4J95A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic k659n mutation responsible for an unclassified craniosynostosis syndrome in space group c2.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
279
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIYYKNTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 279
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j95A01
5IUGA 4MXCA 4IAIA 1MUOA 2QHMA 4L53A 4ZJVA 1KE8A 3QQKA 4GG7A 4QNAA 4NJDA 4LGHA 2ITPA 3UO4A 3COHA 3C4FA 5IUIA 3AT3A 3K54A 4R3RA 2HW7A 5CT7A 3QXPA 2RF9A 4ERKA 3QHRA 2ZVAA 4K8AA 2VX3A 3O0GA 2PVRA 3UVRA 2OZOA 1GY3A 2XJ0A 4HJOA 5C01A 3DS6A 4MH7A 4MNFA 4HOKA 3OS3A 3KVWA 4TL0A 5A4TA 1XH7A 1R1WA 2IVSA 1UWJA 5FLFA 1WBSA 4C57A 3GU6A 4DG0E 1RW8A 5EM5A 3QCSA 5CTPA 3TZMA 4W8DA 1CKPA 3IW7A 3FXZA 3QCYA 4IZAA 3KEXA 2B4SB 4RX5A 2IZTA 3BGQA 3R8VA 1H1RA 4D2SA 1H00A 4DEDA 2BHHA 3RHKA 2XM9A 4EH5A 5K5XA 1KOAA 1XHAA 3JPVA 3EHAA 4FTUA 4W9WA 4ZSAA 5E8UA 4AZEA 3VUGA 2BDJA 5JZJA 2IJMA 5DA3A 2QG7A 1JOWB 2RSVA 2QLQA 5HG7A 5L2IA 1DAWA 3FQEA 3JY9A 1REJA 2OSCA 3AQVA 4D9TA 5TR6A 2PVKA 4FNZA 4GUEA 1JKTA 4IQ6A 2VTRA 5AR7A 4CV9A 4DGMA 4R3PA 2OWBA 3P4KA 2GNLA 4ASDA 4UN0C 4IHPA 5IQBA 3FBVA 3BHTA 2HXQA 3ZUUA 1YXSA 2WQOA 1OPJA 5IU2A 3NVKI 4JDJA 4UZHA 1NVRA 2X7FA 2VRXA 3DK6A 4C2VA 4K1BA 4ZTLA 3SKCA 3ZBFA 5C26A 3NCZA 4KAOA 4EUTA 3CD3A 5AADA 3F7WA 2PVLA 3AC1A 3CS9A 4N4SA 2J0IA 5HO6A 5DBXA 4NFMA 2G01A 5AA9A 3BLQA 3VNTA 4HGTA 2AYPA 2BUJA 5CF8A 5M4CA 4KD1A 4KSQA 2QOKA 1GIIA 4RIYB 4BGQA 4FG9A 2C68A 3G0EA 5EK7A 2CGXA 4HPTE 4JBVA 3NUPA 2CLXA 3MPMA 5C1QB 2J50A 2PZYA 3PXYA 2AC5A 2R3KA 5JGBA 3PJ8A 2XIXA 3R1SA 4R3CA 5CU2A 4ENXA 4NUSA 1S9JA 4ACMA 3FC1X 5LVLA 4H58A 5E1SA 2QLUA 4NW6A 4DH7A 3SG9A 4L43A 3MB6A 4JIAA 5KMJA 3QUPA 4AW2A 4G6NA 2UZDA 2X1NA 1APME 4AA4A 4ZTRA 4ZY5A 2IO6A 1LR4A 4KKEA 5CZHA 4A4OA 4BN1A 3VBVA 1FGKA 4Q9ZA 4C4FA 3TDVA 2Y7JA 5AP7A 4EWHA 5EQYA 1H26A 4MD8E 5T3QA 4O82A 2X4ZA 2BRMA 3ZONA 4GT3A 2XKCA 1UNGA 2O64A 3ORLA 5CVGA 4AFEA 2WPAA 2XB7A 4EZ5A 2VGOA 1G8SA 3I81A 4FV6A 5JN2A 2FGIA 4DA5A 4EONA 4R6VA 3WF7A 5CF4A 2Y4IC 2YFXA 3C7QA 4O0SA 3P9JA 3MFTA 5HE2A 4BYIA 2FA2A 2GHGA 3HMPA 1P14A 5FDXA 3DBDA 3TZ9A 3ACKA 2C6OA 5ANIA 3W16A 3GNIB 4JIKA 4KRCA 1ZY4A 2GTMA 3BQRA 4H36A 1REKA 2VTNA 3OCSA 4EORA 5LMBA 1J7IA 2YIQA 5LQFA 4V01A 4I0RA 4AGWA 5A14A 4RJ7A 3U54A 4RG0A 2XJ1A 3G2FA 3DFAA 2BAJA 2GTNA 4NYEA 5CQUA 2JKKA 3W8LA 5IG1A 4QYEA 2PU8A 5IA2A 4O7RA 2VTPA 4N57A 4H3QA 4O81A 3WF6A 3A8XA 4ZLZA 1PXLA 2HWOA 4EI4A 2WMRA 4JXFA 4U8ZA 2PTKA 4EOSA 4W8EA 5BUIA 3R9HA 4LUEA 1GZNA 5GNKA 2IZSA 4ZSJA 4IH8A 3RK7A 3DXPA 5DOSA 5DEWA 4PP7A 2GNGA 3A7IA 3NR9A 3SA0A 2YCFA 2Z2WA 3UOKA 2UZEA 4QP8A 5CU3A 4QMPA 3L8XA 4GV1A 1JPAA 3LJ2A 2IW6A 3OY1A 4F0FA 3QTIA 4Y8DA 4O7VA 3DBCA 4I1ZA 2W1CA 2HZIA 4O21A 3SLSA 1HCLA 4PPCA 2V7AA 4F7JA 5BNJA 5CF6A 3LCKA 3A8WA 4JG7A 2R3FA 2BRHA 3QGYA 5ANJA 2OJGA 4BWPA 2R9SA 3HV4A 3OF0A 3BLHA 4QYFA 3LMGA 4RBLA 4QP3A 3COMA 4YR8A 4WG5A 3QRUA 4ZZMA 3SG8A 