4J93A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bi-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Small-Molecule HIV-1 Replication Inhibitors That Stabilize Capsid Complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/viral protein inhibitor
molecule keywords Gag protein
total genus 50
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4j93A00
4U0DA 5HGOA 4PH2A 5HGNA 1M9CC 1EM9A 2X2DD 2XGUA 3MGEA 2XGVA 2GOLB 4QNBA 2X83A 4LQWC 5HGLA 4XFXA 4J93A 1M9DC 2M8LA 1GWPA 1M9EC 2WLVA 4NX4C 4WYMA 4E91A 1QRJA 4B4NA 1E6JP 2X82A 3H47A 4XRQA 2WLVB 1G03A 1M9FC 2XDEA 5HGMA 2M8PA 2V4XA 1EIAA 1M9XC 2PWOA 2EIAA 3P05A 4PH3A 4U0CA 1M9YC 2PWMA 2PXRC 3H4EA 3NTEA 4U0EA 4U0AA 4XFZA 4XROA 5JPAA 2M8NA 4XFYA 1AK4C 1P7NA 1U7KA 1D1DA 5HGKA 2LF4A 4PH0A 1AFVA 2KGFA 4HTWA 2JPRA 4E92A 4U0BA 2Y4ZA 3BP9A 4INBA 4DGAC 4U0FA 2GONA 1L6NA 2XGYA 4DGEC
chains in the Genus database with same CATH superfamily
4U0DA 5HGOA 4PH2A 5HGNA 1M9CC 1EM9A 2X2DD 2XGUA 3MGEA 2XGVA 2GOLB 4QNBA 2X83A 4LQWC 5HGLA 4XFXA 4J93A 1M9DC 2M8LA 1GWPA 1M9EC 2WLVA 4NX4C 4WYMA 4E91A 1QRJA 4B4NA 1E6JP 2X82A 3H47A 4XRQA 2WLVB 1G03A 1M9FC 2XDEA 5HGMA 2M8PA 2V4XA 1EIAA 1M9XC 2PWOA 2EIAA 3P05A 4PH3A 4U0CA 1M9YC 2PWMA 2PXRC 3H4EA 3NTEA 4U0EA 4U0AA 4XFZA 4XROA 5JPAA 2M8NA 4XFYA 1AK4C 1P7NA 1U7KA 1D1DA 5HGKA 2LF4A 4PH0A 1AFVA 2KGFA 4HTWA 2JPRA 4E92A 4U0BA 2Y4ZA 3BP9A 4INBA 4DGAC 4U0FA 2GONA 1L6NA 2XGYA 4DGEC
chains in the Genus database with same CATH topology
4U0DA 5HGOA 4PH2A 5HGNA 1M9CC 1EM9A 2X2DD 2XGUA 3MGEA 2XGVA 2GOLB 4QNBA 2X83A 4LQWC 5HGLA 4XFXA 4J93A 1M9DC 2M8LA 1GWPA 1M9EC 2WLVA 4NX4C 4WYMA 4E91A 1QRJA 4B4NA 1E6JP 2X82A 3H47A 4XRQA 2WLVB 1G03A 1M9FC 2XDEA 5HGMA 2M8PA 2V4XA 1EIAA 1M9XC 2PWOA 2EIAA 3P05A 4PH3A 4U0CA 1M9YC 2PWMA 2PXRC 3H4EA 3NTEA 4U0EA 4U0AA 4XFZA 4XROA 5JPAA 2M8NA 4XFYA 1AK4C 1P7NA 1U7KA 1D1DA 5HGKA 2LF4A 4PH0A 1AFVA 2KGFA 4HTWA 2JPRA 4E92A 4U0BA 2Y4ZA 3BP9A 4INBA 4DGAC 4U0FA 2GONA 1L6NA 2XGYA 4DGEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0D A;  5HGO A;  4PH2 A;  5HGN A;  1M9C C;  1EM9 A;  2X2D D;  2XGU A;  3MGE A;  2XGV A;  2GOL B;  4QNB A;  2X83 A;  4LQW C;  5HGL A;  4XFX A;  4J93 A;  1M9D C;  2M8L A;  