4J8YA

E3_5 darpin d77s mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
b'DLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNGADVNASSLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DARPin_E3_5_D77S
publication title Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 50
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4j8yA00
3JUEA 1IKND 1MJ0A 3ZU7B 3B7BA 4HRNA 3V79K 5AQBA 4DUIA 2L6BA 2P2CP 2MYOA 2Y0BG 3T9KA 5HKPA 1SVXA 4QQIA 5EIDA 1BLXB 3UXGA 3Q9NC 5AN8A 3B95A 1N0RA 3HRAA 5ENTD 5AQ9A 2VGEA 4LNUD 4HBDA 5CERB 2J8SD 4DRXE 4BESA 4O60A 3J5QB 4NIKA 5AQAA 4K5AB 4F6RD 3TWSA 2B0OE 2F8YA 2V4HC 5AARA 3TWVA 4ZFHA 3ZUVB 4ATZD 4BEPA 5BXUA 4OAVB 3EU9A 1WG0A 4QFVA 1BD8A 4HI9A 3IXEA 5JMND 2DZOA 4LSZE 1IXVA 1UOHA 5CEAA 3JXJA 4DX1A 2XEEA 5D66A 3KEAA 3V2OA 3LJNA 1IHBA 2DVWA 2XEHA 2HE0A 3AAAC 4G8LA 3UI2A 5ITZF 3TWTA 4U8YD 3TWUA 5KBAA 3TWQA 4GPMA 2DWZA 4RLYA 4LG6A 1A5EA 5HRYA 4J7WA 4UUCA 5KNGA 5CBOA 5ENOD 5AAOA 4U8VD 2JABA 3F6QA 1MX2A 4F1PA 4K5CA 2A5EA 3V31A 4BETA 4G8KA 4BERA 4DX7D 3ZNGA 5CBNA 2ETCA 3SO8A 4HRMB 5FIOA 3T8KA 3EHQA 1AP7A 4O1OA 5EILA 3V2XA 4DX2A 3JXIA 3J5PA 2BKGA 2KBXA 2XENA 1MYOA 5EN5D 5KNHD 4U96D 2KXPC 3DEOA 4HB5A 5HS0A 4A63B 1K1BA 4DX5D 2F37A 2V5QC 2XZDG 4B93B 1DC2A 1OT8A 2ZGGA 4OAUC 3TWRA 4Z68A 5FINA 2QC9A 3NBNB 4HNAD 3EHRA 1K3ZD 2F8XK 2ETBA 2ETAA 5CECB 2DZNA 1TR4A 4N5QA 4YDWA 2ZGDA 1D9SA 5ENSD 1BI8B 4HI8A 4HRLA 2FO1E 3TWXA 5CEDB 4HQDA 5BXOA 1MX4A 1AWCB 2PNNA 2RFAA 1OY3D 3NOCD 1DCQA 4JB8P 4U95D 5ENRD 3ZKJA 4ZHBA 1BU9A 3TWWA 5ENQD 1N11A 1BI7B 3NOGD 2NYJA 2AJAA 3V30A 1G3NB 1MX6A 4HLLA 1K1AA 4BSZB 1QYMA 4J8YA 3W9FA 3UTMA 1YCSB 2Y1LE 5ENPD 1NFIE 1WDYA 4K5BA 4GMRA 4C48B 2RFMA 5KWDA 4CYMD 3Q9UC 3HG0D 3DEPA 2BKKB 4TUMA 3D9HA 5EIBE 5EYLA 5JA4D 1S70B 5AQ7A 4DX6D 3W9GA 4CZ2D 3AJIA 1YYHA 1SW6A 1YMPA 2XZTG 4O1PA 1N0QA 2QYJA 3C5RA 4YDYA 5EYPF
chains in the Genus database with same CATH superfamily
3JUEA 1MJ0A 2IO2C 3B7BA 1O1RA 2QFCA 3MKRA 3HXDA 3CHQA 4GZ6A 1S64A 2VSOE 5BV1A 1DVPA 3OAWA 1HG2A 5ARGA 3FUHA 4FJZA 3QC1A 2J07A 1HO8A 2H6FA 4GTQA 3ZUVB 4B0ZA 1O1TA 2WQHA 5CEAA 4ACLA 3LJNA 1HU3A 2VGYA 4AY6A 2IY0C 2R17C 4N5CA 4UWFA 4M7CA 5HRYA 3CVQA 1W3BA 4AOFA 2VTBB 1D8EA 3ZYMA 2ILRA 5EN5D 4BTBA 4EQFA 3CVPA 2KXPC 3CVYA 2XZDG 3S2AA 2X6IA 2ZXWE 3L13A 2ETBA 3UM3A 5ENSD 3LCAA 1IQRA 3IHVA 5ENRD 3CVWA 4N3AA 3ULEG 1WM5A 4I43A 5A23A 2WXHA 1E96B 4BSZB 2MOWA 2Y1LE 2ZU6B 3D3MA 3SI5A 3Q9UC 4AY5A 3FTVA 4XEIG 4IULA 3I4RB 4GYWA 4O1PA 4TRQA 3HXCA 2QYJA 3C5RA 3UT8A 3JUIA 2JEKA 3RU0A 1LF8A 3VLDA 1INZA 3C3OA 1H2TC 4PUCA 1KT0A 4DRXE 3L54A 2L0IA 4XKCA 1N4PA 5FT9A 3LEWA 2PM7A 2WXIA 4OAVB 2CFUA 3IXEA 5FZQA 1UOHA 2XRYA 2X3MA 4NURA 2KZTB 5AENA 3B7UX 4KVMA 4WUYA 3AG3E 3RSEG 5G55A 4GCOA 2LAHA 4UUCA 5G2NA 3ABKE 1HF8A 2IU1A 3QNKA 1SQMA 3RKVA 2HO1A 1KT1A 4A63B 3DSWA 3UIOC 3MEKA 1JCRA 1KZPA 4G25A 4IN3B 3NF1A 2VSYA 3IKOB 3CKCA 1BI7B 4HOSA 1OCCE 5J90A 1OWLA 1QNFA 3U4TA 3C98A 4BTAA 2VTBA 3DRAA 4DI4A 5EYLA 4JA7A 4HRNA 2X6JA 2Q7FA 4BX8A 4FHKA 3T9KA 4GA1A 3Q9NC 3ABLE 1N4RA 3R9MA 4XIFA 2XPZA 1NA0A 4I2WA 3QWWA 3B7RL 4HOQA 5AARA 1FPPA 3HHMA 4YVOA 2LXMA 4C0EA 1N54A 2R5SA 3NAWA 4QFVA 4JW1A 3EJNA 1PAQA 3GYZA 4WNDA 5ITZF 3UKRG 3FFLA 1TN7A 2OVFA 3FUKA 3D9KA 2QZAA 1S63A 1EPUA 1MX2A 3FTYA 3B7TA 2B6CA 4MS6A 2ETCA 1Z3YA 1LD8A 3B13A 5C2YA 4K03A 3JXIA 4O6FA 3ML9A 3BG0B 3UMVA 4WWPA 5KNHD 2KC7A 3Q7FA 4I1AA 2F37A 4YVQC 4JPSA 1O5MA 2HM8A 2QC9A 3FHEA 2LSVA 2CFZA 2WM9A 4K0RA 4RG6A 4L2LA 2KZTA 3ZPJA 4FULA 5FTPA 2WXJA 2PNNA 3WG7E 3PVLA 3UT7A 1ELWA 1FT1A 2UWJG 1YCSB 3EDTB 3EIQC 4CYMD 4NRHB 3ZHEB 1MZCA 3URZA 3SFZA 4G1TA 1RW2A 5E76A 1IKND 2C0LA 5CRVA 3V79K 4I6EA 2R2LA 2L6JA 4GYYA 5KJLA 3SD5A 2VSNA 2VGEA 2A4ZA 3FY4A 3ULQA 5T4YA 3IV0A 3QB2A 4HI9A 3UUXA 4WNEA 2VQ2A 3TL5A 3FEYA 2DWZA 