3IO7A 5IDPA 5TT7A 1SVHA 4TRLA 4GJ3A 4QMNA 3NUUA 3EQDA 4BHNA 4FT3A 4ZK5A 2JDSA 4USEA 3SXSA 2RIOA 2PE2A 3CTQA 4M13A 4DEGA 4EWQA 3OD6X 3ZFXA 3GT8A 4EOMA 2O0UA 4ZY4A 1Q61A 2VX1A 3N51A 4YJSA 5AR5A 2BCJA 1OL2A 3MH3A 4KBKA 3U4WA 3VBTA 4FSUA 2XF0A 3G6GA 5E4HA 2OFVA 3LPBA 3DAEA 1YKRA 3FMDA 4PTGA 5AAGA 2UW4A 3FLZA 2J2IB 3NNXA 3BGZA 4FKIA 4O7NA 3ULZA 1F3MC 3TM0A 3V8SA 3NNWA 3BHVA 2XS0A 4O1OA 4C35A 2V5QA 5HTIA 2YIXA 3TNPC 2I0EA 4BDEA 4APPA 3UYTA 4DGLC 3BYVA 3TCPA 4F7NA 4FV5A 4ZTQA 5ETCA 3HDNA 4PDPA 5J5SA 4TW9A 4XJ0A 3GXLA 4OTIA 2WB8A 4FTOA 4RLKA 2XBJA 3R22A 5E8SA 3R7IA 1E1XA 4BRXA 2Z02A 3HRCA 2A0CX 2CJMA 3WZUA 3AMBA 4QMSA 3S3IA 4CD0A 5AIKA 5LMKC 4XBRA 3CKXA 3PVGA 3UO5A 5BYLA 3QF9A 1IA9A 3SAYA 4QP2A 3ROCA 3PXZA 3D9VA 2ZDTA 1J3HA 4FE2A 3POOA 3ZEPA 3TJDA 2B9JA 3DY7A 4FMQA 4G16A 5DE2A 4B8MA 3ENHA 3IKAA 3G9NA 3WZKA 2C3KA 4QP7A 2I0YA 3SOAA 2Y4IB 2YLEA 5FBOA 3WZDA 5CQWA 4RWKA 2X39A 5HG8A 5CS6A 3R1QA 2E9VA 3KN5A 3D5UA 3BYOA 4YU2A 3ID6C 4L45A 4U6RA 4MK0A 4XV2A 5CVFA 3VIDA 4FBXA 4RFYA 1FBNA 2VO3A 1VEBA 3Q3BA 2YHVA 5AR4A 4F1MA 5ICPA 1K9AA 2Y4PA 2J0MB 5E7RA 4DH5A 3QHWA 1T45A 4AN3A 3LCSA 4QMOA 3F88A 4FTCA 1CDKA 4U7ZA 4O6LA 3DCVA 3IGGA 3KMWA 5GIOE 1UU7A 3VW8A 1Q8TA 5EI8A 2CKQA 4FF8A 4MVFA 1Y91A 3VS5A 3NRMA 2VTIA 4IB5A 5HBEA 2X7OA 2PMNX 3CD8A 3MW1A 4FIHA 5CXHA 4YGAA 4ZTNA 3AC8A 3THBA 4ENYA 2FYSA 3VS1A 3UOHA 4RPVA 3TN8A 5A4EA 2W96B 2YAKA 2UUEA 3KXMA 4FIEA 4FKPA 3Q4ZA 4NM0A 5E8XA 3TTIA 5IEXA 4HZSA 1UA2A 4L9IA 3QD2B 1Y6AA 3R0TA 4TWPA 5DWRA 5EOBA 5HHWA 2UZLA 4U5JA 3MVHA 4UB7A 5HZNA 5K5NA 2HWPA 4QQJA 2YAAA 2NO3A 3BYSA 5GJDA 2Y6OA 4QP9A 5HO7A 3QRTA 4G3EA 3R28A 2QODA 3HV6A 3NGAA 2OXDA 5FEEA 4QMTA 2QO7A 4CFNA 2OW3A 3ANQA 5GJFA 1YVJA 3ZLWA 5F9EA 2XYNA 4C8BA 4EK5A 1SNUA 1U59A 4UMRA 4BL1A 4J53A 4FV4A 3IG7A 4RX7A 4YBJA 4CMOA 3EYHA 3TJCA 2VU3A 3BU6A 4WBOA 2ZMCA 1V0PA 1MRYA 3OCGA 2PZPA 3HMIA 2R7BA 3DDQA 3H10A 4DFXE 5IQHA 3R8ZA 4ZJIA 4WIHA 4DH3A 1M7QA 1QPDA 1ZZ2A 2YACA 4GEOA 5EHOA 5DEYA 3DBQA 2OICA 5LWMA 3QTXA 3GU5A 3HA6A 4UZDA 1VYZA 3U8WA 4DE4A 5K0KA 1UVRA 4H39A 4CG8A 2XUUA 2WMVA 4JRNA 3EN7A 3W8QA 4LYNA 4BDDA 2ETRA 4N0SA 5BYYA 4RIXA 3C4EA 3ATTA 5EHLA 3FEGA 3NCGA 2DQ7X 3UQCA 1Q8UA 3VS6A 5JSMA 5EYMA 2GCDA 4EQCA 5JFWA 1XR1A 4JRVA 3LJ0A 4O1PA 5A6OA 4J8MA 4OTWA 4WOVA 3ZO3A 3ZUVA 2C0OA 2YM4A 4UXLA 5I9WA 4OLIA 5ETAA 2BRNA 3OEFX 3KVXA 1G3NA 4LV8A 2I6LA 3QTUA 4EK8A 3B8RA 4I20A 4IAFA 2GQGA 4PMTA 5CZIA 2C6MA 2CGVA 2AC3A 4CXAA 3NW7A 5LJJA 3TEIA 5HGIA 1PXKA 4YP8A 5M4UA 3SDJA 4FNWA 2C47A 3ZZEA 4BHZA 1YHSA 3I4BA 1M2QA 3FMKA 4FV2A 2W17A 5C03A 1LPUA 2ITNA 3LXLA 4FTKA 3OG7A 2BALA 5DR2A 5D9HA 4P90A 5JFXA 4YC6A 3EKKA 4O0RA 4NKSA 2Y6MA 3QD0A 1M2PA 2CN8A 4B8LA 4ASEA 4F1OA 4CZUA 5CLPA 5BYZA 3MS9A 4WG4A 1YQJA 3EZVA 2CDZA 3CJGA 3PPKA 4IVBA 4ONAA 4LMUA 5LVPA 4QTAA 2YM7A 3KF7A 4FKLA 2OXXA 3QA8A 3UMXA 1OIUA 3FL4A 2ZYBA 3O17A 3RI1A 3CC6A 3GFEA 3UE4A 3GI3A 4F65A 2OH0E 5I9ZA 1L8TA 4A4XA 2VTOA 1ERKA 4JR7A 4G5JA 4I41A 4EZ7A 5HVJA 1OIYA 4MNEB 