4J8YA

E3_5 darpin d77s mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNGADVNASSLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords DARPin_E3_5_D77S
total genus 50
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4j8yA00
1N11A 5ENRD 2L6BA 5CEDB 3DEOA 4K5CA 1SW6A 4G8KA 3D9HA 5ENPD 5HKPA 3Q9UC 5CBNA 4C48B 5FIOA 2VGEA 4U8YD 4U95D 5ENOD 4HRLA 1K1AA 1BU9A 2ETBA 3V31A 2KBXA 1BD8A 1OY3D 3TWQA 2MYOA 2ETCA 5AQAA 5KBAA 4HB5A 3TWVA 3KEAA 4F6RD 2QC9A 1SVXA 1AWCB 5HS0A 5BXUA 2DWZA 4HI8A 3B7BA 4N5QA 1WG0A 4TUMA 4BERA 4DRXE 1N0RA 4LG6A 3ZNGA 4OAUC 1AP7A 5EYPF 3EHQA 5AQ7A 2A5EA 4RLYA 4GPMA 4OAVB 4QQIA 2QYJA 4GMRA 4B93B 1MX6A 2KXPC 2Y1LE 2Y0BG 4DX6D 2XEHA 4Z68A 5JA4D 2HE0A 5D66A 1DC2A 2BKGA 5CEAA 4J8YA 2FO1E 1QYMA 3W9GA 4O1OA 1IKND 3V79K 4DX2A 2XZDG 2ZGDA 4YDYA 5EIBE 3ZU7B 2RFMA 4ZFHA 5EIDA 3SO8A 1IHBA 5CBOA 4J7WA 4NIKA 5ITZF 2PNNA 5ENTD 5AARA 5KNHD 1A5EA 2F8XK 3NBNB 3NOGD 3EHRA 4DX1A 2ETAA 1DCQA 3J5PA 4BSZB 3HG0D 3AJIA 3JUEA 4BESA 4G8LA 2V4HC 4K5AB 5EYLA 3W9FA 1MJ0A 4O1PA 3UI2A 1D9SA 1K3ZD 2XENA 1G3NB 1YMPA 4YDWA 1YYHA 5FINA 1BI7B 4LSZE 1UOHA 1IXVA 1OT8A 3T8KA 3TWRA 1BLXB 5AAOA 2J8SD 1MYOA 1TR4A 2DZOA 4BETA 4HLLA 4F1PA 1YCSB 2XEEA 2ZGGA 2DVWA 3F6QA 3LJNA 2DZNA 5CERB 4HNAD 3NOCD 3HRAA 2RFAA 1K1BA 4HI9A 5JMND 1N0QA 1NFIE 4HRMB 5EILA 4CYMD 3JXIA 4JB8P 3C5RA 3DEPA 1S70B 4BEPA 2F37A 2AJAA 3J5QB 3JXJA 5AQ9A 3T9KA 4UUCA 3V2OA 4CZ2D 5CECB 5AN8A 3EU9A 3TWUA 4LNUD 3V30A 3TWTA 4ZHBA 4U96D 2V5QC 3TWXA 3Q9NC 4U8VD 4HBDA 4A63B 3TWWA 5HRYA 2NYJA 2BKKB 2F8YA 3V2XA 3UXGA 2P2CP 5ENSD 4ATZD 5KNGA 5ENQD 5EN5D 5AQBA 3ZKJA 2B0OE 2JABA 3ZUVB 1WDYA 1MX4A 1BI8B 4QFVA 3UTMA 4HQDA 2XZTG 4HRNA 4O60A 4DUIA 4DX5D 1MX2A 3IXEA 4DX7D 3TWSA 4K5BA 5KWDA 5BXOA 3B95A 3AAAC
chains in the Genus database with same CATH superfamily
2R03A 2P9IG 2OVBA 1UN9A 1HG5A 5G55A 2WXFA 4TRQA 3SI5A 4KBQA 5AQAA 3APCA 2VTBA 2GROB 1IHGA 4IN3B 3ZYMA 2HM8A 3B7RL 1AP7A 3PVLA 4JW1A 3U4TA 5G05C 4GTSA 3OXLA 4J7WA 4TXQA 5JHAA 2ILRA 1SQMA 4I6EA 4DX1A 3LDZA 3HG0D 4G8LA 4FU3A 2QY7A 2XENA 1HE8A 4ATGA 2WMNA 4UI9J 3LVRE 1BLXB 1HO8A 4HLLA 2YINA 3E32A 3NOCD 4HI9A 1H2UA 3EHNA 5EILA 5LOZA 1N94A 2F37A 3ZFWA 3O48A 5CMWA 4UUCA 4AXHA 4FJZA 4HBDA 4U8VD 2NYJA 2XPYA 4HOQA 5ENSD 2JABA 4HFGA 1OCCE 3AU5A 4AIFA 1Z6TA 2R17C 1JPLA 2R59A 4GZ5A 1N11A 4G8KA 5ENPD 3FUEA 5FIOA 1EPUA 1K1AA 3LPZA 3TL5A 3EDTB 3FUDA 5A7DB 2WXKA 4E85A 4TV3A 2X38A 4BT8A 3DPDA 3FTXA 1OUVA 3UQ3A 2IFUA 4EBAG 4FC8A 3HXDA 1V54E 3ZXSA 3FEYA 4GTQA 1HS6A 4J8YA 1IKND 3PS6A 4UWFA 4GTOA 3AU4A 4G11A 4PUCA 3FU3A 1HFAA 1UG3A 4KT6B 2IF4A 1Z3YA 2ETAA 5DIZA 5LCWC 1QBQA 3AJIA 4KMOA 3UIOC 5J90A 3CEQA 3RK6A 3FP3A 1UOHA 1KT0A 2LXLA 4FADA 2ZGGA 3EJNA 4LERA 1D8DA 1N0QA 1NFIE 2WXPA 4EHMA 4ME2A 5FZRA 4AM9A 3TG5A 3ASHA 3TWUA 4UI9K 3Q7AA 2YHCA 2EINE 3UXGA 3ZKJA 5FWQA 5T3RA 2F0YA 4FP7A 1UJJA 4JA9A 4JXTA 5CMYA 2I2OA 3HXEA 4I1MA 1PY1A 2Y4TA 2WQ6A 3E37A 1NP7A 4WUYA 4LCTA 4L2YA 4U04A 4J6IA 3KD7A 4HB5A 2QC9A 2IO3C 4N5CA 2DWZA 4HI8A 5KJKA 4AEZC 2Y3AA 3CVNA 4DRXE 3SY2A 3ESKA 1TNOA 2CHXA 4OAVB 4B94A 4QQIA 4PS8A 4B93B 3BQOA 2BKGA 5CEAA 3LYAA 4YDYA 3ZU7B 3FH8A 3K9IA 4GYYA 5ITZF 3CHSA 3UMVA 1HU3A 4ILGA 5EX0A 3JUEA 1OCRE 4F3VA 4N3BA 2IOSA 5FINA 4GZ6A 1TNUA 3ZPJA 4A3TA 1H6KA 1QZ2A 2DVWA 4NQ0A 4I43A 2VQ2A 3D9IA 3EU5A 1K1BA 1H0AA 1QQEA 2OEWA 3MX3A 3ASOE 1TN6A 1D9SA 1NA0A 1H19A 3Q79A 5A23A 1H2TC 2EIME 3G2WA 4GCOA 2VTBB 3UTMA 5G2NA 1E96B 3QNKA 5M72A 4EZKA 2HR2A 4H7YA 1TJFA 3DEOA 4ACLA 4A55A 4LNBA 3FUHA 3L22A 4U95D 4MLPA 3APDA 1HZ4A 2LUHA 3HVEA 3L08A 3SBSA 2FEZA 1LD8A 3Q75A 2NSZA 4EQFA 3ABLE 4HOTA 2VJ8A 3EIJA 5G05J 4F53A 2VSXE 4J0UA 2X6KA 4HOSA 3SFYA 3FTSA 4BY6A 3QB2A 3FDHA 4UI9C 5D0QD 4B89A 5EIBE 3UX4A 1OCZE 5B1BE 1O1SA 3L13A 3DSSA 4WNDA 4GMJA 4GCNA 4BWRA 4OVVA 