1LTXA 3N71A 5KNGA 4FHJA 2GRMA 2A5EA 4DX7D 5BUZA 4N2QA 2FF4A 3J5PA 4GTSA 2I1KA 4GU5A 4WAFA 3EIJA 3RK6A 1UN8A 1QBQA 4B93B 1KLXA 2QY7A 4Z68A 2C0MA 2WPVA 4U0SA 5BT1A 4DPRA 1SZ9A 4KBQA 1TNBA 3UM2A 2YHEA 4XX5A 4YDOA 2LUHA 1JPLA 2P9IG 1JWGA 3TG4A 3CVUA 3PNLB 4C9BB 4GB9A 2WXRA 4DI3A 3PZ2A 5DIZA 1N95A 1Z5SC 5JJ6A 4OVUA 1E7UA 4XE0A 4KVOA 4XKBA 1OCRE 4GMJA 3HXFA 4GTRA 2J49A 4JA9A 2V0PA 3BG1B 2A5UA 3FUNA 4PS8A 4EPZA 3MGBA 3ONKA 2IOSA 4WWNA 1EF1C 3CQGB 3CVXA 3O48A 2IONA 3LY7A 4H7YA 2DVWA 3MV2B 3ZHEA 5KBAA 1HH8A 4LG6A 2R02A 3DSTA 2DBAA 4UQZA 3CIAA 1UJKA 5EKQD 3U9WA 3V2XA 1H6OA 3KSQA 5LX8A 1MYOA 3PZ3A 4J8EA 2P9NG 1E90A 3FUDA 1TNYA 2ZGGA 3TXMA 3SNXA 1TR4A 4C0MA 3FULA 2HYZA 4HI8A 2FO1E 2Y4UA 5ENNA 4PH4B 3LPZA 5AYWD 1X81A 3KAEA 3ASHA 4FU3A 2AJAA 4APFA 3PZ1A 1MX6A 3GZ1A 1XNFA 4CT4A 3UM1A 4GTOA 2RFMA 4J6IA 3DEPA 3L82A 3RAUA 3QWVA 3T5XA 1TYQG 1FT2A 5AQBA 4GZ3A 3ZYQA 3LY9A 1OUVA 4RSYA 4AV7A 3CKBA 5AN8A 5EX0A 5AQ9A 4XI0A 4F1SA 4A3VA 4I1OB 2DYRE 5FJYA 4URKA 1IYGA 3MKQB 5G05J 4ATZD 4CDMA 4UWKA 2VJ8A 1TN6A 3QKYA 3V2OA 3NB2A 4BY6A 2AW6A 4G8LA 4FADA 5AJLA 1Z6TA 3DSXA 3EUVA 4GTVA 4ILHB 4U8VD 4BETA 3ZNGA 3EHQA 3HXBA 4N3BA 3L22A 4PDXA 4B8CB 4ANXA 1K1BA 3DSUA 1TNOA 3SHFA 5HI7A 5FINA 4U7EB 3CVLA 1BI8B 4TXQA 2J4BA 1DNPA 2CHXA 4KZ0A 2OV8A 1N11A 5DBKA 1ZU2A 3PE4A 1K8KG 4KXKB 3CLJA 3UKUG 2P58C 4BT8A 3D9HA 4W9RA 2R03A 5JA4D 4UI9K 2OCCE 3TXNA 4AXHA 3E32A 2EIKE 4E6HA 2VGXB 3ASOE 3CHMA 2XGSA 3Q49B 4AM9A 2LSUA 4XI9A 3EHNA 3B95A 1N0RA 2WMNA 3ZRHA 4HBDA 4O60A 4LERA 4MKTA 3TWSA 2F8YA 2V4HC 1YA0A 1SZAA 2GROB 4I17A 4GMLA 4JXTA 2DZOA 1XGWA 5ANRA 3CK9A 1EYHA 5IY5E 4UQXA 5LCWC 3BEEA 3UIPC 3KEZA 3MCXA 5EILA 1VDYA 4BWRA 4F7AA 3Q78A 1SA5A 3G2UA 3MKQA 3ESKA 2IOLA 4NACA 1FCHA 2FEZA 2Y3AA 5A7DB 1MQSA 4HQDA 4LCTA 2GRPB 1AWCB 1Y8MA 5EDSA 4JEUA 4TXRA 3GZ2A 3LS8A 2NYJA 3V30A 2WXGA 2GRLA 2YQ8A 4V3IA 2V5FA 2L9BA 3UTMA 4AJWA 1NFIE 4Y6CA 3FU6A 4GAAA 5M72A 2P9SG 5CMYA 4TV3A 1H19A 3ASGA 3W9GA 1YMPA 2J9QA 4L23A 4YNDA 3ZFWA 2P2CP 5EX3A 4N3CA 3LDZA 2BTDA 4R7LA 1MHQA 2YHCA 4M3OA 3TGOA 4I1MA 3RJVA 1Z3XA 1N52A 2OEVA 3I3NA 2UY1B 4BEPA 2BUGA 4G26A 5AIJA 2XEVA 2XGMA 3KEAA 1UG3A 3RRUA 2PZIA 3APFA 4WWOA 4G23A 3B7SA 5D0QD 3FUEA 2OOEA 1TJFA 3NQPA 2VGXA 4F1PA 2J08A 4G8KA 4BERA 4UI9J 4HRMB 3L08A 3APCA 4CGVA 3DEOA 1HG5A 3ZYLA 3CSFA 2KATA 1JCSA 1OXJA 3CR3A 3S7BA 2ETAA 1TNZA 2I1JA 3PZ4A 3WXXA 1MX4A 2RFAA 5HQ8A 2R59A 1U3CA 5LFAA 4B8AA 3ULYA 3UQ3A 3FUFA 3TG5A 3TJPA 3SFYA 2EIJE 4CDRA 1DCEA 4I9EA 3IEGA 3UX4A 1OWPA 4RVBA 3GZSA 3ZXSA 4Y6WA 1N0QA 2WMOA 3MZLB 2VSXE 2MYOA 3JYSA 4JL0A 2RKKA 4N39A 4LNBA 4U04A 3FTSA 1X5BA 4DLOA 1V55E 4LEUA 3LVQE 2PQRA 4BESA 2AWIA 2OVBA 3G2SA 3TWVA 4YDEA 4TUUA 1BD8A 4I2ZA 4J8FA 2M63A 5D66A 4JC8A 3FH5A 3UI2A 3BUAA 5BW8C 3TWTA 5G05C 4GA2A 3QDNA 2Y69E 1UN9A 3PREA 3F6QA 3P1UA 3JQ1A 5JJ7A 3G2WA 4DX2A 4PS7A 4UWLA 5LCWJ 4Q96A 3CK8A 3Q75A 1ELRA 3FP3A 3KD7A 1N94A 1HXIA 3FUMA 2UY1A 3AS5A 4N5QA 3S7DA 3ISMC 3CK7A 3CV0A 5BXOA 3R7RA 3I4GA 1K1AA 1QYMA 1WDYA 3FH8A 2P9PG 2P9LG 2RG8A 4GZDA 3ABME 3CSTA 4Q69A 2EQXA 4JHRA 4BX9A 3DBSA 3DXKG 3ONLA 3VTXA 4HXIA 4QQIA 3OXLA 3HIZA 3APDA 2WQ6A 4IYPA 3DSSA 4NIKA 5AQAA 4F6RD 3CEQA 3BQOA 3DSVA 3QOUA 1TEZA 2IQCA 4UWHA 4A1GA 2XPIA 4ME2A 3PNTB 3FU3A 1IHGA 5T8IA 1ZBPA 1FVHA 1A5EA 3CQCB 4J8SA 3E30A 3U3WA 1GW6A 2WXLA 3MV3B 2KM4A 3S7JA 5FIOA 5FQ8A 1E8YA 1WAO1 3C3QA 3T5VA 5CMWA 1LD7A 2XGOA 2V5QC 3FDHA 3UINC 3CGHA 5B1AE 3PRZA 3VLEA 2L0TB 1UJJA 4HRLA 1JWFA 1E8XA 3NOCD 1DCQA 3FUJA 5CHEE 3ZKJA 1NI1A 5E75A 2KCVA 3ENEA 5KJKA 1IQUA 4GTPA 2X38A 2LNIA 4PS3A 5ENPD 2EIME 5JHBA 2OEWA 4DLQA 3E33A 1H6PA 2BKKB 3FTZA 4DX6D 4CZ2D 4APOA 3I5PA 3AU5A 3ZU7B 3DXMG 3L6AA 2Y0BG 4I6GA 1U3DA 4EHMA 3PE3A 4HVBA 1O1SA 4OVVA 3ZVVA 5JJTA 3U64A 4FJYA 3CHRA 2J8SD 3JQ0A 3Q79A 5FQ7A 4AVXA 4AP2A 4WNGA 