66D 3UTAA 1F1EA 3P5JB 3MGPD 5CPJC 3MVDD 3W96C 4ZUXB 3LZ1C 3UT9D 2J8PA 3AN2A 4J8WA 3MGPC 3O62C 1P3PA 1JFIB 1B6WA 4NE6A 3LZ1A 3UTAC 2NQBA 1N1JA 5B2IB 4KUDB 4Z5TD 4J8XA 4Z66B 5E5AD 5B0YC 3X1UA 2NZDD 2RVQC 2ZY2A 4KHAA 5AVCB 5F99D 3X1UD 1ZLAC 2FJ7B 3F6TA 2NZDA 1P3FA 3AFAC 4H9SA 4XUJB 5AV9B 3X1VD 1M1AD 5AV5D 2RVQD 1KX3B 1HQ3A 5E5AC 5B0YD 3B6GA 1A7WA 5B33C 2CWEA 3MGSB 1AOIA 5BNVA 5AY8B 1EQZD 3B6FD 5BNXA 3O62D 5GSUB 4X23B 1P3AA 5AV6D 5GSUA 2DF4C 4X23A 1P3AB 3KWQB 5GSUD 4X23D 3X1TB 3W96D 3VH6T 5B1LB 3MGQD 3AZJA 5B31D 3LZ0A 3REHA 1HQ3C 2VQRA 5B2IC 2Y2QA 2UWXA 3A6ND 3UT9A 3WTPD 4AWLC 1BFMA 3WTPA 1EQZC 5F99A 1P3MD 4KGCC 2F8NB 5CPKB 3AFAB 2FJ7A 4G91B 1M1AA 3AFAA 3UTBD 2F8NG 2FJ7D 2NQBD 1S32B 2F8NA 2AROA 5B24C 4DQYB 3VH6W 4Z5TB 5B0ZB 2BG1A 3B0DC 5GXQD 3WAAB 4YS3B 5JRGC 5B1MB 5AVBC 2JCHA 2PYOC 1PZRA 4J8WC 4Z66A 1HQ3D 3B0CT 1M19D 5C3IC 4UUZB 4R8PD 5B33B 5BO0A 3B6FA 4H9NB 3AZJB 5CPJA 2Y2OA 4EO5C 4J8UD 5CPJD 3X1SA 3KXBA 5AVBD 2PYOD 1KX3A 3W99C 3W97D 3AV1C 3MGQA 3KXBB 1H3OA 4HGAB 5KDMA 1AOIC 4DRBA 5DNMC 5CP6D 5JA4A 5AY8A 5BNVB 3AZGC 3LJAD 2IO5B 4Z2MG 3X1VC 3MNNA 3WKJD 3WKJA 1ZLAB 2FJ7C 3KUYA 5BT1C 3KUYB 2NZDC 3A1KA 3AZEB
chains in the Genus database with same CATH topology
1P3FC 1TZYA 3C1BD 4M6BA 3C1CB 5B40D 3EPJA 3AZHB 2Y2PA 4E45A 5B31C 1P3LD 3WA9B 1P3LA 4J8UA 4WU9B 3WA9A 2W8SA 5GT0A 1P3OD 3X1SC 3W97A 1KX5B 3W96A 5DNMB 5GT0B 4YS3D 3AZLA 3W98A 5B40C 1P3BC 5B33D 3MGRD 1AOIB 2HIOC 2LY8A 3MGRA 5JRGA 4NE5A 3MNNB 5B1MD 5AV5C 1M18B 3W99B 3EPKA 3UTBB 2ZY5A 3AFAD 4WZSB 2F8ND 3AZFD 3MNND 5AV8B 5BT1D 5BS7A 5B32B 3MGPA 5KDMB 5B1LD 3MGQB 1TZYD 5DNMD 1U35B 2L5AA 5AV6B 1M19A 1KX5D 4WU8A 3W97C 2CV5B 4WJ3C 4WU8C 1JFIA 4Z5TA 4J8VD 3REJA 4H9PB 2IO5C 3C1BB 3C1CD 4YS3A 1P34D 3NQUB 3TU4D 3AZGB 3B6FB 5B33A 3X1UB 3AZEC 1Q9CA 5AV9A 3AZMC 3H0LC 3MNNC 3AZFB 5B32C 1P3GA 2Y2JA 3R45B 5DNMA 3AZFA 3W99D 3V9RA 5CPIC 5E5AB 3EPLA 5AVBB 2ZY4A 2XD1A 2PYOB 2JSSA 3NQJA 3W98C 5BNXB 3AZJD 1P3BD 3LZ0D 3REHD 1KU5A 3X1TA 2HUEC 3AN2C 3C1CA 3KWQA 2ZM5A 4H9PA 3UT9B 2XD5A 5CPIA 1WWIA 3LZ0B 3REHB 3AZNC 2Y2LA 3MGPB 3AV2A 3AZHA 3AZHD 1B67A 1F66A 4J8XD 2AROB 5B0ZC 4XZQB 1M1AC 2HIOD 2BYMA 1KX4C 5B0ZA 3LJAB 3RELA 4DRAA 3LELC 3TU4B 3MGQC 3AZGD 4UUZA 5AY8C 3AZGA 1P34B 3W99A 2CV5D 2Y2IA 1P3AD 2F2AC 2Y2NA 3AN2D 5CPJB 1U35D 3LELA 3AV2D 1P3KD 3X1TC 4WNNB 4QLCC 5AY8D 4YM6B 3AV1B 5B0YB 1M1AB 4ZUXA 1P3IA 3EG5B 3X1UC 5B2JD 1KX4B 3KFUG 1M18D 2F8NK 1ZLAA 5CP6C 5AV8D 5GT3D 1AOID 3AZEA 4CAYA 4JJNB 3AZIA 4ZUXC 3H0RC 3LZ1B 3AZID 5CPKD 3C1CC 4NFTA 3O62A 1P3PC 5AVCA 3WTPE 1P3OB 3AV1D 3A6NB 4YM6C 1ID3B 4QLCB 3A6NA 4J8UC 4QLCA 3B6GB 3AZLB 3KWQD 3AZJC 5GXQC 5G49B 3V9RB 3LELD 4J8WD 1P3KA 5B1LC 3RELC 1M18A 5AV9C 3MGSA 3AZMA 4HGAC 3MGSD 3UTBC 3WKJB 4LD9A 5B40B 5AV5B 1M18C 5B2JC 2HIOB 4XZQC 2ZY3A 1P3PB 3KUYD 3MGSC 5B1LA 5B1MC 3KSYA 3REJC 1ZLAD 1F66C 3AV1A 4J8XB 1KX3C 3AZKC 4J8UB 4KUDD 5B0YA 3B6GD 2Y2KA 4Z5TC 4QLCD 5JA4B 5CPKA 3REIA 3A6NC 2CV5A 3B0DB 3KXBD 3H0MC 4WU8B 3W97B 5AV6A 1M19B 3X1SD 2DQNC 2CV5C 4KUDC 4G91C 5AV6C 4KGCB 3LZ1D 3AZIB 3LJAA 3MVDC 3B0BA 1BH8B 3AZKA 5CP6A 4R8PB 4G92B 5CPKC 1P3LC 3RELB 5GT3B 3A1IA 1P3FD 3VH5T 3AZMD 4KHAB 1P3GB 4LD9C 1BH9A 5FUGB 1T3UA 2YFVB 3REKB 5CHLB 5F99C 3WTPB 3WKJC 2YFVA 3REID 1S32D 3W98B 1P3IB 5C3IB 1P3KB 3B0CW 5GXQA 3X1TD 4J8VC 2G5HC 5JRGB 1P3MB 2BYKB 3VH5W 1W2EA 5B31A 1ID3C 5DNNB 5B31B 3WA9C 3W98D 4JJNA 