4DLJA 1WAKA 3QQFA 1Q24A 5GZAA 4IADA 4WA9A 1JLUE 4AF3A 4FOBA 2PUNA 2QNJA 4G6OA 2R4BA 2BIKB 2H9VA 4KNBA 3FY0A 5HD7A 5KCVA 2OF2A 4IZ7A 3RPYA 4BWKA 5B7VA 4X3JA 3GCQA 1YOLA 3HP5A 5IQDA 3PFQA 4AOIA 5DLSA 3ZS5A 3OWLA 5BQ0A 5F1ZA 4YMJA 2Y9QA 4K0YA 3U9CA 3LFBA 4MQ2A 4KB8A 3P08A 1PJKA 3BIZA 1R0PA 2WMAA 3O71A 2WQMA 4OTPA 5AM7A 1NVSA 2XYUA 5HD4A 1V0BA 3HX4A 4RWJA 4D0XA 5KUPA 4C4GA 4E4XA 4WUAA 3VQUA 1H1WA 2ZB0A 4HZRA 4OT6A 3KRJA 4M15A 2QOHA 5IZFA 4G2FA 3PJ3A 4Q9SA 4BIEA 4B4LA 1BI8A 1XO2B 4I6QA 2PE1A 4PTCA 3E62A 2R3NA 4NSTA 2VTTA 3BKBA 2JBOA 2ITTA 3DAJA 5DR6A 5JMSA 3ZRMA 1TKIA 4WSYA 4YPSA 2XP2A 3ZXZA 3OBGA 5LOHA 1YOJA 5DGZA 5AUZA 4R7BA 2GS6A 2XKEA 4S34A 4I93A 1PMVA 4X2FA 5BVEA 3CGFA 4RC2A 5AUXA 2ZM3A 1JBPE 3R9OA 2UW8A 3BQCA 4IX5A 5FTQA 3PY1A 4FNYA 2WIHA 4W4WA 3SXRA 4I21A 1IRKA 1YI4A 3OROA 4YZDA 3UMWA 1P5EA 3PXRA 5I9YA 4QPMA 2XIKA 4FKOA 3SRVB 3FZTA 4RFMA 3OXZA 5AP6A 2WEIA 3NAXA 4JDKA 4U3ZA 3MFRA 2ZV2A 2VWBA 3MA6A 5DPVA 3VAPA 3VS7A 3JR1A 3F5UA 3AD5A 3KF4A 3ZLYA 3BEAA 2QO9A 4J96A 3RAKA 3S1HA 4YNOA 3LM5A 5CSXA 3TWJA 2IVUA 3ORXA 3AD4A 2OFUA 5DVRA 4E6CA 4FEVA 2YERA 3PSCA 2WFYA 4DT8A 5GINE 3VULA 2VX0A 4E5AX 2VZ6A 5I3OA 5M56A 2KTYA 2RKUA 3VUKA 4O0VA 2O2UA 5C4LA 5EDRA 3DT1A 4EHZA 3EQFA 4EOLA 2UZOA 4NWMA 4OAVB 5JRSA 3T9TA 2C3IB 4EQMA 3R8LA 5ITAA 4FGBA 2W1GA 2JDVA 4UEUA 2PULA 2GHMA 2Z7RA 4PNIA 5IEVA 2W1FA 1P2AA 5EM8A 4HVSA 2YCSA 4FEQA 3GC0A 4CLJA 3HLLA 3II5A 4BI0A 2JIVA 4E4NA 1B39A 2E9OA 5EQEA 3DZOA 4GKHA 1Y8GA 5G1XA 5J5TA 4HCUA 1URCA 3E64A 1BMKA 2A4LA 3OOGA 4XG6A 1WBOA 3P7AA 3DXNA 4OT5A 5LARA 4XNEA 3DNDA 4D1ZA 3FV8A 3DAKA 3EZRA 3R04A 2J4ZA 2ZV8A 4S30A 2PZIA 2RFNA 3V8WA 2F2CB 2PVMA 3P79A 4KS7A 2WO6A 3HNGA 4FTJA 5DI1A 3FQSA 3V01A 4QP6A 3LQ3A 3Q5IA 2PMLX 4KA3A 2CGWA 3GEQA 3I1AA 3FZ1A 3OUKA 4OGRA 2PZRA 3EQCA 4XP2A 5CX9A 4OR5A 4FSYA 5HCZA 1WMKA 5GZ8A 2YCRA 4G9RA 3UQFA 3A7JA 1V0OA 4BCQA 3LFAA 1H8FA 3MTFA 4K11A 4CFFA 3QXOA 4F6WA 2XCHA 4C61A 5HNBA 5DR9A 4UMTA 4UALA 4IB1A 2C6IA 3MVJA 4BYJA 5FM3A 1URWA 3R2YA 1H4LA 3VO3A 4WG3A 5ANOA 4IBMA 5JK3A 4GCJA 4C59A 4E4MA 4YJTA 5BVNA 4FSMA 4Z3VA 4Y5QA 4OTFA 4R7IA 1ZWSA 2XK8A 3QAME 2R0UA 2YJRA 3QGWA 4BGGA 3FI8A 1OKYA 3ODYX 3C0IA 3DTWA 2OH4A 5CEQA 1GZKA 5IA3A 5GIPE 4IE9A 4GH2A 5LCKA 4O7LA 2H6DA 3GU7A 2GS7A 3C51A 2YM8A 3W32A 2XNNA 3WOWA 1ZYLA 1W7HA 3FC2A 3H4JA 2NNWB 5FBNC 2OLCA 4IFCA 4MBIA 4O7ZA 4PWNA 4O0WA 1PXMA 3D94A 4YPDA 3NVMB 2VTMA 3ATSA 2FSLX 5KNJA 4FL3A 1ZYSA 4Y85A 5JFVA 4OAUC 2XEZA 5L2TA 3QD3A 4JL9A 2X2MA 4GL9A 3P0MA 4G5PA 2JBPA 3NUXA 4IX3A 3M42A 4CFMA 4WNOA 5EOLA 4ZZNA 3IQ7A 3KK8A 3CLYA 4NIFB 4QP4A 5CSHA 3ZTXA 1UU9A 1XWSA 2ZM1A 4QQ5A 4BBEA 1RDQE 2VTJA 5AUUA 4GK3A 5IPJA 3AGMA 4M69A 4JG6A 2W1EA 4BCPA 2DUVA 4D2VA 4A9TA 4XBUA 4AE6A 1U54A 4YSJA 4DF3A 1YW2A 2HZNA 2ITOA 3Q5ZA 4E5WA 2J6MA 5HCYA 2IWIA 5ANDA 5C8MA 3RINA 4TWOA 3ZO4A 5IA5A 4AN2A 3RJCA 1W8CA 2BZHB 2ZV7A 4ZSLA 3QTWA 5EYKA 4N6ZA 3LXNA 4IX6A 5DT4A 4D2WA 4EOKA 2R3PA 3K5VA 3I6WA 2UZUE 3LM0A 1T46A 5K9IA 2NP8A 