4J8YA

E3_5 darpin d77s mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNGADVNASSLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DARPin_E3_5_D77S
publication title Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 50
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4j8yA00
4O1PA 1MYOA 1N0QA 1BI8B 3TWUA 2ETCA 4U96D 4DX1A 3NOGD 5HKPA 5ENOD 4OAUC 2XENA 4TUMA 5ENTD 1YYHA 3ZNGA 3TWVA 5CBNA 3JXJA 5ENPD 5KNGA 3KEAA 4O1OA 5JMND 2A5EA 4BSZB 4NIKA 3LJNA 2QC9A 3AAAC 2DVWA 3HRAA 4LNUD 1K3ZD 4HQDA 5EIDA 4DRXE 2FO1E 1D9SA 2V5QC 5AN8A 3EU9A 1MX4A 5ENQD 4Z68A 1DC2A 4J7WA 4K5CA 3V30A 4U8YD 1BD8A 5AAOA 3EHRA 4DUIA 2XZTG 4K5AB 3B95A 2BKGA 1TR4A 4DX2A 1YMPA 4UUCA 4DX6D 2AJAA 2MYOA 5AQ9A 4QQIA 5ENSD 4QFVA 2QYJA 3TWXA 5JA4D 3TWWA 3V2OA 1WG0A 3C5RA 1G3NB 1BU9A 5KWDA 3EHQA 2PNNA 1BI7B 5CEAA 3TWSA 5AQAA 2B0OE 5FINA 3TWQA 1MX6A 4HLLA 4ZFHA 2BKKB 5HRYA 2DZNA 3AJIA 5EN5D 4ZHBA 3UTMA 4K5BA 5HS0A 4G8KA 1BLXB 5EILA 4BERA 5ITZF 3IXEA 5CERB 2F8YA 4F1PA 5KBAA 3V2XA 2F37A 5EYPF 3W9GA 5BXUA 5BXOA 2XEEA 2XEHA 3J5QB 5FIOA 5CEDB 5AARA 3UXGA 3JUEA 3W9FA 4HRMB 4U95D 1IXVA 1OT8A 4BESA 2ETBA 4CZ2D 5CECB 1K1BA 2ZGGA 3TWTA 1SVXA 1K1AA 5ENRD 4A63B 3SO8A 1SW6A 4B93B 2L6BA 4HRNA 4U8VD 3ZUVB 4HI9A 2KBXA 1N0RA 4GPMA 2KXPC 4RLYA 3TWRA 2VGEA 3Q9UC 3NBNB 4BETA 2RFAA 3ZKJA 4O60A 2HE0A 1DCQA 2Y1LE 1N11A 5EIBE 3F6QA 4HNAD 1NFIE 2NYJA 3D9HA 3NOCD 2XZDG 1MX2A 1UOHA 1IKND 3T9KA 4CYMD 3T8KA 4OAVB 2ETAA 2Y0BG 3J5PA 4YDWA 1WDYA 5KNHD 3DEPA 1AWCB 1MJ0A 4BEPA 4JB8P 3V31A 2JABA 3HG0D 1OY3D 2DZOA 2RFMA 4HRLA 3ZU7B 4DX5D 2V4HC 5AQBA 4LG6A 2DWZA 3V79K 1YCSB 1AP7A 5CBOA 4HI8A 2J8SD 4HBDA 1QYMA 4ATZD 5D66A 4YDYA 2P2CP 1A5EA 4J8YA 5AQ7A 4C48B 3UI2A 4N5QA 2F8XK 4DX7D 4G8LA 4HB5A 2ZGDA 3B7BA 5EYLA 3Q9NC 4LSZE 4GMRA 3JXIA 1S70B 3DEOA 1IHBA 4F6RD
chains in the Genus database with same CATH superfamily
2P9KG 3DBSA 3HXDA 4GZCA 3FTWA 4NIKA 2DYSE 3ASDA 2WXKA 3L82A 5ENQD 3QWPA 3DSVA 2BF0X 5ANLA 3QOUA 1Z3YA 3CSTA 2XZTG 4M3OA 1YMPA 3CEQA 4WUYA 2H6IA 1FCHA 3HXFA 3CVPA 1NI1A 3FP3A 2P9SG 3SI5A 4L9PA 4GZ6A 4BWRA 2R05A 1TYQG 5LCWC 4Y6CA 2AWIA 3KEZA 5FINA 3PREA 3OTNA 5EN5D 3LJ3A 3S7FA 2LSVA 4RG6A 3HYMB 3EJNA 3MYVA 2ZU6B 3OXGA 2DCPA 3L54A 4XZ4A 5AIJA 5BV0A 3TWTA 4HOSA 3ZUVB 3Q9UC 1E8XA 2IEJA 4ATGA 3HVEB 4U0SA 2P9IG 4BT8A 2VSNA 2XPZA 3NOCD 1HU3A 3ISMC 5JHBA 2OV8A 2WXIA 3EU5A 3L17A 3Q7AA 5BPPA 4L7TA 2YHCA 3U64A 3CKBA 3FUDA 5KJNA 1O1RA 1E96B 3RO3A 2ZXWE 3P1UA 3JXIA 2GRRB 5EYPF 2WXPA 4JA9A 5HKPA 1Y8MA 4ACKA 3L22A 2KM4A 1B89A 4BSZB 3VLFA 4RVBA 4G11A 4U7EB 2IOSA 3EHRA 4N3AA 4WWNA 4JVSA 5LX8A 2MYOA 3T5XA 4QFVA 2LO6A 4FP7A 4MLPA 5FTPA 2VSYA 3EHQA 1BI7B 3TG4A 3ABME 3R9MA 5BXOA 4C0EA 5ENNA 1K1BA 5FZSA 1SVXA 3Q78A 2P58C 3KSLA 4K0RA 4AY5A 3IBEA 2RFAA 2VGXB 3CR3A 3PEVB 4B94A 1VDYA 4AOFA 3FH8A 3MA5A 2WMNA 2XGOA 2QZAA 4EPZA 4KZCA 4U63A 3QNKA 5A23A 2DZOA 1KT1A 4GYWA 4C9BB 1UJKA 5CBOA 4KVOA 4A1GA 5AQ7A 4HXIA 3UI2A 4N5QA 3QWVA 4HB5A 5G05C 2LNIA 3HXBA 2I1JA 1N0QA 1H6PA 5T4YA 3G2WA 4J8EA 4XKBA 1O5MA 3NOGD 2FI7A 3NQPA 3U4TA 3LPZA 2VTBB 4JC8A 3PZ3A 3GZ2A 4LNUD 3LY9A 1BPOA 4URKA 4KT6B 2WXMA 4XI0A 5B3SE 1E8WA 2EINE 3ZXSA 4APOA 4KYOB 3Q49B 3RRNB 5LP0A 5KJLA 2X6FA 3PNTB 4LNGA 1RZ4A 1XGWA 4BY6A 3ENEA 3FU3A 4E6HA 3AS4A 4JHJA 2UWJG 2WQ6A 4ABNA 1SW6A 4N2QA 4KMOA 1OWPA 4LRZA 3AS8A 1A17A 1TJFA 3C3OA 2NC9A 4AEZC 2IY0C 3F6QA 4HNAD 2IONA 1L5JA 3E34A 2I9CA 3VTXA 4JA7A 2JEKA 3ZU7B 2GRLA 3MKQB 2B6CA 4BSXA 4TXPA 1KLXA 3C3RA 4G23A 3UT7A 1E7VA 4FLHA 1BI8B 3RO2A 1Z3XA 3D9MA 3TL5A 3CIAA 3N71A 1N9AA 1UN9A 1H2UA 2Y3AA 4DLOA 3BQOA 3BG0B 5FWQA 5B1AE 3CVUA 4DUIA 2XCCA 4UUCA 3QKYA 1N52A 2J09A 2Q7FA 3UM3A 4GZ3A 3ZRHA 2AXVA 4G1TA 2RKKA 3ZPJA 4G26A 2AXZA 1N94A 1TNZA 4YVOA 1O1SA 1E8YA 2RG8A 1N4RA 2DYRE 5D2MC 4B0ZA 1GW6A 2MHKA 4BESA 