4H9RB 5AVCC 5B1MA 1KX3D 4J8VA 3REJD 5JRGD 1TZYB 1WWSA 2JE5A 4E44A 4Z66C 3O62B 3KUYC 4XZQD 1R4VA 5B32D 4H9SC 1P3FB 3REIB 2AROD 2NZDB 4Z2MH 1BH9B 5FUGA 1S32A 2BYMB 3AZNA 5AV9D 4J8XC 2Y2HA 3AZHC 2NQBC 1H3OB 1P34C 1P3IC 3C1BA 5DNNC 4R8PA 3MGRB 3VH5A 5B40A 3KWQC 3REKC 4WU8D 3WTPC 5B2ID 1EQZA 2Y2GA 1P3BB 5DNNA 1P3BA 5GT0D 3AZLC 2YFWA 3AYWB 3X1SB 1KX5C 4R8PC 4G92C 3REKA 3REIC 4WU9D 4ZBJB 5B32A 4ZUXD 3AZIC 1HTAA 3MVDB 5CPID 1P3LB 4CSRA 3UTAB 1P3MA 4CSRB 1S32C 4H9OB 3AZED 4XZQA 2F8NH 1KX4A 4J8WB 4KGCA 4H9OA 4H9QB 4CAYB 4JJNC 3WAAC 3REJB 1N1JB 5B2IA 4J8VB 3AZND 1P3MC 1BH8A 3AZKB 3AL0C 5CP6B 3NQUA 4UPKA 1P3KC 1ID3D 2RIQA 3IP4C 4H9NA 3AV2C 1P3OA 5BO0B 5B32G 1P3AC 3KXBC 1U35C 4WU9A 4EO5B 5GSUC 4X23C 3AZLD 1KX5A 4YM6A 4JJND 4AWLB 1F66D 4ZBJC 3NQJB 3B6FC 5AVBA 1HQ3B 2PYOA 3REKD 4LD9D 3AYWC 5E5AA 3B6GC 2BYKA 3C1BC 5B2JB 1KX4D 5GXQB 3WAAD 3AZMB 1P34A 3AZFC 5B0ZD 2HIOA 5B24D 4XUJC 5B24A 1P3GC 4LD9B 4H9RA 5AV5A 2YFWB 3RELD 3LJAC 3AYWA 5B24B 4KUDA 2NQBB 2AROC 4WV4B 4NE3A 3AV2B 3MVDA 4KGCD 1Z2CB 5GT0C 4YS3C 4WU9C 4YM6D 1U35A 3LZ0C 3REHC 1F66B 1ID3A 1P3OC 5DNND 3UT9C 3WA9D 3AZKD 5B31G 1M19C 3W96B 3AZNB 1TZYC 2HUEB 3AN2B 5G49A 3WAAA 4H9QA 3TU4A 5B2JA 1P3ID 1ULYA 5AV8C 1P3PD 2Y2MA 1EQZB 2G5IC 3UTBA 5BS7C 3X1VA 5GT3A 3VH6A 5AV8A 3X1VB 1P3GD 1TAFB 3TU4C 4XUJD 5GT3C 4WNNA 5CPIB 4XUJA 2FFFB 1TAFA 3FDDA 5AVCD 5F99B 3LELB 3MGRC 3R45A 3EPHA 3UTAD 3AYWD 4Z66D 3UTAA 1F1EA 3P5JB 3MGPD 5CPJC 3MVDD 3W96C 4ZUXB 3LZ1C 3UT9D 2J8PA 3AN2A 4J8WA 3MGPC 3O62C 1P3PA 1JFIB 1B6WA 4NE6A 3LZ1A 3UTAC 2NQBA 1N1JA 5B2IB 4KUDB 4Z5TD 4J8XA 4Z66B 5E5AD 5B0YC 3X1UA 2NZDD 2RVQC 2ZY2A 4KHAA 5AVCB 5F99D 3X1UD 1ZLAC 2FJ7B 3F6TA 2NZDA 1P3FA 3AFAC 4H9SA 4XUJB 5AV9B 3X1VD 1M1AD 5AV5D 2RVQD 1KX3B 1HQ3A 5E5AC 5B0YD 3B6GA 1A7WA 5B33C 2CWEA 3MGSB 1AOIA 5BNVA 5AY8B 1EQZD 3B6FD 5BNXA 3O62D 5GSUB 4X23B 1P3AA 5AV6D 5GSUA 2DF4C 4X23A 1P3AB 3KWQB 5GSUD 4X23D 3X1TB 3W96D 3VH6T 5B1LB 3MGQD 3AZJA 5B31D 3LZ0A 3REHA 1HQ3C 2VQRA 5B2IC 2Y2QA 2UWXA 3A6ND 3UT9A 3WTPD 4AWLC 1BFMA 3WTPA 1EQZC 5F99A 1P3MD 4KGCC 2F8NB 5CPKB 3AFAB 2FJ7A 4G91B 1M1AA 3AFAA 3UTBD 2F8NG 2FJ7D 2NQBD 1S32B 2F8NA 2AROA 5B24C 4DQYB 3VH6W 4Z5TB 5B0ZB 2BG1A 3B0DC 5GXQD 3WAAB 4YS3B 5JRGC 5B1MB 5AVBC 2JCHA 2PYOC 1PZRA 4J8WC 4Z66A 1HQ3D 3B0CT 1M19D 5C3IC 4UUZB 4R8PD 5B33B 5BO0A 3B6FA 4H9NB 3AZJB 5CPJA 2Y2OA 4EO5C 4J8UD 5CPJD 3X1SA 3KXBA 5AVBD 2PYOD 1KX3A 3W99C 3W97D 3AV1C 3MGQA 3KXBB 1H3OA 4HGAB 5KDMA 1AOIC 4DRBA 5DNMC 5CP6D 5JA4A 5AY8A 5BNVB 3AZGC 3LJAD 2IO5B 4Z2MG 3X1VC 3MNNA 3WKJD 3WKJA 1ZLAB 2FJ7C 3KUYA 5BT1C 3KUYB 2NZDC 3A1KA 3AZEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3F C;  1TZY A;  3C1B D;  4M6B A;  3C1C B;  5B40 D;  3AZH B;  4E45 A;  5B31 C;  1P3L D;  3WA9 B;  1P3L A;  4J8U A;  4WU9 B;  3WA9 A;  5GT0 A;  1P3O D;  3X1S C;  3W97 A;  1KX5 B;  3W96 A;  5DNM B;  5GT0 B;  4YS3 D;  3AZL A;  3W98 A;  5B40 C;  1P3B C;  5B33 D;  3MGR D;  1AOI B;  2HIO C;  2LY8 A;  3MGR A;  5JRG A;  4NE5 A;  3MNN B;  5B1M D;  5AV5 C;  1M18 B;  3W99 B;  3UTB B;  3AFA D;  4WZS B;  2F8N D;  3AZF D;  3MNN D;  5AV8 B;  5BT1 D;  5BS7 A;  5B32 B;  3MGP A;  5KDM B;  5B1L D;  3MGQ B;  1TZY D;  5DNM D;  1U35 B;  2L5A A;  5AV6 B;  1M19 A;  1KX5 D;  4WU8 A;  3W97 C;  2CV5 B;  4WU8 C;  1JFI A;  4Z5T A;  4J8V D;  3REJ A;  4H9P B;  2IO5 C;  3C1B B;  3C1C D;  4YS3 A;  1P34 D;  3NQU