1IQUA 1K3ZD 3CK8A 3UINC 3CVYA 2EIJE 4I6JA 1JCRA 2DZNA 5CRUA 3S7BA 5G04C 4LRZA 3C5RA 4AV7A 4XKBA 5D0OD 5CRVA 5CCMA 3T9KA 3UM1A 4ZHBA 4BFRA 3SHFA 4N2QA 3DSTA 3TXMA 4EZLA 3CHPA 3EUVA 3Q49B 3FU6A 2MOWA 2XCBA 3LXUX 3NZUA 4GA0A 3SBTB 5DBKA 2LXMA 3V31A 3UPVA 2R02A 4YDOA 3PUKA 3HIZA 3SGHA 3RKVA 5IY5E 1TEZA 1ELKA 2H6IA 5KCMA 3B13A 3FTVA 5G04J 3CLJA 2WXQA 3L17A 2CHWA 5CHEE 4I6GA 1IYGA 2FULA 4GTRA 4ANXA 3MGBA 5D2MC 3HYMB 2Y1LE 3L16A 2R05A 4U0UA 3PDNA 1OXJA 2UWJG 3PE3A 1WM5A 2HYZA 3SFXA 1Z5SC 3S7FA 5AARA 1SZAA 3DSWA 5KNHD 1VDYA 3I3NA 4BESA 4FA6A 1WAO1 3C98A 3MV2B 1NZNA 4B8AA 3PZDA 4N3AA 4FLHA 2PQRA 4YDWA 3N71A 4A1SA 2OOEA 1O1TA 5CERB 4I17A 4EPZA 2JLBA 4JB8P 1FCHA 2H6GA 3ULQA 4CZ2D 2I1KA 3ULYA 4TXRA 4A63B 1HX8A 5FQ8A 3FTWA 5C2YA 3Q15A 2XGMA 5BV1A 3ZUVB 4ILHB 3QARA 1HH8A 3LKUA 4APOA 3OXGA 5BXOA 3FY4A 1E7VA 3C3OA 1FVFA 3D9PA 4G24A 2KBXA 4HS2A 3GZ2A 3FUIA 4M3OA 3TWQA 4BTAA 3T8MA 4JHRA 4YVOA 2UY1A 4GTTA 4RVBA 4TUMA 2OEVA 5KJLA 2VGXB 4G1TA 5ANRA 1DCEA 2RKKA 2P9NG 1SZ9A 2FO1E 2XZDG 3D9NA 1TN7A 2E2EA 4K03A 4NIKA 4HORA 2PL2A 5JJ6A 4N2SA 4HVBA 4CEMA 4NACA 3NZSA 3PEVB 4J8EA 3JQ1A 2XGSA 3MYVA 1NA3A 4CCAA 3UI2A 3DXKG 1G3NB 4ANVA 1IXVA 4JHKA 4KYOB 2DZOA 1YCSB 3F6QA 3LJNA 4F1SA 3L82A 4CYMD 3PNLB 3PZ3A 5CECB 2V5QC 1O5MA 3RU0A 3ZYLA 4C0EA 2CFUA 3PZ4A 1KLXA 4HQDA 3ZVVA 3L9TA 3BUAA 2WXGA 4F7AA 4DX7D 2P9LG 4K5BA 4RQIA 3LVQE 3UIPC 2EIKE 1SW6A 4RSYA 3CR3A 4WWOA 2P9KG 3HXBA 2IONA 2CHZA 1RZ4A 5KBAA 4XX5A 1JCSA 3T5VA 3FUMA 1JCQA 2CG2A 2V5FA 4OAUC 2KATA 4RG6A 3LY8A 3PREA 4U0SA 3PUJA 4KXKB 3BG1B 2XEHA 3LY7A 4KVOA 3V79K 4JPSA 5JJ7A 2ZGDA 1SA4A 2IOLA 2LSUA 3EHRA 1HF8A 2L0TB 3OAWA 1KZOA 1OWNA 4XZ4A 3QKYA 2LAIA 4L7TA 3TJPA 5KJNA 5AJLA 2NC9A 3TGOA 4B0ZA 3ONLA 3BEEA 2XEEA 1DNPA 2J08A 3KSLA 3Q4AB 1ELWA 4HNAD 2RFAA 4JVSA 2H6FA 4R7LA 1X5BA 3DEPA 1XGWA 2XEVA 3Q9NC 5FT9A 2BKKB 4ATZD 3CSTA 1E8XA 4PS7A 2B0OE 3UKUG 1MX4A 4JHJA 4HRNA 3DXMG 5JHBA 5KJMA 3FWVA 1O1RA 3DPYA 5LFAA 1S64A 3I4RB 2GRLA 4C48B 2XS8A 2R2LA 1BD8A 3ENEA 3U9WA 3B7TA 3CHQA 3QK0A 3MKRA 2FF4A 5BXUA 3ZHEB 3MV3B 3DSXA 3R7RA 3AG4E 1Q2ZA 3ABME 4JL0A 4DLQA 2IJGX 1MX6A 4I1OB 5EKQD 2A4ZA 4BT9A 5E76A 2VYIA 3KAEA 3SO8A 2KM4A 5CBOA 3CVWA 3ZGQA 3NBNB 3MCXA 5LCWJ 4XEIG 3B7SA 2J07A 1N9AA 1MJ0A 2VSNA 4JD2G 3CK9A 5H7PA 1N4SA 1GW6A 2GRPB 3DRAA 1NI1A 5B1AE 2VSYA 5AAOA 1HG2A 1YA0A 1FVHA 1ZB1A 3BG0B 4L1BA 1TN8A 2AXVA 3E30A 5HQ8A 2Q7FA 3ZW3A 2AWIA 3R7QA 3V30A 3G2SA 3C72A 3JYSA 5HRYA 3G2TA 5HI7A 3ML9A 1WY6A 5ENQD 2BF0X 1U3DA 3CVUA 1WDYA 3C3RA 5LP0A 4DUIA 3G2UA 5J08A 2P9PG 4XI0A 4ACKA 3SNXA 4GTPA 1LF8A 2XPZA 2ETCA 2PZIA 3D3MA 4GMLA 4U07A 1XNFA 4BX8A 4TXPA 3Q73A 4U7EB 4MKTA 4FJYA 3EHQA 5B3SE 3Q47B 4OVUA 3HDXA 2KXPC 3NB2A 4J8FA 3CVPA 3UT7A 3KEZA 4J8DA 5AENA 3DWLG 5AJDA 3NOGD 3LCAA 3SQVA 4BSZB 4NRHB 2GW1A 5EYLA 3E34A 3P1UA 3AG3E 5AIJA 4JA7A 3S7DA 3S7JA 3RSEG 2XQ0A 3I5PA 2WPVA 1MZCA 4DI4A 3CVQA 2WVIA 4K0RA 3I4GA 3CGHA 4M7CA 1MQSA 4AY5A 1INZA 2XZTG 4DX5D 3Q5MA 3TWSA 4CDNA 3B95A 5C1DA 3CQCB 4L23A 1OCOE 3Q9UC 3SZ7A 3R9AB 3TAXA 3PRZA 1LD7A 3IHVA 3TWVA 1X81A 3FTUA 3KEAA 2J49A 1BPOA 4FHKA 3IKOB 3U3WA 3CIAA 1ELRA 1K8KG 1OWPA 4KVMA 4RLYA 4L2LA 2P9UG 5D66A 4UQZA 1UN8A 4DX2A 2RFMA 3IV0A 5ENTD 4XKCA 2V0PA 4PH4B 4Y6CA 1PC2A 4UWGA 2ZU6B 3FHEA 4UWLA 3LY9A 5BNWA 1BI7B 2BTDA 4C0MA 1N4RA 4WNFA 1TR4A 4U8HA 2DYSE 5AYWD 2IO2C 3QC1A 5CCLA 1S70B 4BEPA 4GZCA 2FI7A 3LEWA 1D8EA 4EBAA 5EN5D 5AQBA 3CKCA 4APFA 4QFVA 4O60A 4PS3A 1S0PA 3QOUA 3AS5A 3IXEA 4WNEA 3P2BA 4XI9A 1JWGA 1LTXA 3ZHEA 3AS4A 3QJZA 1TNZA 1MHQA 1ZBPA 4GTMA 4N39A 3R9MA 2GRQB 3FFLA 5FJYA 2VGYA 2M63A 4CGWA 5ENNA 4FULA 2X3MA 3HVEB 3NAWA 2AXUA 3D9OA 4N5QA 5FZQA 3ZNGA 2WMOA 4CGVA 1QNFA 1Z3XA 3RJVA 2P9SG 4DK5A 2PQNA 2IQCA 1N4QA 4O1OA 4XE0A 2HO1A 4JZYA 4Y6WA 4A1GA 4O6FA 3U66A 4WWPA 