2QYUA 5G04C 3Q4AB 3PUKA 2JLBA 2KCKA 2I9CA 5ENOD 3CHPA 5LP0A 3X2QE 4GTMA 2BKGA 2WB2A 3SFXA 4F3VA 2H6IA 3FUIA 1EDUA 2ONDA 4UI9C 1BPOA 3D9IA 3LXUX 2DZNA 1HE8A 2J4DA 1B89A 2VYIA 3FTUA 5KCMA 3TWXA 2V8SE 3LY8A 4HLEA 2WQ7A 1H6KA 5LOZA 3AG1E 3PZDA 3D9PA 1HFAA 3W9FA 1L5JA 4C48B 2XS1A 2IF4A 3NZSA 1H2VC 2XCBA 2XZTG 5ARFA 4GTTA 5FQ4A 3FU5A 5CRUA 2EINE 4GA0A 3SBSA 4ATGA 3E4BA 5AJDA 3RIBA 3UXGA 2PM6A 4A55A 5J08A 3QAQA 4BFRA 3QARA 2CHZA 4ANVA 4EZKA 4UWGA 4K5AB 3AG2E 3D9MA 3PUJA 1OCOE 3ASNE 4CDNA 5BXUA 3EU9A 3AG4E 5JMND 4GCNA 3ZN3A 2HE0A 2AXVA 4U8YD 3TWUA 3UM0A 5FZRA 4L9PA 2PL2A 5CCLA 2E2EA 2X6KA 1H2UA 2WVIA 4HB5A 4HOTA 3IBEA 2Y4TA 1OT8A 3ZXPA 2XPYA 3Q7AA 1K3ZD 4B89A 3Q47B 2KCLA 2WXKA 4EZJA 4LUNU 2CG2A 3AU4A 3TWWA 4U0UA 5ENQD 2V4LA 4XZ4A 3NOGD 4HLLA 4ACKA 4WNFA 1ZB1A 3SY2A 3HG0D 4EECA 1JUQA 1D8DA 4JHKA 3DWLG 3AS8A 5KJMA 4G11A 4DUIA 5H7PA 3ZYKA 4U0ZA 3E37A 2YINA 3ML8A 3C3RA 3OXGA 3HRAA 5ENTD 3PEUB 1Y6IA 3Q73A 5CCMA 2NXPA 3J5QB 2AXZA 3DPDA 2FI7A 3CVNA 2C2LA 3LYAA 4I6JA 4JVSA 4LSZE 1RZ4A 4GYOA 3BU8A 3JXJA 4Q94A 4DX1A 4E85A 3EU5A 3AAAC 3TWQA 3FWVA 4GPMA 2EILE 4GZCA 5AAOA 3UPVA 5G04J 4CCAA 3RO2A 4KYOB 4JEHA 3SO8A 3T8KA 4HOUA 2XENA 2YNQA 3PEVB 1OWOA 3QJZA 2BEDA 2FO7A 1PC2A 1HS6A 3HYMB 2WXFA 4DJAA 3RO3A 4HNAD 4HS2A 1QQEA 3SQVA 4YDWA 4RQIA 2ZISA 4L1BA 1N4SA 2X6HA 3D9NA 4HFGA 4AIFA 4U95D 3VLFA 4ABNA 3L9TA 3PDNA 1G3NB 3Q15A 1ELKA 5T3RA 3QK0A 5EIBE 2XRZA 3AJIA 1Q2ZA 1YYHA 3LJ3A 3RRNB 2CG3A 1S0PA 4G2VA 2I2OA 5EIDA 3SZ7A 3O4ZA 1BLXB 2LAIA 4CEMA 4J8DA 1UW4B 4LNUD 4ILGA 5CERB 5FWQA 2NC9A 5A6CA 3KSLA 2GRQB 4KT6B 1NP7A 2B0OE 1JCQA 4G24A 3E34A 2WXMA 2AVPA 4HORA 1IXVA 3MJWA 3U66A 2XEHA 3MYVA 3OTNA 4EBAG 2X6FA 4TXPA 3VTYA 1NA3A 1TJCA 5CBOA 2WXPA 5KJNA 2MHKA 4KMOA 5D0OD 1AP7A 3HDXA 4F53A 2KBXA 1OWNA 1TN8A 2DCPA 4I9CA 2R05A 5HS0A 4FLBA 3HVEB 3RRMB 4J0UA 3NBNB 3ZEFA 2DIWA 3P2BA 5BV0A 4P29A 4UQYA 5JHAA 4CT0A 5CEDB 1KZOA 4EBAA 1BU9A 4GZ5A 3G2TA 3GW4A 4EZLA 4J8YA 3MA5A 4K5BA 5KWDA 4JZYA 4A3TA 5BNWA 5B1BE 3T8MA 1SA4A 1HX8A 2BF0X 4MBGA 2IJGX 1SVXA 5BPPA 3JCKC 2XHEA 3KS2A 2WXQA 3FTXA 3G2VA 3ASFA 2F0YA 4ILIA 3MX3A 4BSXA 3R9AB 1A17A 4ZFHA 4MLPA 3OXFA 4L7TA 4RG9A 2P9KG 4LRZA 4DK5A 1NL4A 2XEEA 2H6HA 4L2YA 2XS8A 1IHBA 3IHYA 3L17A 4RLYA 4FA6A 4J7WA 2DYSE 4GPKA 3QWPA 3ZW3A 2HR2A 2JABA 4K5CA 5CBNA 4NQ0A 2IEJA 1E8ZA 2AXUA 3ZIMA 1NZNA 1V54E 3LVRE 3CHOA 1OWMA 4ANWA 1DC2A 4B94A 4OAUC 3EHRA 1U2VG 2GW1A 2F8XK 3FU0A 2ZGDA 2P9UG 4U63A 4LNGA 4FC8A 1N4QA 2ZIRA 2NSZA 4JB8P 4U07A 2XCCA 5D2MC 2RD0A 4IRUA 3PS6A 2GRRB 4MRUA 1FVFA 4GMRA 3TAXA 4TUMA 3CHSA 4YDYA 5EYPF 5FQ6A 2WXOA 2GGFA 3HVEA 3NZUA 1HZ4A 2L6BA 4A1SA 3R7QA 5HKPA 1E7VA 3ESLA 4BT9A 1QZ2A 4FLHA 2FULA 3UT4A 4N2SA 4FP7A 4JHJA 1E8WA 1OCZE 3D9LA 4JD2G 4KZCA 1TNUA 1WG0A 2CHWA 3D9OA 5B3SE 3D9JA 4X8QA 3L16A 3SBTB 1H0AA 3EHMA 4CGWA 2GRNB 3FTWA 3SF4A 2FBNA 2J09A 3LKUA 4OYSA 1PY1A 2I6HA 2MRIA 1KPSB 4O1OA 2IO3C 3FH7A 5ANLA 3HXEA 4U96D 2WXNA 3S7FA 1N9AA 4DX5D 2E0IA 2IFUA 3TWRA 4ANUA 3ZGQA 3DPYA 5CECB 1D9SA 3K9IA 2H6GA 1WY6A 4AEZC 3ASDA 3PH0C 3FEXA 2LO6A 2PQNA 4CRWA 4ZHBA 1OY3D 2XQ0A 4D10C 5FZSA 4H7XA 1P5QA 5C1DA 3C72A 3AS4A 3Q5MA 3CVVA 3SGHA 4U8HA 1S70B 5AQ7A 1SW6A 2LXLA 3V31A
chains in the Genus database with same CATH topology