B;  3TU4 D;  3AZG B;  3B6F B;  5B33 A;  3X1U B;  3AZE C;  1Q9C A;  5AV9 A;  3AZM C;  3MNN C;  3AZF B;  5B32 C;  1P3G A;  3R45 B;  5DNM A;  3AZF A;  3W99 D;  3V9R A;  5CPI C;  5E5A B;  5AVB B;  2PYO B;  2JSS A;  3NQJ A;  3W98 C;  5BNX B;  3AZJ D;  1P3B D;  3LZ0 D;  3REH D;  1KU5 A;  3X1T A;  2HUE C;  3AN2 C;  3C1C A;  3KWQ A;  4H9P A;  3UT9 B;  5CPI A;  1WWI A;  3LZ0 B;  3REH B;  3AZN C;  3MGP B;  3AV2 A;  3AZH A;  3AZH D;  1B67 A;  1F66 A;  4J8X D;  2ARO B;  5B0Z C;  4XZQ B;  1M1A C;  2HIO D;  2BYM A;  1KX4 C;  5B0Z A;  3LJA B;  3REL A;  4DRA A;  3LEL C;  3TU4 B;  3MGQ C;  3AZG D;  4UUZ A;  5AY8 C;  3AZG A;  1P34 B;  3W99 A;  2CV5 D;  1P3A D;  5CPJ B;  3AN2 D;  1U35 D;  3LEL A;  3AV2 D;  1P3K D;  3X1T C;  4WNN B;  4QLC C;  5AY8 D;  4YM6 B;  3AV1 B;  5B0Y B;  1M1A B;  4ZUX A;  1P3I A;  3X1U C;  5B2J D;  1KX4 B;  1M18 D;  2F8N K;  1ZLA A;  5CP6 C;  5AV8 D;  5GT3 D;  1AOI D;  3AZE A;  4CAY A;  4JJN B;  3AZI A;  4ZUX C;  3LZ1 B;  3AZI D;  5CPK D;  3C1C C;  4NFT A;  3O62 A;  1P3P C;  5AVC A;  3WTP E;  1P3O B;  3AV1 D;  3A6N B;  4YM6 C;  1ID3 B;  4QLC B;  3A6N A;  4J8U C;  4QLC A;  3B6G B;  3AZL B;  3KWQ D;  3AZJ C;  5GXQ C;  5G49 B;  3V9R B;  3LEL D;  4J8W D;  1P3K A;  5B1L C;  3REL C;  1M18 A;  5AV9 C;  3MGS A;  3AZM A;  4HGA C;  3MGS D;  3UTB C;  3WKJ B;  4LD9 A;  5B40 B;  5AV5 B;  1M18 C;  5B2J C;  2HIO B;  4XZQ C;  1P3P B;  3KUY D;  3MGS C;  5B1L A;  5B1M C;  3KSY A;  3REJ C;  1ZLA D;  1F66 C;  3AV1 A;  4J8X B;  1KX3 C;  3AZK C;  4J8U B;  4KUD D;  5B0Y A;  3B6G D;  4Z5T C;  4QLC D;  5JA4 B;  5CPK A;  3REI A;  3A6N C;  2CV5 A;  3B0D B;  3KXB D;  4WU8 B;  3W97 B;  5AV6 A;  1M19 B;  3X1S D;  2CV5 C;  4KUD C;  4G91 C;  5AV6 C;  4KGC B;  3LZ1 D;  3AZI B;  3LJA A;  3MVD C;  3B0B A;  1BH8 B;  3AZK A;  5CP6 A;  4R8P B;  4G92 B;  5CPK C;  1P3L C;  3REL B;  5GT3 B;  1P3F D;  3VH5 T;  3AZM D;  4KHA B;  1P3G B;  4LD9 C;  1BH9 A;  5FUG B;  2YFV B;  3REK B;  5CHL B;  5F99 C;  3WTP B;  3WKJ C;  2YFV A;  3REI D;  1S32 D;  3W98 B;  1P3I B;  5C3I B;  1P3K B;  5GXQ A;  3B0C W;  3X1T D;  4J8V C;  5JRG B;  1P3M B;  2BYK B;  3VH5 W;  5B31 A;  1ID3 C;  5DNN B;  5B31 B;  3WA9 C;  3W98 D;  4JJN A;  4H9R B;  5AVC C;  5B1M A;  1KX3 D;  4J8V A;  3REJ D;  5JRG D;  1TZY B;  1WWS A;  4E44 A;  3O62 B;  4Z66 C;  3KUY C;  4XZQ D;  1R4V A;  5B32 D;  4H9S C;  1P3F B;  3REI B;  2ARO D;  2NZD B;  4Z2M H;  1BH9 B;  5FUG A;  1S32 A;  2BYM B;  3AZN A;  5AV9 D;  4J8X C;  3AZH C;  2NQB C;  1H3O B;  1P34 C;  1P3I C;  3C1B A;  5DNN C;  4R8P A;  3MGR B;  3VH5 A;  5B40 A;  3KWQ C;  3REK C;  4WU8 D;  3WTP C;  5B2I D;  1EQZ A;  1P3B B;  5DNN A;  1P3B A;  5GT0 D;  3AZL C;  2YFW A;  3AYW B;  3X1S B;  1KX5 C;  4R8P C;  4G92 C;  3REK A;  3REI C;  4WU9 D;  4ZBJ B;  5B32 A;  4ZUX D;  3AZI C;  1HTA A;  3MVD B;  5CPI D;  1P3L B;  4CSR A;  3UTA B;  1P3M A;  4CSR B;  1S32 C;  4H9O B;  3AZE D;  4XZQ A;  2F8N H;  1KX4 A;  4J8W B;  4KGC A;  4H9O A;  4H9Q B;  4CAY B;  4JJN C;  3WAA C;  3REJ B;  1N1J B;  5B2I A;  4J8V B;  3AZN D;  1P3M C;  1BH8 A;  3AZK B;  5CP6 B;  3NQU A;  1P3K C;  1ID3 D;  4H9N A;  3AV2 C;  1P3O A;  5BO0 B;  5B32 G;  1P3A C;  3KXB C;  1U35 C;  4WU9 A;  4EO5 B;  5GSU C;  4X23 C;  3AZL D;  1KX5 A;  4YM6 A;  4JJN D;  4AWL B;  1F66 D;  4ZBJ C;  3NQJ B;  3B6F C;  5AVB A;  1HQ3 B;  2PYO A;  3REK