4AOFA 4DPRA 2GRMA 3J5PA 2PM6A 3LS8A 2BUGA 3W9FA 2B6CA 3QDNA 2QZAA 1N95A 3MKQB 3UT8A 4IRUA 4YVQC 2IY0C 3FU0A 2FO7A 1TJCA 4GTVA 3KS2A 4G2VA 2X6IA 4L9PA 4IYPA 3JQ0A 3JXIA 3FULA 2AJAA 4DJAA 1N54A 3AG1E 5AQ9A 1TYQG 3CHOA 4UWKA 2NXPA 1P5QA 3L6AA 2VSOE 4Q94A 3VTYA 2UY1B 1E7UA 1BI8B 1UW4B 2C2LA 1MX2A 3JUIA 1U3CA 3GZ1A 3QWPA 5CEDB 3GZSA 3UM3A 2VGXA 4B8CB 3CVVA 2DYRE 3ASDA 4GPKA 1S63A 3MA5A 2AVPA 2WXOA 3FH7A 4F6RD 1SVXA 1JUQA 2ZISA 3OTNA 4I9EA 3IHYA 2AW6A 5AQ7A 4GPMA 5FQ7A 3ESLA 2MRIA 4X8QA 4ZFHA 3SFZA 4OYSA 3E4BA 4KZ0A 1EYHA 3O4ZA 2V4HC 4O1PA 3JCKC 5EDSA 3UKRG 1YMPA 3ML8A 3EHMA 1L5JA 1OT8A 4TUUA 1V55E 4AP2A 4LUNU 2E0IA 5JMND 4HRMB 3QWVA 4ANWA 2C0MA 2EQXA 4HOUA 3RIBA 5FQ6A 3ZXPA 3FUKA 3EU9A 3TWTA 2GRRB 4AVXA 3T5XA 3APFA 3V2XA 2LNIA 2WXLA 2GGFA 5A6CA 2RD0A 2MHKA 1Y8MA 2XRYA 2ZXWE 3ONKA 3ASFA 3RO3A 2WXNA 3CSFA 4GYOA 4K5CA 3CKBA 4YNDA 5ARGA 3FEXA 1H2VC 1H6OA 1KPSB 3IBEA 2OVFA 1BU9A 5E75A 3VTXA 1OY3D 4JC8A 2LO6A 5EX3A 2I9CA 3CVLA 2Y4UA 2WQ7A 1AWCB 1UJKA 3B7BA 1WG0A 4C9BB 3FTZA 3FU5A 3ZIMA 2A5EA 3D9KA 4GMRA 4DLOA 2XCCA 2J4DA 3FUFA 4UQXA 1DC2A 3TG4A 2HE0A 3W9GA 2EILE 1FT2A 4Q96A 5EIDA 1A5EA 2IU1A 4U0ZA 4V3IA 1DCQA 1DVPA 3Q7FA 4K5AB 4G26A 2CFZA 3TXNA 4GU5A 3VLFA 3G2VA 2DBAA 2WXHA 5LX8A 3CK7A 3PZ2A 4AY6A 3MEKA 1FPPA 3CQGB 3PE4A 2LSVA 2ONDA 4JEHA 4JEUA 5ARFA 3TWXA 3TWWA 2C0LA 2I1JA 3IEGA 1IQRA 1E8ZA 1W3BA 2IEJA 4EECA 3L54A 3ISMC 5CBNA 3ZYQA 2VGEA 3FTYA 4EZJA 2KCLA 1KZPA 4AJWA 1TNBA 3SF4A 4IULA 1OWMA 2XGOA 2WQHA 2CG3A 4UWHA 3PZ1A 4CT4A 4BERA 2KCKA 5BUZA 1N0RA 5EYPF 1NL4A 2XPIA 3GW4A 2BEDA 4N3CA 3UM2A 2QYJA 2PM7A 1N52A 3U64A 4GZ3A 1HXIA 3EIQC 4WWNA 4E6HA 3ZEFA 3FUNA 1OWOA 1SA5A 3MJWA 3MKQA 2PNNA 3UM0A 1B89A 4Q69A 3FH5A 3WXXA 2L9BA 3D9LA 1YYHA 4A3VA 3T8KA 3FUJA 3TWRA 1MYOA 4BETA 4F1PA 2RG8A 3D9JA 3HRAA 2X6JA 4LEUA 1FT1A 4GA2A 4CDRA 3JXJA 3J5QB 2WB2A 3B7UX 4I2WA 4LNUD 4U96D 3E33A 3QWWA 4YDEA 2X6FA 2P2CP 5KNGA 3NQPA 3RAUA 2OCCE 3QAQA 1Y6IA 3ASNE 3NF1A 3ULEG 1A17A 1H6PA 3DBSA 3URZA 3D9HA 5HKPA 2KZTB 3SD5A 2MYOA 3GYZA 1N4PA 3ABKE 3WG7E 3CVXA 3DSVA 4HXIA 2WXMA 2JEKA 4BTBA 4ABNA 4I1AA 2V4LA 3UUXA 2KZTA 3OXFA 3ASGA 3BU8A 3D9MA 3ZN3A 4W9RA 2KC7A 3C3QA 5BW8C 5JA4D 4J8SA 1QYMA 2KCVA 3HHMA 3HXFA 2R5SA 3X2QE 3VLEA 4FHJA 4UQYA 2L6JA 4WAFA 2YQ8A 5FZSA 4FLBA 5FQ4A 5T8IA 2OV8A 4MS6A 4LSZE 5BPPA 1KT1A 2J8SD 4WNGA 1U2VG 4ANUA 1TNYA 1E8YA 2WXJA 4GZDA 5JJTA 2QYUA 2Y69E 3V2OA 3ZYKA 2YHEA 2P58C 2ZIRA 3S2AA 4BX9A 5T4YA 2F8YA 1E90A 4U63A 2LAHA 4NURA 4MRUA 2J4BA 1OWLA 3RRNB 5KWDA 4GAAA 1EDUA 3AAAC 5ENRD 2L6BA 3LJ3A 3AS8A 2FBNA 3PEUB 4U8YD 5ENOD 4HRLA 5BT1A 3CV0A 2ETBA 1RW2A 2L0IA 4D10C 4KZCA 4MBGA 4HLEA 2H6HA 3CHMA 2WM9A 4GA1A 5HS0A 3CHRA 4ILIA 3RO2A 4LG6A 2V8SE 3VLDA 2GRNB 2QFCA 4GYWA 2J09A 2Y0BG 4URKA 4DX6D 4Z68A 2I6HA 1JWFA 2WXRA 2YNQA 1E8WA 4LNGA 3PNTB 1IHBA 2XRZA 4I2ZA 4RG9A 2XS1A 5FTPA 2F8XK 4XIFA 1PAQA 2AXZA 3DSUA 4G23A 5ANLA 1EF1C 2XHEA 3Q78A 3RRUA 4I9CA 3MZLB 3PH0C 1ZU2A 2J9QA 3AG2E 2X6HA 4PDXA 3HXCA 3RRMB 5AN8A 3ZRHA 2A5UA 4CDMA 4CRWA 4CT0A 4BSXA 2WXIA 4G25A 3KSQA 3UT4A 2DCPA 4DI3A 4H7XA 4P29A 4GB9A 2DIWA 5BV0A
chains in the Genus database with same CATH topology
1N11A 5ENRD 2L6BA 5CEDB 3DEOA 4K5CA 1SW6A 4G8KA 3D9HA 5ENPD 5HKPA 3Q9UC 5CBNA 4C48B 5FIOA 2VGEA 4U8YD 4U95D 5ENOD 4HRLA 1K1AA 1BU9A 2ETBA 3V31A 2KBXA 1BD8A 1OY3D 3TWQA 2MYOA 2ETCA 5AQAA 5KBAA 4HB5A 3TWVA 3KEAA 4F6RD 2QC9A 1SVXA 1AWCB 5HS0A 5BXUA 2DWZA 4HI8A 3B7BA 4N5QA 1WG0A 4TUMA 4BERA 4DRXE 1N0RA 4LG6A 3ZNGA 4OAUC 1AP7A 5EYPF 3EHQA 5AQ7A 2A5EA 4RLYA 4GPMA 4OAVB 4QQIA 2QYJA 4GMRA 4B93B 1MX6A 2KXPC 2Y1LE 2Y0BG 4DX6D 2XEHA 4Z68A 5JA4D 2HE0A 5D66A 1DC2A 2BKGA 5CEAA 4J8YA 2FO1E 1QYMA 3W9GA 4O1OA 1IKND 3V79K 4DX2A 2XZDG 2ZGDA 4YDYA 5EIBE 3ZU7B 2RFMA 4ZFHA 5EIDA 3SO8A 1IHBA 5CBOA 4J7WA 