4J93A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bi-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Discovery of Novel Small-Molecule HIV-1 Replication Inhibitors That Stabilize Capsid Complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/viral protein inhibitor
total genus 50
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4j93A00
1M9CC 2M8LA 5JPAA 4QNBA 2GOLB 4XRQA 4E92A 1GWPA 1M9XC 4XROA 1D1DA 1U7KA 1QRJA 2PWMA 4LQWC 2WLVA 2X83A 3H4EA 4NX4C 3H47A 2WLVB 2GONA 1G03A 3MGEA 2X2DD 2JPRA 5HGMA 4XFYA 4XFZA 4DGAC 4INBA 1E6JP 2XGUA 4U0BA 4PH0A 3BP9A 1AFVA 4E91A 2M8PA 1AK4C 2M8NA 2PWOA 4U0CA 1M9YC 2XGYA 1EM9A 4XFXA 5HGLA 2X82A 1EIAA 1P7NA 5HGNA 4HTWA 4U0DA 1L6NA 4U0AA 2XDEA 1M9DC 3NTEA 2Y4ZA 4PH3A 5HGOA 2V4XA 4U0EA 4DGEC 4J93A 1M9EC 4PH2A 4B4NA 1M9FC 2PXRC 2EIAA 3P05A 2XGVA 2KGFA 5HGKA 4U0FA 2LF4A 4WYMA
chains in the Genus database with same CATH superfamily
1M9CC 2M8LA 5JPAA 4QNBA 2GOLB 4XRQA 4E92A 1GWPA 1M9XC 4XROA 1D1DA 1U7KA 1QRJA 2PWMA 4LQWC 2WLVA 2X83A 3H4EA 4NX4C 3H47A 2WLVB 2GONA 1G03A 3MGEA 2X2DD 2JPRA 5HGMA 4XFYA 4XFZA 4DGAC 4INBA 1E6JP 2XGUA 4U0BA 4PH0A 3BP9A 1AFVA 4E91A 2M8PA 1AK4C 2M8NA 2PWOA 4U0CA 1M9YC 2XGYA 1EM9A 4XFXA 5HGLA 2X82A 1EIAA 1P7NA 5HGNA 4HTWA 4U0DA 1L6NA 4U0AA 2XDEA 1M9DC 3NTEA 2Y4ZA 4PH3A 5HGOA 2V4XA 4U0EA 4DGEC 4J93A 1M9EC 4PH2A 4B4NA 1M9FC 2PXRC 2EIAA 3P05A 2XGVA 2KGFA 5HGKA 4U0FA 2LF4A 4WYMA
chains in the Genus database with same CATH topology
1M9CC 2M8LA 5JPAA 4QNBA 2GOLB 4XRQA 4E92A 1GWPA 1M9XC 4XROA 1D1DA 1U7KA 1QRJA 2PWMA 4LQWC 2WLVA 2X83A 3H4EA 4NX4C 3H47A 2WLVB 2GONA 1G03A 3MGEA 2X2DD 2JPRA 5HGMA 4XFYA 4XFZA 4DGAC 4INBA 1E6JP 2XGUA 4U0BA 4PH0A 3BP9A 1AFVA 4E91A 2M8PA 1AK4C 2M8NA 2PWOA 4U0CA 1M9YC 2XGYA 1EM9A 4XFXA 5HGLA 2X82A 1EIAA 1P7NA 5HGNA 4HTWA 4U0DA 1L6NA 4U0AA 2XDEA 1M9DC 3NTEA 2Y4ZA 4PH3A 5HGOA 2V4XA 4U0EA 4DGEC 4J93A 1M9EC 4PH2A 4B4NA 1M9FC 2PXRC 2EIAA 3P05A 2XGVA 2KGFA 5HGKA 4U0FA 2LF4A 4WYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9C C;  2M8L A;  5JPA A;  4QNB A;  2GOL B;  4XRQ A;  4E92 A;  1GWP A;  1M9X C;  4XRO A;  1D1D A;  1U7K A;  1QRJ A;  2PWM A;  4LQW C;  2WLV A;  2X83 A;  3H4E A;  4NX4 C;  3H47 