D;  4LD9 D;  3AYW C;  5E5A A;  3B6G C;  2BYK A;  3C1B C;  5B2J B;  1KX4 D;  5GXQ B;  3WAA D;  3AZM B;  1P34 A;  3AZF C;  5B0Z D;  2HIO A;  5B24 D;  4XUJ C;  5B24 A;  1P3G C;  4LD9 B;  4H9R A;  5AV5 A;  2YFW B;  3REL D;  3LJA C;  3AYW A;  5B24 B;  4KUD A;  2NQB B;  2ARO C;  4WV4 B;  4NE3 A;  3AV2 B;  3MVD A;  4KGC D;  5GT0 C;  4YS3 C;  4WU9 C;  4YM6 D;  1U35 A;  3LZ0 C;  3REH C;  1F66 B;  1ID3 A;  1P3O C;  5DNN D;  3UT9 C;  3WA9 D;  3AZK D;  5B31 G;  1M19 C;  3W96 B;  3AZN B;  1TZY C;  2HUE B;  3AN2 B;  5G49 A;  3WAA A;  4H9Q A;  3TU4 A;  5B2J A;  1P3I D;  1ULY A;  5AV8 C;  1P3P D;  1EQZ B;  3UTB A;  5BS7 C;  3X1V A;  5GT3 A;  3VH6 A;  5AV8 A;  3X1V B;  1P3G D;  1TAF B;  3TU4 C;  4XUJ D;  5GT3 C;  4WNN A;  5CPI B;  4XUJ A;  1TAF A;  5AVC D;  5F99 B;  3LEL B;  3MGR C;  3R45 A;  3UTA D;  3AYW D;  4Z66 D;  3UTA A;  1F1E A;  3MGP D;  5CPJ C;  3MVD D;  3W96 C;  4ZUX B;  3LZ1 C;  3UT9 D;  3AN2 A;  4J8W A;  3MGP C;  3O62 C;  1P3P A;  1JFI B;  1B6W A;  4NE6 A;  3LZ1 A;  3UTA C;  2NQB A;  1N1J A;  5B2I B;  4KUD B;  4Z5T D;  4J8X A;  4Z66 B;  5E5A D;  5B0Y C;  3X1U A;  2NZD D;  2RVQ C;  3X1U D;  4KHA A;  5AVC B;  5F99 D;  2NZD A;  1ZLA C;  2FJ7 B;  1P3F A;  3AFA C;  4H9S A;  4XUJ B;  5AV9 B;  3X1V D;  1M1A D;  5AV5 D;  2RVQ D;  1KX3 B;  1HQ3 A;  5E5A C;  5B0Y D;  3B6G A;  1A7W A;  5B33 C;  2CWE A;  3MGS B;  1AOI A;  5BNV A;  5AY8 B;  1EQZ D;  3B6F D;  5BNX A;  3O62 D;  5GSU B;  4X23 B;  1P3A A;  5AV6 D;  5GSU A;  4X23 A;  1P3A B;  3KWQ B;  5GSU D;  4X23 D;  3X1T B;  3W96 D;  3VH6 T;  5B1L B;  3MGQ D;  3AZJ A;  5B31 D;  3LZ0 A;  3REH A;  1HQ3 C;  5B2I C;  3A6N D;  3UT9 A;  3WTP D;  4AWL C;  1BFM A;  3WTP A;  1EQZ C;  5F99 A;  1P3M D;  4KGC C;  2F8N B;  5CPK B;  3AFA B;  2FJ7 A;  4G91 B;  1M1A A;  3AFA A;  3UTB D;  2F8N G;  2FJ7 D;  2NQB D;  1S32 B;  2F8N A;  2ARO A;  5B24 C;  3VH6 W;  4Z5T B;  5B0Z B;  3B0D C;  5GXQ D;  3WAA B;  4YS3 B;  5JRG C;  5B1M B;  5AVB C;  2PYO C;  4J8W C;  4Z66 A;  1HQ3 D;  3B0C T;  1M19 D;  5C3I C;  4UUZ B;  4R8P D;  5B33 B;  5BO0 A;  3B6F A;  4H9N B;  3AZJ B;  5CPJ A;  4EO5 C;  4J8U D;  5CPJ D;  3X1S A;  3KXB A;  5AVB D;  2PYO D;  1KX3 A;  3W99 C;  3W97 D;  3AV1 C;  3MGQ A;  3KXB B;  1H3O A;  4HGA B;  5KDM A;  1AOI C;  4DRB A;  5DNM C;  5CP6 D;  5JA4 A;  5AY8 A;  5BNV B;  3AZG C;  3LJA D;  2IO5 B;  4Z2M G;  3X1V C;  3MNN A;  3WKJ D;  3WKJ A;  1ZLA B;  2FJ7 C;  3KUY A;  5BT1 C;  3KUY B;  2NZD C;  3AZE B; 
#chains in the Genus database with same CATH topology
 1P3F C;  1TZY A;  3C1B D;  4M6B A;  3C1C B;  5B40 D;  3EPJ A;  3AZH B;  2Y2P A;  4E45 A;  5B31 C;  1P3L D;  3WA9 B;  1P3L A;  4J8U A;  4WU9 B;  3WA9 A;  2W8S A;  5GT0 A;  1P3O D;  3X1S C;  3W97 A;  1KX5 B;  3W96 A;  5DNM B;  5GT0 B;  4YS3 D;  3AZL A;  3W98 A;  5B40 C;  1P3B C;  5B33 D;  3MGR D;  1AOI B;  2HIO C;  2LY8 A;  3MGR A;  5JRG A;  4NE5 A;  3MNN B;  5B1M D;  5AV5 C;  1M18 B;  3W99 B;  3EPK A;  3UTB B;  2ZY5 A;  3AFA D;  4WZS B;  2F8N D;  3AZF D;  3MNN D;  5AV8 B;  5BT1 D;  5BS7 A;  5B32 B;  3MGP A;  5KDM B;  5B1L D;  3MGQ B;  1TZY D;  5DNM D;  1U35 B;  2L5A A;  5AV6 B;  1M19 A;  1KX5 D;  4WU8 A;  3W97 C;  2CV5 B;  4WJ3 C;  4WU8 C;  1JFI A;  4Z5T A;  4J8V D;  3REJ A;  4H9P B;  2IO5 C;  3C1B B;  3C1C D;  4YS3 A;  1P34 D;  3NQU B;  3TU4 D;  3AZG B;  3B6F B;  5B33 A;  3X1U