4NIKA 5ITZF 2PNNA 5ENTD 5AARA 5KNHD 1A5EA 2F8XK 3NBNB 3NOGD 3EHRA 4DX1A 2ETAA 1DCQA 3J5PA 4BSZB 3HG0D 3AJIA 3JUEA 4BESA 4G8LA 2V4HC 4K5AB 5EYLA 3W9FA 1MJ0A 4O1PA 3UI2A 1D9SA 1K3ZD 2XENA 1G3NB 1YMPA 4YDWA 1YYHA 5FINA 1BI7B 4LSZE 1UOHA 1IXVA 1OT8A 3T8KA 3TWRA 1BLXB 5AAOA 2J8SD 1MYOA 1TR4A 2DZOA 4BETA 4HLLA 4F1PA 1YCSB 2XEEA 2ZGGA 2DVWA 3F6QA 3LJNA 2DZNA 5CERB 4HNAD 3NOCD 3HRAA 2RFAA 1K1BA 4HI9A 5JMND 1N0QA 1NFIE 4HRMB 5EILA 4CYMD 3JXIA 4JB8P 3C5RA 3DEPA 1S70B 4BEPA 2F37A 2AJAA 3J5QB 3JXJA 5AQ9A 3T9KA 4UUCA 3V2OA 4CZ2D 5CECB 5AN8A 3EU9A 3TWUA 4LNUD 3V30A 3TWTA 4ZHBA 4U96D 2V5QC 3TWXA 3Q9NC 4U8VD 4HBDA 4A63B 3TWWA 5HRYA 2NYJA 2BKKB 2F8YA 3V2XA 3UXGA 2P2CP 5ENSD 4ATZD 5KNGA 5ENQD 5EN5D 5AQBA 3ZKJA 2B0OE 2JABA 3ZUVB 1WDYA 1MX4A 1BI8B 4QFVA 3UTMA 4HQDA 2XZTG 4HRNA 4O60A 4DUIA 4DX5D 1MX2A 3IXEA 4DX7D 3TWSA 4K5BA 5KWDA 5BXOA 3B95A 3AAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N11 A;  5ENR D;  2L6B A;  5CED B;  3DEO A;  4K5C A;  1SW6 A;  4G8K A;  3D9H A;  5ENP D;  5HKP A;  3Q9U C;  5CBN A;  4C48 B;  5FIO A;  2VGE A;  4U8Y D;  4U95 D;  5ENO D;  4HRL A;  1K1A A;  1BU9 A;  2ETB A;  3V31 A;  2KBX A;  1BD8 A;  1OY3 D;  3TWQ A;  2MYO A;  2ETC A;  5AQA A;  5KBA A;  4HB5 A;  3TWV A;  3KEA A;  4F6R D;  2QC9 A;  1SVX A;  1AWC B;  5HS0 A;  5BXU A;  2DWZ A;  4HI8 A;  3B7B A;  4N5Q A;  1WG0 A;  4TUM A;  4BER A;  4DRX E;  1N0R A;  4LG6 A;  3ZNG A;  4OAU C;  1AP7 A;  5EYP F;  3EHQ A;  5AQ7 A;  2A5E A;  4RLY A;  4GPM A;  4OAV B;  4QQI A;  2QYJ A;  4GMR A;  4B93 B;  1MX6 A;  2KXP C;  2Y1L E;  2Y0B G;  4DX6 D;  2XEH A;  4Z68 A;  5JA4 D;  2HE0 A;  5D66 A;  1DC2 A;  2BKG A;  5CEA A;  4J8Y A;  2FO1 E;  1QYM A;  3W9G A;  4O1O A;  1IKN D;  3V79 K;  4DX2 A;  2XZD G;  2ZGD A;  4YDY A;  5EIB E;  3ZU7 B;  2RFM A;  4ZFH A;  5EID A;  3SO8 A;  1IHB A;  5CBO A;  4J7W A;  4NIK A;  5ITZ F;  2PNN A;  5ENT D;  5AAR A;  5KNH D;  1A5E A;  2F8X K;  3NBN B;  3NOG D;  3EHR A;  4DX1 A;  2ETA A;  1DCQ A;  3J5P A;  4BSZ B;  3HG0 D;  3AJI A;  3JUE A;  4BES A;  4G8L A;  2V4H C;  4K5A B;  5EYL A;  3W9F A;  1MJ0 A;  4O1P A;  3UI2 A;  1D9S A;  1K3Z D;  2XEN A;  1G3N B;  1YMP A;  4YDW A;  1YYH A;  5FIN A;  1BI7 B;  4LSZ E;  1UOH A;  1IXV A;  1OT8 A;  3T8K A;  3TWR A;  1BLX B;  5AAO A;  2J8S D;  1MYO A;  1TR4 A;  2DZO A;  4BET A;  4HLL A;  4F1P A;  1YCS B;  2XEE A;  2ZGG A;  2DVW A;  3F6Q A;  3LJN A;  2DZN A;  5CER B;  4HNA D;  3NOC D;  3HRA A;  2RFA A;  1K1B A;  4HI9 A;  5JMN D;  1N0Q A;  1NFI E;  4HRM B;  5EIL A;  4CYM D;  3JXI A;  4JB8 P;  3C5R A;  3DEP A;  1S70 B;  4BEP A;  2F37 A;  2AJA A;  3J5Q B;  3JXJ A;  5AQ9 A;  3T9K A;  4UUC A;  3V2O A;  4CZ2 D;  5CEC B;  5AN8 A;  3EU9 A;  3TWU A;  4LNU D;  3V30 A;  3TWT A;  4ZHB A;  4U96 D;  2V5Q C;  3TWX A;  3Q9N C;  4U8V D;  4HBD A;  4A63 B;  3TWW A;  5HRY A;  2NYJ A;  2BKK B;  2F8Y A;  3V2X A;  3UXG A;  2P2C P;  5ENS D;  4ATZ D;  5KNG A;  5ENQ D;  5EN5 D;  5AQB A;  3ZKJ A;  2B0O E;  2JAB A;  3ZUV B;  1WDY A;  1MX4 A;  1BI8 B;  4QFV A;  3UTM A;  4HQD A;  2XZT G;  4HRN A;  4O60 A;  4DUI A;  4DX5 D;  1MX2 A;  3IXE A;  4DX7 D;  3TWS A;  4K5B A;  5KWD A;  5BXO A;  3B95 A;  3AAA C; 
#chains in the Genus database with same CATH topology