A;  2WLV B;  2GON A;  1G03 A;  3MGE A;  2X2D D;  2JPR A;  5HGM A;  4XFY A;  4XFZ A;  4DGA C;  4INB A;  1E6J P;  2XGU A;  4U0B A;  4PH0 A;  3BP9 A;  1AFV A;  4E91 A;  2M8P A;  1AK4 C;  2M8N A;  2PWO A;  4U0C A;  1M9Y C;  2XGY A;  1EM9 A;  4XFX A;  5HGL A;  2X82 A;  1EIA A;  1P7N A;  5HGN A;  4HTW A;  4U0D A;  1L6N A;  4U0A A;  2XDE A;  1M9D C;  3NTE A;  2Y4Z A;  4PH3 A;  5HGO A;  2V4X A;  4U0E A;  4DGE C;  4J93 A;  1M9E C;  4PH2 A;  4B4N A;  1M9F C;  2PXR C;  2EIA A;  3P05 A;  2XGV A;  2KGF A;  5HGK A;  4U0F A;  2LF4 A;  4WYM A; 
#chains in the Genus database with same CATH topology
 1M9C C;  2M8L A;  5JPA A;  4QNB A;  2GOL B;  4XRQ A;  4E92 A;  1GWP A;  1M9X C;  4XRO A;  1D1D A;  1U7K A;  1QRJ A;  2PWM A;  4LQW C;  2WLV A;  2X83 A;  3H4E A;  4NX4 C;  3H47 A;  2WLV B;  2GON A;  1G03 A;  3MGE A;  2X2D D;  2JPR A;  5HGM A;  4XFY A;  4XFZ A;  4DGA C;  4INB A;  1E6J P;  2XGU A;  4U0B A;  4PH0 A;  3BP9 A;  1AFV A;  4E91 A;  2M8P A;  1AK4 C;  2M8N A;  2PWO A;  4U0C A;  1M9Y C;  2XGY A;  1EM9 A;  4XFX A;  5HGL A;  2X82 A;  1EIA A;  1P7N A;  5HGN A;  4HTW A;  4U0D A;  1L6N A;  4U0A A;  2XDE A;  1M9D C;  3NTE A;  2Y4Z A;  4PH3 A;  5HGO A;  2V4X A;  4U0E A;  4DGE C;  4J93 A;  1M9E C;  4PH2 A;  4B4N A;  1M9F C;  2PXR C;  2EIA A;  3P05 A;  2XGV A;  2KGF A;  5HGK A;  4U0F A;  2LF4 A;  4WYM A; 
#chains in the Genus database with same CATH homology
 1M9C C;  2M8L A;  5JPA A;  4QNB A;  2GOL B;  4XRQ A;  4E92 A;  1GWP A;  1M9X C;  4XRO A;  1D1D A;  1U7K A;  1QRJ A;  2PWM A;  4LQW C;  2WLV A;  2X83 A;  3H4E A;  4NX4 C;  3H47 A;  2WLV B;  2GON A;  1G03 A;  3MGE A;  2X2D D;  2JPR A;  5HGM A;  4XFY A;  4XFZ A;  4DGA C;  4INB A;  1E6J P;  2XGU A;  4U0B A;  4PH0 A;  3BP9 A;  1AFV A;  4E91 A;  2M8P A;  1AK4 C;  2M8N A;  2PWO A;  4U0C A;  1M9Y C;  2XGY A;  1EM9 A;  4XFX A;  5HGL A;  2X82 A;  1EIA A;  1P7N A;  5HGN A;  4HTW A;  4U0D A;  1L6N A;  4U0A A;  2XDE A;  1M9D C;  3NTE A;  2Y4Z A;  4PH3 A;  5HGO A;  2V4X A;  4U0E A;  4DGE C;  4J93 A;  1M9E C;  4PH2 A;  4B4N A;  1M9F C;  2PXR C;  2EIA A;  3P05 A;  2XGV A;  2KGF A;  5HGK A;  4U0F A;  2LF4 A;  4WYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...