4I2ZA 4BFRA 1U3CA 2OVBA 4FULA 4HI9A 2ONDA 2VGEA 4FA6A 5C2YA 3Q47B 3CVWA 3APCA 5EIBE 3CSFA 1TEZA 2XZDG 4P29A 1JCSA 2UY1A 4N5CA 2Y0BG 4FHKA 2VGXA 4CDRA 4RSYA 4DI4A 4ANVA 3HIZA 3CVYA 1DCEA 5CRUA 3VTYA 4A3VA 3L16A 4J8YA 3CVXA 2HYZA 2Y4UA 5EYLA 3S7BA 3LY7A 4FC8A 2IU1A 3FTXA 4PS7A 2HM8A 2DVWA 3G2VA 1KPSB 4C0MA 1OWLA 1BD8A 3CGHA 1SZ9A 2AJAA 4QQIA 3WG7E 4O6FA 3HHMA 5JA4D 4U04A 4GMJA 2XGMA 2PNNA 4TXQA 3OXFA 4B8CB 2OVFA 2WXOA 4KZ0A 3SZ7A 4H7XA 5CERB 2F8YA 2L9BA 4WNGA 4CEMA 2PL2A 2FO7A 2FULA 3ML8A 3ESLA 1QZ2A 2ETBA 4PDXA 3SO8A 1PAQA 2NXPA 4U8VD 4XKCA 5T8IA 3RK6A 3CK7A 4B89A 3L13A 4G2VA 4WNDA 2RD0A 1NZNA 3EIQC 4NRHB 4KXKB 4AIFA 2J4DA 2MRIA 4FJYA 2FF4A 4J8SA 4Y6WA 4CYMD 2KATA 3GYZA 2A4ZA 3CV0A 3DEPA 3HG0D 4GTVA 4LG6A 2DWZA 1AP7A 4F1SA 1U2VG 3PUJA 4DJAA 4LSZE 4GB9A 1O1TA 1HE8A 1HF8A 2LSUA 3ZFWA 1JCQA 3Q5MA 4OVUA 3TWVA 5ARFA 3KEAA 4DLQA 2V5QC 4FU3A 1WM5A 2AXUA 3OXLA 1NA3A 2XGSA 2X6HA 2LXLA 1RW2A 3U9WA 3DSUA 3CLJA 4NURA 4V3IA 3SY2A 1WG0A 2GRMA 4GA0A 3I5PA 2CFUA 5A7DB 4J8DA 5CEAA 4AM9A 1WAO1 3CVVA 2WB2A 3JQ1A 4ZHBA 5CHEE 4MS6A 1HX8A 3CHMA 3RAUA 2VSXE 2XRYA 2X6KA 3LVQE 4HRMB 4U95D 5BV1A 3UMVA 2V0PA 2CHZA 4WAFA 4BETA 4GTMA 3IV0A 3MZLB 3EUVA 3LS8A 2GRNB 2NYJA 3ASOE 3IKOB 2OEVA 3CK8A 4UI9C 2CG3A 1AWCB 4BEPA 4GMLA 2V4HC 4I6JA 2QYUA 3ULEG 4RG9A 1TNBA 4W9RA 5BT1A 3E30A 4F7AA 4G8LA 3LVRE 3B7UX 1X81A 4F6RD 1MYOA 3DSWA 5FZQA 5ENTD 3WXXA 3ASFA 4CT0A 2XS8A 3LJNA 3QARA 2QC9A 3AAAC 3HRAA 1H2TC 3PS6A 3EU9A 3Q79A 3URZA 4U8YD 5AAOA 3E4BA 2XQ0A 2CG2A 5ENSD 4D10C 2QYJA 5AJDA 5G04J 3V2OA 3ABKE 2H6HA 4CGWA 3FEYA 2WQ7A 3UKRG 3VLEA 4HFGA 2C2LA 3AJIA 5HS0A 4GCOA 2F0YA 4GZDA 4LUNU 4HORA 1TN6A 2E2EA 2HR2A 2L0IA 3JUEA 3U3WA 3ZHEA 2ILRA 1KZOA 1IQUA 2HE0A 3PZ1A 2Y1LE 1H6OA 3QJZA 2KC7A 3T8KA 3SD5A 2L0TB 1ZU2A 1ELRA 3FU6A 2LXMA 4U0UA 4YDWA 4AJWA 1UW4B 1MJ0A 1LD7A 5AQBA 1OCOE 2UY1B 3P2BA 4JW1A 1X5BA 1A5EA 2M63A 1JWFA 4ANWA 2CHXA 3E33A 2PM6A 4LEUA 3LEWA 1UG3A 4OVVA 4Q69A 3D9IA 3KSQA 3G2SA 3QWWA 3ZNGA 5CMYA 4O1OA 3QK0A 3O4ZA 3CK9A 2Y69E 3CHQA 2GROB 4EECA 3ABLE 1MX4A 4DI3A 4I2WA 2BEDA 5G2NA 4K5AB 5AQ9A 3OAWA 2YHEA 2KCLA 1FT1A 2XPIA 3UM2A 5LOZA 2HO1A 4CDNA 3D3MA 4ME2A 2IOLA 3ZW3A 1MX6A 2EIKE 3ASNE 4LERA 5J08A 1PC2A 1OWMA 3UTMA 4G8KA 4CGVA 1DNPA 3UXGA 3DSSA 3PEUB 1OT8A 2WXQA 5EX0A 4E85A 4WNEA 4F3VA 2IO2C 4ILIA 3ZIMA 4PUCA 5LFAA 1K8KG 3GZSA 3I4GA 5FJYA 1NFIE 4I9EA 3UT4A 4DPRA 5M72A 1QBQA 2QY7A 1DVPA 1OY3D 2RFMA 3FUKA 2JLBA 1KZPA 2GGFA 3LXUX 4HS2A 5D66A 2WMOA 3SFXA 1H19A 2KZTA 4B8AA 3ONKA 2J9QA 4I17A 1EYHA 3S7JA 4HOTA 2XENA 3BEEA 1YYHA 2GRQB 5ENPD 4XEIG 3ZYKA 5CMWA 2YNQA 3TJPA 3AU4A 3Q73A 2I2OA 4UWGA 3FTVA 4X8QA 2R5SA 3ML9A 2R59A 4IYPA 3BU8A 3FDHA 3FU5A 4UQZA 1V54E 4DX6D 3MV2B 2VJ8A 4CRWA 3SNXA 2V5FA 4U0ZA 4UI9K 3PDNA 2WXGA 2KCKA 4Q96A 3TWXA 1NL4A 3D9NA 5G55A 4CCAA 4FLBA 4ZFHA 3KD7A 4OYSA 5B1BE 2Y4TA 4WNFA 5FIOA 5H7PA 4CZ2D 3ZVVA 1EPUA 3JUIA 2WXHA 3D9KA 2KXPC 3C72A 3SQVA 1DCQA 4DK5A 1ELKA 3LDZA 3D9HA 3DXKG 3ESKA 1OXJA 4TUUA 3D9PA 2X38A 4OAVB 2YQ8A 3O48A 3G2UA 1SA4A 4GYYA 3SGHA 5KNHD 3S7DA 4IULA 3QAQA 3AG3E 1WY6A 3TG5A 1INZA 3FUJA 4U8HA 5JJTA 3MEKA 2WXRA 3G2TA 4GU5A 3FUIA 4UQYA 2X3MA 4YVQC 4GTTA 2ZIRA 4XIFA 3UM0A 5KNGA 4EQFA 4YNDA 4HQDA 1D9SA 2LAHA 1MZCA 4UWHA 1V55E 2PM7A 5BUZA 3U66A 1SZAA 1W3BA 3EIJA 5CCLA 4K5CA 4PS8A 3AG2E 1TR4A 5LCWJ 3UIPC 3RSEG 5FQ6A 1FVFA 1TJCA 2KCVA 4GA1A 3FULA 4FADA 5FT9A 1LTXA 4MKTA 2B0OE 4ACLA 3CQCB 1D8EA 2DZNA 4BTBA 4K5BA 3IXEA 2QFCA 5KBAA 2EQXA 4L2YA 4FHJA 5KJMA 3UT8A 4I9CA 4L1BA 3APDA 5ENRD 1Z6TA 2BTDA 4B93B 2KBXA 4GPMA 2LUHA 1E8ZA 4O60A 4CDMA 1IYGA 1E90A 3ZHEB 3NAWA 1ZB1A 2AVPA 4BX8A 4JHRA 3SF4A 2P9LG 3ZEFA 4KVMA 5AENA 4JB8P 3KS2A 4UWFA 4XX5A 5KJKA 4EBAG 1HO8A 4TV3A 2ZGDA 3Q9NC 5D0OD 4JEHA 1TN8A 4U07A 4OAUC 5JJ6A 3B13A 3JXJA 3NF1A 2XEVA 