 2R03 A;  2P9I G;  2OVB A;  1UN9 A;  1HG5 A;  5G55 A;  2WXF A;  4TRQ A;  3SI5 A;  4KBQ A;  5AQA A;  3APC A;  2VTB A;  2GRO B;  1IHG A;  4IN3 B;  3ZYM A;  2HM8 A;  3B7R L;  1AP7 A;  3PVL A;  4JW1 A;  3U4T A;  5G05 C;  4GTS A;  3OXL A;  4J7W A;  4TXQ A;  5JHA A;  2ILR A;  1SQM A;  4I6E A;  4DX1 A;  3LDZ A;  3HG0 D;  4G8L A;  4FU3 A;  2QY7 A;  2XEN A;  1HE8 A;  4ATG A;  2WMN A;  4UI9 J;  3LVR E;  1BLX B;  1HO8 A;  4HLL A;  2YIN A;  3E32 A;  3NOC D;  4HI9 A;  1H2U A;  3EHN A;  5EIL A;  5LOZ A;  1N94 A;  2F37 A;  3ZFW A;  3O48 A;  5CMW A;  4UUC A;  4AXH A;  4FJZ A;  4HBD A;  4U8V D;  2NYJ A;  2XPY A;  4HOQ A;  5ENS D;  2JAB A;  4HFG A;  1OCC E;  3AU5 A;  4AIF A;  1Z6T A;  2R17 C;  1JPL A;  2R59 A;  4GZ5 A;  1N11 A;  4G8K A;  5ENP D;  3FUE A;  5FIO A;  1EPU A;  1K1A A;  3LPZ A;  3TL5 A;  3EDT B;  3FUD A;  5A7D B;  2WXK A;  4E85 A;  4TV3 A;  2X38 A;  4BT8 A;  3DPD A;  3FTX A;  1OUV A;  3UQ3 A;  2IFU A;  4EBA G;  4FC8 A;  3HXD A;  1V54 E;  3ZXS A;  3FEY A;  4GTQ A;  1HS6 A;  4J8Y A;  1IKN D;  3PS6 A;  4UWF A;  4GTO A;  3AU4 A;  4G11 A;  4PUC A;  3FU3 A;  1HFA A;  1UG3 A;  4KT6 B;  2IF4 A;  1Z3Y A;  2ETA A;  5DIZ A;  5LCW C;  1QBQ A;  3AJI A;  4KMO A;  3UIO C;  5J90 A;  3CEQ A;  3RK6 A;  3FP3 A;  1UOH A;  1KT0 A;  2LXL A;  4FAD A;  2ZGG A;  3EJN A;  4LER A;  1D8D A;  1N0Q A;  1NFI E;  2WXP A;  4EHM A;  4ME2 A;  5FZR A;  4AM9 A;  3TG5 A;  3ASH A;  3TWU A;  4UI9 K;  3Q7A A;  2YHC A;  2EIN E;  3UXG A;  3ZKJ A;  5FWQ A;  5T3R A;  2F0Y A;  4FP7 A;  1UJJ A;  4JA9 A;  4JXT A;  5CMY A;  2I2O A;  3HXE A;  4I1M A;  1PY1 A;  2Y4T A;  2WQ6 A;  3E37 A;  1NP7 A;  4WUY A;  4LCT A;  4L2Y A;  4U04 A;  4J6I A;  3KD7 A;  4HB5 A;  2QC9 A;  2IO3 C;  4N5C A;  2DWZ A;  4HI8 A;  5KJK A;  4AEZ C;  2Y3A A;  3CVN A;  4DRX E;  3SY2 A;  3ESK A;  1TNO A;  2CHX A;  4OAV B;  4B94 A;  4QQI A;  4PS8 A;  4B93 B;  3BQO A;  2BKG A;  5CEA A;  3LYA A;  4YDY A;  3ZU7 B;  3FH8 A;  3K9I A;  4GYY A;  5ITZ F;  3CHS A;  3UMV A;  1HU3 A;  4ILG A;  5EX0 A;  3JUE A;  1OCR E;  4F3V A;  4N3B A;  2IOS A;  5FIN A;  4GZ6 A;  1TNU A;  3ZPJ A;  4A3T A;  1H6K A;  1QZ2 A;  2DVW A;  4NQ0 A;  4I43 A;  2VQ2 A;  3D9I A;  3EU5 A;  1K1B A;  1H0A A;  1QQE A;  2OEW A;  3MX3 A;  3ASO E;  1TN6 A;  1D9S A;  1NA0 A;  1H19 A;  3Q79 A;  5A23 A;  1H2T C;  2EIM E;  3G2W A;  4GCO A;  2VTB B;  3UTM A;  5G2N A;  1E96 B;  3QNK A;  5M72 A;  4EZK A;  2HR2 A;  4H7Y A;  1TJF A;  3DEO A;  4ACL A;  4A55 A;  4LNB A;  3FUH A;  3L22 A;  4U95 D;  4MLP A;  3APD A;  1HZ4 A;  2LUH A;  3HVE A;  3L08 A;  3SBS A;  2FEZ A;  1LD8 A;  3Q75 A;  2NSZ A;  4EQF A;  3ABL E;  4HOT A;  2VJ8 A;  3EIJ A;  5G05 J;  4F53 A;  2VSX E;  4J0U A;  2X6K A;  4HOS A;  3SFY A;  3FTS A;  4BY6 A;  3QB2 A;  3FDH A;  4UI9 C;  5D0Q D;  4B89 A;  5EIB E;  3UX4 A;  1OCZ E;  5B1B E;  1O1S A;  3L13 A;  3DSS A;  4WND A;  4GMJ A;  4GCN A;  4BWR A;  4OVV A;  1IQU A;  1K3Z D;  3CK8 A;  3UIN C;  3CVY A;  2EIJ E;  4I6J A;  1JCR A;  2DZN A;  5CRU A;  3S7B A;  5G04 C;  4LRZ A;  3C5R A;  4AV7 A;  4XKB A;  5D0O D;  5CRV A;  5CCM A;  3T9K A;  3UM1 A;  4ZHB A;  4BFR A;  3SHF A;  4N2Q A;  3DST A;  3TXM A;  4EZL A;  3CHP A;  3EUV A;  3Q49 B;  3FU6 A;  2MOW A;  2XCB A;  3LXU X;  3NZU A;  4GA0 A;  3SBT B;  5DBK A;  2LXM A;  3V31 A;  3UPV A;  2R02 A;  4YDO A;  3PUK A;  3HIZ A;  3SGH A;  3RKV A;  5IY5 E;  1TEZ A;  1ELK A;  2H6I A;  5KCM A;  3B13 A;  3FTV A;  5G04 J;  3CLJ A;  2WXQ A;  3L17 A;  2CHW A;  5CHE E;  4I6G A;  1IYG A;  2FUL A;  4GTR A;  4ANX A;  3MGB A;  5D2M C;  3HYM B;  2Y1L E;  3L16 A;  2R05 A;  4U0U A;  3PDN A;  1OXJ A;  2UWJ G;  3PE3 A;  1WM5 A;  2HYZ A;  3SFX A;  1Z5S C;  3S7F A;  5AAR A;  1SZA A;  3DSW A;  5KNH D;  1VDY A;  3I3N A;  4BES A;  4FA6 A;  1WAO 1;  3C98 A;  3MV2 B;  1NZN A;  4B8A A;  3PZD A;  4N3A A;  4FLH A;  2PQR A;  4YDW A;  3N71 A;  4A1S A;  2OOE A;  1O1T A;  5CER B;  4I17 A;  4EPZ A;  2JLB A;  4JB8 P;  1FCH A;  2H6G A;  3ULQ A;  4CZ2 D;  2I1K A;  3ULY A;  4TXR A;  4A63 B;  1HX8 A;  5FQ8 A;  3FTW A;  5C2Y A;  3Q15 A;  2XGM A;  5BV1 A;  3ZUV B;  4ILH B;  3QAR A;  1HH8 A;  3LKU A;  4APO A;  3OXG A;  5BXO A;  3FY4 A;  1E7V A;  3C3O A;  1FVF A;  3D9P A;  4G24 A;  2KBX A;  4HS2 A;  3GZ2 A;  3FUI A;  