B;  3AZE C;  1Q9C A;  5AV9 A;  3AZM C;  3H0L C;  3MNN C;  3AZF B;  5B32 C;  1P3G A;  2Y2J A;  3R45 B;  5DNM A;  3AZF A;  3W99 D;  3V9R A;  5CPI C;  5E5A B;  3EPL A;  5AVB B;  2ZY4 A;  2XD1 A;  2PYO B;  2JSS A;  3NQJ A;  3W98 C;  5BNX B;  3AZJ D;  1P3B D;  3LZ0 D;  3REH D;  1KU5 A;  3X1T A;  2HUE C;  3AN2 C;  3C1C A;  3KWQ A;  2ZM5 A;  4H9P A;  3UT9 B;  2XD5 A;  5CPI A;  1WWI A;  3LZ0 B;  3REH B;  3AZN C;  2Y2L A;  3MGP B;  3AV2 A;  3AZH A;  3AZH D;  1B67 A;  1F66 A;  4J8X D;  2ARO B;  5B0Z C;  4XZQ B;  1M1A C;  2HIO D;  2BYM A;  1KX4 C;  5B0Z A;  3LJA B;  3REL A;  4DRA A;  3LEL C;  3TU4 B;  3MGQ C;  3AZG D;  4UUZ A;  5AY8 C;  3AZG A;  1P34 B;  3W99 A;  2CV5 D;  2Y2I A;  1P3A D;  2F2A C;  2Y2N A;  3AN2 D;  5CPJ B;  1U35 D;  3LEL A;  3AV2 D;  1P3K D;  3X1T C;  4WNN B;  4QLC C;  5AY8 D;  4YM6 B;  3AV1 B;  5B0Y B;  1M1A B;  4ZUX A;  1P3I A;  3EG5 B;  3X1U C;  5B2J D;  1KX4 B;  3KFU G;  1M18 D;  2F8N K;  1ZLA A;  5CP6 C;  5AV8 D;  5GT3 D;  1AOI D;  3AZE A;  4CAY A;  4JJN B;  3AZI A;  4ZUX C;  3H0R C;  3LZ1 B;  3AZI D;  5CPK D;  3C1C C;  4NFT A;  3O62 A;  1P3P C;  5AVC A;  3WTP E;  1P3O B;  3AV1 D;  3A6N B;  4YM6 C;  1ID3 B;  4QLC B;  3A6N A;  4J8U C;  4QLC A;  3B6G B;  3AZL B;  3KWQ D;  3AZJ C;  5GXQ C;  5G49 B;  3V9R B;  3LEL D;  4J8W D;  1P3K A;  5B1L C;  3REL C;  1M18 A;  5AV9 C;  3MGS A;  3AZM A;  4HGA C;  3MGS D;  3UTB C;  3WKJ B;  4LD9 A;  5B40 B;  5AV5 B;  1M18 C;  5B2J C;  2HIO B;  4XZQ C;  2ZY3 A;  1P3P B;  3KUY D;  3MGS C;  5B1L A;  5B1M C;  3KSY A;  3REJ C;  1ZLA D;  1F66 C;  3AV1 A;  4J8X B;  1KX3 C;  3AZK C;  4J8U B;  4KUD D;  5B0Y A;  3B6G D;  2Y2K A;  4Z5T C;  4QLC D;  5JA4 B;  5CPK A;  3REI A;  3A6N C;  2CV5 A;  3B0D B;  3KXB D;  3H0M C;  4WU8 B;  3W97 B;  5AV6 A;  1M19 B;  3X1S D;  2DQN C;  2CV5 C;  4KUD C;  4G91 C;  5AV6 C;  4KGC B;  3LZ1 D;  3AZI B;  3LJA A;  3MVD C;  3B0B A;  1BH8 B;  3AZK A;  5CP6 A;  4R8P B;  4G92 B;  5CPK C;  1P3L C;  3REL B;  5GT3 B;  3A1I A;  1P3F D;  3VH5 T;  3AZM D;  4KHA B;  1P3G B;  4LD9 C;  1BH9 A;  5FUG B;  1T3U A;  2YFV B;  3REK B;  5CHL B;  5F99 C;  3WTP B;  3WKJ C;  2YFV A;  3REI D;  1S32 D;  3W98 B;  1P3I B;  5C3I B;  1P3K B;  3B0C W;  5GXQ A;  3X1T D;  4J8V C;  2G5H C;  5JRG B;  1P3M B;  2BYK B;  3VH5 W;  1W2E A;  5B31 A;  1ID3 C;  5DNN B;  5B31 B;  3WA9 C;  3W98 D;  4JJN A;  4H9R B;  5AVC C;  5B1M A;  1KX3 D;  4J8V A;  3REJ D;  5JRG D;  1TZY B;  1WWS A;  2JE5 A;  4E44 A;  4Z66 C;  3O62 B;  3KUY C;  4XZQ D;  1R4V A;  5B32 D;  4H9S C;  1P3F B;  3REI B;  2ARO D;  2NZD B;  4Z2M H;  1BH9 B;  5FUG A;  1S32 A;  2BYM B;  3AZN A;  5AV9 D;  4J8X C;  2Y2H A;  3AZH C;  2NQB C;  1H3O B;  1P34 C;  1P3I C;  3C1B A;  5DNN C;  4R8P A;  3MGR B;  3VH5 A;  5B40 A;  3KWQ C;  3REK C;  4WU8 D;  3WTP C;  5B2I D;  1EQZ A;  2Y2G A;  1P3B B;  5DNN A;  1P3B A;  5GT0 D;  3AZL C;  2YFW A;  3AYW B;  3X1S B;  1KX5 C;  4R8P C;  4G92 C;  3REK A;  3REI C;  4WU9 D;  4ZBJ B;  5B32 A;  4ZUX D;  3AZI C;  1HTA A;  3MVD B;  5CPI D;  1P3L B;  4CSR A;  3UTA B;  1P3M A;  4CSR B;  1S32 C;  4H9O B;  3AZE D;  4XZQ A;  2F8N H;  1KX4 A;  4J8W B;  4KGC A;  4H9O A;  4H9Q B;  4CAY B;  4JJN C;  3WAA C;  3REJ B;  1N1J B;  5B2I A;  4J8V B;  3AZN D;  1P3M C;  1BH8 A;  3AZK B;  3AL0 C;  5CP6 B;  3NQU A;  4UPK A;  1P3K C;  1ID3 D;  2RIQ A;  3IP4 C;  4H9N