3G9LX 1ZMVA 3RM6A 1JSTA 2Z8CA 4UYAA 4C02A 4CG9A 1A06A 4Z55A 2ITWA 2WHBA 4J71A 2F4JA 1XH4A 4IAZA 4A9SA 3NNUA 5TOZA 2YEXA 3W18A 1H1QA 3QALE 3VBWA 3ODZX 4L44A 2X8EA 2BROA 3DK3A 3TKHA 4BFMA 5J9LA 2UW5A 5AP5A 1PKGA 1SYKA 3GOKA 4G34A 5IH5A 1Q41A 3PDTA 4H05A 5A4LA 3LFSA 2WMBA 2YIWA 5KKRC 4QMZA 5CSVA 2KULA 3O96A 3B8QA 4JDHA 4Y72A 1WVYA 1YDTE 2GDOA 4R77A 3WE8A 5IQCA 3A7GA 4FTRA 4C36A 4USFA 1PRYA 1IEPA 2Y8OA 3OY3A 2ERKA 4CMTA 1SVEA 2OK1A 4E4LA 2NRUA 4RLLA 3C0HA 3TIYA 2R5TA 3UIMA 4BCMA 1I09A 1SNXA 4KRDA 3DXQA 4U79A 5J87A 2ESMA 5HI2A 3FMMA 2CSNA 4FIJA 4FZ7A 5HE0A 1RQQA 2X81A 3QWKA 2O63A 5CU6A 3D5WA 2CLQA 3O8TA 3VF9A 4A7CA 1JSUA 2GQSA 3F3WA 4C38A 3QZHA 4NU1A 4IJ9A 1ZRZA 2BHEA 3KRRA 3RZBA 3AGLA 3T9IA 5IQFA 2BRBA 2C0IA 2VO6A 2YISA 5IQIA 4FTIA 1Q97A 3QLGA 4AZFA 2OKRA 2FSOX 4MXZA 2R3RA 2WMSA 4YJOA 2F9GA 1F5QA 1XKKA 3KFAA 4BKZA 5K4IA 2VTSA 4EOIA 4RJ3A 4DTAA 4ACCA 1YI6A 3AC4A 1CSNA 3H0ZA 4GVJA 4LRJA 5B2MA 1OIRA 2P2HA 4ZJJA 1VR2A 2WTIA 4DEAA 3KN6A 4X2KA 1YWNA 3LMHA 4K9YA 2PVJA 1OIQA 4M3QA 1HOWA 2PVNA 3QFVA 3Q52A 3AMAA 4ZSGA 4APCA 3QYWA 2PY3A 3VW6A 3Q9ZA 2ERZE 4UMQA 3UC3A 3BBWA 5EKNA 4I22A 4PY1A 2W4OA 2WD1A 2PHKA 2E9UA 2H8HA 3DGKA 4RVMA 1BX6A 3R01A 5HG9A 2EVAA 2CKEA 3ORNA 1Q62A 1VYWA 2UZTA 2HW6A 5L4QA 3FL5A 1K3AA 4O91A 4M66A 2QONA 5HX6A 2ZM4A 4PL5A 3QQJA 3I6UA 3OXIA 2VWIA 3F82A 4KBAA 4LM5A 5JFSA 3GCVA 1PXOA 3DV3A 3EYGA 2ONLA 3BRBA 5CU0A 3LAUA 5CNOA 4BCJA 4TYGA 4L7SA 4BC6A 1XQZA 1L3RE 1RJBA 3L9MA 4AE9A 4HGLA 4XLVA 4M0YA 2GQRA 4I0SA 4HW7A 2QOIA 4UWYA 1BLXA 1WBPA 3BE2A 4RC4A 4FKGA 5HESA 4BIDA 5CAQA 4OBOA 5HICA 2X9EA 3W2PA 4GFOA 2QCSA 4CFXA 3CP9A 4CGAA 1GJOA 2LAVA 5D41A 2I1MA 2UZNA 3R9NA 4TWCA 5AV2A 4FSZA 4OTQA 1KSWA 4IWDA 4CYJA 2UW0A 5HIBA 5I4NA 3RAHA 1XBBA 3E3BX 3OW4A 3UC4A 4EK4A 3D7ZA 3GCSA 4W4XA 4LOPA 5FXQA 4HCTA 4CV8A 3RP9A 4MXXA 4FT9A 3KKVA 4M12A 4TNDA 5KMMA 1P4OA 3A62A 3R7UA 3D5XA 2F2UA 2P0CA 2A2AA 4YJUA 1YXVA 5H3QA 3QTRA 4B0GA 1SMHA 1ZYJA 3NYOA 3PG3A 4RVKA 3N4UA 4XH6A 3TNIA 3RPOA 4UX9A 5CY3A 5D1JA 1CTPE 3QU0A 5KKRB 2BILB 3GGFA 4FVRA 2WAJA 2YA9A 3LE6A 3MTLA 3NIZA 4JG8A 3IOPA 4DHFA 1SZMA 4YHFA 5M55A 4D4SA 3FPMA 1PYXA 1AD5A 3C4WA 3PY3A 4RFZA 5CALA 5A54A 5AAEA 3FI3A 1XH9A 2PE0A 4O7TA 4PMMA 5DT3A 5K3YA 3HMOA 2WZJA 4FV3A 4MBJA 4F99A 2XCKA 3CQEA 4PL3A 3SV0A 3RNYA 2QOOA 4GIIA 4BBFA 2BFYA 4E5BA 5DHJA 3ANRA 4XG3A 4EH9A 5HU9A 4HYHA 3U4UA 5D12A 1OVEA 4DC2A 1FPUA 1ZAOA 3TV4A 3NLBA 5B2KA 4LUDA 3FMNA 4RA5A 3OTUA 1QCFA 2HCKA 5CAUA 3GUBA 1O6LA 3UP2A 4BDGA 2PMIA 4O0UA 4R5YA 4YSMA 4X2NA 3FMHA 4XV1A 3ITZA 4G6LA 2ZOQA 3QZGA 4BDIA 3BU5A 4PPBA 4AQCA 4YTFA 4FYNA 4DITA 2QVSE 2GFCA 2GNJA 3A99A 3PRFA 2XK7A 5GJGA 4I0TA 4C58A 3FZOA 3W2OA 4DFYA 3T3UA 4S32A 3PWYA 1QPCA 3FHIA 4L8MA 4RZWA 4XS2A 4XRJA 1G8AA 2JD5A 4BCFA 4IAKA 4EHEA 3R9RA 4B9DA 4G3GA 2XM8A 3F3UA 3LFQA 1LEZA 4S31A 3ZO2A 3OWKA 5AR8A 4CCBA 1UU8A 4TYIA 2OJIA 4ACHA 4QRCA 2Q0BA 2W05A 3E8EA 4KINA 4OTHA 5E9EA 5EYDA 1WFCA 3GC8A 5HCXA 5FRIA 5FGKA 3P1AA 3DDPA 4QOXA 1GZOA 