4M3O A;  3TWQ A;  4BTA A;  3T8M A;  4JHR A;  4YVO A;  2UY1 A;  4GTT A;  4RVB A;  4TUM A;  2OEV A;  5KJL A;  2VGX B;  4G1T A;  5ANR A;  1DCE A;  2RKK A;  2P9N G;  1SZ9 A;  2FO1 E;  2XZD G;  3D9N A;  1TN7 A;  2E2E A;  4K03 A;  4NIK A;  4HOR A;  2PL2 A;  5JJ6 A;  4N2S A;  4HVB A;  4CEM A;  4NAC A;  3NZS A;  3PEV B;  4J8E A;  3JQ1 A;  2XGS A;  3MYV A;  1NA3 A;  4CCA A;  3UI2 A;  3DXK G;  1G3N B;  4ANV A;  1IXV A;  4JHK A;  4KYO B;  2DZO A;  1YCS B;  3F6Q A;  3LJN A;  4F1S A;  3L82 A;  4CYM D;  3PNL B;  3PZ3 A;  5CEC B;  2V5Q C;  1O5M A;  3RU0 A;  3ZYL A;  4C0E A;  2CFU A;  3PZ4 A;  1KLX A;  4HQD A;  3ZVV A;  3L9T A;  3BUA A;  2WXG A;  4F7A A;  4DX7 D;  2P9L G;  4K5B A;  4RQI A;  3LVQ E;  3UIP C;  2EIK E;  1SW6 A;  4RSY A;  3CR3 A;  4WWO A;  2P9K G;  3HXB A;  2ION A;  2CHZ A;  1RZ4 A;  5KBA A;  4XX5 A;  1JCS A;  3T5V A;  3FUM A;  1JCQ A;  2CG2 A;  2V5F A;  4OAU C;  2KAT A;  4RG6 A;  3LY8 A;  3PRE A;  4U0S A;  3PUJ A;  4KXK B;  3BG1 B;  2XEH A;  3LY7 A;  4KVO A;  3V79 K;  4JPS A;  5JJ7 A;  2ZGD A;  1SA4 A;  2IOL A;  2LSU A;  3EHR A;  1HF8 A;  2L0T B;  3OAW A;  1KZO A;  1OWN A;  4XZ4 A;  3QKY A;  2LAI A;  4L7T A;  3TJP A;  5KJN A;  5AJL A;  2NC9 A;  3TGO A;  4B0Z A;  3ONL A;  3BEE A;  2XEE A;  1DNP A;  2J08 A;  3KSL A;  3Q4A B;  1ELW A;  4HNA D;  2RFA A;  4JVS A;  2H6F A;  4R7L A;  1X5B A;  3DEP A;  1XGW A;  2XEV A;  3Q9N C;  5FT9 A;  2BKK B;  4ATZ D;  3CST A;  1E8X A;  4PS7 A;  2B0O E;  3UKU G;  1MX4 A;  4JHJ A;  4HRN A;  3DXM G;  5JHB A;  5KJM A;  3FWV A;  1O1R A;  3DPY A;  5LFA A;  1S64 A;  3I4R B;  2GRL A;  4C48 B;  2XS8 A;  2R2L A;  1BD8 A;  3ENE A;  3U9W A;  3B7T A;  3CHQ A;  3QK0 A;  3MKR A;  2FF4 A;  5BXU A;  3ZHE B;  3MV3 B;  3DSX A;  3R7R A;  3AG4 E;  1Q2Z A;  3ABM E;  4JL0 A;  4DLQ A;  2IJG X;  1MX6 A;  4I1O B;  5EKQ D;  2A4Z A;  4BT9 A;  5E76 A;  2VYI A;  3KAE A;  3SO8 A;  2KM4 A;  5CBO A;  3CVW A;  3ZGQ A;  3NBN B;  3MCX A;  5LCW J;  4XEI G;  3B7S A;  2J07 A;  1N9A A;  1MJ0 A;  2VSN A;  4JD2 G;  3CK9 A;  5H7P A;  1N4S A;  1GW6 A;  2GRP B;  3DRA A;  1NI1 A;  5B1A E;  2VSY A;  5AAO A;  1HG2 A;  1YA0 A;  1FVH A;  1ZB1 A;  3BG0 B;  4L1B A;  1TN8 A;  2AXV A;  3E30 A;  5HQ8 A;  2Q7F A;  3ZW3 A;  2AWI A;  3R7Q A;  3V30 A;  3G2S A;  3C72 A;  3JYS A;  5HRY A;  3G2T A;  5HI7 A;  3ML9 A;  1WY6 A;  5ENQ D;  2BF0 X;  1U3D A;  3CVU A;  1WDY A;  3C3R A;  5LP0 A;  4DUI A;  3G2U A;  5J08 A;  2P9P G;  4XI0 A;  4ACK A;  3SNX A;  4GTP A;  1LF8 A;  2XPZ A;  2ETC A;  2PZI A;  3D3M A;  4GML A;  4U07 A;  1XNF A;  4BX8 A;  4TXP A;  3Q73 A;  4U7E B;  4MKT A;  4FJY A;  3EHQ A;  5B3S E;  3Q47 B;  4OVU A;  3HDX A;  2KXP C;  3NB2 A;  4J8F A;  3CVP A;  3UT7 A;  3KEZ A;  4J8D A;  5AEN A;  3DWL G;  5AJD A;  3NOG D;  3LCA A;  3SQV A;  4BSZ B;  4NRH B;  2GW1 A;  5EYL A;  3E34 A;  3P1U A;  3AG3 E;  5AIJ A;  4JA7 A;  3S7D A;  3S7J A;  3RSE G;  2XQ0 A;  3I5P A;  2WPV A;  1MZC A;  4DI4 A;  3CVQ A;  2WVI A;  4K0R A;  3I4G A;  3CGH A;  4M7C A;  1MQS A;  4AY5 A;  1INZ A;  2XZT G;  4DX5 D;  3Q5M A;  3TWS A;  4CDN A;  3B95 A;  5C1D A;  3CQC B;  4L23 A;  1OCO E;  3Q9U C;  3SZ7 A;  3R9A B;  3TAX A;  3PRZ A;  1LD7 A;  3IHV A;  3TWV A;  1X81 A;  3FTU A;  3KEA A;  2J49 A;  1BPO A;  4FHK A;  3IKO B;  3U3W A;  3CIA A;  1ELR A;  1K8K G;  1OWP A;  4KVM A;  4RLY A;  4L2L A;  2P9U G;  5D66 A;  4UQZ A;  1UN8 A;  4DX2 A;  2RFM A;  3IV0 A;  5ENT D;  4XKC A;  2V0P A;  4PH4 B;  4Y6C A;  1PC2 A;  4UWG A;  2ZU6 B;  3FHE A;  4UWL A;  3LY9 A;  5BNW A;  1BI7 B;  2BTD A;  4C0M A;  1N4R A;  4WNF A;  1TR4 A;  4U8H A;  2DYS E;  5AYW D;  2IO2 C;  3QC1 A;  5CCL A;  1S70 B;  4BEP A;  4GZC A;  2FI7 A;  3LEW A;  1D8E A;  4EBA A;  5EN5 D;  5AQB A;  3CKC A;  4APF A;  4QFV