A;  3AV2 C;  1P3O A;  5BO0 B;  5B32 G;  1P3A C;  3KXB C;  1U35 C;  4WU9 A;  4EO5 B;  5GSU C;  4X23 C;  3AZL D;  1KX5 A;  4YM6 A;  4JJN D;  4AWL B;  1F66 D;  4ZBJ C;  3NQJ B;  3B6F C;  5AVB A;  1HQ3 B;  2PYO A;  3REK D;  4LD9 D;  3AYW C;  5E5A A;  3B6G C;  2BYK A;  3C1B C;  5B2J B;  1KX4 D;  5GXQ B;  3WAA D;  3AZM B;  1P34 A;  3AZF C;  5B0Z D;  2HIO A;  5B24 D;  4XUJ C;  5B24 A;  1P3G C;  4LD9 B;  4H9R A;  5AV5 A;  2YFW B;  3REL D;  3LJA C;  3AYW A;  5B24 B;  4KUD A;  2NQB B;  2ARO C;  4WV4 B;  4NE3 A;  3AV2 B;  3MVD A;  4KGC D;  1Z2C B;  5GT0 C;  4YS3 C;  4WU9 C;  4YM6 D;  1U35 A;  3LZ0 C;  3REH C;  1F66 B;  1ID3 A;  1P3O C;  5DNN D;  3UT9 C;  3WA9 D;  3AZK D;  5B31 G;  1M19 C;  3W96 B;  3AZN B;  1TZY C;  2HUE B;  3AN2 B;  5G49 A;  3WAA A;  4H9Q A;  3TU4 A;  5B2J A;  1P3I D;  1ULY A;  5AV8 C;  1P3P D;  2Y2M A;  1EQZ B;  2G5I C;  3UTB A;  5BS7 C;  3X1V A;  5GT3 A;  3VH6 A;  5AV8 A;  3X1V B;  1P3G D;  1TAF B;  3TU4 C;  4XUJ D;  5GT3 C;  4WNN A;  5CPI B;  4XUJ A;  2FFF B;  1TAF A;  3FDD A;  5AVC D;  5F99 B;  3LEL B;  3MGR C;  3R45 A;  3EPH A;  3UTA D;  3AYW D;  4Z66 D;  3UTA A;  1F1E A;  3P5J B;  3MGP D;  5CPJ C;  3MVD D;  3W96 C;  4ZUX B;  3LZ1 C;  3UT9 D;  2J8P A;  3AN2 A;  4J8W A;  3MGP C;  3O62 C;  1P3P A;  1JFI B;  1B6W A;  4NE6 A;  3LZ1 A;  3UTA C;  2NQB A;  1N1J A;  5B2I B;  4KUD B;  4Z5T D;  4J8X A;  4Z66 B;  5E5A D;  5B0Y C;  3X1U A;  2NZD D;  2RVQ C;  2ZY2 A;  4KHA A;  5AVC B;  5F99 D;  3X1U D;  1ZLA C;  2FJ7 B;  3F6T A;  2NZD A;  1P3F A;  3AFA C;  4H9S A;  4XUJ B;  5AV9 B;  3X1V D;  1M1A D;  5AV5 D;  2RVQ D;  1KX3 B;  1HQ3 A;  5E5A C;  5B0Y D;  3B6G A;  1A7W A;  5B33 C;  2CWE A;  3MGS B;  1AOI A;  5BNV A;  5AY8 B;  1EQZ D;  3B6F D;  5BNX A;  3O62 D;  5GSU B;  4X23 B;  1P3A A;  5AV6 D;  5GSU A;  2DF4 C;  4X23 A;  1P3A B;  3KWQ B;  5GSU D;  4X23 D;  3X1T B;  3W96 D;  3VH6 T;  5B1L B;  3MGQ D;  3AZJ A;  5B31 D;  3LZ0 A;  3REH A;  1HQ3 C;  2VQR A;  5B2I C;  2Y2Q A;  2UWX A;  3A6N D;  3UT9 A;  3WTP D;  4AWL C;  1BFM A;  3WTP A;  1EQZ C;  5F99 A;  1P3M D;  4KGC C;  2F8N B;  5CPK B;  3AFA B;  2FJ7 A;  4G91 B;  1M1A A;  3AFA A;  3UTB D;  2F8N G;  2FJ7 D;  2NQB D;  1S32 B;  2F8N A;  2ARO A;  5B24 C;  4DQY B;  3VH6 W;  4Z5T B;  5B0Z B;  2BG1 A;  3B0D C;  5GXQ D;  3WAA B;  4YS3 B;  5JRG C;  5B1M B;  5AVB C;  2JCH A;  2PYO C;  1PZR A;  4J8W C;  4Z66 A;  1HQ3 D;  3B0C T;  1M19 D;  5C3I C;  4UUZ B;  4R8P D;  5B33 B;  5BO0 A;  3B6F A;  4H9N B;  3AZJ B;  5CPJ A;  2Y2O A;  4EO5 C;  4J8U D;  5CPJ D;  3X1S A;  3KXB A;  5AVB D;  2PYO D;  1KX3 A;  3W99 C;  3W97 D;  3AV1 C;  3MGQ A;  3KXB B;  1H3O A;  4HGA B;  5KDM A;  1AOI C;  4DRB A;  5DNM C;  5CP6 D;  5JA4 A;  5AY8 A;  5BNV B;  3AZG C;  3LJA D;  2IO5 B;  4Z2M G;  3X1V C;  3MNN A;  3WKJ D;  3WKJ A;  1ZLA B;  2FJ7 C;  3KUY A;  5BT1 C;  3KUY B;  2NZD C;  3A1K A;  3AZE B; 
#chains in the Genus database with same CATH homology