3ZN3A 3FTUA 3AU5A 2J07A 2PZIA 5BNWA 3V30A 2BKGA 3FUNA 3TXMA 3ZXPA 3RRMB 4TXRA 3TWWA 3RKVA 4HOUA 1FT2A 2FEZA 3TWSA 3TWQA 5JJ7A 3MX3A 2XCBA 1MHQA 4BERA 2EIJE 5BXUA 5AARA 2DBAA 1IXVA 2VSOE 2LAIA 4A63B 2XS1A 3ASGA 3C3QA 4J8FA 3NBNB 1S64A 2IQCA 3C98A 3DPDA 3HXEA 3T9KA 3DSXA 3FTYA 5E75A 3PRZA 3V31A 3ONLA 4R7LA 4DX5D 3MGBA 3JCKC 5G05J 4N39A 4GTOA 4I43A 3QB2A 4C48B 3FY4A 2NSZA 3TGOA 4XE0A 1IHBA 1HFAA 4ILHB 2ETCA 1ELWA 4U96D 4JPSA 5DIZA 4MRUA 2KZTB 3MJWA 2WPVA 2OOEA 3NZSA 3LYAA 5EKQD 4UWLA 2FO1E 1K3ZD 4J6IA 3UKUG 2EIME 4J7WA 1JPLA 4TRQA 4RQIA 3FTSA 4DX2A 1H0AA 3FFLA 4LNBA 2YINA 1TNUA 5D0QD 4L23A 3PZDA 4GCNA 3SFYA 5KWDA 5BW8C 4I1OB 3UUXA 1ZBPA 5C1DA 4HLLA 3R9AB 4ANXA 3EHNA 2F37A 4UWKA 3RU0A 2MOWA 3IEGA 2GW1A 2FBNA 4KBQA 2GRPB 3NZUA 3B7TA 1SQMA 1H2VC 1OCZE 4BT9A 3UINC 3S2AA 4A3TA 3LKUA 3ULYA 3DXMG 1FPPA 3ZYQA 3ZYLA 1JUQA 3FU0A 1P5QA 4Q94A 2VGYA 3CHRA 1Z5SC 4G25A 3TAXA 3MKRA 4HLEA 5T3RA 3HDXA 3QDNA 3D9JA 4XI9A 3TWUA 3MV3B 1TNOA 5ENOD 1PY1A 4NQ0A 5CCMA 3PE3A 3E37A 4YDEA 5EIDA 3VLDA 2R02A 5AN8A 2CHWA 3FHEA 3JYSA 1DC2A 5A6CA 2CFZA 3BUAA 4JL0A 3FUHA 3B95A 1JCRA 4BTAA 5CRVA 3IHVA 5FZRA 3GZ1A 3RIBA 2VYIA 3T5VA 3D9LA 1TNYA 3IHYA 4K03A 5AQAA 3EHMA 1XNFA 5FQ8A 4PS3A 2IJGX 5EILA 2WVIA 1YA0A 1TN7A 2XEEA 2P9PG 3AG4E 5CEDB 3W9FA 4JZYA 2V4LA 1K1AA 2V8SE 3TXNA 3RRUA 1N0RA 4RLYA 2WXJA 2X6IA 4I6GA 3APFA 2XRZA 4H7YA 5FQ7A 4HOQA 3J5PA 2XPYA 3DWLG 2JABA 2WM9A 4N3CA 3CKCA 1MQSA 4HVBA 1EDUA 4AY6A 4ATZD 1QNFA 1JWGA 2R2LA 1HG5A 5ARGA 2F8XK 3E32A 3MCXA 3LCAA 4APFA 5IY5E 4DX1A 4GZ5A 4N3BA 3Q7FA 3X2QE 4PH4B 2P9UG 4A1SA 4EZKA 3L9TA 3GW4A 3PE4A 4WWOA 2I6HA 3PH0C 1KT0A 2L6JA 3PVLA 1HZ4A 3FWVA 2J49A 3SFZA 1H6KA 3D9OA 4F53A 2J08A 1NA0A 3FEXA 2H6FA 5G04C 4F1PA 3NB2A 4LCTA 4AV7A 3KAEA 1Y6IA 3HVEA 3ULQA 5CECB 3CQGB 4A55A 1U3DA 1S63A 2L6BA 4HRNA 3SBSA 4M7CA 1HS6A 3QC1A 4AVXA 1N4QA 3CHOA 2PQRA 4AXHA 4N2SA 4IRUA 3B7RL 5EX3A 5J90A 5ANRA 2ZISA 1LD8A 1UOHA 3R7QA 4AP2A 2ETAA 1WDYA 2J4BA 4GTPA 4ILGA 4EBAA 2H6GA 4HI8A 4EZJA 4YDYA 5KCMA 2WXFA 3FUEA 3B7SA 1S70B 1OWNA 4O1PA 3PUKA 3T8MA 2I1KA 4FJZA 2E0IA 5E76A 5CBNA 2WQHA 2C0LA 2BUGA 2IO3C 3SHFA 2IFUA 2A5EA 5AJLA 2R03A 5JHAA 4GTQA 4EZLA 3PZ2A 4Z68A 5FQ4A 3I4RB 1IQRA 5EDSA 3CVLA 2A5UA 1SA5A 1HXIA 1E7UA 4ANUA 3C5RA 5DBKA 1BU9A 3Q75A 3ZGQA 4JHKA 3PZ4A 4GTRA 3FTZA 5HRYA 4JD2G 4IN3B 1BLXB 3V2XA 3W9GA 4J0UA 2XEHA 4GPKA 4NACA 4MBGA 3R7RA 3CVNA 4BX9A 2OCCE 2X6JA 3BG1B 3UIOC 3DPYA 4I1MA 2AW6A 4JXTA 4UI9J 2IF4A 3FH7A 1OCRE 1MX2A 3Q15A 4GA2A 3UX4A 3CHPA 3L6AA 3FH5A 3AS5A 4HRLA 3RJVA 3V79K 1OWOA 2DIWA 3HXCA 4HBDA 4I6EA 3ZYMA 5HQ8A 1OUVA 3PNLB 2P9NG 3UQ3A 4DX7D 3CHSA 4GMRA 2VTBA 1N95A 3SBTB 4GAAA 1N4SA 2EILE 4TUMA 3K9IA 2R17C 1NP7A 4WWPA 4CT4A 2WXLA 5JMND 4I1AA 5HI7A 3AG1E 1Q2ZA 4DRXE 1FVHA 1N54A 1OCCE 3CVQA 1HG2A 3UM1A 2OEWA 3L08A 1EF1C 1G3NB 4GTSA 1UN8A 1UJJA 4YDOA 3Q4AB 5AYWD 1D8DA 3UPVA 2BKKB 4G24A 4JEUA 5ITZF 3FUMA 3J5QB 2C0MA 3EDTB 3FUFA 4L2LA 2ZGGA 2VQ2A 3TWRA 4UQXA 4EHMA 3ZKJA 3DRAA 3I3NA 1N11A 1QQEA 2PQNA 3LY8A 1IKND 3MKQA 1IHGA 2WXNA 3ASHA 2XHEA 1YCSB 2J8SD 1N4PA 1QYMA 3JQ0A 1S0PA 1HH8A 2P2CP 1LF8A 3DSTA 4GYOA 3B7BA 3DEOA
chains in the Genus database with same CATH topology
4O1PA 1MYOA 1N0QA 1BI8B 3TWUA 2ETCA 4U96D 4DX1A 3NOGD 5HKPA 5ENOD 4OAUC 2XENA 4TUMA 5ENTD 1YYHA 3ZNGA 3TWVA 5CBNA 3JXJA 5ENPD 5KNGA 3KEAA 4O1OA 5JMND 2A5EA 4BSZB 4NIKA 3LJNA 2QC9A 3AAAC 2DVWA 3HRAA 4LNUD 1K3ZD 4HQDA 5EIDA 4DRXE 2FO1E 1D9SA 2V5QC 5AN8A 3EU9A 1MX4A 5ENQD 4Z68A 1DC2A 4J7WA 4K5CA 3V30A 4U8YD 1BD8A 5AAOA 3EHRA 4DUIA 2XZTG 4K5AB 3B95A 2BKGA 1TR4A 4DX2A 1YMPA 4UUCA 4DX6D 2AJAA 2MYOA 5AQ9A 4QQIA 5ENSD 4QFVA 2QYJA 3TWXA 5JA4D 3TWWA 3V2OA 1WG0A 3C5RA 1G3NB 1BU9A 5KWDA 3EHQA 2PNNA 1BI7B 5CEAA 3TWSA 5AQAA 2B0OE 5FINA 3TWQA 1MX6A 4HLLA 4ZFHA 2BKKB 