4J95A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic k659n mutation responsible for an unclassified craniosynostosis syndrome in space group c2.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
279
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIYYKNTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
total genus 91
structure length 279
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j95A01
3OW4A 5I9ZA 4NW6A 2W1IA 4FKSA 4CG9A 5CYIA 4IBMA 4AGUA 4E6AA 3L8PA 2GHMA 3B8RA 3NS9A 3G51A 4FEUA 4ZJIA 4FTLA 5IQCA 4IM2A 2P2HA 3KF4A 4TZRA 2Q0NA 4O0RA 2XBAA 4AAAA 5BVNA 5CEMA 2BTSA 3E88A 3GCQA 2R0UA 3FI2A 2Z7RA 3S00A 2BHHA 3GXLA 1XH5A 1P4FA 2OW3A 4YLKA 3VNTA 3WZJA 2C6TA 3R8ZA 3DAEA 4F7JA 2F49A 4HOKA 5IH4A 3ZRLA 5I9VA 3C9WA 5FP5A 3AC8A 3OUNB 4UZDA 3OT8A 5HU3A 3GEQA 2G9XA 4HYUA 4QTCA 3DOGA 4I6BA 4ZJJA 4D5KA 4PTGA 3WILA 2GQRA 5HD4A 2PE1A 2W7XA 4LRJA 3AGLA 4PPAA 1PF8A 4V0GA 4F1TA 2UVYA 3OG7A 2W5HA 3AQVA 2QHMA 3I81A 4P2KA 2OK1A 4P5ZA 4FEXA 5LARA 2GNLA 4WIHA 5FGKA 3CTJA 4QTEA 4B9DA 4XJ0A 2EXCX 1CMKE 4FKUA 4FNWA 3DXNA 2O65A 4PUZA 1PXKA 3HRCA 4OTPA 4EH9A 2YN8A 1VR2A 3DT1A 4W8EA 1NW1A 2BHEA 2YERA 5DRDA 5HCXA 2A0CX 2YAAA 3EQPA 3QRUA 3G2FA 3FSFA 3FZ1A 4FA2A 2BFXA 2UW4A 3F82A 2WQMA 1B38A 2QO7A 3C5UA 3TKIA 5K4IA 4FTCA 4CFNA 4UV0A 4EWQA 4G5PA 5AEPA 2OXDA 3O8UA 4G6OA 4LFIA 3CQUA 5DPVA 5F95A 5KKRC 1GIJA 5K9IA 1JAMA 4HNIA 3LIJA 5L6PA 4R6VA 5A54A 3TZ7A 2W1CA 4CFWA 2OF2A 1UWHA 1YDSE 5HOAA 5GIPE 3AC4A 3DNDA 4FV6A 4IWOA 1W7HA 4R7HA 1HCKA 4ASZA 4KKEA 2PY3A 4C02A 5K0XA 2PE2A 3HGKA 3PXYA 4RIWB 4BDKA 2ZV9A 5AV2A 4NIFB 4ZTLA 1F3MC 1BUHA 1NT2A 3H9FA 4TWCA 2ZDTA 3MVLA 2ITVA 3V3VA 3QC9A 4CMUA 3V8WA 1XR1A 3PUPA 4WKQA 3KF7A 2IVSA 3PPZA 1PXNA 3V5WA 4L8MA 4E5AX 4E6CA 3C4EA 3I6WA 1MRYA 2QR7A 4QMPA 2OJJA 3FSKA 3BE2A 3IS5A 1H0WA 2VZ6A 1TQMA 2ITXA 3IW4A 2WQBA 4IVCA 4WBOA 4I21A 4AZVA 3LCKA 4CVAA 4HVIA 5HEZA 5FDPA 3TUDA 5HESA 4RG0A 2JLDA 3OWKA 1Q8ZA 1VEBA 3HLLA 2RG5A 1ZYSA 1H28A 3UMWA 3TDWA 4BFMA 3LFFA 3A7JA 3IW8A 4KWPA 3A7FA 4AT4A 4FK3A 5IG1A 5JFSA 2P55A 5DLSA 3FZSA 5FTGA 1ZYLA 4H05A 4GKHA 3ORKA 4FSZA 1GIIA 3ZO3A 3TUBA 4XV1A 4NT4A 4FZ6A 4IB5A 4BIDA 4EK4A 4YMJA 4FKOA 1MRUA 3WARA 4BYJA 3KA0A 1XQZA 2G2IA 3BV2A 3LQ8A 4D28A 4FIFA 3RP9A 3LFAA 3BEGA 3V5QA 3GU5A 4ZIMA 5AUZA 4ZMFA 2W05A 4YJTA 4E26A 3E3PA 4EUUA 4OTHA 5IA0A 1DI8A 3R1YA 2YM5A 1O6YA 2GNHA 3I0OA 4M67A 5ACBC 4NFNA 2I0EA 1DM2A 1Z9XA 3MJ2A 5AP2A 1FGKA 5FXRA 4MH7A 5D12A 1J7UA 4XG9A 1Z5MA 2Z7SA 4B7TA 4DT8A 3FHIA 4EZ5A 3Q9WA 5DT3A 3UVQA 4ERWA 5I9YA 2WNTA 4HZRA 4BBMA 5C9CA 3E7OA 2VTPA 2ERZE 2OGVA 5J5SA 4FZAB 4RGJA 3D2IA 3UOHA 5DE2A 3KXXA 5EDPA 5HG8A 3A8XA 4FKGA 3IECA 3MB6A 4ZZNA 4QMUA 2JITA 5KHXA 4RIYA 2IG7A 4YHFA 3PG3A 1YOMA 3MPAA 4R77A 3G6GA 3IOPA 2IW6A 4XG6A 3FI4A 4QPSA 3RKBA 4GU6A 2CCHA 2QOBA 4BBFA 2Q0BA 3G15A 3CJFA 4OT6A 4ENXA 1B39A 2OKRA 2YZLA 3PXQA 4J8MA 2R5TA 3HMPA 4X2JA 5K0KA 4IB1A 4UYNA 5HE1A 3RAIA 3B2TA 3ZTXA 4DGMA 1AD5A 3V5PA 3QBNA 3QQJA 2VWBA 5J8IA 5L6WL 4ALUA 3CTQA 1YXVA 3UE4A 3NX8A 4IANA 4Q5HA 3ZRMA 4CKJA 1Y6BA 3R30A 3DAKA 4A4XA 4LOPA 2PMNX 4I5HA 2OU7A 3JYAA 4R8QA 2W1DA 2NPQA 2G01A 4I5PA 1H24A 1KE7A 3CBLA 3EQRA 2ITNA 3S95A 2GS6A 3EFJA 4BCJA 1Q4LA 2W96B 3RWPA 3GU7A 4I20A 4X3FA 3TZ8A 4ZAUA 4X2FA 3T9IA 4OUCA 4W9WA 4GVJA 4O21A 3R7IA 2AC3A 2WU7A 3ZU7A 3VRZA 4AGWA 5LMKC 4ACHA 4JXFA 4TNDA 3K5VA 3P1AA 4NCTC 4QYFA 3Q9YA 5AR2A 4RLLA 1QCFA 4IM0A 3FI8A 3UBDA 1BL6A 3PFQA 4X7QA 3HVCA 4RX7A 5JZNA 4DH1A 3CD8A 4U3ZA 2YDIA 1UA2A 3DTWA 3LFEA 4BWPA 3G90X 4W8DA 2OZAA 3UIMA 4FL3A 1ZLTA 2QHNA 3NUPA 5FTOA 4D9TA 1OKYA 4BHNA 5BNJA 2Y7JA 3DBDA 4P4CA 4NJ3A 4C4IA 5JGAA 5BMSA 2G1TA 3A7IA 4RWIA 4UXLA 1KOAA 4XEYA 2O64A 5CEKA 4MBIA 4GYIA 4U9AA 4HPTE 4ZZMA 4ASEA 2O3PA 5J1VA 4DF3A 2UUEA 3KRWA 3CXWA 3MSSA 4MD8E 4X3FC 4J53A 3HV6A 1YOJA 2ZV2A 4A4OA 1M7QA 1F0QA 3LFNA 3F2RA 2ACXA 2UW3A 4DEEA 4GJ3A 4XG8A 3MI9A 3F88A 3NYXA 4RC4A 4BZDA 4PL5A 3ZLSA 5EFQA 3FMEA 5AX3A 3BGQA 4YC6A 4O27B 4NCTA 3PA5A 2YZAA 3V51A 3GCSA 1CKPA 3EYGA 2GDOA 2IN6A 4FT5A 1ZMWA 4QMOA 3F5XA 5EI8A 4HYIA 4CFUA 2EXEA 3AMYA 4PMPA 2PMLX 3QZGA 4DTKA 1XKKA 3FKNA 2WTCA 4KRDA 2IW8A 3U9NA 2X39A 4QNYA 5CU3A 4CQGA 4ERKA 3FL4A 4O2ZA 2BZHB 2WMTA 3OOGA 1H1PA 3A7HA 5HD7A 3VVHA 2X1NA 5HE0A 4F6WA 5KMIA 2A1AB 4EI4A 1A9UA 3HAVA 3QRJA 3D2KA 5HTIA 4BGGA 3NVKI 4II5A 2ZM4A 4GT4A 4ALVA 2CDZA 5I3OA 1CTPE 1KSWA 4FV4A 4Z55A 3R0TA 2PUPA 3ITZA 2CGWA 3LCSA 4LGGA 4LUDA 3E92A 3NNUA 3RPVA 3U9CA 3S4QA 4PWNA 2WMAA 4HPUE 1BLXA 4DG0E 4AZEA 4TYIA 2BZKB 4C36A 5HGIA 2F9GA 4FTMA 5CU6A 4M12A 4F7SA 1YXXA 3VBXA 2C0OA 4FSRA 2BAJA 3VUIA 1Y8YA 3JR1A 3HP2A 4I22A 3GENA 4GUEA 4FIJA 3NEWA 5HO8A 5A4QA 1ZYDA 4QMNA 3F6XA 4ZTNA 5ANOA 4C59A 3KXNA 2GCDA 2IW9A 1I44A 3F7WA 4DGGA 4I0RA 5A6NA 1OL1A 3JVSA 2C5YA 3KMMA 4IB3A 4JL9A 5AAEA 5M53A 3BHVA 4DA5A 3S1HA 2C6KA 2CPKE 1XWSA 4L46A 1KOBA 3FLWA 4O6LA 4WD5A 2BROA 3AMAA 4UMTA 3V5TA 3CR0A 2XYNA 4AFEA 4ENYA 3K5UA 3FPQA 3UDBA 3DKGA 2V22A 3ID6C 3ZO1A 2REIA 1WCCA 2E9NA 3DDPA 4U43A 4G3CA 4D2PA 5J1WA 4ANBA 3EN5A 2FUMA 3SRVA 3RPRA 4Z7HA 5M44A 1AQ1A 4JG6A 2OIBA 4QP8A 2Y6MA 3VUDA 