 1P3F C;  1TZY A;  3C1B D;  4M6B A;  3C1C B;  5B40 D;  3EPJ A;  3AZH B;  2Y2P A;  4E45 A;  5B31 C;  1P3L D;  3WA9 B;  1P3L A;  4J8U A;  4WU9 B;  3WA9 A;  2W8S A;  5GT0 A;  1P3O D;  3X1S C;  3W97 A;  1KX5 B;  3W96 A;  5DNM B;  5GT0 B;  4YS3 D;  3AZL A;  3W98 A;  5B40 C;  1P3B C;  5B33 D;  3MGR D;  1AOI B;  2HIO C;  2LY8 A;  3MGR A;  5JRG A;  4NE5 A;  3MNN B;  5B1M D;  5AV5 C;  1M18 B;  3W99 B;  3EPK A;  3UTB B;  2ZY5 A;  3AFA D;  4WZS B;  2F8N D;  3AZF D;  3MNN D;  5AV8 B;  5BT1 D;  5BS7 A;  5B32 B;  3MGP A;  5KDM B;  5B1L D;  3MGQ B;  1TZY D;  5DNM D;  1U35 B;  2L5A A;  5AV6 B;  1M19 A;  1KX5 D;  4WU8 A;  3W97 C;  2CV5 B;  4WJ3 C;  4WU8 C;  1JFI A;  4Z5T A;  4J8V D;  3REJ A;  4H9P B;  2IO5 C;  3C1B B;  3C1C D;  4YS3 A;  1P34 D;  3NQU B;  3TU4 D;  3AZG B;  3B6F B;  5B33 A;  3X1U B;  3AZE C;  1Q9C A;  5AV9 A;  3AZM C;  3H0L C;  3MNN C;  3AZF B;  5B32 C;  1P3G A;  2Y2J A;  3R45 B;  5DNM A;  3AZF A;  3W99 D;  3V9R A;  5CPI C;  5E5A B;  3EPL A;  5AVB B;  2ZY4 A;  2XD1 A;  2PYO B;  2JSS A;  3NQJ A;  3W98 C;  5BNX B;  3AZJ D;  1P3B D;  3LZ0 D;  3REH D;  1KU5 A;  3X1T A;  2HUE C;  3AN2 C;  3C1C A;  3KWQ A;  2ZM5 A;  4H9P A;  3UT9 B;  2XD5 A;  5CPI A;  1WWI A;  3LZ0 B;  3REH B;  3AZN C;  2Y2L A;  3MGP B;  3AV2 A;  3AZH A;  3AZH D;  1B67 A;  1F66 A;  4J8X D;  2ARO B;  5B0Z C;  4XZQ B;  1M1A C;  2HIO D;  2BYM A;  1KX4 C;  5B0Z A;  3LJA B;  3REL A;  4DRA A;  3LEL C;  3TU4 B;  3MGQ C;  3AZG D;  4UUZ A;  5AY8 C;  3AZG A;  1P34 B;  3W99 A;  2CV5 D;  2Y2I A;  1P3A D;  2F2A C;  2Y2N A;  3AN2 D;  5CPJ B;  1U35 D;  3LEL A;  3AV2 D;  1P3K D;  3X1T C;  4WNN B;  4QLC C;  5AY8 D;  4YM6 B;  3AV1 B;  5B0Y B;  1M1A B;  4ZUX A;  1P3I A;  3EG5 B;  3X1U C;  5B2J D;  1KX4 B;  3KFU G;  1M18 D;  2F8N K;  1ZLA A;  5CP6 C;  5AV8 D;  5GT3 D;  1AOI D;  3AZE A;  4CAY A;  4JJN B;  3AZI A;  4ZUX C;  3H0R C;  3LZ1 B;  3AZI D;  5CPK D;  3C1C C;  4NFT A;  3O62 A;  1P3P C;  5AVC A;  3WTP E;  1P3O B;  3AV1 D;  3A6N B;  4YM6 C;  1ID3 B;  4QLC B;  3A6N A;  4J8U C;  4QLC A;  3B6G B;  3AZL B;  3KWQ D;  3AZJ C;  5GXQ C;  5G49 B;  3V9R B;  3LEL D;  4J8W D;  1P3K A;  5B1L C;  3REL C;  1M18 A;  5AV9 C;  3MGS A;  3AZM A;  4HGA C;  3MGS D;  3UTB C;  3WKJ B;  4LD9 A;  5B40 B;  5AV5 B;  1M18 C;  5B2J C;  2HIO B;  4XZQ C;  2ZY3 A;  1P3P B;  3KUY D;  3MGS C;  5B1L A;  5B1M C;  3KSY A;  3REJ C;  1ZLA D;  1F66 C;  3AV1 A;  4J8X B;  1KX3 C;  3AZK C;  4J8U B;  4KUD D;  5B0Y A;  3B6G D;  2Y2K A;  4Z5T C;  4QLC D;  5JA4 B;  5CPK A;  3REI A;  3A6N C;  2CV5 A;  3B0D B;  3KXB D;  3H0M C;  4WU8 B;  3W97 B;  5AV6 A;  1M19 B;  3X1S D;  2DQN C;  2CV5 C;  4KUD C;  4G91 C;  5AV6 C;  4KGC B;  3LZ1 D;  3AZI B;  3LJA A;  3MVD C;  3B0B A;  1BH8 B;  3AZK A;  5CP6 A;  4R8P B;  4G92 B;  5CPK C;  1P3L C;  3REL B;  5GT3 B;  3A1I A;  1P3F D;  3VH5 T;  3AZM D;  4KHA B;  1P3G B;  4LD9 C;  1BH9 A;  5FUG B;  1T3U A;  2YFV B;  3REK B;  5CHL B;  5F99 C;  3WTP B;  3WKJ C;  2YFV A;  3REI D;  1S32 D;  3W98 B;  1P3I B;  5C3I B;  1P3K B;  3B0C W;  5GXQ A;  3X1T D;  4J8V C;  2G5H C;  5JRG B;  1P3M B;  2BYK B;  3VH5 W;  1W2E A;  5B31 A;  1ID3 C;  5DNN B;  5B31 B;  3WA9 C;  3W98 D;  4JJN A;  4H9R B;  5AVC C;  5B1M A;  1KX3 D;  4J8V A;  3REJ D;  5JRG D;  1TZY B;  1WWS A;  2JE5 A;  4E44 A;  4Z66 C;  3O62 B;  3KUY C;  4XZQ D;  1R4V A;  5B32 D;  4H9S C;  1P3F B;  3REI B;  2ARO D;  2NZD B;  4Z2M H;  1BH9 B;  5FUG A;  1S32 A;  2BYM B;  3AZN A;  5AV9 D;  4J8X C;  2Y2H A;  3AZH C;  2NQB C;  1H3O B;  1P34 C;  1P3I C;  3C1B A;  5DNN C;  4R8P A;  3MGR B;  3VH5 A;  5B40 A;  3KWQ C;  3REK C;  4WU8 D;  3WTP C;  5B2I D;  1EQZ A;  2Y2G A;  1P3B B;  5DNN A;  1P3B A;  5GT0 D;  3AZL C;  2YFW A;  3AYW B;  3X1S B;  1KX5 C;  4R8P C;  4G92 C;  3REK