3V04A 3UZRA 1BL7A 3VVHA 5D11A 3E7VA 3GC9A 4EH8A 5IQGA 4TXCA 3EFJA 2ITVA 2XK3A 4KKGA 4YNEA 5J7HA 3IECA 3DBFA 3OT3A 4G3DA 4USDA 4QYGA 5CEMA 3PG1A 4BZOA 3TNQB 2C5NA 4X6RA 5BVWA 2GNHA 2ITUA 5EDQA 4JOAA 4MKCA 4QMWA 5M57A 4DFUA 2W9FB 3O51A 1PXPA 3LHJA 3ZMMA 4ANQA 2VNYA 4D4RA 4TN6A 5F94A 1OL6A 3IK3A 4I5CA 5EW9A 2Z7LA 3O50A 3PYYA 1PKDA 3FY2A 4AT5A 5BUJA 4J1RA 5JQ8A 3PA4A 3E93A 5DT0A 2JKOA 5KO1A 3Q6WA 4FZ6A 2R3QA 4YJNA 4RIXB 2HY81 3I60A 3PLAE 4RQVA 4BCKA 4OBQA 2VN9A 4UMUA 2AUHA 2QG5A 5B0XA 4OW8A 4ACDA 3F61A 4ZSEA 3ZFMA 3QX4A 4FIGA 1CM8A 3CIKA 5KMLA 2QKRA 5AP2A 3MDYA 1YXUA 1Q3DA 3QL8A 4NK9A 5AUVA 4L01A 3RWPA 2YDKA 2QURA 2BZKB 2X9FA 3JVRA 4J7BA 4U43A 3O7LB 5BX0A 2F7EE 3TTJA 1FMOE 3Q4TA 4G3CA 4FTTA 3RZFA 4F0IA 3LCDA 4KUJA 2YM3A 2XK9A 3LVPA 5CAVA 1Q8ZA 3I5NA 4IVCA 3F3TA 3EQPA 2EXMA 5E92A 3LOKA 3LFCA 5K4JA 4FTAA 3E8NA 4FL1A 2CGUA 2H34A 1Q3WA 1PHKA 3WF9A 3R8UA 3ZH8A 3NX8A 3PXQA 3OTVA 3RK5A 4FTQA 5JEBA 5HOAA 1ZMUA 4F4PA 5LXMA 3PE1A 5IH4A 2OJFE 1KOBA 1TQMA 1TVOA 4FVQA 4HYIA 4L00A 4O2PA 4FKUA 3ZU7A 3GVUA 3VUHA 4GS6A 4BBMA 4E6AA 2GSFA 4II5A 3ELJA 2JAVA 3BPRA 3LZBA 3MH0A 4MXOA 4BDBA 2V62A 5M4IA 4IB3A 4RQKA 3SX9A 2W1DA 2WOUA 3PSDA 4AG8A 3CQUA 3DB8A 3ZC5A 4A9UA 4F09A 4CCUA 2PVHA 2EWAA 5DNRA 2PVYA 3ZDIA 4HNIA 3BEGA 4C4HA 2XIRA 4YJPA 1I44A 2BKKA 1J1BA 2R3LA 4F7SA 4O27B 4DEIA 4GSBA 2HZ4A 3R9DA 4QMMA 3B2WA 3P23A 4WSQA 3MJ2A 4I6FA 4HPUE 2O5KA 4BDKA 4ID7A 4GKIA 2B52A 1ZXEA 2JFLA 5L8LA 3LFDA 3WIKA 4XP3A 4ITJA 5KE0A 2BTRA 2OF4A 3HV7A 4EJ7A 3RNIA 4FV1A 2C69A 2UVZA 3NW5A 4BZNA 4Z7HA 1AQ1A 4WD5A 2F7ZE 2WELA 4NM5A 1GOLA 1U46A 5KMIA 3E63A 4IWPA 4E8AA 1MRVA 1UWHA 3R63A 5AP0A 4XHKB 1JQHA 3Q04A 3VS2A 2CCIA 2JKMA 1F0QA 3ROYA 1KE5A 1PXJA 4DBXA 4ALUA 5I3RA 3MIYA 2H96A 4I6BA 5EG3A 4YLKA 3EWHA 3KB7A 4IZYA 5I9XA 3QKLA 5CANA 3V6RA 3AC3A 4RIWA 5KHXA 2QU5A 4HVGA 2IZRA 4EBVA 4CVAA 3G6HA 3QQGA 3QUDA 4QP1A 3W2QA 3UG2A 5ETIA 3VRYA 4IVDA 4OTRA 2WOTA 3DA6A 2J51A 3PXKA 4FOCA 2XNEA 3FYJX 4J97A 4K6ZA 4M97A 3ULIA 3ZC6A 5J95A 3CQWA 3EOCA 4NT4A 4XCUA 5L6WL 3K3JA 4AAAA 5JQ5A 1BYGA 4C3PA 5AX3A 3PA3A 2C1BA 4GK4A 1OL5A 1SVGA 3DJ7A 4FTNA 2QI8A 4GK2A 4TYHA 4DT9A 2OG8A 2B9FA 3R83A 3D7TA 4EOOA 3MVLA 3NAYA 1NVQA 1LUFA 1GZ8A 2YN8A 3MPAA 4GW8A 4EKLA 1OKVA 3R6XA 2G9XA 4TNBA 4WO5A 4QMXA 3DU8A 5EYCA 1BL6A 2JC6A 2V7OA 2VWWA 1H28A 3KK9A 4FL2A 5LVNA 2CNQA 3PIYA 4XP0A 1FQ1B 3AC2A 3L1SA 3RPVA 5BVFA 4CTBA 3HMMA 4D2RA 4JX3A 4KBCA 4O0TA 4QPAA 1YXXA 2X2KA 4TKSA 4WNMA 4C62A 4HYUA 3G90X 3HAMA 1Q99A 4AZWA 5CEIA 4JBOA 4EH2A 1BUHA 2UW6A 3EN9A 2YDIA 3BU3A 4NZWB 4DCEA 3V5JA 3EQBA 2IPXA 1GIJA 1O6KA 3MIAA 3R73A 3LCOA 3F6XA 2QR8A 3TI1A 4UWBA 5I9VA 3RWQA 3F2AA 4FG8A 2V22A 2G2HA 2I7QA 1YDSE 4IWQA 3EN6A 5IISA 5CNNA 3UGCA 3TUDA 5AV3A 2BKZA 1Q4LA 4D28A 3GU4A 4CRLA 4DN5A 4S33A 4F9WA 4XOZA 1OGUA 2YZLA 4AGDA 4C4JA 4EZ3A 4FX3A 1KWPA 3LCTA 4ZTHA 4BDFA 4C2WA 4CFUA 3F5PA 4QTEA 1W0XC 3EH9A 1EH4A 4NKAA 4ZAUA 1KE6A 5M44A 3UNJA 3PPZA 3S95A 2ITYA 1OI9A 2YABA 1CKIA 5J1VA 1FVRA 