2NP8A 4EHVA 3UG2A 3UZPA 4XG4A 4WHZA 1PXLA 4Y72A 5DRBA 2J0JA 3ANRA 3CY2A 2QOOA 1GZNA 4Y85A 1IA8A 3ORZA 4FTIA 4BDAA 4O7SA 4ZS0A 5AM7A 5FBNC 2ZM1A 2HCKA 4YPDA 4FBXA 2F7EE 3RI1A 3KQ7A 4R5YA 1TQIA 3FLZA 4C4FA 4M69B 1M2PA 1V0PA 1DS5A 4R3RA 4RWKA 3HV5A 1PMEA 5CAQA 3QXPA 4UB7A 5J9LA 4J96A 5EQYA 3IKAA 4E4NA 3BLHA 4JS8A 2VWIA 3BU6A 1OITA 1WBNA 5L8KA 4E4LA 4JOAA 1OIUA 3BU3A 3HX4A 3C7QA 2WMBA 1JQHA 4TYGA 3ZO2A 3FLSA 4L42A 4D1ZA 4JLCA 5CNNA 2GNGA 3JXWA 3DGKA 3V5JA 2R3NA 3D7ZA 2ZV7A 3HAMA 3NYVA 4FV3A 3R9NA 3R1NA 4EHEA 2OWBA 3QRIA 3CPBA 1ZMUA 4K9YA 3R7OA 3QTXA 4BDEA 3FMKA 4C2WA 5HORA 3HUBA 3QCYA 5EYMA 3SA0A 5E8TA 5CEOA 3ZM9A 5H9BA 2WO6A 3NSZA 5ANEA 5M08A 3V6SA 3WF6A 5EDQA 3PRFA 5CSPA 4PPCA 3KVWA 1YKRA 3AD5A 4FZ7A 1OPLA 3FZOA 3Q52A 4KKHA 5BUEA 3DJ5A 3M11A 3NMUF 4C3PA 2HIWA 3KULA 2PMIA 4BCHA 3FLYA 1FQ1B 5CI7A 3ZZWA 4YUQA 5LOHA 2IJMA 3ZEPA 4ZLZA 3EOCA 3A8WA 4AZWA 2JBPA 4TRLA 4EK3A 3MV5A 4XBRA 4XG2A 5TKDA 3ORLA 4HW7A 5IDNA 3MA6A 5JFVA 1QPCA 3QTWA 4ACDA 2VTAA 4JQEA 4RVLA 2J2IB 3LW0A 3OFMA 1YI3A 2FYSA 3Q04A 3FC2A 4BGHA 4IVDA 4QMVA 3C0GA 4DH7A 4DTAA 4MKCA 1PKGA 5EI2A 2Y4IC 1RJBA 2DQ7X 3MPMA 3P5KA 4FIEA 1CSNA 2CKEA 3T8OA 3GC8A 4D1SA 4R1YA 4FEQA 5KMOA 2PZYA 4V01A 4KIPA 1KV2A 2R9SA 4UY9A 1H8FA 3VS0A 4XLVA 4WG3A 2Y4IB 3GT8A 4EL9A 4IJ9A 2EXMA 4IAKA 4UWYA 4RJ8A 3UC4A 3H3CA 3UGCA 3QALE 5B0XA 4P7EA 4AA0A 4O7LA 3IQ7A 3TJDA 5I4NA 4I0TA 1JSVA 1H1QA 4NWMA 3E62A 3RBWA 4F6SA 5JFWA 2J7TA 3QU0A 3LAUA 3LMGA 5F4NA 5GIOE 2CLXA 2ZM3A 3W2PA 5GZAA 3EN6A 4IXPA 3U4UA 2W5AA 5EHYA 1OM1A 1W82A 4MK0A 4RZVA 5KZ0A 3SC1A 3RAWA 4OTDA 5M07A 2WD1A 1XH4A 1OI9A 3A61A 5C03A 1CM8A 4GUBA 2UZTA 3EN7A 2VRXA 3QZFA 4L7FA 3TJCA 4ZSAA 3WE4A 4BDJA 4ORKA 1DAYA 3R2YA 4KIOA 5IQAA 4YTIA 3WYYA 3NW6A 3O2MA 5CX9A 4CYJA 4CMTA 3UQCA 4LM5A 3OY3A 5EHLA 3CEKA 4YJOA 2JDTA 2RG6A 2WKMA 4EOLA 3H30A 2X6EA 4I6HA 3R1SA 1REKA 4FTKA 4BF2A 4QMZA 3KXZA 1H01A 2ZAZA 3OXIA 4CXAA 4EK5A 4ZSEA 2BRMA 3EHAA 2YABA 2XZSA 4GV1A 3FJQE 5IEXA 1KWPA 3MN3A 1BX6A 2VTLA 4FTNA 2XCKA 4WSQA 1EH4A 3C4ZA 4WOVA 4AP7A 3GOPA 3LFCA 5EG3A 5B7VA 4BZOA 4M0ZA 5HU9A 3A4PA 2WAJA 4L9IA 2VO3A 5IUHA 4G5JA 4JDKA 4CZUA 3SRVB 2OF4A 3DS6A 3H0YA 4GU9A 4Y5HA 3LVPA 3SDJA 4YJRA 2ITPA 4GKIA 4JR3A 2C6DA 4DT9A 3PRIA 5FM2A 5E8SA 1OL2A 5LXMA 2F57A 2PPQA 2BRGA 3VS7A 3ZHPC 5CT7A 1M7NA 5CWZA 1IRKA 4IX4A 5B2LA 3O96A 1ZARA 2R3IA 2X4ZA 5ETFA 4IZYA 3ORXA 4I4EA 4G9CA 3BYMA 4O22A 1MQBA 4RRVA 2PULA 4M97A 3KVXA 3PIXA 2JBOA 1KV1A 1ZAOA 5CALA 3DXQA 3BHTA 2ZB1A 3HYHA 3R8LA 5AUYA 2IZUA 2J0LA 4IVBA 2VX0A 5DG5A 3LM0A 2FSTX 3ORIA 4AACA 4ITJA 5BMMA 2XYUA 4JG8A 2PZIA 5CU0A 4H1JA 4C34A 4XRJA 4LRMA 4R1VA 1NA7A 3EFWA 3PJCA 4RQKA 4XLIA 4MHAA 3ZSIA 4BDHA 3ZBFA 3TIYA 5IZFA 2BZIB 3HMNA 4WRGA 2ITWA 4M69A 4BDIA 4FYOA 2UW6A 4J71A 4F64A 4O0YA 2YIXA 4PMSA 2OJIA 5ACKA 3F66A 4NM7A 3QXOA 3DB8A 1XBBA 2GQGA 3R6XA 2XMYA 3AC3A 3MS9A 2W17A 1NXKA 3PTGA 1JPAA 3R1QA 4F9AA 3BRBA 4UWBA 3HUCA 3Q4TA 5CF6A 5C4LA 1LEWA 3BLQA 4UMUA 2BDWA 4FV2A 4PF4A 2YA9A 2DS1A 3C50A 2AUHA 1NVRA 4W4VA 2QQ7A 3QQUA 3ATSA 4JJRA 3OWPA 4O0TA 3HL7A 1LUFA 4I94A 2V0DA 4XH6A 4ANMA 4ACMA 4HVSA 4CFXA 5CAUA 5KMMA 4GW8A 4MNFA 3BHHA 2BAKA 4XUFA 3PY3A 4AT5A 3BYVA 3MFTA 4L52A 2XUUA 3QD2B 2C1BA 4FKRA 4I92A 4G1WA 1NVSA 5KCVA 4YSJA 1WBWA 3GQIA 3Q60A 3PIZA 1FMKA 3ZLXA 4QQTA 4CTCA 4YURA 2NRUA 1Q99A 3ZH8A 3R2BA 5K5NA 3AT2A 3VF9A 4MD9E 3ZYAA 1PJKA 5FQDC 2Y6OA 3FMLA 2YJRA 3F69A 4FTJA 5AJQA 4JIAA 1I09A 2W9FB 3VC4A 4FVQA 2Z7QA 3MW1A 4IEBA 5EH0A 5EQPA 2F7ZE 2C3IB 2XF0A 1H07A 3B2WA 1W98A 2KULA 3O8PA 4I3ZA 4DFLA 4OTGA 2I0HA 2XNOA 4ANOA 1OBGA 1Y57A 3EQIA 4WNPA 1H1SA 2VTQA 5FDXA 2CNQA 5KO1A 3PZHA 3FQEA 2JKOA 4H58A 4MXOA 1UNGA 1ZOEA 4P90A 3TTJA 4CKRA 3N4VA 2CJMA 4V04A 2J5EA 2JAVA 2YCQA 3P08A 4XNEA 4HVDA 4AZSA 4PL3A 3QFVA 4OAUC 4NTSA 4TXCA 4ANSA 5H8BA 2OIQA 3LXLA 3QTUA 1WVXA 2WTWA 2YM7A 5M55A 1ZOGA 4A9SA 4DINA 4AS0A 2V55A 3TV4A 3E64A 4IC7A 4O1OA 1OMWA 3OVVA 4ZSLA 3UOLA 4MXYA 4PQNA 3CE3A 4AN2A 3DJ6A 4CRLA 3LFSA 2SRCA 2GTNA 4CTBA 1SVGA 2YIRA 4FVRA 4ONAA 4D1XA 5E1EA 4P5QA 4BVUA 3NIEA 3NUUA 3VJNA 4FSQA 3VQUA 5JRQA 4HGTA 3RWQA 5CF5A 3BPRA 5CSWA 1SYKA 2R3FA 3BQCA 5LMAA 3VRYA 3QCSA 5AAFA 3BWFA 3R8UA 4BTMA 2R3JA 5I5ZA 1KE5A 2XNNA 5IQGA 4QMYA 5C8NA 5CSHA 3RALA 1JKLA 5BVWA 3ZM4A 4AF3A 2UW5A 4AGDA 4U42A 2WTVA 3UPXA 4FICA 2VWUA 3TIZA 4PMTA 1JKSA 3U8WA 1GAGA 1JOWB 4M68A 4ACGA 4FC0A 5HNIX 1QPJA 1GZKA 2PYWA 1OKVA 1RE8A 4DGNA 2C3JA 3FZPA 5HLPA 3IDCA 2YM3A 2UZUE 4K0YA 1R39A 1Q5KA 3EL7A 4G2FA 5GHVA 3WE8A 3W8LA 1G8AA 4PNIA 3B8QA 3ZS5A 1U46A 5JKGA 3UO5A 3KK9A 5AP1A 1PXIA 2J51A 3V5LA 4FG7A 4U0IA 2X9EA 2XKEA 3L8XA 4QMSA 4R7IA 2YITA 3BGZA 4ZLYA 1WBOA 2C5XA 2QOQA 5HLNA 5BVDA 2JDRA 4DCAA 4FVPA 3PJ3A 4EQMA 3DTCA 3GQLA 3QX4A 4NYEA 2JIIA 3LJ2A 5IA2A 3FYKX 4PRJA 3PIYA 5IMEA 1JWHA 1OUKA 3W2SA 3WF5A 4IFCA 4XX9A 2E9PA 2X2MA 3QZHA 4IFGA 4JG7A 3HMMA 2XP2A 5EI6A 3COKA 2O5KA 1U5RA 3UQFA 5CVFA 2R2PA 4BDGA 4KAOA 5FG8A 1WVWA 4ACCA 4BR3A 2G15A 2HZ4A 4LRKA 4MTAA 4DE4A 1MUOA 5A14A 4JDIA 5CEIA 1H0VA 4ZXTA 1RW8A 3H10A 1RDQE 2RFDA 4FV0A 4HCVA 4N6ZA 5LCJA 4RBLA 3KU2A 5CXZA 1YWVA 2VU3A 3D14A 3CJGA 