5HRYA 2DZNA 3AJIA 5EN5D 4ZHBA 3UTMA 4K5BA 5HS0A 4G8KA 1BLXB 5EILA 4BERA 5ITZF 3IXEA 5CERB 2F8YA 4F1PA 5KBAA 3V2XA 2F37A 5EYPF 3W9GA 5BXUA 5BXOA 2XEEA 2XEHA 3J5QB 5FIOA 5CEDB 5AARA 3UXGA 3JUEA 3W9FA 4HRMB 4U95D 1IXVA 1OT8A 4BESA 2ETBA 4CZ2D 5CECB 1K1BA 2ZGGA 3TWTA 1SVXA 1K1AA 5ENRD 4A63B 3SO8A 1SW6A 4B93B 2L6BA 4HRNA 4U8VD 3ZUVB 4HI9A 2KBXA 1N0RA 4GPMA 2KXPC 4RLYA 3TWRA 2VGEA 3Q9UC 3NBNB 4BETA 2RFAA 3ZKJA 4O60A 2HE0A 1DCQA 2Y1LE 1N11A 5EIBE 3F6QA 4HNAD 1NFIE 2NYJA 3D9HA 3NOCD 2XZDG 1MX2A 1UOHA 1IKND 3T9KA 4CYMD 3T8KA 4OAVB 2ETAA 2Y0BG 3J5PA 4YDWA 1WDYA 5KNHD 3DEPA 1AWCB 1MJ0A 4BEPA 4JB8P 3V31A 2JABA 3HG0D 1OY3D 2DZOA 2RFMA 4HRLA 3ZU7B 4DX5D 2V4HC 5AQBA 4LG6A 2DWZA 3V79K 1YCSB 1AP7A 5CBOA 4HI8A 2J8SD 4HBDA 1QYMA 4ATZD 5D66A 4YDYA 2P2CP 1A5EA 4J8YA 5AQ7A 4C48B 3UI2A 4N5QA 2F8XK 4DX7D 4G8LA 4HB5A 2ZGDA 3B7BA 5EYLA 3Q9NC 4LSZE 4GMRA 3JXIA 1S70B 3DEOA 1IHBA 4F6RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O1P A;  1MYO A;  1N0Q A;  1BI8 B;  3TWU A;  2ETC A;  4U96 D;  4DX1 A;  3NOG D;  5HKP A;  5ENO D;  4OAU C;  2XEN A;  4TUM A;  5ENT D;  1YYH A;  3ZNG A;  3TWV A;  5CBN A;  3JXJ A;  5ENP D;  5KNG A;  3KEA A;  4O1O A;  5JMN D;  2A5E A;  4BSZ B;  4NIK A;  3LJN A;  2QC9 A;  3AAA C;  2DVW A;  3HRA A;  4LNU D;  1K3Z D;  4HQD A;  5EID A;  4DRX E;  2FO1 E;  1D9S A;  2V5Q C;  5AN8 A;  3EU9 A;  1MX4 A;  5ENQ D;  4Z68 A;  1DC2 A;  4J7W A;  4K5C A;  3V30 A;  4U8Y D;  1BD8 A;  5AAO A;  3EHR A;  4DUI A;  2XZT G;  4K5A B;  3B95 A;  2BKG A;  1TR4 A;  4DX2 A;  1YMP A;  4UUC A;  4DX6 D;  2AJA A;  2MYO A;  5AQ9 A;  4QQI A;  5ENS D;  4QFV A;  2QYJ A;  3TWX A;  5JA4 D;  3TWW A;  3V2O A;  1WG0 A;  3C5R A;  1G3N B;  1BU9 A;  5KWD A;  3EHQ A;  2PNN A;  1BI7 B;  5CEA A;  3TWS A;  5AQA A;  2B0O E;  5FIN A;  3TWQ A;  1MX6 A;  4HLL A;  4ZFH A;  2BKK B;  5HRY A;  2DZN A;  3AJI A;  5EN5 D;  4ZHB A;  3UTM A;  4K5B A;  5HS0 A;  4G8K A;  1BLX B;  5EIL A;  4BER A;  5ITZ F;  3IXE A;  5CER B;  2F8Y A;  4F1P A;  5KBA A;  3V2X A;  2F37 A;  5EYP F;  3W9G A;  5BXU A;  5BXO A;  2XEE A;  2XEH A;  3J5Q B;  5FIO A;  5CED B;  5AAR A;  3UXG A;  3JUE A;  3W9F A;  4HRM B;  4U95 D;  1IXV A;  1OT8 A;  4BES A;  2ETB A;  4CZ2 D;  5CEC B;  1K1B A;  2ZGG A;  3TWT A;  1SVX A;  1K1A A;  5ENR D;  4A63 B;  3SO8 A;  1SW6 A;  4B93 B;  2L6B A;  4HRN A;  4U8V D;  3ZUV B;  4HI9 A;  2KBX A;  1N0R A;  4GPM A;  2KXP C;  4RLY A;  3TWR A;  2VGE A;  3Q9U C;  3NBN B;  4BET A;  2RFA A;  3ZKJ A;  4O60 A;  2HE0 A;  1DCQ A;  2Y1L E;  1N11 A;  5EIB E;  3F6Q A;  4HNA D;  1NFI E;  2NYJ A;  3D9H A;  3NOC D;  2XZD G;  1MX2 A;  1UOH A;  1IKN D;  3T9K A;  4CYM D;  3T8K A;  4OAV B;  2ETA A;  2Y0B G;  3J5P A;  4YDW A;  1WDY A;  5KNH D;  3DEP A;  1AWC B;  1MJ0 A;  4BEP A;  4JB8 P;  3V31 A;  2JAB A;  3HG0 D;  1OY3 D;  2DZO A;  2RFM A;  4HRL A;  3ZU7 B;  4DX5 D;  2V4H C;  5AQB A;  4LG6 A;  2DWZ A;  3V79 K;  1YCS B;  1AP7 A;  5CBO A;  4HI8 A;  2J8S D;  4HBD A;  1QYM A;  4ATZ D;  5D66 A;  4YDY A;  2P2C P;  1A5E A;  4J8Y A;  5AQ7 A;  4C48 B;  3UI2 A;  4N5Q A;  2F8X K;  4DX7 D;  4G8L A;  4HB5 A;  2ZGD A;  3B7B A;  5EYL A;  3Q9N C;  4LSZ E;  4GMR A;  3JXI A;  1S70 B;  3DEO A;  1IHB A;  4F6R D; 
#chains in the Genus database with same CATH topology