3MGYA 1DAYA 3ZBXA 3EFKA 2W7XA 3I7CA 4D58A 5F20A 5J7BA 1RE8A 4D9UA 2ZB1A 4BKJA 5FM2A 3CEKA 3NIEA 1Y8YA 3I7BA 5KZ0A 4AA5A 4FYOA 4EOQA 1OL1A 4E1ZA 4BDAA 2Q83A 2J0KA 2XNBA 3R8PA 5LWNA 3R7VA 5CAPA 4ASZA 4BKYA 2FUMA 1YHWA 1MQBA 4PX6A 3EIDA 3AXWA 1OL7A 4WUNA 3E92A 4FKSA 4IM3A 4BCGA 1ND4A 4D4YA 4E6QA 2WTKC 3DKOA 2X0GA 3F3VA 5HLWA 5ANEA 3QX2A 2WU6A 1SM2A 4ZIMA 4MWHA 4TT7A 5DH3A 4AA0A 4NL0A 3BX5A 3NDMA 1H1SA 4K2RA 4QTCA 4E20A 5C8NA 5L6PA 4IZ5A 2WMUA 3BHUA 5CF5A 5ETFA 4DAWA 2ZV9A 2JGZA 1UV5A 2XBAA 1LEWA 4AP7A 1ZLTA 2VGPA 3ETAA 4O7YA 3K2LA 4CKRA 2P4IA 4X0MA 1WZYA 3TG1A 4CSVA 5D10A 1ZYDA 2V55A 3WILA 2JFMA 2VO7A 4YHTA 4NH1A 4JJRA 4JLCA 5E1EA 4BTJA 4D5KA 3R7GA 3U6JA 3NSZA 3ORTA 4WRSA 5KMOA 3OZ6A 1H08A 2OU7A 4RJ6A 3SQQA 4YC8A 2XVDA 2ONLC 4R7HA 1H27A 5HVKA 5L6OA 4AOJA 3PIZA 2B55A 2OJ9A 4XV9A 4XEYA 3FLSA 4EYMA 2B9HA 2EXCX 5CVHA 4EC9A 4M69B 3DLSA 4BWXA 4EH6A 5DYJA 2V0DA 2XIZA 3AG9A 2JKQA 5TKDA 1U54B 5HQ0A 3U6IA 3HRFA 3NUSA 3JVSA 4J8NA 1OKWA 3IW4A 1PW2A 3DK7A 4P2KA 3FPQA 3KCFA 3GQIA 4EOJA 2X6EA 5IH6A 4LOOA 3FUPA 3P78A 4Y46A 3F69A 2VO0A 3G15A 3AD6A 2EU9A 4V0GA 3FKNA 3PJ1A 3ZDUA 4BIBA 4EHGA 1LP4A 3QQHA 4KIQA 2XZSA 2F57A 4J98A 4X2JA 2YCQA 5IA4A 1YOMA 2FVDA 4YZMA 5TE0A 4ORKA 4FZAB 4BY9E 4PL4A 5HBJA 3FMJA 3F2RA 4FIFA 3CPBA 3VUMA 1OMWA 3DNEA 4BCHA 5JGAA 1Y6BA 3CPCA 3C1XA 3HA8A 2XRWA 5E8WA 2QQ7A 5AA8A 5T68A 3KU2A 2DS1A 3HVCA 5HE1A 5HIEA 3BE9A 1KUTA 5IQAA 2IW8A 3IOKA 4TZRA 2QO2A 4JR3A 3M11A 3QRJA 4BVUA 5BVDA 2GPHA 4FV9A 4O38A 3QA0A 4L6QA 2B9IA 4Y83A 2Z60A 5I0BA 4C3RA 2PYWA 4AS0A 5LVMA 2BMCA 5FP6A 4I3ZA 4MHAA 3ORZA 3TNHA 3F9NA 4B7TA 2WQNA 3HL7A 1E1VA 4ZY6A 3N4VA 4P7EA 3MH2A 3MA3A 4AUAA 4F64A 2HOGA 4IEBA 5KMNA 3ZZWA 4FTLA 2A19B 1AGWA 3CY3A 2QOLA 3HEGA 5IQEA 5CENA 3I0OA 3OEZA 4EH7A 5BVOA 3QZIA 1GIHA 3RK9A 3ZSHA 2E9NA 4I4EA 2Y0AA 1ZYCA 2UZVA 1Q8WA 4MBLA 4XG4A 3A2CA 1DI9A 2JDTA 3H9FA 2OBJA 3SW7A 2JLDA 2WTKB 4ZZOA 2WKMA 3P7CA 3F7ZA 5HIDA 2BIYA 2WQBA 4J95A 4YLJA 4BDCA 3N9XA 1PYEA 2UW9A 3FZPA 2EB3A 2FO0A 3LIJA 3PP1A 5H9BA 5A4CA 4IX4A 3FKLA 3BI6A 4FKQA 2PK9A 3ACJA 1G5SA 3PTGA 3QRKA 4U41A 1H25A 1XH8A 1OECA 3JS2A 3VN9A 4D1XA 4FNXA 4CFVA 5EM6A 5J79A 2IN6A 4LL0A 4F63A 3PPJA 4YZBA 4DH1A 2R3IA 2XMYA 4H1MA 5A3XA 4H1JA 2HIWA 3HKOA 5HTBA 5HLPA 5KZIA 2GNFA 1H0WA 1XH5A 4EBWA 4UV0A 1YDRE 1WBVA 4XV3A 3QKKA 3UBDA 3MB7A 4PDSA 3V51A 5HEZA 4U3YA 5AIRA 4BGHA 3DB6A 5HX8A 2J7TA 4B99A 1ZZLA 3R1NA 4AN9A 4ALVA 4E26A 5FXSA 1OM1A 2GU8A 3UNZA 1J7UA 2HXLA 3BCEA 1XJDA 2B54A 2QD9A 4HGEA 5FTGA 4MWIA 4AACA 2VWUA 3GBZA 4NCTA 4QYYA 4ZTMA 3QC4A 3ZRLA 5ACKA 3F2NA 3W10A 2YLFA 4H3PA 3RKBA 2XNMA 3SRVA 1PY5A 5HLNA 3OWPA 2C5OA 3QTQA 4DGGA 4X3FA 3CTHA 3BGPA 2EB2A 3BBTB 4C7TA 1ZOEA 3K3IA 3ZM9A 5C4KA 4E7WA 3KMMA 4KSPA 1O9UA 3FE3A 3R00A 4P5QA 5IUHA 4YTIA 3TXOA 3NYXA 3UYSA 1A48A 4UY9A 5HKMA 5L2QA 1NY3A 3C0GA 3W33A 3NMUF 2VTLA 4PF4A 4D2TA 4YTHA 4CZTA 5CAOA 4BTFA 4R5SA 3OFMA 5DMZA 3WF5A 2C3LA 3KULA 4M0ZA 5AV4A 4IM0A 2RG6A 4C34A 5JH6A 3L9PA 2PL0A 1PXNA 