4U44A 1H25A 5FUTA 4YPSA 4YTHA 4XV2A 3F3ZA 4WNKA 5FEDA 5AAGA 4I0SA 1OL6A 4HVGA 3FMHA 3UMXA 2GTMA 2WQOA 4B8MA 4FIHA 4S33A 4F1OA 3F5PA 1UU7A 2PUIA 4O0UA 4DTBA 4RIOA 1WVYA 3QLFA 4FKLA 3GFWA 4D0WA 2QNJA 5IF1A 2C6LA 1VYZA 2QI8A 1URWA 3EWHA 3NCGA 4BCFA 2JC6A 1OUYA 4HGEA 3KRRA 5AP7A 3R21A 4Q9SA 4XG3A 1L3RE 3RGFA 4WT6A 2PWLA 3CY3A 2PTKA 3MB7A 2VV9A 3E3BX 3KXHA 4H3QA 3C5IA 5HIDA 2QG5A 3TG1A 2YWPA 3U54A 2V5QA 5DMZA 4USFA 2UZLA 2WGJA 4OTIA 4BDBA 2ZYBA 3ERKA 2UZNA 4QP3A 4Q5EA 3EQHA 5HE3A 1ZRZA 4DLJA 4DHFA 2OI4X 4Z7GA 1ZOHA 1KUTA 4DFYA 2R3HA 5ETAA 3DFCB 1ZWSA 4NM0A 4QP7A 4ZTMA 4O83A 3ANQA 2P3GX 2QU5A 5EW3A 1ZMVA 3RM6A 1MQ4A 3MH1A 3U4WA 5DYJA 4DFBA 3IW7A 4O7TA 4FUYA 3L1SA 4GSBA 3SOAA 2WQEA 4FF8A 3VUGA 5E8ZA 4E5BA 3CIKA 3P79A 4C8BA 5KKRB 3R83A 1J7IA 3MESA 4JIKA 4PV0A 4KSQA 4N4SA 5EK7A 5HQ0A 2OICA 2RF9A 2XJ1A 4TN6A 1MP8A 2UV2A 1BYGA 3R7YA 1XH9A 3PVGA 4FSTA 4X3JA 3UNKA 3ET7A 2JKKA 3TUCA 5E8WA 2QLQA 3R8PA 4N0SA 4NFMA 2ZV8A 4A7CA 3MY1A 3TI1A 3JY9A 5C1QB 5H8EA 5TT7A 5KBRA 2C6EA 5ITAA 3WZUA 3GP0A 4UMQA 4DEIA 4L3JA 1OBDA 2H34A 3R9OA 2ERKA 3AGMA 4WSYA 5IISA 3LMIA 1R78A 3PLSA 3WZEA 4M66A 5J9YA 3COMA 4YO6A 3TEIA 4E6DA 4GT3A 4U79A 4WG5A 3NAXA 2C3LA 4QMLA 3ZCLA 1JLUE 3EFLA 5F20A 1L8TA 3ZZEA 3SXRA 2BAQA 4L7SA 1IAHA 4BRXA 1Q3DA 2DYLA 3PWDA 4L67A 5EW9A 5HO6A 1QL6A 4IH8A 5E90A 5LWNA 3POZA 4K2RA 5C01A 3R7UA 4BTFA 3F3UA 2WMQA 4JI9A 4Z3VA 2C5VA 2FSMX 2BRNA 3JY0A 3KXMA 5M4FA 4JBPA 5DR2A 1YDRE 4MD7E 1O6LA 5E4HA 2F2UA 4KIKA 4EOQA 4MNEA 4F70A 2W1ZA 3R00A 3TXOA 4ANQA 4QTDA 2W1HA 2XM9A 2YHVA 4FI1A 2R0IA 3OW3A 4F7LA 2R3PA 4M0YA 3DBEA 2HWPA 4FOCA 4EYJA 4NIFA 4G6LA 5LVNA 3PSBA 4L6QA 1YI6A 3ZSGA 2Z02A 2C0TA 4O0VA 2WMXA 4QYEA 3VW8A 2OZOA 4FL1A 5ETIA 4DEHA 3PZEA 3EB0A 5L2WA 1T46A 3LJ1A 2R3MA 2WOUA 2FSOX 5HNGA 4D4SA 4DC2A 4E4XA 4GK4A 4UN0C 3AXWA 4F9WA 3Q2JA 1HCLA 3F2AA 3BZ3A 4QYGA 5LVPA 1PXOA 1UU9A 2XRWA 4RWJA 3O50A 2DWBA 2VAGA 4LV5A 4WUNA 5BUJA 4IX3A 4CNHA 2QOKA 4PTCA 5I9XA 1H4LA 3QZIA 1FVRA 4XOZA 5AP0A 2OH4A 3EFKA 3IO7A 4KABA 3TCPA 4EHGA 4YBKA 4RIWA 3SD0A 3OP5A 3IGGA 4JNWA 4DFXE 5AV4A 5I0BA 2OO8X 4YJUA 3LPBA 4KNBA 2GFSA 5K4JA 5CXHA 1H27A 4TY1A 4XRLA 4D2VA 3ZLYA 3FC1X 2AYPA 3DKCA 5I3RA 4Z9LA 5TE0A 1XJDA 4MNEB 3GU8A 4OBQA 2X81A 3BQRA 3OEFX 3EIDA 3SXFA 1W0XC 5HTCA 3QQLA 2BPMA 4S32A 4FTUA 1YQJA 4GIIA 4IACA 4L45A 5AP4A 2O0UA 3WIKA 4XG7A 4EORA 1E9HA 3I6UA 5EKNA 3PVBA 4ALWA 5BYYA 3ZXTA 3E8NA 4QP6A 1TVOA 5CSVA 2XK7A 5H3QA 1ZYJA 2WMUA 3PJ2A 4FKTA 5LVMA 4N57A 2ZMDA 3RJCA 2UZDA 3LXPA 4S31A 2BMCA 2F7XE 4FKVA 3F3TA 4IC8A 4F0FA 4BICA 1H26A 2JIVA 1AGWA 2A4LA 3Q9ZA 3R7GA 1PW2A 4FG9A 4J1RA 3R9RA 5AR4A 4UXQA 3O7LB 5BVEA 5JEBA 3U6JA 4AW2A 4U40A 2E9OA 3WIGA 3NPCA 3UYTA 4C4JA 3Q6UA 2VTRA 5LVOA 1SM2A 3ULIA 2VX3A 2FH9A 3M42A 3O8TA 2BILB 5EHOA 5LVLA 2XNBA 4BCOA 2V7AA 5D1JA 3OUKA 4RIYB 1WBTA 4WBBB 1UVRA 2QVSE 1R0PA 2V7OA 3QYZA 5AV1A 4NUSA 4E20A 3GUBA 4FOBA 4ARKA 4U5JA 1WMKA 3NNWA 4NZWB 4CCUA 4U6RA 2YAKA 4U45A 4GFOA 3E7VA 2WMWA 1Q61A 2IZRA 4JRVA 5HICA 2CLQA 4IM3A 2W0JA 4C4GA 3WBLA 4GT5A 2CGXA 4KRCA 4DG2E 3FY2A 4GK3A 2RL5A 4X21A 3FV8A 5IA5A 1U54B 3QRTA 5HZNA 1Y91A 2J0IA 5JSMA 4YJSA 3QCXA 4ZY4A 1K9AA 3OY1A 5EM7A 4PTEA 3Q4UA 4ASXA 3I1AA 3I7CA 3A4OX 3W55A 1YRPA 3BCEA 4L53A 4YHTA 2XNEA 4F7NA 4E8AA 3KY2A 4FV5A 1G8SA 3BIZA 2OJ9A 1WBPA 4DCEA 2RFNA 4BY9E 4BBEA 3KGAA 3PY0A 3CCNA 4QYHA 5L2QA 4BCGA 4FEWA 2XS0A 1H08A 4MWIA 2Y9QA 5L2IA 3KRXA 3LJ0A 4YBJA 2OZAB 2C6MA 2FO0A 1IG1A 3PP0A 2QOIA 4X3FB 4DG3E 4UMRA 3GC0A 4YNOA 4RJ6A 4YO4A 4JQ7A 5FEEA 1WAKA 3BBWA 4C33A 4D2TA 2BZJA 3DK3A 2YIQA 3ODYX 4CEGA 5AR8A 2P4IA 3DKFA 4Y83A 4NEUA 4QO9A 2GS7A 5HBEA 4E6QA 5L6OA 4XP2A 4UEUA 2WIHA 1OL5A 4EWHA 1OIYA 4W4XA 3D5WA 5JFXA 3CQEA 3L8SA 5CTPA 2PE0A 3W10A 3W32A 4AX8A 4BDDA 5M06A 1FOTA 1K3AA 2IZTA 2W4JA 4NTTA 3NNXA 4EOIA 3GU4A 3IGOA 4O1PA 3TWJA 3JVRA 3KMWA 4X0MA 4EOOA 4XV3A 4EOKA 5J5TA 5LMKA 1SZMA 4G3GA 3CS9A 2PMOX 3EH9A 3QD3A 4MYGA 4L43A 3C51A 5CEPA 2VO7A 4S34A 1PYXA 3QKMA 1SVHA 2EB3A 2WTIA 3RINA 2OLCA 5FWKK 3ZBXA 4BZNA 3QGYA 5E1SA 2BTRA 4QMQA 4FKIA 2JAMA 4FSNA 3VUMA 2UW7A 4K6ZA 3W2RA 2JKMA 2WEIA 3RPSA 2WMRA 4BCMA 4DGLC 4MVFA 5HHWA 4YZBA 3UZTA 1MRVA 4EUTA 2XKFA 3W8QA 3QHWA 4YZMA 5CVHA 2A2AA 3IW5A 4IX6A 1UNLA 5CANA 4JDHA 3P7BA 5F9EA 3FXZA 4FNYA 4I24A 5GZ8A 1ND4A 4W9XA 4CLIA 2R3QA 2XK4A 4FMQA 1Q8YA 5HNBA 4J95A 5J7HA 2OXYA 3VS3A 3E5AA 3BI6A 3PJ8A 4PDPA 5M56A 5KMJA 1GJOA 4OR5A 4X2GA 4HNFA 2QCSA 5J79A 1U5QA 3QYWA 1TKIA 4M13A 4OTFA 4RA5A 4GFGA 4EZ7A 3HDMA 4BWKA 4FZDB 4UX9A 4UZHA 3G33A 4AXAA 5DOSA 2AC5A 2OXXA 4APCA 4GG5A 2XIZA 2RSVA 2CGVA 2X9FA 2XK8A 4I5CA 4S2ZA 5EOLA 2EVAA 5AUVA 3WF9A 3PSDA 4IW0A 3UO4A 3ZLWA 4YLJA 5CAVA 3MY0A 3ZFXA 2UZOA 3QTQA 4ITHA 5M51A 2JGZA 1J1BA 2PHKA 3GGFA 4U81A 3NAYA 2X7OA 3TNIA 3A99A 2GSFA 4D4RA 3VS5A 4IAIA 3RNYA 3G9NA 3GNIB 1TQPA 1J7LA 2B9IA 3R8MA 2VO0A 4ZLOA 4CZYB 3SOCA 1QPDA 3C0HA 4FSWA 4FTRA 1JKTA 4L68A 3AD6A 4LGDA 3E8CA 4KBKA 4ASDA 5M4IA 1YHVA 3CC6A 2VGPA 3D7TB 4ZP5A 3ROCA 3H9OA 3OHTA 5AA8A 5ANKA 3VBTA 2QKWB 1ZXEA 4GVAA 2FB8A 4TWNA 1LPUA 3D7TA 2NNWB 3QUDA 3FKOA 3QGWA 4DFUA 1GY3A 2CSNA 3MY5A 2XM8A 3FE3A 