3JUEA 1IKND 1MJ0A 3ZU7B 3B7BA 4HRNA 3V79K 5AQBA 4DUIA 2L6BA 2P2CP 2MYOA 2Y0BG 3T9KA 5HKPA 1SVXA 4QQIA 5EIDA 1BLXB 3UXGA 3Q9NC 5AN8A 3B95A 1N0RA 3HRAA 5ENTD 5AQ9A 2VGEA 4LNUD 4HBDA 5CERB 2J8SD 4DRXE 4BESA 4O60A 3J5QB 4NIKA 5AQAA 4K5AB 4F6RD 3TWSA 2B0OE 2F8YA 2V4HC 5AARA 3TWVA 4ZFHA 3ZUVB 4ATZD 4BEPA 5BXUA 4OAVB 3EU9A 1WG0A 4QFVA 1BD8A 4HI9A 3IXEA 5JMND 2DZOA 4LSZE 1IXVA 1UOHA 5CEAA 3JXJA 4DX1A 2XEEA 5D66A 3KEAA 3V2OA 3LJNA 1IHBA 2DVWA 2XEHA 2HE0A 3AAAC 4G8LA 3UI2A 5ITZF 3TWTA 4U8YD 3TWUA 5KBAA 3TWQA 4GPMA 2DWZA 4RLYA 4LG6A 1A5EA 5HRYA 4J7WA 4UUCA 5KNGA 5CBOA 5ENOD 5AAOA 4U8VD 2JABA 3F6QA 1MX2A 4F1PA 4K5CA 2A5EA 3V31A 4BETA 4G8KA 4BERA 4DX7D 3ZNGA 5CBNA 2ETCA 3SO8A 4HRMB 5FIOA 3T8KA 3EHQA 1AP7A 4O1OA 5EILA 3V2XA 4DX2A 3JXIA 3J5PA 2BKGA 2KBXA 2XENA 1MYOA 5EN5D 5KNHD 4U96D 2KXPC 3DEOA 4HB5A 5HS0A 4A63B 1K1BA 4DX5D 2F37A 2V5QC 2XZDG 4B93B 1DC2A 1OT8A 2ZGGA 4OAUC 3TWRA 4Z68A 5FINA 2QC9A 3NBNB 4HNAD 3EHRA 1K3ZD 2F8XK 2ETBA 2ETAA 5CECB 2DZNA 1TR4A 4N5QA 4YDWA 2ZGDA 1D9SA 5ENSD 1BI8B 4HI8A 4HRLA 2FO1E 3TWXA 5CEDB 4HQDA 5BXOA 1MX4A 1AWCB 2PNNA 2RFAA 1OY3D 3NOCD 1DCQA 4JB8P 4U95D 5ENRD 3ZKJA 4ZHBA 1BU9A 3TWWA 5ENQD 1N11A 1BI7B 3NOGD 2NYJA 2AJAA 3V30A 1G3NB 1MX6A 4HLLA 1K1AA 4BSZB 1QYMA 4J8YA 3W9FA 3UTMA 1YCSB 2Y1LE 5ENPD 1NFIE 1WDYA 4K5BA 4GMRA 4C48B 2RFMA 5KWDA 4CYMD 3Q9UC 3HG0D 3DEPA 2BKKB 4TUMA 3D9HA 5EIBE 5EYLA 5JA4D 1S70B 5AQ7A 4DX6D 3W9GA 4CZ2D 3AJIA 1YYHA 1SW6A 1YMPA 2XZTG 4O1PA 1N0QA 2QYJA 3C5RA 4YDYA 5EYPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUE A;  1IKN D;  1MJ0 A;  3ZU7 B;  3B7B A;  4HRN A;  3V79 K;  5AQB A;  4DUI A;  2L6B A;  2P2C P;  2MYO A;  2Y0B G;  3T9K A;  5HKP A;  1SVX A;  4QQI A;  5EID A;  1BLX B;  3UXG A;  3Q9N C;  5AN8 A;  3B95 A;  1N0R A;  3HRA A;  5ENT D;  5AQ9 A;  2VGE A;  4LNU D;  4HBD A;  5CER B;  2J8S D;  4DRX E;  4BES A;  4O60 A;  3J5Q B;  4NIK A;  5AQA A;  4K5A B;  4F6R D;  3TWS A;  2B0O E;  2F8Y A;  2V4H C;  5AAR A;  3TWV A;  4ZFH A;  3ZUV B;  4ATZ D;  4BEP A;  5BXU A;  4OAV B;  3EU9 A;  1WG0 A;  4QFV A;  1BD8 A;  4HI9 A;  3IXE A;  5JMN D;  2DZO A;  4LSZ E;  1IXV A;  1UOH A;  5CEA A;  3JXJ A;  4DX1 A;  2XEE A;  5D66 A;  3KEA A;  3V2O A;  3LJN A;  1IHB A;  2DVW A;  2XEH A;  2HE0 A;  3AAA C;  4G8L A;  3UI2 A;  5ITZ F;  3TWT A;  4U8Y D;  3TWU A;  5KBA A;  3TWQ A;  4GPM A;  2DWZ A;  4RLY A;  4LG6 A;  1A5E A;  5HRY A;  4J7W A;  4UUC A;  5KNG A;  5CBO A;  5ENO D;  5AAO A;  4U8V D;  2JAB A;  3F6Q A;  1MX2 A;  4F1P A;  4K5C A;  2A5E A;  3V31 A;  4BET A;  4G8K A;  4BER A;  4DX7 D;  3ZNG A;  5CBN A;  2ETC A;  3SO8 A;  4HRM B;  5FIO A;  3T8K A;  3EHQ A;  1AP7 A;  4O1O A;  5EIL A;  3V2X A;  4DX2 A;  3JXI A;  3J5P A;  2BKG A;  2KBX A;  2XEN A;  1MYO A;  5EN5 D;  5KNH D;  4U96 D;  2KXP C;  3DEO A;  4HB5 A;  5HS0 A;  4A63 B;  1K1B A;  4DX5 D;  2F37 A;  2V5Q C;  2XZD G;  4B93 B;  1DC2 A;  1OT8 A;  2ZGG A;  4OAU C;  3TWR A;  4Z68 A;  5FIN A;  2QC9 A;  3NBN B;  4HNA D;  3EHR A;  1K3Z D;  2F8X K;  2ETB A;  2ETA A;  5CEC B;  2DZN A;  1TR4 A;  4N5Q A;  4YDW A;  2ZGD A;  1D9S A;  5ENS D;  1BI8 B;  4HI8 A;  4HRL A;  2FO1 E;  3TWX A;  5CED B;  4HQD A;  5BXO A;  1MX4 A;  1AWC B;  2PNN A;  2RFA A;  1OY3 D;  3NOC D;  1DCQ A;  4JB8 P;  4U95 D;  5ENR D;  3ZKJ A;  4ZHB A;  1BU9 A;  3TWW A;  5ENQ D;  1N11 A;  1BI7 B;  3NOG D;  2NYJ A;  2AJA A;  3V30 A;  1G3N B;  1MX6 A;  4HLL A;  1K1A A;  4BSZ B;  1QYM A;  4J8Y A;  3W9F A;  3UTM A;  1YCS B;  2Y1L E;  5ENP D;  1NFI E;  1WDY A;  4K5B A;  4GMR A;  4C48 B;  2RFM A;  5KWD A;  4CYM D;  3Q9U C;  3HG0 D;  3DEP A;  2BKK B;  4TUM A;  3D9H A;  5EIB E;  5EYL A;  5JA4 D;  1S70 B;  5AQ7 A;  4DX6 D;  3W9G A;  4CZ2 D;  3AJI A;  1YYH A;  1SW6 A;  1YMP A;  2XZT G;  4O1P A;  1N0Q A;  2QYJ A;  3C5R A;  4YDY A;  5EYP F; 
#chains in the Genus database with same CATH topology