A;  4O60 A;  4PS3 A;  1S0P A;  3QOU A;  3AS5 A;  3IXE A;  4WNE A;  3P2B A;  4XI9 A;  1JWG A;  1LTX A;  3ZHE A;  3AS4 A;  3QJZ A;  1TNZ A;  1MHQ A;  1ZBP A;  4GTM A;  4N39 A;  3R9M A;  2GRQ B;  3FFL A;  5FJY A;  2VGY A;  2M63 A;  4CGW A;  5ENN A;  4FUL A;  2X3M A;  3HVE B;  3NAW A;  2AXU A;  3D9O A;  4N5Q A;  5FZQ A;  3ZNG A;  2WMO A;  4CGV A;  1QNF A;  1Z3X A;  3RJV A;  2P9S G;  4DK5 A;  2PQN A;  2IQC A;  1N4Q A;  4O1O A;  4XE0 A;  2HO1 A;  4JZY A;  4Y6W A;  4A1G A;  4O6F A;  3U66 A;  4WWP A;  4AOF A;  4DPR A;  2GRM A;  3J5P A;  2PM6 A;  3LS8 A;  2BUG A;  3W9F A;  2B6C A;  3QDN A;  2QZA A;  1N95 A;  3MKQ B;  3UT8 A;  4IRU A;  4YVQ C;  2IY0 C;  3FU0 A;  2FO7 A;  1TJC A;  4GTV A;  3KS2 A;  4G2V A;  2X6I A;  4L9P A;  4IYP A;  3JQ0 A;  3JXI A;  3FUL A;  2AJA A;  4DJA A;  1N54 A;  3AG1 E;  5AQ9 A;  1TYQ G;  3CHO A;  4UWK A;  2NXP A;  1P5Q A;  3L6A A;  2VSO E;  4Q94 A;  3VTY A;  2UY1 B;  1E7U A;  1BI8 B;  1UW4 B;  2C2L A;  1MX2 A;  3JUI A;  1U3C A;  3GZ1 A;  3QWP A;  5CED B;  3GZS A;  3UM3 A;  2VGX A;  4B8C B;  3CVV A;  2DYR E;  3ASD A;  4GPK A;  1S63 A;  3MA5 A;  2AVP A;  2WXO A;  3FH7 A;  4F6R D;  1SVX A;  1JUQ A;  2ZIS A;  3OTN A;  4I9E A;  3IHY A;  2AW6 A;  5AQ7 A;  4GPM A;  5FQ7 A;  3ESL A;  2MRI A;  4X8Q A;  4ZFH A;  3SFZ A;  4OYS A;  3E4B A;  4KZ0 A;  1EYH A;  3O4Z A;  2V4H C;  4O1P A;  3JCK C;  5EDS A;  3UKR G;  1YMP A;  3ML8 A;  3EHM A;  1L5J A;  1OT8 A;  4TUU A;  1V55 E;  4AP2 A;  4LUN U;  2E0I A;  5JMN D;  4HRM B;  3QWV A;  4ANW A;  2C0M A;  2EQX A;  4HOU A;  3RIB A;  5FQ6 A;  3ZXP A;  3FUK A;  3EU9 A;  3TWT A;  2GRR B;  4AVX A;  3T5X A;  3APF A;  3V2X A;  2LNI A;  2WXL A;  2GGF A;  5A6C A;  2RD0 A;  2MHK A;  1Y8M A;  2XRY A;  2ZXW E;  3ONK A;  3ASF A;  3RO3 A;  2WXN A;  3CSF A;  4GYO A;  4K5C A;  3CKB A;  4YND A;  5ARG A;  3FEX A;  1H2V C;  1H6O A;  1KPS B;  3IBE A;  2OVF A;  1BU9 A;  5E75 A;  3VTX A;  1OY3 D;  4JC8 A;  2LO6 A;  5EX3 A;  2I9C A;  3CVL A;  2Y4U A;  2WQ7 A;  1AWC B;  1UJK A;  3B7B A;  1WG0 A;  4C9B B;  3FTZ A;  3FU5 A;  3ZIM A;  2A5E A;  3D9K A;  4GMR A;  4DLO A;  2XCC A;  2J4D A;  3FUF A;  4UQX A;  1DC2 A;  3TG4 A;  2HE0 A;  3W9G A;  2EIL E;  1FT2 A;  4Q96 A;  5EID A;  1A5E A;  2IU1 A;  4U0Z A;  4V3I A;  1DCQ A;  1DVP A;  3Q7F A;  4K5A B;  4G26 A;  2CFZ A;  3TXN A;  4GU5 A;  3VLF A;  3G2V A;  2DBA A;  2WXH A;  5LX8 A;  3CK7 A;  3PZ2 A;  4AY6 A;  3MEK A;  1FPP A;  3CQG B;  3PE4 A;  2LSV A;  2OND A;  4JEH A;  4JEU A;  5ARF A;  3TWX A;  3TWW A;  2C0L A;  2I1J A;  3IEG A;  1IQR A;  1E8Z A;  1W3B A;  2IEJ A;  4EEC A;  3L54 A;  3ISM C;  5CBN A;  3ZYQ A;  2VGE A;  3FTY A;  4EZJ A;  2KCL A;  1KZP A;  4AJW A;  1TNB A;  3SF4 A;  4IUL A;  1OWM A;  2XGO A;  2WQH A;  2CG3 A;  4UWH A;  3PZ1 A;  4CT4 A;  4BER A;  2KCK A;  5BUZ A;  1N0R A;  5EYP F;  1NL4 A;  2XPI A;  3GW4 A;  2BED A;  4N3C A;  3UM2 A;  2QYJ A;  2PM7 A;  1N52 A;  3U64 A;  4GZ3 A;  1HXI A;  3EIQ C;  4WWN A;  4E6H A;  3ZEF A;  3FUN A;  1OWO A;  1SA5 A;  3MJW A;  3MKQ A;  2PNN A;  3UM0 A;  1B89 A;  4Q69 A;  3FH5 A;  3WXX A;  2L9B A;  3D9L A;  1YYH A;  4A3V A;  3T8K A;  3FUJ A;  3TWR A;  1MYO A;  4BET A;  4F1P A;  2RG8 A;  3D9J A;  3HRA A;  2X6J A;  4LEU A;  1FT1 A;  4GA2 A;  4CDR A;  3JXJ A;  3J5Q B;  2WB2 A;  3B7U X;  4I2W A;  4LNU D;  4U96 D;  3E33 A;  3QWW A;  4YDE A;  2X6F A;  2P2C P;  5KNG A;  3NQP A;  3RAU A;  2OCC E;  3QAQ A;  1Y6I A;  3ASN E;  3NF1 A;  3ULE G;  1A17 A;  1H6P A;  3DBS A;  3URZ A;  3D9H A;  5HKP A;  2KZT B;  3SD5 A;  2MYO A;  3GYZ A;  1N4P A;  3ABK E;  3WG7 E;  3CVX A;  3DSV A;  4HXI A;  2WXM A;  2JEK A;  4BTB A;  4ABN A;  4I1A A;  2V4L A;  3UUX A;  2KZT A;  3OXF A;  3ASG A;  3BU8 A;  3D9M A;  3ZN3 A;  4W9R A;  