4BIEA 4CGAA 4BCNA 2PVNA 2CMWA 5HVYA 3DLSA 4MXXA 2CN8A 4CV9A 3ZDIA 3F5UA 4I23A 5DGZA 2XNPA 3QWKA 3ELJA 4BB4A 3GU6A 3EKKA 3GB2A 3MVMA 3R7EA 5D11A 3DB6A 3OTVA 4EQUA 3UIBA 4FSMA 3MDYA 4MXCA 4ITIA 5AIRA 4OTRA 3SW4A 3VUKA 5JGDA 4RPVA 4RVKA 4KINA 5IQEA 3LHJA 3D5UA 5AP5A 2Y8OA 3S3IA 4NL0A 4E5WA 4I5MA 4L00A 4RFMA 3BLRA 2QODA 2PK9A 3PY1A 5CQWA 4B99A 5HX8A 3F61A 5ANJA 4LGHA 2X8DA 3TT0A 1SNXA 2ZVAA 4CMOA 3D0EA 2GPHA 4V05A 4QP1A 2VWYA 4FTAA 4O7RA 2VO6A 3KCFA 3GCUA 4C57A 4PP7A 3D9VA 3DJ7A 4GRBA 2VTMA 3TN8A 4BGQA 3UNJA 4Y46A 4X6RA 1A06A 1RQQA 5EQEA 4YP8A 4NM5A 3E8DA 5E7RA 3FQSA 3BYUA 4A06A 2XKDA 3DXPA 5IQIA 3QA0A 5D7VA 4G3DA 4BL1A 4QP2A 1V1KA 5DEYA 1R1WA 2VTIA 4X2KA 1YW2A 5LCKA 4G17A 4H3PA 5EDRA 3EQGA 3ULZA 2B0QA 1XH7A 3AC2A 4BI2A 4NJDA 3UZRA 1Q8TA 2HELA 1PMVA 3AG9A 2QOHA 4RT7A 3CSVA 3U55A 4QOXA 2YIWA 4FKJA 4MWHA 2XNMA 4R5SA 3K2LA 4HGSA 1OPKA 2J4ZA 4ZSJA 2YCFA 4F1MA 4OW8A 5A4CA 2HAKA 1WBSA 3DAJA 4QRCA 3L9MA 2QONA 4QP4A 3PXZA 4KA3A 3D83A 4TWPA 2XNGA 4AOTA 3Q4ZA 3NRMA 4AGCA 1KE9A 4GS6A 2QLUA 3IPHA 5CY3A 4BIBA 3CD3A 3G0FA 5CI6A 5FBOA 3NW7A 5L8JA 3DY7A 2QO9A 4WNOA 5BYZA 3PXRA 5EKOA 5H2UA 2R3KA 3E8EA 4XV9A 3EQFA 4ZTHA 5CZHA 3Q9XA 1O6KA 4CT1A 4RVMA 5EYCA 3QAME 4CD0A 2ONLA 5A46A 1JSUA 3UIXA 2VGOA 3LKMA 1A48A 4FTQA 1GIHA 4X2NA 2FVDA 3DZOA 5E92A 5GZ9A 1DAWA 1OIQA 2BALA 2ZOQA 3RCDA 3TV6A 4JBVA 2JIUA 2UW0A 4EONA 5LQFA 2X6DA 3HV3A 3IG7A 2JFLA 4AU8A 5FXSA 3K3IA 4RC3A 5LMBA 4PL4A 2YDJA 4BI1A 4OTWA 3RAHA 2ZMCA 3KB7A 4KSPA 2O63A 4TTHB 2W1GA 3LLAA 4EHZA 3CPCA 4NKSA 3KN6A 5DR6A 4IJPA 2WTKB 4ZY5A 3BBTB 4K1BA 4OTQA 3UNZA 2VUWA 3C1XA 4GEOA 2A27A 3DZQA 3ENHA 2CNUA 1Z57A 3QHRA 4ZEGA 3BU5A 2H9VA 3W1FA 1LR4A 2IO6A 3FMJA 4RJ5A 1XBAA 4RMZA 4U3YA 2HW6A 5AUWA 4O0WA 4AW1A 2WQNA 3PA3A 5L2TA 2Z7LA 4DEDA 5KNJA 3UC3A 4BDFA 4U7ZA 5IEVA 1W84A 3MGYA 3PG1A 4IAZA 1PY5A 3JUHA 5IQHA 4CFFA 5H8GA 1K2PA 2X4FA 3AMBA 3IDBA 4YR8A 1V0OA 2W1FA 4FG8A 2QOLA 4DFNA 1Q8WA 3QLGA 4O6EA 2ONLC 1FINA 4D58A 3L9NA 1NVQA 3F3WA 4TKSA 4LUEA 4D2RA 1OECA 5AUXA 4B8LA 4WUAA 2X2KA 3OBGA 2B55A 1M2QA 3DKOA 2J0KA 4EH5A 4J98A 5IU2A 3A7GA 4AN9A 4DEGA 3NUYA 3O0GA 5AP6A 1M14A 4LI5A 3R63A 3VULA 1J3HA 4C58A 5G1XA 1URCA 1XHAA 3JS2A 3NCZA 1E1VA 2H96A 2G2FA 4AG8A 4BN1A 4DBNA 4FKPA 5BYLA 2QD9A 3CKWA 2W99B 4QQ5A 2CHLA 5K3YA 4AOJA 4ZZOA 2Z2WA 3G9LX 5IEYA 3WZDA 2B9HA 4R3CA 1PKDA 2QOFA 5T3QA 3TTIA 2JDVA 2PL0A 1UKHA 2P2IA 5FM3A 4I6QA 4LG4A 4TW9A 3FZTA 4EH6A 4L01A 3ACKA 4GIHA 2UVZA 4TWOA 3IK3A 4YJNA 5L3AA 2X8IA 3AC1A 3QCQA 5AWMA 3RZFA 4D4YA 2CKPA 3QA8A 5DWRA 1ERKA 1YI4A 3C13A 5ANIA 5HVJA 4F6UA 2V62A 4XOYA 1FGIA 4CLJA 1OKZA 4IX5A 3KRJA 3BGPA 3U51A 4L3LA 4XHKB 4EH4A 2BFYA 5CLPA 5FEQA 2R3LA 4EBWA 3KULB 5C8MA 1M2RA 3EQCA 4MX9A 4EK8A 3CP9A 3UP2A 5E8UA 3R02A 4EZ3A 2E2BA 3TACA 2LGCA 2BR1A 2XH5A 4O91A 2B54A 3ZUUA 3FBVA 4U8ZA 3F5GA 3SG8A 3Q32A 3FYJX 4RQVA 5DT4A 3GCVA 4ID7A 4I93A 1WZYA 2O2UA 3FMDA 4FNXA 2F2CB 2Q83A 1PMNA 2XIYA 4O7NA 1F5QA 3QWJA 2WIPA 5J7BA 3OC1A 1R0EA 3KMUA 4LL5A 5C27A 4EC9A 3P7CA 2R64A 1QPEA 3LFBA 3L8VA 2RKUA 5J87A 4C3RA 4O7VA 5DVRA 3I4BA 1UNHA 3FDNA 4KB8A 3OBJA 4YC8A 4BTKA 3EQDA 4FT0A 4FL2A 5CEQA 4LL0A 3TNPC 3AOXA 3RK5A 3FMMA 4AWIA 4NU1A 2J90A 4IIRA 4YZNA 3LCTA 3MIYA 5E8YA 4K8AA 3V01A 3WF8A 1S9JA 2C6OA 5HE2A 1Q24A 4C3FA 1CKIA 2QU6A 5M4UA 5C8KA 5AR7A 2HZIA 4H36A 3F9NA 5CNOA 3P9JA 2GHGA 3PE1A 4FIIA 2B1PA 4JDJA 4QT1A 5BVOA 4YZDA 4M8TA 3DBFA 1U59A 1YWRA 2XB7A 3SKCA 5HBJA 3QL8A 2ESMA 4OAVB 2RFEA 3HDNA 4ZOGA 3UVRA 4PDYA 3VN9A 2ITZA 2HWOA 3KREA 3PDTA 4MXAA 5JH6A 5M4CA 1SNUA 1P4OA 2VTTA 1T45A 2JD5A 4KIKB 5F94A 3DQXA 1OZ1A 1X8BA 2XBJA 4KS7A 2NRYA 3VHKA 3NR9A 4LOQA 3FHRA 3NYNA 3UIUA 3N51A 1IR3A 3QQKA 1SVEA 4QYYA 3RVGA 2OBJA 1PMUA 3FMNA 4IDVA 5C26A 5KMKA 1H1RA 3EZRA 3NLBA 4LQMA 4NKAA 2XRUA 4BKJA 1XH6A 4F9YA 5HLWA 2CKOA 3QTRA 4MF0A 2VTHA 3O23A 2XIKA 2Z60A 5AFVA 2PUUA 3LCOA 4AQCA 4O86A 2RGPA 4O0SA 2VD5A 3W33A 4B6LA 4C61A 1FPUA 4KUJA 3ALOA 4F63A 4CKIA 5KHWA 3OF0A 1J1CA 5EYKA 4FZFB 2WPAA 2HW7A 3R71A 5E8VA 5HIEA 4C0TA 2XEZA 4CFMA 5GJDA 4RJ7A 2QR8A 3BELA 4IZ5A 2GHLA 2EU9A 4QP9A 2JFMA 3MVJA 4TYEA 5AV3A 4AFJA 4EOJA 4EYMA 5A9UA 2KTYA 2C4GA 2VTJA 4D0XA 4RLKA 4QTBA 4E3CA 1ZYCA 4DGOA 4KD1A 1GZ8A 4R78A 4ZTRA 1SMHA 3COHA 3A60A 4J52A 4M84A 5HIBA 5ETCA 4AA5A 5HCZA 4E73A 5CAPA 3WYXA 3DK6A 4O7ZA 2PVFA 3ORPA 3DPKA 4M15A 3VQHA 4DEAA 2X8EA 3FEGA 5E9EA 4FKWA 1PXPA 3DLZA 5BVFA 5CF8A 2QC6A 3VS4A 5AX9A 2BRHA 3BV3A 2A19B 5E91A 3NUAA 5HG5A 4K77A 3VWAA 2C30A 1LEZA 2HOGA 3I5NA 5KMNA 3VS6A 3D5VA 4RVTA 4BCIA 3S2PA 3RNIA 3WF7A 3WOWA 4EOPA 4HZSA 2UW9A 2YCRA 4FV1A 4PPBA 2YWVA 4O84A 3AC5A 3REPA 4U97A 3ZEWA 4QNAA 2C47A 4RIXB 5FD2A 3ZONA 3BKBA 4IE9A 4FT9A 4D5HA 2CCIA 4N70A 4F0GA 4CQEA 3OXZA 5L4QA 4BKZA 1FBNA 4G9RA 1PXMA 2WXVA 3HMOA 4JX7A 3II5A 4LV8A 5BX0A 3KK8A 4RX8A 5JQ8A 3IDPA 4XBUA 3Q6WA 2PZRA 3Q2MA 2I6LA 4JAJA 3SAYA 3TNQB 3D15A 3LLTA 3PYYA 3HA6A 4KBCA 4AN3A 3EQBA 4BKYA 2IVTA 2X0GA 5L8LA 4FGBA 3ZMMA 4AZFA 5B2MA 4IDTA 4GK2A 3C4WA 3FKLA 4FX3A 4WO5A 5EYDA 1STCE 5GNKA 3O71A 5AIKA 5EM8A 2WTKC 2BIYA 2ETKA 3UP7A 5HTBA 4DITA 2YM6A 1VYWA 3MFRA 3NGAA 4GG7A 3EL8A 