 3JUE A;  1MJ0 A;  2IO2 C;  3B7B A;  1O1R A;  2QFC A;  3MKR A;  3HXD A;  3CHQ A;  4GZ6 A;  1S64 A;  2VSO E;  5BV1 A;  1DVP A;  3OAW A;  1HG2 A;  5ARG A;  3FUH A;  4FJZ A;  3QC1 A;  2J07 A;  1HO8 A;  2H6F A;  4GTQ A;  3ZUV B;  4B0Z A;  1O1T A;  2WQH A;  5CEA A;  4ACL A;  3LJN A;  1HU3 A;  2VGY A;  4AY6 A;  2IY0 C;  2R17 C;  4N5C A;  4UWF A;  4M7C A;  5HRY A;  3CVQ A;  1W3B A;  4AOF A;  2VTB B;  1D8E A;  3ZYM A;  2ILR A;  5EN5 D;  4BTB A;  4EQF A;  3CVP A;  2KXP C;  3CVY A;  2XZD G;  3S2A A;  2X6I A;  2ZXW E;  3L13 A;  2ETB A;  3UM3 A;  5ENS D;  3LCA A;  1IQR A;  3IHV A;  5ENR D;  3CVW A;  4N3A A;  3ULE G;  1WM5 A;  4I43 A;  5A23 A;  2WXH A;  1E96 B;  4BSZ B;  2MOW A;  2Y1L E;  2ZU6 B;  3D3M A;  3SI5 A;  3Q9U C;  4AY5 A;  3FTV A;  4XEI G;  4IUL A;  3I4R B;  4GYW A;  4O1P A;  4TRQ A;  3HXC A;  2QYJ A;  3C5R A;  3UT8 A;  3JUI A;  2JEK A;  3RU0 A;  1LF8 A;  3VLD A;  1INZ A;  3C3O A;  1H2T C;  4PUC A;  1KT0 A;  4DRX E;  3L54 A;  2L0I A;  4XKC A;  1N4P A;  5FT9 A;  3LEW A;  2PM7 A;  2WXI A;  4OAV B;  2CFU A;  3IXE A;  5FZQ A;  1UOH A;  2XRY A;  2X3M A;  4NUR A;  2KZT B;  5AEN A;  3B7U X;  4KVM A;  4WUY A;  3AG3 E;  3RSE G;  5G55 A;  4GCO A;  2LAH A;  4UUC A;  5G2N A;  3ABK E;  1HF8 A;  2IU1 A;  3QNK A;  1SQM A;  3RKV A;  2HO1 A;  1KT1 A;  4A63 B;  3DSW A;  3UIO C;  3MEK A;  1JCR A;  1KZP A;  4G25 A;  4IN3 B;  3NF1 A;  2VSY A;  3IKO B;  3CKC A;  1BI7 B;  4HOS A;  1OCC E;  5J90 A;  1OWL A;  1QNF A;  3U4T A;  3C98 A;  4BTA A;  2VTB A;  3DRA A;  4DI4 A;  5EYL A;  4JA7 A;  4HRN A;  2X6J A;  2Q7F A;  4BX8 A;  4FHK A;  3T9K A;  4GA1 A;  3Q9N C;  3ABL E;  1N4R A;  3R9M A;  4XIF A;  2XPZ A;  1NA0 A;  4I2W A;  3QWW A;  3B7R L;  4HOQ A;  5AAR A;  1FPP A;  3HHM A;  4YVO A;  2LXM A;  4C0E A;  1N54 A;  2R5S A;  3NAW A;  4QFV A;  4JW1 A;  3EJN A;  1PAQ A;  3GYZ A;  4WND A;  5ITZ F;  3UKR G;  3FFL A;  1TN7 A;  2OVF A;  3FUK A;  3D9K A;  2QZA A;  1S63 A;  1EPU A;  1MX2 A;  3FTY A;  3B7T A;  2B6C A;  4MS6 A;  2ETC A;  1Z3Y A;  1LD8 A;  3B13 A;  5C2Y A;  4K03 A;  3JXI A;  4O6F A;  3ML9 A;  3BG0 B;  3UMV A;  4WWP A;  5KNH D;  2KC7 A;  3Q7F A;  4I1A A;  2F37 A;  4YVQ C;  4JPS A;  1O5M A;  2HM8 A;  2QC9 A;  3FHE A;  2LSV A;  2CFZ A;  2WM9 A;  4K0R A;  4RG6 A;  4L2L A;  2KZT A;  3ZPJ A;  4FUL A;  5FTP A;  2WXJ A;  2PNN A;  3WG7 E;  3PVL A;  3UT7 A;  1ELW A;  1FT1 A;  2UWJ G;  1YCS B;  3EDT B;  3EIQ C;  4CYM D;  4NRH B;  3ZHE B;  1MZC A;  3URZ A;  3SFZ A;  4G1T A;  1RW2 A;  5E76 A;  1IKN D;  2C0L A;  5CRV A;  3V79 K;  4I6E A;  2R2L A;  2L6J A;  4GYY A;  5KJL A;  3SD5 A;  2VSN A;  2VGE A;  2A4Z A;  3FY4 A;  3ULQ A;  5T4Y A;  3IV0 A;  3QB2 A;  4HI9 A;  3UUX A;  4WNE A;  2VQ2 A;  3TL5 A;  3FEY A;  2DWZ A;  1LTX A;  3N71 A;  5KNG A;  4FHJ A;  2GRM A;  2A5E A;  4DX7 D;  5BUZ A;  4N2Q A;  2FF4 A;  3J5P A;  4GTS A;  2I1K A;  4GU5 A;  4WAF A;  3EIJ A;  3RK6 A;  1UN8 A;  1QBQ A;  4B93 B;  1KLX A;  2QY7 A;  4Z68 A;  2C0M A;  2WPV A;  4U0S A;  5BT1 A;  4DPR A;  1SZ9 A;  4KBQ A;  1TNB A;  3UM2 A;  2YHE A;  4XX5 A;  4YDO A;  2LUH A;  1JPL A;  2P9I G;  1JWG A;  3TG4 A;  3CVU A;  3PNL B;  4C9B B;  4GB9 A;  2WXR A;  4DI3 A;  3PZ2 A;  5DIZ A;  1N95 A;  1Z5S C;  5JJ6 A;  4OVU A;  1E7U A;  4XE0 A;  4KVO A;  4XKB A;  1OCR E;  4GMJ A;  3HXF A;  4GTR A;  2J49 A;  4JA9 A;  2V0P A;  3BG1 B;  2A5U A;  3FUN A;  4PS8 A;  4EPZ A;  3MGB A;  3ONK A;  2IOS A;  4WWN A;  1EF1 C;  3CQG B;  3CVX A;  3O48 A;  2ION A;  3LY7 A;  4H7Y A;  2DVW A;  3MV2 B;  3ZHE A;  5KBA A;  1HH8 A;  4LG6 A;  2R02 A;  3DST A;  2DBA A;  4UQZ A;  3CIA A;  1UJK A;  5EKQ D;  3U9W A;  3V2X A;  1H6O A;  3KSQ A;  5LX8 A;  1MYO A;  3PZ3 A;  4J8E A;  2P9N G;  1E90 A;  3FUD A;  1TNY A;  2ZGG A;  3TXM A;  3SNX A;  1TR4 A;  4C0M A;  3FUL A;  2HYZ A;  4HI8 A;  2FO1 E;  2Y4U A;  5ENN A;  4PH4 B;  3LPZ A;  5AYW D;  1X81 A;  3KAE A;  3ASH A;  4FU3 A;  2AJA A;  4APF A;  3PZ1 A;  1MX6 A;  3GZ1 A;  1XNF A;  4CT4 A;  3UM1 A;  4GTO A;  2RFM A;  4J6I A;  3DEP A;  3L82 A;  3RAU A;  3QWV A;  3T5X A;  1TYQ G;  1FT2 A;  5AQB A;  4GZ3 A;  3ZYQ A;  3LY9 A;  1OUV A;  4RSY A;  4AV7 A;  3CKB A;  5AN8 A;  5EX0 A;  5AQ9 A;  4XI0 A;  4F1S A;  4A3V A;  4I1O