4J93A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bi-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Discovery of Novel Small-Molecule HIV-1 Replication Inhibitors That Stabilize Capsid Complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/viral protein inhibitor
total genus 50
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4j93A00
4INBA 4U0AA 1M9EC 4HTWA 2EIAA 4E91A 4J93A 4XRQA 1D1DA 1P7NA 1M9DC 2PWOA 2XGYA 4PH3A 4PH0A 5HGOA 2WLVA 3H4EA 1QRJA 4DGAC 4LQWC 1L6NA 2Y4ZA 4DGEC 3P05A 4XFZA 2PWMA 4U0BA 1M9YC 1M9XC 2X2DD 2JPRA 4B4NA 2V4XA 4XROA 4PH2A 2PXRC 3BP9A 3H47A 4U0FA 4XFXA 3NTEA 1GWPA 1E6JP 1AFVA 2WLVB 1EIAA 1M9CC 2M8LA 3MGEA 2GONA 4QNBA 2M8PA 1U7KA 5HGMA 4NX4C 2KGFA 4XFYA 1EM9A 1M9FC 2XGUA 4WYMA 1AK4C 2M8NA 5JPAA 2X82A 2X83A 2GOLB 4U0CA 2LF4A 4U0DA 1G03A 5HGKA 2XDEA 5HGLA 4E92A 2XGVA 5HGNA 4U0EA
chains in the Genus database with same CATH superfamily
4INBA 4U0AA 1M9EC 4HTWA 2EIAA 4E91A 4J93A 4XRQA 1D1DA 1P7NA 1M9DC 2PWOA 2XGYA 4PH3A 4PH0A 5HGOA 2WLVA 3H4EA 1QRJA 4DGAC 4LQWC 1L6NA 2Y4ZA 4DGEC 3P05A 4XFZA 2PWMA 4U0BA 1M9YC 1M9XC 2X2DD 2JPRA 4B4NA 2V4XA 4XROA 4PH2A 2PXRC 3BP9A 3H47A 4U0FA 4XFXA 3NTEA 1GWPA 1E6JP 1AFVA 2WLVB 1EIAA 1M9CC 2M8LA 3MGEA 2GONA 4QNBA 2M8PA 1U7KA 5HGMA 4NX4C 2KGFA 4XFYA 1EM9A 1M9FC 2XGUA 4WYMA 1AK4C 2M8NA 5JPAA 2X82A 2X83A 2GOLB 4U0CA 2LF4A 4U0DA 1G03A 5HGKA 2XDEA 5HGLA 4E92A 2XGVA 5HGNA 4U0EA
chains in the Genus database with same CATH topology
4INBA 4U0AA 1M9EC 4HTWA 2EIAA 4E91A 4J93A 4XRQA 1D1DA 1P7NA 1M9DC 2PWOA 2XGYA 4PH3A 4PH0A 5HGOA 2WLVA 3H4EA 1QRJA 4DGAC 4LQWC 1L6NA 2Y4ZA 4DGEC 3P05A 4XFZA 2PWMA 4U0BA 1M9YC 1M9XC 2X2DD 2JPRA 4B4NA 2V4XA 4XROA 4PH2A 2PXRC 3BP9A 3H47A 4U0FA 4XFXA 3NTEA 1GWPA 1E6JP 1AFVA 2WLVB 1EIAA 1M9CC 2M8LA 3MGEA 2GONA 4QNBA 2M8PA 1U7KA 5HGMA 4NX4C 2KGFA 4XFYA 1EM9A 1M9FC 2XGUA 4WYMA 1AK4C 2M8NA 5JPAA 2X82A 2X83A 2GOLB 4U0CA 2LF4A 4U0DA 1G03A 5HGKA 2XDEA 5HGLA 4E92A 2XGVA 5HGNA 4U0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INB A;  4U0A A;  1M9E C;  4HTW A;  2EIA A;  4E91 A;  4J93 A;  4XRQ A;  1D1D A;  1P7N A;  1M9D C;  2PWO A;  2XGY A;  4PH3 A;  4PH0 A;  5HGO A;  2WLV A;  3H4E A;  1QRJ A;  4DGA