4X21A 4RX8A 3PVUA 1XBAA 1NW1A 3DPKA 1J7LA 2OIDA 4G17A 4ZMEA 2YZAA 3FXWA 4ZMFA 4Y73A 4LMNA 2QOCA 3VQHA 1DI8A 5JZNA 3ZSIA 3C4XA 2XEYA 4GRBA 4FSRA 5EW3A 3DJ6A 3NYVA 4EK6A 5CXZA 1PMEA 4FV8A 4KIPA 3FQHA 4AXAA 4FKWA 4DFLA 2I0VA 4TTHB 3KL8A 4O7WA 4CTCA 4WKQA 3C50A 2W5HA 1VJYA 4EEVA 4EH4A 3PJ2A 2CNVA 4ASXA 4ANMA 4C3FA 3H9RA 2PZ5A 3UG1A 4HGSA 4EKKA 3JUHA 2XJ2A 3LQ8A 3KGAA 4RSSA 1WBTA 3O23A 4R8QA 2OZAA 5DFPA 4PRJA 5EM7A 5CYIA 5E8YA 3ZLXA 4JT3A 5KBRA 4MF0A 3S0OA 3ZCLA 4ZLOA 2WTCA 4PDOA 2R2PA 4C0TA 2PUPA 4PMPA 3NUNA 4NTTA 3CE3A 4BTKA 2DWBA 2ITQA 3IDBA 3DKGA 5JKGA 3Q53A 4IW0A 5EHYA 2CNUA 4FEWA 5AM6A 2VTAA 1W98A 3S4QA 3BHYA 3UP7A 3DFCB 2XIYA 4O0XA 3QRIA 3KREA 4I5HA 2ITXA 3GOPA 5ANGA 1Z9XA 3SC1A 3WYYA 2QHNA 4LQMA 4CYIA 3DTCA 3GU8A 5AJQA 2XKDA 5E91A 2ETMA 3V5QA 4BI2A 4EH3A 2VNWA 2WU7A 2ZMDA 3VUIA 3WARA 2ZAZA 4IM2A 5IMXA 1ATPE 4CT1A 5G6VA 1H01A 3H0YA 3TUBA 1YRPA 5I5ZA 2LGCA 4WNPA 4X7QA 3UDBA 2X4FA 3OVVA 4C37A 3GCPA 3SD0A 5L2SA 4FODA 4QYHA 4DINA 4M68A 5TO8A 3UO6A 3FHRA 5AUWA 2VAGA 2FSTX 4M8TA 1JVPP 2I40A 3W2RA 3MY1A 4Y5HA 4O83A 3DBEA 3R71A 1IASA 1UNLA 2WMTA 4NIFA 5IEYA 4ANOA 4WT6A 3WE4A 5AP1A 3A61A 4I5PA 3KRLA 2C6EA 3LQ5A 2GS2A 5AR2A 3UOJA 2Z7SA 4P4CA 3A4OX 3CJFA 4RZVA 1IR3A 3HECA 3NZ0A 2OIBA 3V5LA 5KBQA 1IAJA 4RA4A 3CBLA 4DEBA 5FD2A 4RWLA 4YJVA 3KC3A 4FI1A 5FG8A 5HO8A 3S2PA 3DZQA 2IW9A 4BZDA 2QOFA 3C4CA 2R0IA 3BHHA 2QKWB 1R3CA 2RL5A 4FV0A 2O8YA 4NTSA 4YJRA 2GNIA 4EQUA 5IMEA 3BV3A 1STCE 4BICA 3AC5A 1H07A 2R3MA 4X6QC 5EQPA 3V5PA 3BWJA 4M67A 3CCNA 2J0JA 4NEUA 4U45A 3UTOA 3LXKA 4FGRA 4NM3A 3V5WA 3OC1A 3V5TA 3ERKA 4FICA 2WTDA 4WHZA 4DYMA 4TWNA 3COKA 2J5FA 3ET7A 3KRWA 2BR1A 4KIKA 5LMAA 2HAKA 3MFSA 5AP4A 5AR3A 2BFXA 3R1YA 3PJCA 4WNKA 5BMSA 2W0JA 2BDWA 3KXHA 4P5ZA 4ZLYA 3CR0A 3WF8A 5M51A 1UKHA 3R30A 3AT2A 3D0EA 3WI6A 1QPEA 3QQUA 3KCKA 3FWQA 3KXGA 1QMZA 4XX9A 3VC4A 1JKLA 2PUUA 3LFEA 4DGOA 3A60A 3MVMA 3H30A 5J9YA 2WNTA 4OTGA 2YITA 2W99B 5A6NA 3TDWA 4M14A 1CMKE 4IAYA 3KQ7A 4PV0A 5M06A 2JIUA 3MSSA 5CSWA 3QCQA 3FI4A 3PA5A 4I23A 4BCOA 4EL9A 2R7IA 3IGOA 5ANKA 3EQIA 3MBLA 1UKIA 1ZY5A 5C9CA 3ZRKA 4O6EA 4E6DA 3JXWA 3IS5A 2IVVA 4ITIA 2E9PA 4K77A 5BUEA 3RPSA 4F1TA 3Q2JA 2RFSA 3Q60A 4MD7E 3TIZA 3ZSGA 5K0XA 3ORIA 3VBQA 1WVXA 5D7AA 3RM7A 3RTPA 4LV5A 4BCIA 3RPRA 4CQGA 4N6YA 4EK3A 3TT0A 2Q0NA 4MD9E 2R64A 4LFIA 3ZO1A 4YZ9A 4RJ8A 4JAIA 4AFJA 3PSBA 3QQLA 1U5RA 2C5VA 3GENA 4DEHA 4Y95A 5AWMA 3VF8A 2HK5A 4IDVA 3G0FA 3K5UA 4DFBA 5BMMA 3UJGA 2C0TA 3QYZA 4JAJA 5AP3A 3D83A 4FIIA 5M09A 3TL8A 4QQTA 5FXRA 4D5HA 3V3VA 3ORPA 1FOTA 5C27A 4BI1A 3GP0A 4Q2AA 4AT4A 4C33A 4RT7A 3ALNA 5JRQA 1YI3A 3E8DA 3TKUA 5AUTA 2W1HA 4RIOA 1OITA 2BRGA 4C4IA 3PRIA 3Q9YA 3KMUA 1OKZA 2JDRA 4FKRA 3SOCA 5CEOA 3LLTA 3R02A 4RIYA 3C5UA 4YJQA 1M14A 5KHWA 3LMIA 4MXAA 5HVYA 2WXVA 3G5DA 3NS9A 2DYLA 4HNFA 3COIA 1OUYA 2VWZA 4MTAA 4YBKA 3ZEWA 2HZ0A 1ZOGA 3CXWA 1PMNA 2OGVA 4U80A 3KXNA 2VWXA 2QC6A 3UIUA 4FSNA 1KV2A 4RIWB 3CY2A 5GHVA 1WCCA 4FTMA 4ARKA 3WBLA 1A9UA 