B;  2DYR E;  5FJY A;  4URK A;  1IYG A;  3MKQ B;  5G05 J;  4ATZ D;  4CDM A;  4UWK A;  2VJ8 A;  1TN6 A;  3QKY A;  3V2O A;  3NB2 A;  4BY6 A;  2AW6 A;  4G8L A;  4FAD A;  5AJL A;  1Z6T A;  3DSX A;  3EUV A;  4GTV A;  4ILH B;  4U8V D;  4BET A;  3ZNG A;  3EHQ A;  3HXB A;  4N3B A;  3L22 A;  4PDX A;  4B8C B;  4ANX A;  1K1B A;  3DSU A;  1TNO A;  3SHF A;  5HI7 A;  5FIN A;  4U7E B;  3CVL A;  1BI8 B;  4TXQ A;  2J4B A;  1DNP A;  2CHX A;  4KZ0 A;  2OV8 A;  1N11 A;  5DBK A;  1ZU2 A;  3PE4 A;  1K8K G;  4KXK B;  3CLJ A;  3UKU G;  2P58 C;  4BT8 A;  3D9H A;  4W9R A;  2R03 A;  5JA4 D;  4UI9 K;  2OCC E;  3TXN A;  4AXH A;  3E32 A;  2EIK E;  4E6H A;  2VGX B;  3ASO E;  3CHM A;  2XGS A;  3Q49 B;  4AM9 A;  2LSU A;  4XI9 A;  3EHN A;  3B95 A;  1N0R A;  2WMN A;  3ZRH A;  4HBD A;  4O60 A;  4LER A;  4MKT A;  3TWS A;  2F8Y A;  2V4H C;  1YA0 A;  1SZA A;  2GRO B;  4I17 A;  4GML A;  4JXT A;  2DZO A;  1XGW A;  5ANR A;  3CK9 A;  1EYH A;  5IY5 E;  4UQX A;  5LCW C;  3BEE A;  3UIP C;  3KEZ A;  3MCX A;  5EIL A;  1VDY A;  4BWR A;  4F7A A;  3Q78 A;  1SA5 A;  3G2U A;  3MKQ A;  3ESK A;  2IOL A;  4NAC A;  1FCH A;  2FEZ A;  2Y3A A;  5A7D B;  1MQS A;  4HQD A;  4LCT A;  2GRP B;  1AWC B;  1Y8M A;  5EDS A;  4JEU A;  4TXR A;  3GZ2 A;  3LS8 A;  2NYJ A;  3V30 A;  2WXG A;  2GRL A;  2YQ8 A;  4V3I A;  2V5F A;  2L9B A;  3UTM A;  4AJW A;  1NFI E;  4Y6C A;  3FU6 A;  4GAA A;  5M72 A;  2P9S G;  5CMY A;  4TV3 A;  1H19 A;  3ASG A;  3W9G A;  1YMP A;  2J9Q A;  4L23 A;  4YND A;  3ZFW A;  2P2C P;  5EX3 A;  4N3C A;  3LDZ A;  2BTD A;  4R7L A;  1MHQ A;  2YHC A;  4M3O A;  3TGO A;  4I1M A;  3RJV A;  1Z3X A;  1N52 A;  2OEV A;  3I3N A;  2UY1 B;  4BEP A;  2BUG A;  4G26 A;  5AIJ A;  2XEV A;  2XGM A;  3KEA A;  1UG3 A;  3RRU A;  2PZI A;  3APF A;  4WWO A;  4G23 A;  3B7S A;  5D0Q D;  3FUE A;  2OOE A;  1TJF A;  3NQP A;  2VGX A;  4F1P A;  2J08 A;  4G8K A;  4BER A;  4UI9 J;  4HRM B;  3L08 A;  3APC A;  4CGV A;  3DEO A;  1HG5 A;  3ZYL A;  3CSF A;  2KAT A;  1JCS A;  1OXJ A;  3CR3 A;  3S7B A;  2ETA A;  1TNZ A;  2I1J A;  3PZ4 A;  3WXX A;  1MX4 A;  2RFA A;  5HQ8 A;  2R59 A;  1U3C A;  5LFA A;  4B8A A;  3ULY A;  3UQ3 A;  3FUF A;  3TG5 A;  3TJP A;  3SFY A;  2EIJ E;  4CDR A;  1DCE A;  4I9E A;  3IEG A;  3UX4 A;  1OWP A;  4RVB A;  3GZS A;  3ZXS A;  4Y6W A;  1N0Q A;  2WMO A;  3MZL B;  2VSX E;  2MYO A;  3JYS A;  4JL0 A;  2RKK A;  4N39 A;  4LNB A;  4U04 A;  3FTS A;  1X5B A;  4DLO A;  1V55 E;  4LEU A;  3LVQ E;  2PQR A;  4BES A;  2AWI A;  2OVB A;  3G2S A;  3TWV A;  4YDE A;  4TUU A;  1BD8 A;  4I2Z A;  4J8F A;  2M63 A;  5D66 A;  4JC8 A;  3FH5 A;  3UI2 A;  3BUA A;  5BW8 C;  3TWT A;  5G05 C;  4GA2 A;  3QDN A;  2Y69 E;  1UN9 A;  3PRE A;  3F6Q A;  3P1U A;  3JQ1 A;  5JJ7 A;  3G2W A;  4DX2 A;  4PS7 A;  4UWL A;  5LCW J;  4Q96 A;  3CK8 A;  3Q75 A;  1ELR A;  3FP3 A;  3KD7 A;  1N94 A;  1HXI A;  3FUM A;  2UY1 A;  3AS5 A;  4N5Q A;  3S7D A;  3ISM C;  3CK7 A;  3CV0 A;  5BXO A;  3R7R A;  3I4G A;  1K1A A;  1QYM A;  1WDY A;  3FH8 A;  2P9P G;  2P9L G;  2RG8 A;  4GZD A;  3ABM E;  3CST A;  4Q69 A;  2EQX A;  4JHR A;  4BX9 A;  3DBS A;  3DXK G;  3ONL A;  3VTX A;  4HXI A;  4QQI A;  3OXL A;  3HIZ A;  3APD A;  2WQ6 A;  4IYP A;  3DSS A;  4NIK A;  5AQA A;  4F6R D;  3CEQ A;  3BQO A;  3DSV A;  3QOU A;  1TEZ A;  2IQC A;  4UWH A;  4A1G A;  2XPI A;  4ME2 A;  3PNT B;  3FU3 A;  1IHG A;  5T8I A;  1ZBP A;  1FVH A;  1A5E A;  3CQC B;  4J8S A;  3E30 A;  3U3W A;  1GW6 A;  2WXL A;  3MV3 B;  2KM4 A;  3S7J A;  5FIO A;  5FQ8 A;  1E8Y A;  1WAO 1;  3C3Q A;  3T5V A;  5CMW A;  1LD7 A;  2XGO A;  2V5Q C;  3FDH A;  3UIN C;  3CGH A;  5B1A E;  3PRZ A;  3VLE A;  2L0T B;  1UJJ A;  4HRL A;  1JWF A;  1E8X A;  3NOC D;  1DCQ A;  3FUJ A;  5CHE E;  3ZKJ A;  1NI1 A;  5E75 A;  2KCV