1GWP A;  1M9E C;  2WLV A;  4NX4 C;  4WYM A;  4E91 A;  1QRJ A;  4B4N A;  1E6J P;  2X82 A;  3H47 A;  4XRQ A;  2WLV B;  1G03 A;  1M9F C;  2XDE A;  5HGM A;  2M8P A;  2V4X A;  1EIA A;  1M9X C;  2PWO A;  2EIA A;  3P05 A;  4PH3 A;  4U0C A;  1M9Y C;  2PWM A;  2PXR C;  3H4E A;  3NTE A;  4U0E A;  4U0A A;  4XFZ A;  4XRO A;  5JPA A;  2M8N A;  4XFY A;  1AK4 C;  1P7N A;  1U7K A;  1D1D A;  5HGK A;  2LF4 A;  4PH0 A;  1AFV A;  2KGF A;  4HTW A;  2JPR A;  4E92 A;  4U0B A;  2Y4Z A;  3BP9 A;  4INB A;  4DGA C;  4U0F A;  2GON A;  1L6N A;  2XGY A;  4DGE C; 
#chains in the Genus database with same CATH topology
 4U0D A;  5HGO A;  4PH2 A;  5HGN A;  1M9C C;  1EM9 A;  2X2D D;  2XGU A;  3MGE A;  2XGV A;  2GOL B;  4QNB A;  2X83 A;  4LQW C;  5HGL A;  4XFX A;  4J93 A;  1M9D C;  2M8L A;  1GWP A;  1M9E C;  2WLV A;  4NX4 C;  4WYM A;  4E91 A;  1QRJ A;  4B4N A;  1E6J P;  2X82 A;  3H47 A;  4XRQ A;  2WLV B;  1G03 A;  1M9F C;  2XDE A;  5HGM A;  2M8P A;  2V4X A;  1EIA A;  1M9X C;  2PWO A;  2EIA A;  3P05 A;  4PH3 A;  4U0C A;  1M9Y C;  2PWM A;  2PXR C;  3H4E A;  3NTE A;  4U0E A;  4U0A A;  4XFZ A;  4XRO A;  5JPA A;  2M8N A;  4XFY A;  1AK4 C;  1P7N A;  1U7K A;  1D1D A;  5HGK A;  2LF4 A;  4PH0 A;  1AFV A;  2KGF A;  4HTW A;  2JPR A;  4E92 A;  4U0B A;  2Y4Z A;  3BP9 A;  4INB A;  4DGA C;  4U0F A;  2GON A;  1L6N A;  2XGY A;  4DGE C; 
#chains in the Genus database with same CATH homology
 4U0D A;  5HGO A;  4PH2 A;  5HGN A;  1M9C C;  1EM9 A;  2X2D D;  2XGU A;  3MGE A;  2XGV A;  2GOL B;  4QNB A;  2X83 A;  4LQW C;  5HGL A;  4XFX A;  4J93 A;  1M9D C;  2M8L A;  1GWP A;  1M9E C;  2WLV A;  4NX4 C;  4WYM A;  4E91 A;  1QRJ A;  4B4N A;  1E6J P;  2X82 A;  3H47 A;  4XRQ A;  2WLV B;  1G03 A;  1M9F C;  2XDE A;  5HGM A;  2M8P A;  2V4X A;  1EIA A;  1M9X C;  2PWO A;  2EIA A;  3P05 A;  4PH3 A;  4U0C A;  1M9Y C;  2PWM A;  2PXR C;  3H4E A;  3NTE A;  4U0E A;  4U0A A;  4XFZ A;  4XRO A;  5JPA A;  2M8N A;  4XFY A;  1AK4 C;  1P7N A;  1U7K A;  1D1D A;  5HGK A;  2LF4 A;  4PH0 A;  1AFV A;  2KGF A;  4HTW A;  2JPR A;  4E92 A;  4U0B A;  2Y4Z A;  3BP9 A;  4INB A;  4DGA C;  4U0F A;  2GON A;  1L6N A;  2XGY A;  4DGE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...