 2P9K G;  3DBS A;  3HXD A;  4GZC A;  3FTW A;  4NIK A;  2DYS E;  3ASD A;  2WXK A;  3L82 A;  5ENQ D;  3QWP A;  3DSV A;  2BF0 X;  5ANL A;  3QOU A;  1Z3Y A;  3CST A;  2XZT G;  4M3O A;  1YMP A;  3CEQ A;  4WUY A;  2H6I A;  1FCH A;  3HXF A;  3CVP A;  1NI1 A;  3FP3 A;  2P9S G;  3SI5 A;  4L9P A;  4GZ6 A;  4BWR A;  2R05 A;  1TYQ G;  5LCW C;  4Y6C A;  2AWI A;  3KEZ A;  5FIN A;  3PRE A;  3OTN A;  5EN5 D;  3LJ3 A;  3S7F A;  2LSV A;  4RG6 A;  3HYM B;  3EJN A;  3MYV A;  2ZU6 B;  3OXG A;  2DCP A;  3L54 A;  4XZ4 A;  5AIJ A;  5BV0 A;  3TWT A;  4HOS A;  3ZUV B;  3Q9U C;  1E8X A;  2IEJ A;  4ATG A;  3HVE B;  4U0S A;  2P9I G;  4BT8 A;  2VSN A;  2XPZ A;  3NOC D;  1HU3 A;  3ISM C;  5JHB A;  2OV8 A;  2WXI A;  3EU5 A;  3L17 A;  3Q7A A;  5BPP A;  4L7T A;  2YHC A;  3U64 A;  3CKB A;  3FUD A;  5KJN A;  1O1R A;  1E96 B;  3RO3 A;  2ZXW E;  3P1U A;  3JXI A;  2GRR B;  5EYP F;  2WXP A;  4JA9 A;  5HKP A;  1Y8M A;  4ACK A;  3L22 A;  2KM4 A;  1B89 A;  4BSZ B;  3VLF A;  4RVB A;  4G11 A;  4U7E B;  2IOS A;  3EHR A;  4N3A A;  4WWN A;  4JVS A;  5LX8 A;  2MYO A;  3T5X A;  4QFV A;  2LO6 A;  4FP7 A;  4MLP A;  5FTP A;  2VSY A;  3EHQ A;  1BI7 B;  3TG4 A;  3ABM E;  3R9M A;  5BXO A;  4C0E A;  5ENN A;  1K1B A;  5FZS A;  1SVX A;  3Q78 A;  2P58 C;  3KSL A;  4K0R A;  4AY5 A;  3IBE A;  2RFA A;  2VGX B;  3CR3 A;  3PEV B;  4B94 A;  1VDY A;  4AOF A;  3FH8 A;  3MA5 A;  2WMN A;  2XGO A;  2QZA A;  4EPZ A;  4KZC A;  4U63 A;  3QNK A;  5A23 A;  2DZO A;  1KT1 A;  4GYW A;  4C9B B;  1UJK A;  5CBO A;  4KVO A;  4A1G A;  5AQ7 A;  4HXI A;  3UI2 A;  4N5Q A;  3QWV A;  4HB5 A;  5G05 C;  2LNI A;  3HXB A;  2I1J A;  1N0Q A;  1H6P A;  5T4Y A;  3G2W A;  4J8E A;  4XKB A;  1O5M A;  3NOG D;  2FI7 A;  3NQP A;  3U4T A;  3LPZ A;  2VTB B;  4JC8 A;  3PZ3 A;  3GZ2 A;  4LNU D;  3LY9 A;  1BPO A;  4URK A;  4KT6 B;  2WXM A;  4XI0 A;  5B3S E;  1E8W A;  2EIN E;  3ZXS A;  4APO A;  4KYO B;  3Q49 B;  3RRN B;  5LP0 A;  5KJL A;  2X6F A;  3PNT B;  4LNG A;  1RZ4 A;  1XGW A;  4BY6 A;  3ENE A;  3FU3 A;  4E6H A;  3AS4 A;  4JHJ A;  2UWJ G;  2WQ6 A;  4ABN A;  1SW6 A;  4N2Q A;  4KMO A;  1OWP A;  4LRZ A;  3AS8 A;  1A17 A;  1TJF A;  3C3O A;  2NC9 A;  4AEZ C;  2IY0 C;  3F6Q A;  4HNA D;  2ION A;  1L5J A;  3E34 A;  2I9C A;  3VTX A;  4JA7 A;  2JEK A;  3ZU7 B;  2GRL A;  3MKQ B;  2B6C A;  4BSX A;  4TXP A;  1KLX A;  3C3R A;  4G23 A;  3UT7 A;  1E7V A;  4FLH A;  1BI8 B;  3RO2 A;  1Z3X A;  3D9M A;  3TL5 A;  3CIA A;  3N71 A;  1N9A A;  1UN9 A;  1H2U A;  2Y3A A;  4DLO A;  3BQO A;  3BG0 B;  5FWQ A;  5B1A E;  3CVU A;  4DUI A;  2XCC A;  4UUC A;  3QKY A;  1N52 A;  2J09 A;  2Q7F A;  3UM3 A;  4GZ3 A;  3ZRH A;  2AXV A;  4G1T A;  2RKK A;  3ZPJ A;  4G26 A;  2AXZ A;  1N94 A;  1TNZ A;  4YVO A;  1O1S A;  1E8Y A;  2RG8 A;  1N4R A;  2DYR E;  5D2M C;  4B0Z A;  1GW6 A;  2MHK A;  4BES A;  4I2Z A;  4BFR A;  1U3C A;  2OVB A;  4FUL A;  4HI9 A;  2OND A;  2VGE A;  4FA6 A;  5C2Y A;  3Q47 B;  3CVW A;  3APC A;  5EIB E;  3CSF A;  1TEZ A;  2XZD G;  4P29 A;  1JCS A;  2UY1 A;  4N5C A;  2Y0B G;  4FHK A;  2VGX A;  4CDR A;  4RSY A;  4DI4 A;  4ANV A;  3HIZ A;  3CVY A;  1DCE A;  5CRU A;  3VTY A;  4A3V A;  3L16 A;  4J8Y A;  3CVX A;  2HYZ A;  2Y4U A;  5EYL A;  3S7B A;  3LY7 A;  4FC8 A;  2IU1 A;  3FTX A;  4PS7 A;  2HM8 A;  2DVW A;  3G2V A;  1KPS B;  4C0M A;  1OWL A;  1BD8 A;  3CGH A;  1SZ9 A;  2AJA A;  4QQI A;  3WG7 E;  4O6F A;  3HHM A;  5JA4 D;  4U04 A;  4GMJ A;  2XGM A;  2PNN A;  4TXQ A;  3OXF A;  4B8C B;  2OVF A;  2WXO A;  4KZ0 A;  3SZ7 A;  4H7X A;  5CER B;  2F8Y A;  2L9B A;  4WNG A;  4CEM A;  2PL2 A;  2FO7 A;  2FUL A;  3ML8 A;  3ESL A;  1QZ2 A;  2ETB A;  4PDX A;  3SO8 A;  1PAQ A;  2NXP A;  4U8V D;  4XKC A;  5T8I A;  3RK6 A;  3CK7 A;  4B89 A;  3L13 A;  4G2V A;  4WND A;  2RD0 A;  1NZN A;  3EIQ C;  4NRH B;  4KXK B;  4AIF A;  2J4D A;  2MRI A;  4FJY A;  2FF4 A;  4J8S A;  4Y6W A;  4CYM D;  2KAT A;  3GYZ A;  2A4Z A;  3CV0 A;  3DEP A;  3HG0 D;  4GTV A;  4LG6 A;  2DWZ A;  1AP7 A;  4F1S A;  1U2V G;  3PUJ A;  4DJA A;  4LSZ E;  4GB9 A;  1O1T A;  1HE8 A;  1HF8 A;  2LSU A;  3ZFW A;  1JCQ A;  3Q5M A;  4OVU A;  3TWV A;  5ARF A;  3KEA A;  4DLQ A;  2V5Q C;  4FU3 A;  1WM5 A;  2AXU A;  3OXL A;  1NA3 A;  2XGS A;  2X6H A;  2LXL A;  