A;  3REI C;  4WU9 D;  4ZBJ B;  5B32 A;  4ZUX D;  3AZI C;  1HTA A;  3MVD B;  5CPI D;  1P3L B;  4CSR A;  3UTA B;  1P3M A;  4CSR B;  1S32 C;  4H9O B;  3AZE D;  4XZQ A;  2F8N H;  1KX4 A;  4J8W B;  4KGC A;  4H9O A;  4H9Q B;  4CAY B;  4JJN C;  3WAA C;  3REJ B;  1N1J B;  5B2I A;  4J8V B;  3AZN D;  1P3M C;  1BH8 A;  3AZK B;  3AL0 C;  5CP6 B;  3NQU A;  4UPK A;  1P3K C;  1ID3 D;  2RIQ A;  3IP4 C;  4H9N A;  3AV2 C;  1P3O A;  5BO0 B;  5B32 G;  1P3A C;  3KXB C;  1U35 C;  4WU9 A;  4EO5 B;  5GSU C;  4X23 C;  3AZL D;  1KX5 A;  4YM6 A;  4JJN D;  4AWL B;  1F66 D;  4ZBJ C;  3NQJ B;  3B6F C;  5AVB A;  1HQ3 B;  2PYO A;  3REK D;  4LD9 D;  3AYW C;  5E5A A;  3B6G C;  2BYK A;  3C1B C;  5B2J B;  1KX4 D;  5GXQ B;  3WAA D;  3AZM B;  1P34 A;  3AZF C;  5B0Z D;  2HIO A;  5B24 D;  4XUJ C;  5B24 A;  1P3G C;  4LD9 B;  4H9R A;  5AV5 A;  2YFW B;  3REL D;  3LJA C;  3AYW A;  5B24 B;  4KUD A;  2NQB B;  2ARO C;  4WV4 B;  4NE3 A;  3AV2 B;  3MVD A;  4KGC D;  1Z2C B;  5GT0 C;  4YS3 C;  4WU9 C;  4YM6 D;  1U35 A;  3LZ0 C;  3REH C;  1F66 B;  1ID3 A;  1P3O C;  5DNN D;  3UT9 C;  3WA9 D;  3AZK D;  5B31 G;  1M19 C;  3W96 B;  3AZN B;  1TZY C;  2HUE B;  3AN2 B;  5G49 A;  3WAA A;  4H9Q A;  3TU4 A;  5B2J A;  1P3I D;  1ULY A;  5AV8 C;  1P3P D;  2Y2M A;  1EQZ B;  2G5I C;  3UTB A;  5BS7 C;  3X1V A;  5GT3 A;  3VH6 A;  5AV8 A;  3X1V B;  1P3G D;  1TAF B;  3TU4 C;  4XUJ D;  5GT3 C;  4WNN A;  5CPI B;  4XUJ A;  2FFF B;  1TAF A;  3FDD A;  5AVC D;  5F99 B;  3LEL B;  3MGR C;  3R45 A;  3EPH A;  3UTA D;  3AYW D;  4Z66 D;  3UTA A;  1F1E A;  3P5J B;  3MGP D;  5CPJ C;  3MVD D;  3W96 C;  4ZUX B;  3LZ1 C;  3UT9 D;  2J8P A;  3AN2 A;  4J8W A;  3MGP C;  3O62 C;  1P3P A;  1JFI B;  1B6W A;  4NE6 A;  3LZ1 A;  3UTA C;  2NQB A;  1N1J A;  5B2I B;  4KUD B;  4Z5T D;  4J8X A;  4Z66 B;  5E5A D;  5B0Y C;  3X1U A;  2NZD D;  2RVQ C;  2ZY2 A;  4KHA A;  5AVC B;  5F99 D;  3X1U D;  1ZLA C;  2FJ7 B;  3F6T A;  2NZD A;  1P3F A;  3AFA C;  4H9S A;  4XUJ B;  5AV9 B;  3X1V D;  1M1A D;  5AV5 D;  2RVQ D;  1KX3 B;  1HQ3 A;  5E5A C;  5B0Y D;  3B6G A;  1A7W A;  5B33 C;  2CWE A;  3MGS B;  1AOI A;  5BNV A;  5AY8 B;  1EQZ D;  3B6F D;  5BNX A;  3O62 D;  5GSU B;  4X23 B;  1P3A A;  5AV6 D;  5GSU A;  2DF4 C;  4X23 A;  1P3A B;  3KWQ B;  5GSU D;  4X23 D;  3X1T B;  3W96 D;  3VH6 T;  5B1L B;  3MGQ D;  3AZJ A;  5B31 D;  3LZ0 A;  3REH A;  1HQ3 C;  2VQR A;  5B2I C;  2Y2Q A;  2UWX A;  3A6N D;  3UT9 A;  3WTP D;  4AWL C;  1BFM A;  3WTP A;  1EQZ C;  5F99 A;  1P3M D;  4KGC C;  2F8N B;  5CPK B;  3AFA B;  2FJ7 A;  4G91 B;  1M1A A;  3AFA A;  3UTB D;  2F8N G;  2FJ7 D;  2NQB D;  1S32 B;  2F8N A;  2ARO A;  5B24 C;  4DQY B;  3VH6 W;  4Z5T B;  5B0Z B;  2BG1 A;  3B0D C;  5GXQ D;  3WAA B;  4YS3 B;  5JRG C;  5B1M B;  5AVB C;  2JCH A;  2PYO C;  1PZR A;  4J8W C;  4Z66 A;  1HQ3 D;  3B0C T;  1M19 D;  5C3I C;  4UUZ B;  4R8P D;  5B33 B;  5BO0 A;  3B6F A;  4H9N B;  3AZJ B;  5CPJ A;  2Y2O A;  4EO5 C;  4J8U D;  5CPJ D;  3X1S A;  3KXB A;  5AVB D;  2PYO D;  1KX3 A;  3W99 C;  3W97 D;  3AV1 C;  3MGQ A;  3KXB B;  1H3O A;  4HGA B;  5KDM A;  1AOI C;  4DRB A;  5DNM C;  5CP6 D;  5JA4 A;  5AY8 A;  5BNV B;  3AZG C;  3LJA D;  2IO5 B;  4Z2M G;  3X1V C;  3MNN A;  3WKJ D;  3WKJ A;  1ZLA B;  2FJ7 C;  3KUY A;  5BT1 C;  3KUY B;  2NZD C;  3A1K A;  3AZE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...