3RHXA 5JRSA 3M2WA 3NUNA 5DEWA 4AA4A 4LYNA 2WB8A 4G31A 4ANNA 2GS2A 3LM5A 4ANLA 3ALNA 3FY0A 3ZRKA 3KRLA 2YLFA 3CKXA 3MH0A 3Q53A 3OOMA 1REJA 2YM8A 4W4YA 1ATPE 2IWIA 4TYHB 1JSTA 3NW5A 4FT3A 2Y4PA 2XK3A 3NDMA 4OT5A 4CG8A 4AW5A 3QC4A 1UWJA 3LZBA 4TL0A 1JBPE 1OKWA 2BVAA 3DDQA 3HRBA 2GNIA 3HMIA 3PP1A 4ZK5A 5DT0A 4HVHA 4QQCA 4CSVA 4QPAA 4KIQA 2BKKA 4NK9A 4Z16A 3BHUA 3WI6A 5JZJA 5AV0A 2WTJA 1M17A 1U54A 2J5FA 3C4XA 3ZSHA 4E4MA 4C4EA 3SV0A 4PDSA 2YJSA 5DFPA 2HENA 2XVDA 3TV7A 5ANDA 3FUPA 1P5EA 1OL7A 3BE9A 3VIDA 2E9UA 4EKLA 3SVVA 3P4KA 5A4LA 4KBAA 3BWJA 2XKCA 5JN2A 2YACA 4BC6A 3GI3A 3I5ZA 3N4TA 4USEA 5DA3A 3ZC5A 1W8CA 3GOKA 2VTNA 2HZ0A 3KCKA 3UJGA 4D2WA 3H0ZA 5CT0A 4RX5A 5FP6A 4EK6A 2VX1A 4HJOA 3EN9A 2E9VA 3HECA 3RK9A 4CT2A 5CQUA 5CZIA 4BTJA 2PZ5A 4IADA 2OH0E 1IASA 4YC3A 4JAIA 1HOWA 5CASA 4WA9A 4AE9A 4AUAA 3VBYA 3R04A 4F09A 3GC9A 4J8NA 4ZS4A 1YXTA 3VS2A 1YVJA 2JEDA 4GCJA 3AT3A 4KKGA 3SHEA 1XO2B 4PX6A 3FPMA 5D9HA 5B2KA 4IWDA 3ZFYA 3TL8A 2FGIA 3VF8A 1P14A 1IEPA 4F0IA 5GJFA 4ZJVA 3R28A 4BCKA 3VUHA 2YDKA 1OPJA 3D94A 3W2QA 4MCVA 4OBPA 4O7YA 3O51A 2F4JA 1BL7A 4TT7A 5JGBA 1U4DA 2X2LA 2ITUA 4K18A 3DA6A 4R3PA 3RM7A 3SW7A 3OTUA 4O2PA 2EWAA 4BCQA 4FV9A 2X7GA 4DN5A 2C68A 1ZZLA 3MIAA 4U80A 4IVAA 2XIRA 3H4JA 4YJVA 5EW8A 3TKHA 4B4LA 3EN4A 2OJGA 2RFSA 4IAYA 1ZZ2A 3HEGA 4J99A 1NY3A 3KC3A 4L3PA 1WBVA 3RAKA 4FV7A 3FL5A 1VZOA 3TNWA 5LWMA 4F08A 5CAOA 2WTDA 4O38A 3FXXA 3ORMA 3UPZA 2QG7A 4FGRA 3OEZA 2ITQA 2H8HA 3ZC6A 3DU8A 2I40A 4LOOA 4NW5A 4W4WA 4C4HA 5LJJA 3DNEA 4C35A 1Y8GA 5DR9A 3BYOA 2CNVA 3LQ3A 2VWXA 5KBQA 2PVHA 3PSCA 4MQ2A 4JR7A 3K3JA 3PLAE 3SG9A 2J0MB 3DCVA 4B0GA 4JBOA 4QQJA 5JK3A 1FVVA 3KKVA 2I0VA 3V6RA 4EQCA 4JBQA 4QMXA 4EBVA 5IH5A 3U6HA 3HRFA 3QQGA 5FLFA 3OS3A 2R3GA 4D4VA 1YXUA 3QTIA 4CZTA 1BI8A 4Y5QA 4H1MA 5TF9A 5BQ0A 1JVPP 4QMTA 4E1ZA 4WNMA 3OCGA 1WFCA 2HY81 3MA3A 2BDFA 3T3UA 4A9UA 3EMGA 5A4EA 3KXGA 5F1ZA 2ITYA 2BKZA 2ZDUA 3UODA 3CGFA 4I4FA 2ITTA 5J95A 4ZY6A 4APPA 3VHEA 1YDTE 3R73A 3UYSA 2H6DA 3CTHA 4AT3A 5BPYA 4QMWA 3SQQA 3HV4A 3UOKA 5JMSA 3JPVA 3P23A 1KE8A 4FK6A 1BI7A 4FODA 4XS2A 1H1WA 5DNRA 3W18A 5HX6A 1KE6A 2C1AA 3PXKA 3ZXZA 2UZWE 4C38A 4EC8A 4FTTA 1UU3A 2BUJA 4FV8A 5EM6A 4PMMA 2PZPA 2J50A 3GBZA 4I1ZA 3V8TA 4GL9A 4RA4A 4G3FA 3CQWA 4M7IA 1YWNA 5E8XA 1FVTA 2ETMA 2WMSA 3LXNA 2IVVA 3MFSA 1DI9A 4FT7A 2PSQA 4UYAA 2W4KA 4FSUA 5FXQA 4K11A 5DI1A 5L2SA 4EKKA 3DBQA 3OWLA 4AZTA 4HGLA 3DFAA 3HV7A 2W5BA 4U41A 5AUUA 2GNFA 3TZMA 2YCSA 5G6VA 1QMZA 4J97A 3FWQA 5ICPA 3HKOA 3QUEA 5J9ZA 4G16A 2WEVA 5FRIA 2BDJA 5I9UA 4BCPA 3DQWA 4EEVA 3ODZX 3VBQA 4TNBA 3LMHA 3MJ1A 4OGRA 2C69A 2YEXA 4NSTA 4ZMEA 1Q8UA 5ANGA 5T6KA 2B4SB 5HI2A 3NVMB 2I0YA 3QD4A 5D7AA 2R4BA 3RPOA 3IW6A 4GMYA 5AR3A 2WHBA 5AR5A 4TYHA 4I6FA 3RK7A 4BWXA 1R3CA 2VWWA 3ATTA 2X7FA 4FE2A 3Q5ZA 3UVPA 2RIOA 3O7LD 2IPXA 4OBOA 4MQ1A 1OVEA 2O8YA 2P33A 3GFEA 3SLSA 4UMPA 1G5SA 3O17A 4M14A 1S9IA 4CFVA 3ACJA 5CU4A 4X6QC 4S30A 4FYNA 4F65A 2LAVA 1LP4A 3N9XA 2XCHA 4J7BA 1UU8A 3OT3A 3ENMA 4FNZA 2R7IA 2PVMA 4XP0A 4D55A 4DAWA 2B9JA 4A9TA 4GFMA 4C2VA 2W9ZB 3PPJA 1M52A 2GFCA 4MF1A 4EH2A 2CKQA 3HNGA 4DEBA 3LFDA 5DN3A 4R7BA 3W2CA 3MPTA 5JQ5A 3I79A 2XK9A 3PXFA 5HG7A 2Y0AA 3QX2A 5KX8A 2VTSA 3ZUVA 3CGOA 4EH3A 2VNYA 3EKNA 4EOSA 5IUIA 2XK6A 2HK5A 3BHYA 3BX5A 2IZSA 4BHZA 4I41A 3KN5A 2XIXA 3Q3BA 4A9RA 2UVXA 1GZOA 3R7VA 5IA4A 4ZTQA 4EJNA 2G2HA 4RIXA 3DV3A 2JDOA 2YLEA 1H00A 3I7BA 4DYMA 3UO6A 5EOBA 3L9LA 3EYHA 5K5XA 5AA9A 4XP3A 1Q97A 2JDSA 4PNKA 4Q2AA 2PVJA 2XJ0A 3I0QA 3F3VA 3E63A 5DIAA 2YFXA 4YSMA 5KE0A 1GOLA 1JKKA 3NIZA 4G6NA 3KFAA 3R01A 5HBHA 3U87A 3L9PA 2QURA 3Q5IA 2XA4A 2DUVA 3QQHA 2R3RA 2PU8A 2PVYA 2IVUA 2HYYA 2HY0A 3S0OA 5CU2A 3QQFA 3VW6A 1IA9A 4GH2A 4IZ7A 5HVKA 3OD6X 2I7QA 4EJ7A 3COIA 5FTQA 2PVLA 2W06A 3PWYA 5AMNA 5KZIA 3ZFMA 4JQ8A 2NO3A 4AOIA 2HZNA 3IONA 3I60A 4YJQA 3GCPA 4F4PA 4IQ6A 4YHJA 3PA4A 1PXJA 3P7AA 3SGCA 4CCBA 5IDPA 2CN5A 4IMYA 3MTLA 1ZY4A 4YNEA 5AP3A 3R8VA 3VBVA 3MWUA 4IAFA 4F9BA 3Q96A 4AW0A 4RFZA 1PYEA 4JVGA 4YTFA 4IB0A 3FQHA 3C4CA 3T3VA 4CRSA 1OIRA 4PDOA 3FLNC 2WMVA 3KL8A 2WOTA 3TDVA 2YISA 4XYFA 4WG4A 3PVWA 5TOZA 2FA2A 4CV8A 5KMLA 5IMXA 2PVRA 2ITOA 3KEXA 4NH1A 3TM0A 3ETAA 3F7ZA 2W1EA 4D9UA 3VAPA 3C4FA 3W2OA 5T68A 3OZ6A 5IQDA 2C6IA 3A2CA 2BRBA 3HA8A 4H3BA 4F99A 3FAAA 2C3KA 5TO8A 3RCJA 3ZUTA 4MXZA 3OXTA 4EH7A 4IZAA 2OFUA 3QUPA 5IA1A 3D5XA 5I9WA 3NYOA 3BEAA 4HYHA 4IAAA 3AT4A 4YZ9A 4K33A 4D2SA 3QF9A 1UKIA 4OLIA 4Y8DA 3DK7A 4FIGA 3MBLA 3D4QA 2OJFE 2XJ2A 3IOKA 5EM5A 4F9CA 1B6CB 1W83A 3PE2A 4EOMA 5AUTA 3AD4A 5TR6A 2ZB0A 4DH3A 2QKRA 4PP9A 3QD0A 3RMFA 1PHKA 3VO3A 2OIDA 2GU8A 4RWLA 3QKKA 1OB3A 3MH3A 4MEDA 4PY1A 2VN9A 4MAOA 3VUTA 2VNWA 4FKQA 4IHPA 3NWWA 5AADA 3GC7A 1UV5A 1GNGA 1BMKA 3K54A 5CVGA 3NZ0A 3QRKA 2VWZA 4G3EA 2Z8CA 5HKMA 3E87A 4QMMA 5DHJA 2HXLA 2JKQA 3VBWA 4BI0A 3UOJA 1Q3WA 4O81A 3OCTA 4GJ2A 4L44A 3SXSA 3MYGA 1XBCA 1YOLA 5IQFA 3R22A 2ETRA 2J6MA 3P78A 1YHWA 3OMVA 3C0IA 5DBXA 3RPYA 3RZBA 1APME 5M09A 5CS6A 1G3NA 4JT3A 5HCYA 4EH8A 2BIKB 5A4TA 2CGUA 2W4OA 4HCTA 4FTOA 2R7BA 3M1SA 2OFVA 1BKXA 4UBAA 3OROA 3NUXA 3RHKA 4CYIA 