1RW2 A;  3U9W A;  3DSU A;  3CLJ A;  4NUR A;  4V3I A;  3SY2 A;  1WG0 A;  2GRM A;  4GA0 A;  3I5P A;  2CFU A;  5A7D B;  4J8D A;  5CEA A;  4AM9 A;  1WAO 1;  3CVV A;  2WB2 A;  3JQ1 A;  4ZHB A;  5CHE E;  4MS6 A;  1HX8 A;  3CHM A;  3RAU A;  2VSX E;  2XRY A;  2X6K A;  3LVQ E;  4HRM B;  4U95 D;  5BV1 A;  3UMV A;  2V0P A;  2CHZ A;  4WAF A;  4BET A;  4GTM A;  3IV0 A;  3MZL B;  3EUV A;  3LS8 A;  2GRN B;  2NYJ A;  3ASO E;  3IKO B;  2OEV A;  3CK8 A;  4UI9 C;  2CG3 A;  1AWC B;  4BEP A;  4GML A;  2V4H C;  4I6J A;  2QYU A;  3ULE G;  4RG9 A;  1TNB A;  4W9R A;  5BT1 A;  3E30 A;  4F7A A;  4G8L A;  3LVR E;  3B7U X;  1X81 A;  4F6R D;  1MYO A;  3DSW A;  5FZQ A;  5ENT D;  3WXX A;  3ASF A;  4CT0 A;  2XS8 A;  3LJN A;  3QAR A;  2QC9 A;  3AAA C;  3HRA A;  1H2T C;  3PS6 A;  3EU9 A;  3Q79 A;  3URZ A;  4U8Y D;  5AAO A;  3E4B A;  2XQ0 A;  2CG2 A;  5ENS D;  4D10 C;  2QYJ A;  5AJD A;  5G04 J;  3V2O A;  3ABK E;  2H6H A;  4CGW A;  3FEY A;  2WQ7 A;  3UKR G;  3VLE A;  4HFG A;  2C2L A;  3AJI A;  5HS0 A;  4GCO A;  2F0Y A;  4GZD A;  4LUN U;  4HOR A;  1TN6 A;  2E2E A;  2HR2 A;  2L0I A;  3JUE A;  3U3W A;  3ZHE A;  2ILR A;  1KZO A;  1IQU A;  2HE0 A;  3PZ1 A;  2Y1L E;  1H6O A;  3QJZ A;  2KC7 A;  3T8K A;  3SD5 A;  2L0T B;  1ZU2 A;  1ELR A;  3FU6 A;  2LXM A;  4U0U A;  4YDW A;  4AJW A;  1UW4 B;  1MJ0 A;  1LD7 A;  5AQB A;  1OCO E;  2UY1 B;  3P2B A;  4JW1 A;  1X5B A;  1A5E A;  2M63 A;  1JWF A;  4ANW A;  2CHX A;  3E33 A;  2PM6 A;  4LEU A;  3LEW A;  1UG3 A;  4OVV A;  4Q69 A;  3D9I A;  3KSQ A;  3G2S A;  3QWW A;  3ZNG A;  5CMY A;  4O1O A;  3QK0 A;  3O4Z A;  3CK9 A;  2Y69 E;  3CHQ A;  2GRO B;  4EEC A;  3ABL E;  1MX4 A;  4DI3 A;  4I2W A;  2BED A;  5G2N A;  4K5A B;  5AQ9 A;  3OAW A;  2YHE A;  2KCL A;  1FT1 A;  2XPI A;  3UM2 A;  5LOZ A;  2HO1 A;  4CDN A;  3D3M A;  4ME2 A;  2IOL A;  3ZW3 A;  1MX6 A;  2EIK E;  3ASN E;  4LER A;  5J08 A;  1PC2 A;  1OWM A;  3UTM A;  4G8K A;  4CGV A;  1DNP A;  3UXG A;  3DSS A;  3PEU B;  1OT8 A;  2WXQ A;  5EX0 A;  4E85 A;  4WNE A;  4F3V A;  2IO2 C;  4ILI A;  3ZIM A;  4PUC A;  5LFA A;  1K8K G;  3GZS A;  3I4G A;  5FJY A;  1NFI E;  4I9E A;  3UT4 A;  4DPR A;  5M72 A;  1QBQ A;  2QY7 A;  1DVP A;  1OY3 D;  2RFM A;  3FUK A;  2JLB A;  1KZP A;  2GGF A;  3LXU X;  4HS2 A;  5D66 A;  2WMO A;  3SFX A;  1H19 A;  2KZT A;  4B8A A;  3ONK A;  2J9Q A;  4I17 A;  1EYH A;  3S7J A;  4HOT A;  2XEN A;  3BEE A;  1YYH A;  2GRQ B;  5ENP D;  4XEI G;  3ZYK A;  5CMW A;  2YNQ A;  3TJP A;  3AU4 A;  3Q73 A;  2I2O A;  4UWG A;  3FTV A;  4X8Q A;  2R5S A;  3ML9 A;  2R59 A;  4IYP A;  3BU8 A;  3FDH A;  3FU5 A;  4UQZ A;  1V54 E;  4DX6 D;  3MV2 B;  2VJ8 A;  4CRW A;  3SNX A;  2V5F A;  4U0Z A;  4UI9 K;  3PDN A;  2WXG A;  2KCK A;  4Q96 A;  3TWX A;  1NL4 A;  3D9N A;  5G55 A;  4CCA A;  4FLB A;  4ZFH A;  3KD7 A;  4OYS A;  5B1B E;  2Y4T A;  4WNF A;  5FIO A;  5H7P A;  4CZ2 D;  3ZVV A;  1EPU A;  3JUI A;  2WXH A;  3D9K A;  2KXP C;  3C72 A;  3SQV A;  1DCQ A;  4DK5 A;  1ELK A;  3LDZ A;  3D9H A;  3DXK G;  3ESK A;  1OXJ A;  4TUU A;  3D9P A;  2X38 A;  4OAV B;  2YQ8 A;  3O48 A;  3G2U A;  1SA4 A;  4GYY A;  3SGH A;  5KNH D;  3S7D A;  4IUL A;  3QAQ A;  3AG3 E;  1WY6 A;  3TG5 A;  1INZ A;  3FUJ A;  4U8H A;  5JJT A;  3MEK A;  2WXR A;  3G2T A;  4GU5 A;  3FUI A;  4UQY A;  2X3M A;  4YVQ C;  4GTT A;  2ZIR A;  4XIF A;  3UM0 A;  5KNG A;  4EQF A;  4YND A;  4HQD A;  1D9S A;  2LAH A;  1MZC A;  4UWH A;  1V55 E;  2PM7 A;  5BUZ A;  3U66 A;  1SZA A;  1W3B A;  3EIJ A;  5CCL A;  4K5C A;  4PS8 A;  3AG2 E;  1TR4 A;  5LCW J;  3UIP C;  3RSE G;  5FQ6 A;  1FVF A;  1TJC A;  2KCV A;  4GA1 A;  3FUL A;  4FAD A;  5FT9 A;  1LTX A;  4MKT A;  2B0O E;  4ACL A;  3CQC B;  1D8E A;  2DZN A;  4BTB A;  4K5B A;  3IXE A;  2QFC A;  5KBA A;  