A;  3ENE A;  5KJK A;  1IQU A;  4GTP A;  2X38 A;  2LNI A;  4PS3 A;  5ENP D;  2EIM E;  5JHB A;  2OEW A;  4DLQ A;  3E33 A;  1H6P A;  2BKK B;  3FTZ A;  4DX6 D;  4CZ2 D;  4APO A;  3I5P A;  3AU5 A;  3ZU7 B;  3DXM G;  3L6A A;  2Y0B G;  4I6G A;  1U3D A;  4EHM A;  3PE3 A;  4HVB A;  1O1S A;  4OVV A;  3ZVV A;  5JJT A;  3U64 A;  4FJY A;  3CHR A;  2J8S D;  3JQ0 A;  3Q79 A;  5FQ7 A;  4AVX A;  4AP2 A;  4WNG A;  2QYU A;  5G04 C;  3Q4A B;  3PUK A;  2JLB A;  2KCK A;  2I9C A;  5ENO D;  3CHP A;  5LP0 A;  3X2Q E;  4GTM A;  2BKG A;  2WB2 A;  3SFX A;  4F3V A;  2H6I A;  3FUI A;  1EDU A;  2OND A;  4UI9 C;  1BPO A;  3D9I A;  3LXU X;  2DZN A;  1HE8 A;  2J4D A;  1B89 A;  2VYI A;  3FTU A;  5KCM A;  3TWX A;  2V8S E;  3LY8 A;  4HLE A;  2WQ7 A;  1H6K A;  5LOZ A;  3AG1 E;  3PZD A;  3D9P A;  1HFA A;  3W9F A;  1L5J A;  4C48 B;  2XS1 A;  2IF4 A;  3NZS A;  1H2V C;  2XCB A;  2XZT G;  5ARF A;  4GTT A;  5FQ4 A;  3FU5 A;  5CRU A;  2EIN E;  4GA0 A;  3SBS A;  4ATG A;  3E4B A;  5AJD A;  3RIB A;  3UXG A;  2PM6 A;  4A55 A;  5J08 A;  3QAQ A;  4BFR A;  3QAR A;  2CHZ A;  4ANV A;  4EZK A;  4UWG A;  4K5A B;  3AG2 E;  3D9M A;  3PUJ A;  1OCO E;  3ASN E;  4CDN A;  5BXU A;  3EU9 A;  3AG4 E;  5JMN D;  4GCN A;  3ZN3 A;  2HE0 A;  2AXV A;  4U8Y D;  3TWU A;  3UM0 A;  5FZR A;  4L9P A;  2PL2 A;  5CCL A;  2E2E A;  2X6K A;  1H2U A;  2WVI A;  4HB5 A;  4HOT A;  3IBE A;  2Y4T A;  1OT8 A;  3ZXP A;  2XPY A;  3Q7A A;  1K3Z D;  4B89 A;  3Q47 B;  2KCL A;  2WXK A;  4EZJ A;  4LUN U;  2CG2 A;  3AU4 A;  3TWW A;  4U0U A;  5ENQ D;  2V4L A;  4XZ4 A;  3NOG D;  4HLL A;  4ACK A;  4WNF A;  1ZB1 A;  3SY2 A;  3HG0 D;  4EEC A;  1JUQ A;  1D8D A;  4JHK A;  3DWL G;  3AS8 A;  5KJM A;  4G11 A;  4DUI A;  5H7P A;  3ZYK A;  4U0Z A;  3E37 A;  2YIN A;  3ML8 A;  3C3R A;  3OXG A;  3HRA A;  5ENT D;  3PEU B;  1Y6I A;  3Q73 A;  5CCM A;  2NXP A;  3J5Q B;  2AXZ A;  3DPD A;  2FI7 A;  3CVN A;  2C2L A;  3LYA A;  4I6J A;  4JVS A;  4LSZ E;  1RZ4 A;  4GYO A;  3BU8 A;  3JXJ A;  4Q94 A;  4DX1 A;  4E85 A;  3EU5 A;  3AAA C;  3TWQ A;  3FWV A;  4GPM A;  2EIL E;  4GZC A;  5AAO A;  3UPV A;  5G04 J;  4CCA A;  3RO2 A;  4KYO B;  4JEH A;  3SO8 A;  3T8K A;  4HOU A;  2XEN A;  2YNQ A;  3PEV B;  1OWO A;  3QJZ A;  2BED A;  2FO7 A;  1PC2 A;  1HS6 A;  3HYM B;  2WXF A;  4DJA A;  3RO3 A;  4HNA D;  4HS2 A;  1QQE A;  3SQV A;  4YDW A;  4RQI A;  2ZIS A;  4L1B A;  1N4S A;  2X6H A;  3D9N A;  4HFG A;  4AIF A;  4U95 D;  3VLF A;  4ABN A;  3L9T A;  3PDN A;  1G3N B;  3Q15 A;  1ELK A;  5T3R A;  3QK0 A;  5EIB E;  2XRZ A;  3AJI A;  1Q2Z A;  1YYH A;  3LJ3 A;  3RRN B;  2CG3 A;  1S0P A;  4G2V A;  2I2O A;  5EID A;  3SZ7 A;  3O4Z A;  1BLX B;  2LAI A;  4CEM A;  4J8D A;  1UW4 B;  4LNU D;  4ILG A;  5CER B;  5FWQ A;  2NC9 A;  5A6C A;  3KSL A;  2GRQ B;  4KT6 B;  1NP7 A;  2B0O E;  1JCQ A;  4G24 A;  3E34 A;  2WXM A;  2AVP A;  4HOR A;  1IXV A;  3MJW A;  3U66 A;  2XEH A;  3MYV A;  3OTN A;  4EBA G;  2X6F A;  4TXP A;  3VTY A;  1NA3 A;  1TJC A;  5CBO A;  2WXP A;  5KJN A;  2MHK A;  4KMO A;  5D0O D;  1AP7 A;  3HDX A;  4F53 A;  2KBX A;  1OWN A;  1TN8 A;  2DCP A;  4I9C A;  2R05 A;  5HS0 A;  4FLB A;  3HVE B;  3RRM B;  4J0U A;  3NBN B;  3ZEF A;  2DIW A;  3P2B A;  5BV0 A;  4P29 A;  4UQY A;  5JHA A;  4CT0 A;  5CED B;  1KZO A;  4EBA A;  1BU9 A;  4GZ5 A;  3G2T A;  3GW4 A;  4EZL A;  4J8Y A;  3MA5 A;  4K5B A;  5KWD A;  4JZY A;  4A3T A;  5BNW A;  5B1B E;  3T8M A;  1SA4 A;  1HX8 A;  2BF0 X;  4MBG A;  2IJG X;  1SVX A;  5BPP A;  3JCK C;  2XHE A;  3KS2 A;  2WXQ A;  3FTX A;  3G2V A;  3ASF A;  2F0Y A;  4ILI A;  3MX3 A;  4BSX A;  3R9A B;  1A17 A;  4ZFH A;  4MLP A;  3OXF A;  4L7T A;  4RG9 A;  2P9K G;  4LRZ A;  4DK5 A;  1NL4 A;  2XEE A;  2H6H A;  4L2Y A;  2XS8 A;  1IHB A;  3IHY A;  3L17 A;  4RLY