3W16A 5BUIA 3FXWA 5CF4A 4LMNA 4IWQA 3F2NA 5HG9A 4YU2A 5IUGA 4RSSA 3N4UA 5M57A 3UG1A 5IQBA 1P2AA 4YJPA 5BVKA 4NM3A 4DBXA 1JNKA 3PJ1A 3V8SA 3NUSA 3G6HA 3LOKA 3CLYA 2B53A 2GNJA 2WZJA 1YHSA 5D41A 5GINE 2QOCA 2P0CA 3OCSA 4TYJA 3G0EA 4YZCA 4ZSGA 3OWJA 2B7AA 3HZTA 4YLLA 2VWVA 1PRYA 5C4KA 3UTOA 4FUXA 4JRNA 4Y95A 4A9YA 2BCJA 2PVKA 4JX3A 5DH3A 3FLQA 4HYSA 3ZDUA 2I1MA 5IH6A 3VJOA 3H9RA 5IKWA 3UQGA 4UWCA 2WFYA 4LMUA 4O82A 4M3QA 3G5DA 4RJ3A 2C0IA 5AM6A 5IPJA 2WELA 5GJGA 4HCUA 4QTAA 4RC2A 3TKUA 4E93A 3E93A 1CKJA 2HXQA 5CSXA 1YXSA 3SX9A 5IA3A 2C5OA 3OCBA 4ZTSA 3MVHA 4O96A 3ROYA 3RTPA 2YM4A 3FI3A 3P86A 2B9FA 3V04A 3LXKA 4XCUA 3R9HA 4BDCA 2UW8A 4FEVA 2QO2A 1Q62A 2XEYA 3QKLA 4C7TA 2YIYA 3ORNA 3MH2A 4KS8A 3LCDA 3GVUA 3QTSA 4MBJA 3POOA 4A4LA 2FSLX 4AE6A 4IWPA 4C62A 2EUFB 4DH5A 1XH8A 1ZY5A 2J9MA 3NNVA 4H39A 4RFYA 3MTFA 4QPMA 4FR4A 3ZOSA 4DFZE 4RZWA 3LE6A 1J91A 5JT2A 3P0MA 2GQSA 3Q4CA 4UALA 3VS1A 4RX9A 4DH8A 5A6OA 4N6YA 1OGUA 2OG8A 4MBLA 1FMOE 3ORTA 1Q41A 3TNHA 1VJYA 3TZ9A 3T9TA 2C5NA 3QTZA 2WU6A 4RJ4A 1Y6AA 3R9DA 2UZVA 5A3XA 3DBCA 4DLIA 3EZVA 5HO7A 3LFQA 4BYIA 3U6IA 1CDKA 3FZRA 4O0XA 3MFUA 5CENA 3THBA 2ZJWA 2PUNA 2OSCA 3EJ1A 5D10A 4V0GB 4XMOA 4C37A 2VTOA 1O9UA 2R3OA 4USDA 4A07A 4E7WA 3A62A 4TPTA 2GMXA 3PVUA 4YTCA 2EB2A 3ZO4A 4GYGA 4YGAA 1E1XA 3WZKA 3LQ5A 2B52A 2UZBA 4QD6A 3PPKA 3BYSA 2UZEA 5KUPA 4G34A 4O7WA 4Q9ZA 4WRSA 1V0BA 1IAJA 3HP5A 4FSYA 4Y73A
chains in the Genus database with same CATH superfamily
3OW4A 5I9ZA 4NW6A 2W1IA 4FKSA 4CG9A 5CYIA 4IBMA 4AGUA 4E6AA 3L8PA 2GHMA 3B8RA 3NS9A 3G51A 4FEUA 4ZJIA 4FTLA 5IQCA 4IM2A 2P2HA 3KF4A 4TZRA 2Q0NA 4O0RA 2XBAA 4AAAA 5BVNA 5CEMA 2BTSA 3E88A 3GCQA 2R0UA 3FI2A 2Z7RA 3S00A 2BHHA 3GXLA 1XH5A 1P4FA 2OW3A 4YLKA 3VNTA 3WZJA 2C6TA 3R8ZA 3DAEA 4F7JA 2F49A 4HOKA 5IH4A 3ZRLA 5I9VA 3C9WA 5FP5A 3AC8A 3OUNB 4UZDA 3OT8A 5HU3A 3GEQA 2G9XA 4HYUA 4QTCA 3DOGA 4I6BA 4ZJJA 4D5KA 4PTGA 3WILA 2GQRA 5HD4A 2PE1A 2W7XA 4LRJA 3AGLA 4PPAA 1PF8A 4V0GA 4F1TA 2UVYA 3OG7A 2W5HA 3AQVA 2QHMA 3I81A 4P2KA 2OK1A 4P5ZA 4FEXA 5LARA 2GNLA 4WIHA 5FGKA 3CTJA 4QTEA 4B9DA 4XJ0A 2EXCX 1CMKE 4FKUA 4FNWA 3DXNA 2O65A 4PUZA 1PXKA 3HRCA 4OTPA 4EH9A 2YN8A 1VR2A 3DT1A 4W8EA 1NW1A 2BHEA 2YERA 5DRDA 5HCXA 2A0CX 2YAAA 3EQPA 3QRUA 3G2FA 3FSFA 3FZ1A 4FA2A 2BFXA 2UW4A 3F82A 2WQMA 1B38A 2QO7A 3C5UA 3TKIA 5K4IA 4FTCA 4CFNA 4UV0A 4EWQA 4G5PA 5AEPA 2OXDA 3O8UA 4G6OA 4LFIA 3CQUA 5DPVA 5F95A 5KKRC 1GIJA 5K9IA 1JAMA 4HNIA 3LIJA 5L6PA 4R6VA 5A54A 3TZ7A 2W1CA 4CFWA 2OF2A 1UWHA 1YDSE 5HOAA 5GIPE 3AC4A 3DNDA 4FV6A 4IWOA 1W7HA 4R7HA 1HCKA 4ASZA 4KKEA 2PY3A 4C02A 5K0XA 2PE2A 3HGKA 3PXYA 4RIWB 4BDKA 2ZV9A 5AV2A 4NIFB 4ZTLA 1F3MC 1BUHA 1NT2A 3H9FA 4TWCA 2ZDTA 3MVLA 2ITVA 3V3VA 3QC9A 4CMUA 3V8WA 1XR1A 3PUPA 4WKQA 3KF7A 2IVSA 3PPZA 1PXNA 3V5WA 4L8MA 4E5AX 3W0QA 4E6CA 3C4EA 3I6WA 1MRYA 2QR7A 4QMPA 2OJJA 3FSKA 3BE2A 3IS5A 1H0WA 2VZ6A 1TQMA 2ITXA 3IW4A 2WQBA 4IVCA 4WBOA 4I21A 4AZVA 3LCKA 4CVAA 4HVIA 5HEZA 5FDPA 3TUDA 5HESA 4RG0A 2JLDA 3OWKA 1Q8ZA 1VEBA 3HLLA 2RG5A 1ZYSA 1H28A 3UMWA 3TDWA 4BFMA 3LFFA 1ST0A 3A7JA 3IW8A 4KWPA 3A7FA 4AT4A 4FK3A 5IG1A 5JFSA 2P55A 5DLSA 3FZSA 5FTGA 1ZYLA 4H05A 4GKHA 3ORKA 4FSZA 1GIIA 3ZO3A 3TUBA 4XV1A 2XAOA 4NT4A 4FZ6A 4IB5A 4BIDA 4EK4A 4YMJA 4FKOA 1MRUA 3WARA 4BYJA 3KA0A 1XQZA 2G2IA 3BV2A 3LQ8A 4D28A 4FIFA 3RP9A 3LFAA 3BEGA 3V5QA 3GU5A 4ZIMA 5AUZA 4ZMFA 2W05A 4YJTA 4E26A 3E3PA 4EUUA 4OTHA 5IA0A 1DI8A 3R1YA 2YM5A 1O6YA 2GNHA 3I0OA 4M67A 5ACBC 4NFNA 2I0EA 1DM2A 1Z9XA 3MJ2A 5AP2A 1FGKA 5FXRA 4MH7A 2IEWA 5D12A 1J7UA 4XG9A 1Z5MA 2Z7SA 4B7TA 4DT8A 3FHIA 4EZ5A 3Q9WA 5DT3A 3UVQA 4ERWA 5I9YA 1G8JA 2WNTA 4HZRA 4BBMA 5C9CA 3E7OA 2VTPA 2ERZE 2OGVA 5J5SA 4FZAB 4RGJA 3D2IA 3UOHA 5DE2A 3KXXA 5EDPA 5HG8A 3A8XA 4FKGA 3IECA 3MB6A 4ZZNA 4QMUA 2JITA 5KHXA 4RIYA 2IG7A 4YHFA 3PG3A 1YOMA 3MPAA 4R77A 3G6GA 3IOPA 2IW6A 4XG6A 3FI4A 4QPSA 3RKBA 4GU6A 2CCHA 2QOBA 4BBFA 2Q0BA 3G15A 3CJFA 4OT6A 4ENXA 1B39A 2OKRA 2YZLA 3PXQA 4J8MA 2R5TA 3HMPA 4X2JA 5K0KA 4IB1A 4UYNA 5HE1A 3RAIA 3B2TA 3ZTXA 4DGMA 1AD5A 3V5PA 3QBNA 3TMOA 3QQJA 2VWBA 5J8IA 5L6WL 4ALUA 3CTQA 1YXVA 3UE4A 3NX8A 4IANA 4Q5HA 3ZRMA 4CKJA 1Y6BA 3R30A 3DAKA 4A4XA 4LOPA 2PMNX 4I5HA 2OU7A 3JYAA 4R8QA 2W1DA 2NPQA 2G01A 4I5PA 1H24A 1KE7A 3CBLA 3EQRA 2ITNA 3S95A 2GS6A 3EFJA 4BCJA 1Q4LA 2W96B 3RWPA 1TFFA 3GU7A 4I20A 4X3FA 3TZ8A 4ZAUA 4X2FA 3T9IA 4OUCA 4W9WA 4GVJA 4O21A 3R7IA 2AC3A 2WU7A 3ZU7A 3VRZA 4AGWA 5LMKC 4ACHA 4JXFA 4TNDA 3K5VA 3P1AA 4NCTC 4QYFA 3Q9YA 5AR2A 4RLLA 1QCFA 4IM0A 3FI8A 3UBDA 1BL6A 3PFQA 4X7QA 3HVCA 4RX7A 5JZNA 4DH1A 3CD8A 4U3ZA 2YDIA 1UA2A 3DTWA 3LFEA 4BWPA 4AXEA 3G90X 4W8DA 2OZAA 3UIMA 4FL3A 1ZLTA 2QHNA 3NUPA 5FTOA 4D9TA 1OKYA 4BHNA 5BNJA 2Y7JA 3DBDA 4P4CA 4NJ3A 4C4IA 5JGAA 5BMSA 2G1TA 3A7IA 4RWIA 4UXLA 1KOAA 4XEYA 2O64A 5CEKA 4MBIA 4GYIA 4U9AA 4HPTE 4ZZMA 4ASEA 2O3PA 5J1VA 4DF3A 2UUEA 3KRWA 3CXWA 3MSSA 4MD8E 4X3FC 4J53A 3HV6A 1YOJA 2ZV2A 4A4OA 1M7QA 1F0QA 3LFNA 3F2RA 2ACXA 2UW3A 4DEEA 4GJ3A 4XG8A 3MI9A 3F88A 3NYXA 4RC4A 4BZDA 4PL5A 3ZLSA 5EFQA 3FMEA 5AX3A 3BGQA 4YC6A 4O27B 4NCTA 3PA5A 2YZAA 3V51A 3GCSA 