C;  4LQW C;  1L6N A;  2Y4Z A;  4DGE C;  3P05 A;  4XFZ A;  2PWM A;  4U0B A;  1M9Y C;  1M9X C;  2X2D D;  2JPR A;  4B4N A;  2V4X A;  4XRO A;  4PH2 A;  2PXR C;  3BP9 A;  3H47 A;  4U0F A;  4XFX A;  3NTE A;  1GWP A;  1E6J P;  1AFV A;  2WLV B;  1EIA A;  1M9C C;  2M8L A;  3MGE A;  2GON A;  4QNB A;  2M8P A;  1U7K A;  5HGM A;  4NX4 C;  2KGF A;  4XFY A;  1EM9 A;  1M9F C;  2XGU A;  4WYM A;  1AK4 C;  2M8N A;  5JPA A;  2X82 A;  2X83 A;  2GOL B;  4U0C A;  2LF4 A;  4U0D A;  1G03 A;  5HGK A;  2XDE A;  5HGL A;  4E92 A;  2XGV A;  5HGN A;  4U0E A; 
#chains in the Genus database with same CATH topology
 4INB A;  4U0A A;  1M9E C;  4HTW A;  2EIA A;  4E91 A;  4J93 A;  4XRQ A;  1D1D A;  1P7N A;  1M9D C;  2PWO A;  2XGY A;  4PH3 A;  4PH0 A;  5HGO A;  2WLV A;  3H4E A;  1QRJ A;  4DGA C;  4LQW C;  1L6N A;  2Y4Z A;  4DGE C;  3P05 A;  4XFZ A;  2PWM A;  4U0B A;  1M9Y C;  1M9X C;  2X2D D;  2JPR A;  4B4N A;  2V4X A;  4XRO A;  4PH2 A;  2PXR C;  3BP9 A;  3H47 A;  4U0F A;  4XFX A;  3NTE A;  1GWP A;  1E6J P;  1AFV A;  2WLV B;  1EIA A;  1M9C C;  2M8L A;  3MGE A;  2GON A;  4QNB A;  2M8P A;  1U7K A;  5HGM A;  4NX4 C;  2KGF A;  4XFY A;  1EM9 A;  1M9F C;  2XGU A;  4WYM A;  1AK4 C;  2M8N A;  5JPA A;  2X82 A;  2X83 A;  2GOL B;  4U0C A;  2LF4 A;  4U0D A;  1G03 A;  5HGK A;  2XDE A;  5HGL A;  4E92 A;  2XGV A;  5HGN A;  4U0E A; 
#chains in the Genus database with same CATH homology
 4INB A;  4U0A A;  1M9E C;  4HTW A;  2EIA A;  4E91 A;  4J93 A;  4XRQ A;  1D1D A;  1P7N A;  1M9D C;  2PWO A;  2XGY A;  4PH3 A;  4PH0 A;  5HGO A;  2WLV A;  3H4E A;  1QRJ A;  4DGA C;  4LQW C;  1L6N A;  2Y4Z A;  4DGE C;  3P05 A;  4XFZ A;  2PWM A;  4U0B A;  1M9Y C;  1M9X C;  2X2D D;  2JPR A;  4B4N A;  2V4X A;  4XRO A;  4PH2 A;  2PXR C;  3BP9 A;  3H47 A;  4U0F A;  4XFX A;  3NTE A;  1GWP A;  1E6J P;  1AFV A;  2WLV B;  1EIA A;  1M9C C;  2M8L A;  3MGE A;  2GON A;  4QNB A;  2M8P A;  1U7K A;  5HGM A;  4NX4 C;  2KGF A;  4XFY A;  1EM9 A;  1M9F C;  2XGU A;  4WYM A;  1AK4 C;  2M8N A;  5JPA A;  2X82 A;  2X83 A;  2GOL B;  4U0C A;  2LF4 A;  4U0D A;  1G03 A;  5HGK A;  2XDE A;  5HGL A;  4E92 A;  2XGV A;  5HGN A;  4U0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...