2EQX A;  4L2Y A;  4FHJ A;  5KJM A;  3UT8 A;  4I9C A;  4L1B A;  3APD A;  5ENR D;  1Z6T A;  2BTD A;  4B93 B;  2KBX A;  4GPM A;  2LUH A;  1E8Z A;  4O60 A;  4CDM A;  1IYG A;  1E90 A;  3ZHE B;  3NAW A;  1ZB1 A;  2AVP A;  4BX8 A;  4JHR A;  3SF4 A;  2P9L G;  3ZEF A;  4KVM A;  5AEN A;  4JB8 P;  3KS2 A;  4UWF A;  4XX5 A;  5KJK A;  4EBA G;  1HO8 A;  4TV3 A;  2ZGD A;  3Q9N C;  5D0O D;  4JEH A;  1TN8 A;  4U07 A;  4OAU C;  5JJ6 A;  3B13 A;  3JXJ A;  3NF1 A;  2XEV A;  3ZN3 A;  3FTU A;  3AU5 A;  2J07 A;  2PZI A;  5BNW A;  3V30 A;  2BKG A;  3FUN A;  3TXM A;  3ZXP A;  3RRM B;  4TXR A;  3TWW A;  3RKV A;  4HOU A;  1FT2 A;  2FEZ A;  3TWS A;  3TWQ A;  5JJ7 A;  3MX3 A;  2XCB A;  1MHQ A;  4BER A;  2EIJ E;  5BXU A;  5AAR A;  2DBA A;  1IXV A;  2VSO E;  2LAI A;  4A63 B;  2XS1 A;  3ASG A;  3C3Q A;  4J8F A;  3NBN B;  1S64 A;  2IQC A;  3C98 A;  3DPD A;  3HXE A;  3T9K A;  3DSX A;  3FTY A;  5E75 A;  3PRZ A;  3V31 A;  3ONL A;  4R7L A;  4DX5 D;  3MGB A;  3JCK C;  5G05 J;  4N39 A;  4GTO A;  4I43 A;  3QB2 A;  4C48 B;  3FY4 A;  2NSZ A;  3TGO A;  4XE0 A;  1IHB A;  1HFA A;  4ILH B;  2ETC A;  1ELW A;  4U96 D;  4JPS A;  5DIZ A;  4MRU A;  2KZT B;  3MJW A;  2WPV A;  2OOE A;  3NZS A;  3LYA A;  5EKQ D;  4UWL A;  2FO1 E;  1K3Z D;  4J6I A;  3UKU G;  2EIM E;  4J7W A;  1JPL A;  4TRQ A;  4RQI A;  3FTS A;  4DX2 A;  1H0A A;  3FFL A;  4LNB A;  2YIN A;  1TNU A;  5D0Q D;  4L23 A;  3PZD A;  4GCN A;  3SFY A;  5KWD A;  5BW8 C;  4I1O B;  3UUX A;  1ZBP A;  5C1D A;  4HLL A;  3R9A B;  4ANX A;  3EHN A;  2F37 A;  4UWK A;  3RU0 A;  2MOW A;  3IEG A;  2GW1 A;  2FBN A;  4KBQ A;  2GRP B;  3NZU A;  3B7T A;  1SQM A;  1H2V C;  1OCZ E;  4BT9 A;  3UIN C;  3S2A A;  4A3T A;  3LKU A;  3ULY A;  3DXM G;  1FPP A;  3ZYQ A;  3ZYL A;  1JUQ A;  3FU0 A;  1P5Q A;  4Q94 A;  2VGY A;  3CHR A;  1Z5S C;  4G25 A;  3TAX A;  3MKR A;  4HLE A;  5T3R A;  3HDX A;  3QDN A;  3D9J A;  4XI9 A;  3TWU A;  3MV3 B;  1TNO A;  5ENO D;  1PY1 A;  4NQ0 A;  5CCM A;  3PE3 A;  3E37 A;  4YDE A;  5EID A;  3VLD A;  2R02 A;  5AN8 A;  2CHW A;  3FHE A;  3JYS A;  1DC2 A;  5A6C A;  2CFZ A;  3BUA A;  4JL0 A;  3FUH A;  3B95 A;  1JCR A;  4BTA A;  5CRV A;  3IHV A;  5FZR A;  3GZ1 A;  3RIB A;  2VYI A;  3T5V A;  3D9L A;  1TNY A;  3IHY A;  4K03 A;  5AQA A;  3EHM A;  1XNF A;  5FQ8 A;  4PS3 A;  2IJG X;  5EIL A;  2WVI A;  1YA0 A;  1TN7 A;  2XEE A;  2P9P G;  3AG4 E;  5CED B;  3W9F A;  4JZY A;  2V4L A;  1K1A A;  2V8S E;  3TXN A;  3RRU A;  1N0R A;  4RLY A;  2WXJ A;  2X6I A;  4I6G A;  3APF A;  2XRZ A;  4H7Y A;  5FQ7 A;  4HOQ A;  3J5P A;  2XPY A;  3DWL G;  2JAB A;  2WM9 A;  4N3C A;  3CKC A;  1MQS A;  4HVB A;  1EDU A;  4AY6 A;  4ATZ D;  1QNF A;  1JWG A;  2R2L A;  1HG5 A;  5ARG A;  2F8X K;  3E32 A;  3MCX A;  3LCA A;  4APF A;  5IY5 E;  4DX1 A;  4GZ5 A;  4N3B A;  3Q7F A;  3X2Q E;  4PH4 B;  2P9U G;  4A1S A;  4EZK A;  3L9T A;  3GW4 A;  3PE4 A;  4WWO A;  2I6H A;  3PH0 C;  1KT0 A;  2L6J A;  3PVL A;  1HZ4 A;  3FWV A;  2J49 A;  3SFZ A;  1H6K A;  3D9O A;  4F53 A;  2J08 A;  1NA0 A;  3FEX A;  2H6F A;  5G04 C;  4F1P A;  3NB2 A;  4LCT A;  4AV7 A;  3KAE A;  1Y6I A;  3HVE A;  3ULQ A;  5CEC B;  3CQG B;  4A55 A;  1U3D A;  1S63 A;  2L6B A;  4HRN A;  3SBS A;  4M7C A;  1HS6 A;  3QC1 A;  4AVX A;  1N4Q A;  3CHO A;  2PQR A;  4AXH A;  4N2S A;  4IRU A;  3B7R L;  5EX3 A;  5J90 A;  5ANR A;  2ZIS A;  1LD8 A;  1UOH A;  3R7Q A;  4AP2 A;  2ETA A;  1WDY A;  2J4B A;  4GTP A;  4ILG A;  4EBA A;  2H6G A;  4HI8 A;  4EZJ A;  4YDY A;  5KCM A;  2WXF A;  3FUE A;  3B7S A;  1S70 B;  1OWN A;  4O1P A;  3PUK A;  3T8M A;  2I1K A;  4FJZ A;  2E0I A;  5E76 A;  5CBN A;  2WQH A;  2C0L A;  2BUG A;  2IO3 C;  3SHF A;  2IFU A;  2A5E A;  5AJL A;  2R03 A;  5JHA A;  4GTQ A;  4EZL A;  3PZ2 A;  4Z68 A;  5FQ4 