1CKPA 3EYGA 2GDOA 2IN6A 4FT5A 1ZMWA 4QMOA 3F5XA 5EI8A 4HYIA 4CFUA 2EXEA 3AMYA 4PMPA 2PMLX 3QZGA 4DTKA 1XKKA 3FKNA 2WTCA 4KRDA 2IW8A 3U9NA 2X39A 4QNYA 5CU3A 4CQGA 4ERKA 3FL4A 4O2ZA 2BZHB 2WMTA 3OOGA 1H1PA 3A7HA 5HD7A 3VVHA 2X1NA 5HE0A 4F6WA 5KMIA 2A1AB 4EI4A 1A9UA 3HAVA 3QRJA 3D2KA 5HTIA 4BGGA 3NVKI 4II5A 2ZM4A 4GT4A 4ALVA 2CDZA 5I3OA 1CTPE 1KSWA 4FV4A 4Z55A 3R0TA 2PUPA 3ITZA 2CGWA 3LCSA 4LGGA 4LUDA 3E92A 3NNUA 3RPVA 3U9CA 3S4QA 4PWNA 2WMAA 4HPUE 1BLXA 4DG0E 4AZEA 4TYIA 2BZKB 4C36A 5HGIA 2F9GA 4FTMA 3ML1A 5CU6A 4M12A 4F7SA 1YXXA 3VBXA 1XMLA 2C0OA 4FSRA 2BAJA 3VUIA 1Y8YA 3JR1A 3HP2A 4I22A 3GENA 4GUEA 4FIJA 3NEWA 5HO8A 5A4QA 1ZYDA 4QMNA 3F6XA 4ZTNA 5ANOA 4C59A 3KXNA 2GCDA 2IW9A 1I44A 3F7WA 4DGGA 4I0RA 5A6NA 1OL1A 3JVSA 2C5YA 3KMMA 4IB3A 4JL9A 5AAEA 5M53A 3BHVA 4DA5A 3S1HA 2C6KA 2CPKE 1XWSA 4L46A 1KOBA 3FLWA 4FRFA 4O6LA 4WD5A 2BROA 3AMAA 4UMTA 3V5TA 3CR0A 2XYNA 4AFEA 4ENYA 1W2CA 3K5UA 3FPQA 3UDBA 3DKGA 2V22A 3ID6C 3ZO1A 2REIA 1WCCA 2E9NA 3DDPA 4U43A 4G3CA 4D2PA 5J1WA 4ANBA 3EN5A 2FUMA 3SRVA 3RPRA 4Z7HA 5M44A 1AQ1A 4JG6A 2OIBA 4QP8A 2Y6MA 3VUDA 2NP8A 4EHVA 3UG2A 3UZPA 4XG4A 4WHZA 1PXLA 4Y72A 5DRBA 2J0JA 3ANRA 3CY2A 2QOOA 1GZNA 4Y85A 1IA8A 3ORZA 4FTIA 4BDAA 4O7SA 4ZS0A 5AM7A 5FBNC 2ZM1A 2HCKA 4YPDA 4FBXA 2F7EE 3RI1A 3KQ7A 4R5YA 1TQIA 3AKLA 3FLZA 4C4FA 4M69B 1M2PA 1V0PA 1DS5A 4R3RA 4RWKA 3HV5A 1PMEA 5CAQA 3QXPA 4UB7A 5J9LA 4J96A 5EQYA 3IKAA 4E4NA 3BLHA 4JS8A 2VWIA 3BU6A 1OITA 1WBNA 5L8KA 4E4LA 4JOAA 1OIUA 3BU3A 3HX4A 3C7QA 2WMBA 1JQHA 4TYGA 3ZO2A 3FLSA 4L42A 4D1ZA 4JLCA 5CNNA 2GNGA 3JXWA 3DGKA 3V5JA 2R3NA 3D7ZA 2ZV7A 3HAMA 3NYVA 4FV3A 3R9NA 4QDVA 3R1NA 4EHEA 2OWBA 3QRIA 3CPBA 1ZMUA 4K9YA 3R7OA 3QTXA 4BDEA 3FMKA 4C2WA 5HORA 3HUBA 3QCYA 5EYMA 3SA0A 5E8TA 5CEOA 3ZM9A 5H9BA 2WO6A 3NSZA 5ANEA 5M08A 3V6SA 3WF6A 5EDQA 3PRFA 5CSPA 4PPCA 3KVWA 1YKRA 3AD5A 4FZ7A 1OPLA 3FZOA 3Q52A 4KKHA 5BUEA 3DJ5A 3M11A 3NMUF 4C3PA 2HIWA 3KULA 2PMIA 4BCHA 3FLYA 1FQ1B 5CI7A 3ZZWA 4YUQA 5LOHA 2IJMA 3ZEPA 4ZLZA 3EOCA 3A8WA 4AZWA 2JBPA 4TRLA 4EK3A 3MV5A 4XBRA 4XG2A 5TKDA 3ORLA 4HW7A 5IDNA 3MA6A 5JFVA 4QEBA 1QPCA 3QTWA 4ACDA 2VTAA 4JQEA 4RVLA 2J2IB 3LW0A 3OFMA 1YI3A 2FYSA 3Q04A 3FC2A 4BGHA 4IVDA 4QMVA 3C0GA 4DH7A 4DTAA 4MKCA 1PKGA 5EI2A 2Y4IC 1RJBA 2DQ7X 3MPMA 3P5KA 4FIEA 1CSNA 2CKEA 3T8OA 3GC8A 4D1SA 4R1YA 4FEQA 5KMOA 2PZYA 3TYKA 4V01A 4KIPA 1KV2A 2R9SA 2AQXA 4UY9A 1H8FA 3VS0A 4XLVA 2X0PA 2Y4IB 3GT8A 4WG3A 4EL9A 4IJ9A 2EXMA 4IAKA 4UWYA 4RJ8A 3UDTA 3UC4A 3H3CA 3UGCA 3QALE 5B0XA 4P7EA 4AA0A 4O7LA 3IQ7A 3TJDA 5I4NA 4I0TA 1JSVA 1H1QA 4NWMA 3E62A 3RBWA 4F6SA 5JFWA 2J7TA 3QU0A 3LAUA 3LMGA 4JMQA 5F4NA 5GIOE 2CLXA 2ZM3A 3W2PA 5GZAA 3EN6A 4IXPA 3U4UA 2W5AA 5EHYA 1OM1A 1W82A 4MK0A 4RZVA 5KZ0A 3SC1A 3RAWA 4OTDA 5M07A 2WD1A 1XH4A 1OI9A 3A61A 5C03A 1CM8A 4GUBA 2UZTA 3EN7A 2VRXA 3QZFA 4L7FA 3TJCA 4ZSAA 3WE4A 4BDJA 4ORKA 1DAYA 3R2YA 4KIOA 5IQAA 4YTIA 3WYYA 3NW6A 3O2MA 5CX9A 4CYJA 4CMTA 3UQCA 4LM5A 3OY3A 5EHLA 3CEKA 4YJOA 2JDTA 2RG6A 2WKMA 4EOLA 3H30A 2X6EA 4I6HA 3R1SA 1REKA 4FTKA 4BF2A 4QMZA 3KXZA 1H01A 2ZAZA 3OXIA 4CXAA 4AXFA 4EK5A 4ZSEA 2BRMA 3EHAA 2YABA 2XZSA 4GV1A 3FJQE 5IEXA 1KWPA 3MN3A 1BX6A 2VTLA 4FTNA 2XCKA 4WSQA 1EH4A 3C4ZA 4AXDA 4WOVA 4AP7A 3GOPA 3LFCA 5EG3A 5B7VA 4BZOA 4M0ZA 5HU9A 3A4PA 2A98A 2WAJA 4L9IA 2VO3A 5IUHA 4G5JA 4JDKA 4CZUA 3SRVB 2OF4A 3DS6A 3H0YA 4GU9A 4Y5HA 3LVPA 3SDJA 4YJRA 2ITPA 4GKIA 4JR3A 2C6DA 4DT9A 3PRIA 5FM2A 5E8SA 1OL2A 5LXMA 2F57A 2PPQA 3W0OA 2BRGA 3VS7A 3ZHPC 5CT7A 1M7NA 5CWZA 1IRKA 4IX4A 5B2LA 3O96A 1ZARA 2R3IA 2X4ZA 5ETFA 4IZYA 3ORXA 4I4EA 4G9CA 3BYMA 4O22A 1MQBA 4RRVA 2PULA 4M97A 3KVXA 3PIXA 2JBOA 1KV1A 1ZAOA 5CALA 3DXQA 3BHTA 4DDGA 2ZB1A 3HYHA 3R8LA 5AUYA 2IZUA 2J0LA 4IVBA 2VX0A 5DG5A 3LM0A 2FSTX 4O4CA 3ORIA 4AACA 4ITJA 5BMMA 2XYUA 4JG8A 2PZIA 1XMMA 5CU0A 4H1JA 4C34A 4XRJA 4LRMA 4R1VA 1NA7A 3EFWA 3PJCA 4RQKA 4XLIA 4MHAA 3ZSIA 4BDHA 3ZBFA 3TIYA 5IZFA 2BZIB 3HMNA 3BL9A 4WRGA 2ITWA 4M69A 4BDIA 4FYOA 2UW6A 4J71A 4F64A 4O0YA 2YIXA 4PMSA 2OJIA 5ACKA 3F66A 4NM7A 3QXOA 3DB8A 1XBBA 2GQGA 3R6XA 2XMYA 3AC3A 3MS9A 2W17A 1NXKA 3PTGA 1JPAA 3R1QA 4F9AA 3BRBA 4UWBA 3HUCA 3Q4TA 5CF6A 5C4LA 1LEWA 3BLQA 4UMUA 2BDWA 4FV2A 4PF4A 2YA9A 2DS1A 3C50A 2AUHA 1NVRA 4W4VA 2QQ7A 3QQUA 3ATSA 4JJRA 3OWPA 4O0TA 3HL7A 1LUFA 4I94A 2V0DA 4XH6A 4ANMA 4ACMA 4HVSA 4CFXA 5CAUA 5KMMA 4GW8A 4MNFA 3BHHA 2BAKA 4XUFA 3PY3A 4AT5A 3BYVA 3MFTA 4L52A 2XUUA 3QD2B 2C1BA 4FKRA 4I92A 4G1WA 1NVSA 5KCVA 4YSJA 1WBWA 3GQIA 3Q60A 3PIZA 1FMKA 3ZLXA 4QQTA 4CTCA 4YURA 2NRUA 1Q99A 3ZH8A 3R2BA 5K5NA 3AT2A 3VF9A 4MD9E 3ZYAA 1PJKA 5FQDC 2Y6OA 3FMLA 2YJRA 3F69A 4FTJA 5AJQA 4JIAA 1I09A 2W9FB 3VC4A 4FVQA 2Z7QA 3MW1A 4IEBA 5EH0A 5EQPA 2F7ZE 2C3IB 2XF0A 1H07A 3B2WA 1W98A 2KULA 3O8PA 4I3ZA 4DFLA 4OTGA 2I0HA 2XNOA 4ANOA 1OBGA 1Y57A 3EQIA 4WNPA 1H1SA 2VTQA 5FDXA 2CNQA 5KO1A 3PZHA 3FQEA 2JKOA 4H58A 4MXOA 1UNGA 1ZOEA 4P90A 3TTJA 4CKRA 3N4VA 2CJMA 4V04A 2J5EA 2JAVA 2YCQA 3P08A 4XNEA 4HVDA 4AZSA 4PL3A 3QFVA 4OAUC 4NTSA 4TXCA 4ANSA 5H8BA 2OIQA 3LXLA 3QTUA 1WVXA 2WTWA 2YM7A 5M55A 1ZOGA 4A9SA 4DINA 4AS0A 2V55A 