2KC7 A;  3C3Q A;  5BW8 C;  5JA4 D;  4J8S A;  1QYM A;  2KCV A;  3HHM A;  3HXF A;  2R5S A;  3X2Q E;  3VLE A;  4FHJ A;  4UQY A;  2L6J A;  4WAF A;  2YQ8 A;  5FZS A;  4FLB A;  5FQ4 A;  5T8I A;  2OV8 A;  4MS6 A;  4LSZ E;  5BPP A;  1KT1 A;  2J8S D;  4WNG A;  1U2V G;  4ANU A;  1TNY A;  1E8Y A;  2WXJ A;  4GZD A;  5JJT A;  2QYU A;  2Y69 E;  3V2O A;  3ZYK A;  2YHE A;  2P58 C;  2ZIR A;  3S2A A;  4BX9 A;  5T4Y A;  2F8Y A;  1E90 A;  4U63 A;  2LAH A;  4NUR A;  4MRU A;  2J4B A;  1OWL A;  3RRN B;  5KWD A;  4GAA A;  1EDU A;  3AAA C;  5ENR D;  2L6B A;  3LJ3 A;  3AS8 A;  2FBN A;  3PEU B;  4U8Y D;  5ENO D;  4HRL A;  5BT1 A;  3CV0 A;  2ETB A;  1RW2 A;  2L0I A;  4D10 C;  4KZC A;  4MBG A;  4HLE A;  2H6H A;  3CHM A;  2WM9 A;  4GA1 A;  5HS0 A;  3CHR A;  4ILI A;  3RO2 A;  4LG6 A;  2V8S E;  3VLD A;  2GRN B;  2QFC A;  4GYW A;  2J09 A;  2Y0B G;  4URK A;  4DX6 D;  4Z68 A;  2I6H A;  1JWF A;  2WXR A;  2YNQ A;  1E8W A;  4LNG A;  3PNT B;  1IHB A;  2XRZ A;  4I2Z A;  4RG9 A;  2XS1 A;  5FTP A;  2F8X K;  4XIF A;  1PAQ A;  2AXZ A;  3DSU A;  4G23 A;  5ANL A;  1EF1 C;  2XHE A;  3Q78 A;  3RRU A;  4I9C A;  3MZL B;  3PH0 C;  1ZU2 A;  2J9Q A;  3AG2 E;  2X6H A;  4PDX A;  3HXC A;  3RRM B;  5AN8 A;  3ZRH A;  2A5U A;  4CDM A;  4CRW A;  4CT0 A;  4BSX A;  2WXI A;  4G25 A;  3KSQ A;  3UT4 A;  2DCP A;  4DI3 A;  4H7X A;  4P29 A;  4GB9 A;  2DIW A;  5BV0 A; 
#chains in the Genus database with same CATH homology
 1N11 A;  5ENR D;  2L6B A;  5CED B;  3DEO A;  4K5C A;  1SW6 A;  4G8K A;  3D9H A;  5ENP D;  5HKP A;  3Q9U C;  5CBN A;  4C48 B;  5FIO A;  2VGE A;  4U8Y D;  4U95 D;  5ENO D;  4HRL A;  1K1A A;  1BU9 A;  2ETB A;  3V31 A;  2KBX A;  1BD8 A;  1OY3 D;  3TWQ A;  2MYO A;  2ETC A;  5AQA A;  5KBA A;  4HB5 A;  3TWV A;  3KEA A;  4F6R D;  2QC9 A;  1SVX A;  1AWC B;  5HS0 A;  5BXU A;  2DWZ A;  4HI8 A;  3B7B A;  4N5Q A;  1WG0 A;  4TUM A;  4BER A;  4DRX E;  1N0R A;  4LG6 A;  3ZNG A;  4OAU C;  1AP7 A;  5EYP F;  3EHQ A;  5AQ7 A;  2A5E A;  4RLY A;  4GPM A;  4OAV B;  4QQI A;  2QYJ A;  4GMR A;  4B93 B;  1MX6 A;  2KXP C;  2Y1L E;  2Y0B G;  4DX6 D;  2XEH A;  4Z68 A;  5JA4 D;  2HE0 A;  5D66 A;  1DC2 A;  2BKG A;  5CEA A;  4J8Y A;  2FO1 E;  1QYM A;  3W9G A;  4O1O A;  1IKN D;  3V79 K;  4DX2 A;  2XZD G;  2ZGD A;  4YDY A;  5EIB E;  3ZU7 B;  2RFM A;  4ZFH A;  5EID A;  3SO8 A;  1IHB A;  5CBO A;  4J7W A;  4NIK A;  5ITZ F;  2PNN A;  5ENT D;  5AAR A;  5KNH D;  1A5E A;  2F8X K;  3NBN B;  3NOG D;  3EHR A;  4DX1 A;  2ETA A;  1DCQ A;  3J5P A;  4BSZ B;  3HG0 D;  3AJI A;  3JUE A;  4BES A;  4G8L A;  2V4H C;  4K5A B;  5EYL A;  3W9F A;  1MJ0 A;  4O1P A;  3UI2 A;  1D9S A;  1K3Z D;  2XEN A;  1G3N B;  1YMP A;  4YDW A;  1YYH A;  5FIN A;  1BI7 B;  4LSZ E;  1UOH A;  1IXV A;  1OT8 A;  3T8K A;  3TWR A;  1BLX B;  5AAO A;  2J8S D;  1MYO A;  1TR4 A;  2DZO A;  4BET A;  4HLL A;  4F1P A;  1YCS B;  2XEE A;  2ZGG A;  2DVW A;  3F6Q A;  3LJN A;  2DZN A;  5CER B;  4HNA D;  3NOC D;  3HRA A;  2RFA A;  1K1B A;  4HI9 A;  5JMN D;  1N0Q A;  1NFI E;  4HRM B;  5EIL A;  4CYM D;  3JXI A;  4JB8 P;  3C5R A;  3DEP A;  1S70 B;  4BEP A;  2F37 A;  2AJA A;  3J5Q B;  3JXJ A;  5AQ9 A;  3T9K A;  4UUC A;  3V2O A;  4CZ2 D;  5CEC B;  5AN8 A;  3EU9 A;  3TWU A;  4LNU D;  3V30 A;  3TWT A;  4ZHB A;  4U96 D;  2V5Q C;  3TWX A;  3Q9N C;  4U8V D;  4HBD A;  4A63 B;  3TWW A;  5HRY A;  2NYJ A;  2BKK B;  2F8Y A;  3V2X A;  3UXG A;  2P2C P;  5ENS D;  4ATZ D;  5KNG A;  5ENQ D;  5EN5 D;  5AQB A;  3ZKJ A;  2B0O E;  2JAB A;  3ZUV B;  1WDY A;  1MX4 A;  1BI8 B;  4QFV A;  3UTM A;  4HQD A;  2XZT G;  4HRN A;  4O60 A;  4DUI A;  4DX5 D;  1MX2 A;  3IXE A;  4DX7 D;  3TWS A;  4K5B A;  5KWD A;  5BXO A;  3B95 A;  3AAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...