A;  3I4R B;  1IQR A;  5EDS A;  3CVL A;  2A5U A;  1SA5 A;  1HXI A;  1E7U A;  4ANU A;  3C5R A;  5DBK A;  1BU9 A;  3Q75 A;  3ZGQ A;  4JHK A;  3PZ4 A;  4GTR A;  3FTZ A;  5HRY A;  4JD2 G;  4IN3 B;  1BLX B;  3V2X A;  3W9G A;  4J0U A;  2XEH A;  4GPK A;  4NAC A;  4MBG A;  3R7R A;  3CVN A;  4BX9 A;  2OCC E;  2X6J A;  3BG1 B;  3UIO C;  3DPY A;  4I1M A;  2AW6 A;  4JXT A;  4UI9 J;  2IF4 A;  3FH7 A;  1OCR E;  1MX2 A;  3Q15 A;  4GA2 A;  3UX4 A;  3CHP A;  3L6A A;  3FH5 A;  3AS5 A;  4HRL A;  3RJV A;  3V79 K;  1OWO A;  2DIW A;  3HXC A;  4HBD A;  4I6E A;  3ZYM A;  5HQ8 A;  1OUV A;  3PNL B;  2P9N G;  3UQ3 A;  4DX7 D;  3CHS A;  4GMR A;  2VTB A;  1N95 A;  3SBT B;  4GAA A;  1N4S A;  2EIL E;  4TUM A;  3K9I A;  2R17 C;  1NP7 A;  4WWP A;  4CT4 A;  2WXL A;  5JMN D;  4I1A A;  5HI7 A;  3AG1 E;  1Q2Z A;  4DRX E;  1FVH A;  1N54 A;  1OCC E;  3CVQ A;  1HG2 A;  3UM1 A;  2OEW A;  3L08 A;  1EF1 C;  1G3N B;  4GTS A;  1UN8 A;  1UJJ A;  4YDO A;  3Q4A B;  5AYW D;  1D8D A;  3UPV A;  2BKK B;  4G24 A;  4JEU A;  5ITZ F;  3FUM A;  3J5Q B;  2C0M A;  3EDT B;  3FUF A;  4L2L A;  2ZGG A;  2VQ2 A;  3TWR A;  4UQX A;  4EHM A;  3ZKJ A;  3DRA A;  3I3N A;  1N11 A;  1QQE A;  2PQN A;  3LY8 A;  1IKN D;  3MKQ A;  1IHG A;  2WXN A;  3ASH A;  2XHE A;  1YCS B;  2J8S D;  1N4P A;  1QYM A;  3JQ0 A;  1S0P A;  1HH8 A;  2P2C P;  1LF8 A;  3DST A;  4GYO A;  3B7B A;  3DEO A; 
#chains in the Genus database with same CATH homology
 4O1P A;  1MYO A;  1N0Q A;  1BI8 B;  3TWU A;  2ETC A;  4U96 D;  4DX1 A;  3NOG D;  5HKP A;  5ENO D;  4OAU C;  2XEN A;  4TUM A;  5ENT D;  1YYH A;  3ZNG A;  3TWV A;  5CBN A;  3JXJ A;  5ENP D;  5KNG A;  3KEA A;  4O1O A;  5JMN D;  2A5E A;  4BSZ B;  4NIK A;  3LJN A;  2QC9 A;  3AAA C;  2DVW A;  3HRA A;  4LNU D;  1K3Z D;  4HQD A;  5EID A;  4DRX E;  2FO1 E;  1D9S A;  2V5Q C;  5AN8 A;  3EU9 A;  1MX4 A;  5ENQ D;  4Z68 A;  1DC2 A;  4J7W A;  4K5C A;  3V30 A;  4U8Y D;  1BD8 A;  5AAO A;  3EHR A;  4DUI A;  2XZT G;  4K5A B;  3B95 A;  2BKG A;  1TR4 A;  4DX2 A;  1YMP A;  4UUC A;  4DX6 D;  2AJA A;  2MYO A;  5AQ9 A;  4QQI A;  5ENS D;  4QFV A;  2QYJ A;  3TWX A;  5JA4 D;  3TWW A;  3V2O A;  1WG0 A;  3C5R A;  1G3N B;  1BU9 A;  5KWD A;  3EHQ A;  2PNN A;  1BI7 B;  5CEA A;  3TWS A;  5AQA A;  2B0O E;  5FIN A;  3TWQ A;  1MX6 A;  4HLL A;  4ZFH A;  2BKK B;  5HRY A;  2DZN A;  3AJI A;  5EN5 D;  4ZHB A;  3UTM A;  4K5B A;  5HS0 A;  4G8K A;  1BLX B;  5EIL A;  4BER A;  5ITZ F;  3IXE A;  5CER B;  2F8Y A;  4F1P A;  5KBA A;  3V2X A;  2F37 A;  5EYP F;  3W9G A;  5BXU A;  5BXO A;  2XEE A;  2XEH A;  3J5Q B;  5FIO A;  5CED B;  5AAR A;  3UXG A;  3JUE A;  3W9F A;  4HRM B;  4U95 D;  1IXV A;  1OT8 A;  4BES A;  2ETB A;  4CZ2 D;  5CEC B;  1K1B A;  2ZGG A;  3TWT A;  1SVX A;  1K1A A;  5ENR D;  4A63 B;  3SO8 A;  1SW6 A;  4B93 B;  2L6B A;  4HRN A;  4U8V D;  3ZUV B;  4HI9 A;  2KBX A;  1N0R A;  4GPM A;  2KXP C;  4RLY A;  3TWR A;  2VGE A;  3Q9U C;  3NBN B;  4BET A;  2RFA A;  3ZKJ A;  4O60 A;  2HE0 A;  1DCQ A;  2Y1L E;  1N11 A;  5EIB E;  3F6Q A;  4HNA D;  1NFI E;  2NYJ A;  3D9H A;  3NOC D;  2XZD G;  1MX2 A;  1UOH A;  1IKN D;  3T9K A;  4CYM D;  3T8K A;  4OAV B;  2ETA A;  2Y0B G;  3J5P A;  4YDW A;  1WDY A;  5KNH D;  3DEP A;  1AWC B;  1MJ0 A;  4BEP A;  4JB8 P;  3V31 A;  2JAB A;  3HG0 D;  1OY3 D;  2DZO A;  2RFM A;  4HRL A;  3ZU7 B;  4DX5 D;  2V4H C;  5AQB A;  4LG6 A;  2DWZ A;  3V79 K;  1YCS B;  1AP7 A;  5CBO A;  4HI8 A;  2J8S D;  4HBD A;  1QYM A;  4ATZ D;  5D66 A;  4YDY A;  2P2C P;  1A5E A;  4J8Y A;  5AQ7 A;  4C48 B;  3UI2 A;  4N5Q A;  2F8X K;  4DX7 D;  4G8L A;  4HB5 A;  2ZGD A;  3B7B A;  5EYL A;  3Q9N C;  4LSZ E;  4GMR A;  3JXI A;  1S70 B;  3DEO A;  1IHB A;  4F6R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...