A;  4FA6 A;  4J7W A;  2DYS E;  4GPK A;  3QWP A;  3ZW3 A;  2HR2 A;  2JAB A;  4K5C A;  5CBN A;  4NQ0 A;  2IEJ A;  1E8Z A;  2AXU A;  3ZIM A;  1NZN A;  1V54 E;  3LVR E;  3CHO A;  1OWM A;  4ANW A;  1DC2 A;  4B94 A;  4OAU C;  3EHR A;  1U2V G;  2GW1 A;  2F8X K;  3FU0 A;  2ZGD A;  2P9U G;  4U63 A;  4LNG A;  4FC8 A;  1N4Q A;  2ZIR A;  2NSZ A;  4JB8 P;  4U07 A;  2XCC A;  5D2M C;  2RD0 A;  4IRU A;  3PS6 A;  2GRR B;  4MRU A;  1FVF A;  4GMR A;  3TAX A;  4TUM A;  3CHS A;  4YDY A;  5EYP F;  5FQ6 A;  2WXO A;  2GGF A;  3HVE A;  3NZU A;  1HZ4 A;  2L6B A;  4A1S A;  3R7Q A;  5HKP A;  1E7V A;  3ESL A;  4BT9 A;  1QZ2 A;  4FLH A;  2FUL A;  3UT4 A;  4N2S A;  4FP7 A;  4JHJ A;  1E8W A;  1OCZ E;  3D9L A;  4JD2 G;  4KZC A;  1TNU A;  1WG0 A;  2CHW A;  3D9O A;  5B3S E;  3D9J A;  4X8Q A;  3L16 A;  3SBT B;  1H0A A;  3EHM A;  4CGW A;  2GRN B;  3FTW A;  3SF4 A;  2FBN A;  2J09 A;  3LKU A;  4OYS A;  1PY1 A;  2I6H A;  2MRI A;  1KPS B;  4O1O A;  2IO3 C;  3FH7 A;  5ANL A;  3HXE A;  4U96 D;  2WXN A;  3S7F A;  1N9A A;  4DX5 D;  2E0I A;  2IFU A;  3TWR A;  4ANU A;  3ZGQ A;  3DPY A;  5CEC B;  1D9S A;  3K9I A;  2H6G A;  1WY6 A;  4AEZ C;  3ASD A;  3PH0 C;  3FEX A;  2LO6 A;  2PQN A;  4CRW A;  4ZHB A;  1OY3 D;  2XQ0 A;  4D10 C;  5FZS A;  4H7X A;  1P5Q A;  5C1D A;  3C72 A;  3AS4 A;  3Q5M A;  3CVV A;  3SGH A;  4U8H A;  1S70 B;  5AQ7 A;  1SW6 A;  2LXL A;  3V31 A; 
#chains in the Genus database with same CATH homology
 3JUE A;  1IKN D;  1MJ0 A;  3ZU7 B;  3B7B A;  4HRN A;  3V79 K;  5AQB A;  4DUI A;  2L6B A;  2P2C P;  2MYO A;  2Y0B G;  3T9K A;  5HKP A;  1SVX A;  4QQI A;  5EID A;  1BLX B;  3UXG A;  3Q9N C;  5AN8 A;  3B95 A;  1N0R A;  3HRA A;  5ENT D;  5AQ9 A;  2VGE A;  4LNU D;  4HBD A;  5CER B;  2J8S D;  4DRX E;  4BES A;  4O60 A;  3J5Q B;  4NIK A;  5AQA A;  4K5A B;  4F6R D;  3TWS A;  2B0O E;  2F8Y A;  2V4H C;  5AAR A;  3TWV A;  4ZFH A;  3ZUV B;  4ATZ D;  4BEP A;  5BXU A;  4OAV B;  3EU9 A;  1WG0 A;  4QFV A;  1BD8 A;  4HI9 A;  3IXE A;  5JMN D;  2DZO A;  4LSZ E;  1IXV A;  1UOH A;  5CEA A;  3JXJ A;  4DX1 A;  2XEE A;  5D66 A;  3KEA A;  3V2O A;  3LJN A;  1IHB A;  2DVW A;  2XEH A;  2HE0 A;  3AAA C;  4G8L A;  3UI2 A;  5ITZ F;  3TWT A;  4U8Y D;  3TWU A;  5KBA A;  3TWQ A;  4GPM A;  2DWZ A;  4RLY A;  4LG6 A;  1A5E A;  5HRY A;  4J7W A;  4UUC A;  5KNG A;  5CBO A;  5ENO D;  5AAO A;  4U8V D;  2JAB A;  3F6Q A;  1MX2 A;  4F1P A;  4K5C A;  2A5E A;  3V31 A;  4BET A;  4G8K A;  4BER A;  4DX7 D;  3ZNG A;  5CBN A;  2ETC A;  3SO8 A;  4HRM B;  5FIO A;  3T8K A;  3EHQ A;  1AP7 A;  4O1O A;  5EIL A;  3V2X A;  4DX2 A;  3JXI A;  3J5P A;  2BKG A;  2KBX A;  2XEN A;  1MYO A;  5EN5 D;  5KNH D;  4U96 D;  2KXP C;  3DEO A;  4HB5 A;  5HS0 A;  4A63 B;  1K1B A;  4DX5 D;  2F37 A;  2V5Q C;  2XZD G;  4B93 B;  1DC2 A;  1OT8 A;  2ZGG A;  4OAU C;  3TWR A;  4Z68 A;  5FIN A;  2QC9 A;  3NBN B;  4HNA D;  3EHR A;  1K3Z D;  2F8X K;  2ETB A;  2ETA A;  5CEC B;  2DZN A;  1TR4 A;  4N5Q A;  4YDW A;  2ZGD A;  1D9S A;  5ENS D;  1BI8 B;  4HI8 A;  4HRL A;  2FO1 E;  3TWX A;  5CED B;  4HQD A;  5BXO A;  1MX4 A;  1AWC B;  2PNN A;  2RFA A;  1OY3 D;  3NOC D;  1DCQ A;  4JB8 P;  4U95 D;  5ENR D;  3ZKJ A;  4ZHB A;  1BU9 A;  3TWW A;  5ENQ D;  1N11 A;  1BI7 B;  3NOG D;  2NYJ A;  2AJA A;  3V30 A;  1G3N B;  1MX6 A;  4HLL A;  1K1A A;  4BSZ B;  1QYM A;  4J8Y A;  3W9F A;  3UTM A;  1YCS B;  2Y1L E;  5ENP D;  1NFI E;  1WDY A;  4K5B A;  4GMR A;  4C48 B;  2RFM A;  5KWD A;  4CYM D;  3Q9U C;  3HG0 D;  3DEP A;  2BKK B;  4TUM A;  3D9H A;  5EIB E;  5EYL A;  5JA4 D;  1S70 B;  5AQ7 A;  4DX6 D;  3W9G A;  4CZ2 D;  3AJI A;  1YYH A;  1SW6 A;  1YMP A;  2XZT G;  4O1P A;  1N0Q A;  2QYJ A;  3C5R A;  4YDY A;  5EYP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...