3TV4A 3E64A 4IC7A 4O1OA 1OMWA 3OVVA 4ZSLA 3UOLA 4MXYA 4PQNA 3CE3A 4AN2A 3DJ6A 4CRLA 3LFSA 2SRCA 2GTNA 4CTBA 1SVGA 2YIRA 4FVRA 4ONAA 4D1XA 5E1EA 4P5QA 4BVUA 3NIEA 3NUUA 3VJNA 4FSQA 3VQUA 5JRQA 4HGTA 3RWQA 5CF5A 3BPRA 5CSWA 1SYKA 2R3FA 3BQCA 5LMAA 3VRYA 3QCSA 5AAFA 3BWFA 3R8UA 4BTMA 2R3JA 5I5ZA 1KE5A 2XNNA 5IQGA 4QMYA 5C8NA 5CSHA 3RALA 1JKLA 5BVWA 3ZM4A 4AF3A 2UW5A 4AGDA 4U42A 2WTVA 3UPXA 4FICA 2VWUA 3TIZA 4PMTA 1JKSA 3U8WA 1GAGA 1JOWB 4M68A 4ACGA 4FC0A 5HNIX 1QPJA 1GZKA 3NFFB 2PYWA 1OKVA 1RE8A 4DGNA 2C3JA 3FZPA 5HLPA 3IDCA 2YM3A 2UZUE 4K0YA 1R39A 1Q5KA 3EL7A 4G2FA 5GHVA 3WE8A 3W8LA 1G8AA 4PNIA 3B8QA 3ZS5A 1U46A 5JKGA 3UO5A 3KK9A 5AP1A 1PXIA 2J51A 3V5LA 4FG7A 4U0IA 2X9EA 2XKEA 3L8XA 4QMSA 4R7IA 2YITA 3BGZA 4ZLYA 1WBOA 2C5XA 2QOQA 5HLNA 5BVDA 2JDRA 4DCAA 4FVPA 3PJ3A 4EQMA 3DTCA 3GQLA 3QX4A 4NYEA 2JIIA 3LJ2A 5IA2A 3FYKX 4PRJA 3PIYA 5IMEA 4BJJA 1JWHA 1OUKA 3W2SA 3WF5A 4IFCA 4XX9A 2E9PA 2X2MA 3QZHA 4IFGA 4JG7A 3HMMA 2XP2A 5EI6A 3COKA 2O5KA 1U5RA 3UQFA 5CVFA 2R2PA 4BDGA 4KAOA 5FG8A 1WVWA 4ACCA 4BR3A 2G15A 2HZ4A 4LRKA 4MTAA 4DE4A 1MUOA 5A14A 4JDIA 5CEIA 1H0VA 4ZXTA 1RW8A 3H10A 1RDQE 2RFDA 4FV0A 4HCVA 4N6ZA 5LCJA 4RBLA 3KU2A 5CXZA 1YWVA 2VU3A 3D14A 3CJGA 4U44A 1H25A 5FUTA 4YPSA 4YTHA 4XV2A 3F3ZA 4WNKA 5FEDA 5AAGA 4I0SA 1OL6A 4HVGA 3FMHA 3UMXA 2GTMA 2WQOA 4B8MA 4FIHA 4S33A 4F1OA 3F5PA 1UU7A 2PUIA 4O0UA 4DTBA 4RIOA 1WVYA 3QLFA 4FKLA 3GFWA 4FJVA 4D0WA 2QNJA 5IF1A 2C6LA 1VYZA 2QI8A 1URWA 3EWHA 3NCGA 4BCFA 2JC6A 1OUYA 4HGEA 3KRRA 5AP7A 3R21A 4Q9SA 4XG3A 1L3RE 3RGFA 4WT6A 2PWLA 3CY3A 2PTKA 3MB7A 2VV9A 3E3BX 3KXHA 4H3QA 3C5IA 5HIDA 2QG5A 3TG1A 2YWPA 3U54A 2V5QA 5DMZA 4USFA 2UZLA 2WGJA 4OTIA 4BDBA 2ZYBA 3ERKA 2UZNA 4QP3A 4Q5EA 3EQHA 5HE3A 1ZRZA 4DLJA 4DHFA 2OI4X 4O4EA 4Z7GA 1ZOHA 1KUTA 4DFYA 3W0SA 2R3HA 5ETAA 3DFCB 1ZWSA 4NM0A 4QP7A 4ZTMA 4O83A 3ANQA 2P3GX 2QU5A 5EW3A 3W0NA 1ZMVA 3RM6A 1MQ4A 3MH1A 3U4WA 5DYJA 4DFBA 3IW7A 4O7TA 4FUYA 3L1SA 4GSBA 3SOAA 2WQEA 4FF8A 3VUGA 5E8ZA 4E5BA 3CIKA 3P79A 4C8BA 5KKRB 3R83A 1J7IA 3MESA 4JIKA 4PV0A 4KSQA 4N4SA 5EK7A 5HQ0A 2OICA 2RF9A 2XJ1A 4TN6A 1MP8A 2UV2A 1BYGA 3R7YA 1XH9A 3PVGA 4FSTA 4X3JA 3UNKA 3ET7A 2JKKA 3TUCA 5E8WA 2QLQA 3R8PA 4N0SA 4NFMA 2ZV8A 4A7CA 3MY1A 3TI1A 3JY9A 5C1QB 5H8EA 5TT7A 5KBRA 2C6EA 5ITAA 3WZUA 3GP0A 4UMQA 4DEIA 4L3JA 1OBDA 2H34A 3R9OA 2ERKA 3AGMA 4WSYA 5IISA 3LMIA 1R78A 3PLSA 3WZEA 4M66A 5J9YA 3COMA 4YO6A 3TEIA 4E6DA 4GT3A 4U79A 4WG5A 3NAXA 2C3LA 4QMLA 3ZCLA 1JLUE 3EFLA 5F20A 1L8TA 3ZZEA 3SXRA 2BAQA 4L7SA 1IAHA 4BRXA 1Q3DA 2DYLA 3PWDA 4L67A 5EW9A 5HO6A 2XALA 1QL6A 4IH8A 5E90A 5LWNA 3POZA 4K2RA 5C01A 3R7UA 4BTFA 3F3UA 2WMQA 4JI9A 4Z3VA 2C5VA 2FSMX 3P5JC 1ST4A 2BRNA 3JY0A 3KXMA 5M4FA 4JBPA 5DR2A 1YDRE 4MD7E 1O6LA 5E4HA 2F2UA 4KIKA 4EOQA 4MNEA 4F70A 2W1ZA 3R00A 3TXOA 4ANQA 4QTDA 2W1HA 2XM9A 2YHVA 4FI1A 2R0IA 3OW3A 4F7LA 2R3PA 4M0YA 3DBEA 2HWPA 4FOCA 4EYJA 4NIFA 4G6LA 5LVNA 3PSBA 4L6QA 1YI6A 3ZSGA 2Z02A 2C0TA 4O0VA 2WMXA 4QYEA 3VW8A 2OZOA 4FL1A 5ETIA 4DEHA 3PZEA 3EB0A 5L2WA 1T46A 3LJ1A 2R3MA 2WOUA 2FSOX 5HNGA 4D4SA 4DC2A 4E4XA 4GK4A 4UN0C 3AXWA 4F9WA 3Q2JA 1HCLA 3F2AA 3BZ3A 4QYGA 5LVPA 1PXOA 1UU9A 2XRWA 4RWJA 3O50A 2DWBA 2VAGA 4LV5A 4WUNA 5BUJA 4IX3A 4CNHA 2QOKA 4PTCA 5I9XA 1H4LA 3QZIA 1FVRA 4XOZA 5AP0A 2OH4A 3EFKA 3IO7A 4KABA 3TCPA 4EHGA 4YBKA 4RIWA 3SD0A 3OP5A 3IGGA 4JNWA 4DFXE 5AV4A 5I0BA 2OO8X 4YJUA 3LPBA 4KNBA 2GFSA 5K4JA 5CXHA 1H27A 4TY1A 4XRLA 4D2VA 3ZLYA 3FC1X 2AYPA 3DKCA 5I3RA 4Z9LA 5TE0A 1XJDA 4MNEB 3GU8A 4OBQA 2X81A 3BQRA 3OEFX 3EIDA 3SXFA 1W0XC 5HTCA 4O4FA 3QQLA 2BPMA 4S32A 4BJJB 4FTUA 1YQJA 4GIIA 4IACA 4L45A 5AP4A 2O0UA 3WIKA 4XG7A 4EORA 1E9HA 3I6UA 5EKNA 3PVBA 4ALWA 5BYYA 3ZXTA 3E8NA 4QP6A 1TVOA 5CSVA 2XK7A 5H3QA 1ZYJA 2WMUA 3PJ2A 4FKTA 5LVMA 4N57A 2ZMDA 3RJCA 2UZDA 3LXPA 4S31A 2BMCA 2F7XE 4FKVA 3F3TA 4IC8A 4F0FA 4BICA 1H26A 2JIVA 1AGWA 2A4LA 3Q9ZA 3R7GA 1PW2A 4FG9A 4J1RA 3R9RA 5AR4A 4UXQA 3O7LB 5BVEA 5JEBA 3U6JA 4AW2A 4U40A 2E9OA 3WIGA 3NPCA 3UYTA 4C4JA 3Q6UA 2VTRA 5LVOA 1SM2A 3ULIA 2VX3A 2FH9A 3M42A 3O8TA 2BILB 5EHOA 5LVLA 2XNBA 4BCOA 2V7AA 5D1JA 3OUKA 4RIYB 1WBTA 4WBBB 1UVRA 2QVSE 1R0PA 2V7OA 3QYZA 5AV1A 4NUSA 4E20A 3BL7A 3GUBA 4FOBA 4ARKA 4U5JA 1WMKA 3NNWA 4NZWB 4CCUA 4U6RA 2YAKA 4U45A 4GFOA 3E7VA 2WMWA 1Q61A 2IZRA 4JRVA 5HICA 2CLQA 4IM3A 2W0JA 4C4GA 3WBLA 4GT5A 2CGXA 4KRCA 4DG2E 3FY2A 4GK3A 2RL5A 4X21A 3FV8A 5IA5A 1U54B 3QRTA 5HZNA 1Y91A 2J0IA 5JSMA 4YJSA 3QCXA 4ZY4A 1K9AA 3OY1A 5EM7A 4PTEA 3Q4UA 4ASXA 3I1AA 3I7CA 3A4OX 3W55A 1YRPA 3BCEA 4L53A 4YHTA 2XNEA 4F7NA 4E8AA 3KY2A 4FV5A 1G8SA 3BIZA 2OJ9A 1WBPA 4DCEA 2RFNA 4BY9E 4BBEA 3KGAA 3PY0A 3CCNA 4QYHA 5L2QA 4BCGA 4FEWA 2XS0A 1H08A 4MWIA 2Y9QA 5L2IA 3KRXA 3LJ0A 4YBJA 2OZAB 2C6MA 2FO0A 1IG1A 3PP0A 2QOIA 4X3FB 4DG3E 4UMRA 3GC0A 4YNOA 4RJ6A 4YO4A 4JQ7A 4QDEA 5FEEA 1WAKA 3BBWA 4C33A 4D2TA 2BZJA 3DK3A 2YIQA 3ODYX 4CEGA 5AR8A 2P4IA 3DKFA 4Y83A 4NEUA 4QO9A 2GS7A 5HBEA 4E6QA 5L6OA 4XP2A 4UEUA 2WIHA 1OL5A 4EWHA 1OIYA 4W4XA 3D5WA 5JFXA 3CQEA 3L8SA 5CTPA 2PE0A 3W10A 3W32A 4AX8A 4BDDA 5M06A 1FOTA 1K3AA 2IZTA 2W4JA 4NTTA 3NNXA