2PMOX 4UWCA 1JAMA 4CEGA 5J9ZA 3MN3A 4A9RA 5E8VA 4DEEA 4Z16A 4RGJA 4V04A 2VWYA 3QZFA 3CTJA 3I0QA 2C5XA 3D4QA 3HV5A 2O3PA 3QUEA 3L9NA 4HCVA 3TV6A 4WBBB 3LFNA 5I9UA 5CU4A 4ERWA 1Y57A 3PE2A 3EMGA 2BZJA 5B2LA 2GFSA 3LJ1A 4TYHB 4FUXA 4J99A 4KKHA 1NXKA 2C6TA 3D7TB 3R7OA 3QWJA 3ZOSA 1O6YA 2O65A 4RJ4A 3EL7A 3V6SA 4CZYB 4ZXTA 1NT2A 4GYGA 2VWVA 3I79A 2J9MA 1R78A 4ANNA 1WBWA 3TUCA 2B0QA 4PUZA 3ZFYA 2VUWA 4DGNA 5M08A 4GJ2A 3E3PA 5T6KA 5AX9A 4ZS0A 4FA2A 3UPZA 2C6KA 3MWUA 4YHJA 2YIYA 4XG2A 1ZMWA 3W2CA 5CSPA 3SGCA 3VBYA 4JQ7A 5F95A 4X2GA 2FB8A 3E87A 3RHXA 4XG9A 4UYNA 2RFEA 4GIHA 4AOTA 5CEKA 4MYGA 3TZ7A 5H8GA 3NWWA 4OUCA 2EUFB 2PSQA 4YZCA 3WYXA 5CT0A 3E5AA 4R78A 3F66A 5J8IA 4TYEA 3T8OA 2W06A 4DTBA 1WBNA 4R1YA 4RWIA 3G51A 3MFUA 2HELA 3P5KA 3RAWA 2VTHA 3ORMA 4Z9LA 3SW4A 3IDPA 1FGIA 1FMKA 2HY0A 3RMFA 4CNHA 2WGJA 1XH6A 3UOLA 3O8PA 3A4PA 3FLQA 3PY0A 2PPQA 1OPKA 4F7LA 5KMKA 4IB0A 3EQRA 4AU8A 4AZSA 3EFLA 4QMUA 1OPLA 3P7BA 4D55A 4CQEA 3UZTA 3UQGA 2JIIA 1TQIA 4F6SA 1V1KA 3GCUA 4F08A 3HRBA 1FINA 2YWPA 3HGKA 4FSQA 4L3LA 5IA1A 3VS3A 1W84A 2ETKA 4IWOA 2YM6A 4KWPA 3OXTA 5M4FA 4IANA 4YTCA 3FDNA 2C1AA 3ZYAA 5FEQA 2YJSA 2C6DA 2P55A 2I0HA 4FKVA 4FT0A 4OBPA 5HNGA 3RCJA 3FLYA 3U51A 2CKPA 4IACA 3UODA 1X8BA 2XRUA 4IVAA 5FUTA 2A27A 3R8MA 3Q2MA 4F0GA 3VWAA 2G15A 4I94A 4QTBA 4XG7A 2P33A 3E7OA 3L8PA 4LGGA 1M52A 1UNHA 4AZVA 1ZARA 4PDYA 4QD6A 1TQPA 4FKJA 3VUTA 3U55A 5E8ZA 4E93A 3KRXA 3BYUA 4D0WA 4IAAA 2C5YA 4GU6A 3WZJA 3IW8A 3QTSA 4PP9A 4I92A 3OMVA 4JS8A 4O2ZA 4QQCA 4FSTA 3QTZA 3VS4A 3NUAA 2EXEA 4NJ3A 4B6LA 3WZEA 2FH9A 4ANLA 3L9LA 1MP8A 1JSVA 2WTVA 2XNGA 3F5GA 3BLRA 1U4DA 4IDTA 4IFGA 3FI2A 4FV7A 4GVAA 1GNGA 2BTSA 2CMWA 3IONA 4IJPA 4U44A 4A06A 4AWIA 2BVAA 4EOPA 3AMYA 3KXZA 4DFZE 3A7HA 4O84A 2W4JA 2BDFA 4FEUA 2C30A 2PVFA 3MY5A 4G1WA 4BTMA 3C5IA 4OTDA 1XBCA 3OHTA 3PP0A 4O7SA 3S00A 3E8CA 2F7XE 4QO9A 4RMZA 4YO6A 4G9CA 4M84A 4NCTC 4DH8A 5EKOA 5AMNA 3OOMA 3T3VA 2G1TA 2QOBA 2XK4A 4GUBA 4BDJA 4F9CA 1M7NA 5HORA 3CGOA 5HTCA 2PUIA 5L3AA 4X3FC 4FR4A 3OBJA 4PQNA 4UBAA 4KIOA 4W9XA 3ENMA 2BAQA 1DM2A 2ACXA 5LVOA 2XNPA 3L8SA 4W4YA 4A4LA 2XA4A 1M17A 4GFGA 1JWHA 3TZ8A 4QTDA 3VBXA 3HP2A 1YXTA 4DCAA 3P86A 3UZPA 3Q4UA 3PVWA 4XUFA 3RBWA 1DS5A 4DFNA 4FEXA 3QC9A 4MXYA 4QNYA 4NM7A 4V0GB 2IG7A 3FYKX 3NNVA 3UIXA 3ZXTA 3U6HA 5FEDA 2NRYA 3UPXA 2W5AA 4G31A 2WMXA 3ZM4A 1E9HA 2X6DA 4QMQA 5A46A 3LW0A 3BZ3A 2OIQA 1PXIA 3EQGA 3I5ZA 1ZOHA 3O8UA 4HYSA 4H3BA 3R21A 4IC7A 5FWKK 3RGFA 1OBGA 4D4VA 4L68A 4AGCA 2QOQA 2QR7A 3D5VA 5EH0A 4AT3A 2VV9A 4V05A 4JI9A 3SXFA 2X8DA 4J52A 2R3OA 3GFWA 3MESA 4L7FA 3RVGA 4YC3A 4CT2A 5JT2A 3ORKA 1BI7A 1KE7A 1QPJA 3O7LD 4FK6A 4NW5A 3E88A 2CHLA 3NEWA 2UW3A 3OWJA 4AX8A 4I5MA 4RVTA 5FQDC 4F9YA 5AFVA 5CASA 4IMYA 4I4FA 4GU9A 4I24A 3ZUTA 2ZJWA 4FKTA 4C4EA 3FSFA 3MI9A 5HU3A 3Q96A 4U97A 4WRGA 4F70A 2UZWE 4U0IA 2WIPA 2B7AA 4PPAA 3OUNB 4UXQA 2G2FA 3QKMA 3A7FA 3MJ1A 4U9AA 3FZRA 1JKSA 1H24A 3Q4CA 4ZS4A 3KY2A 3FXXA 4JX7A 4NFNA 4U81A 3MV5A 3PZHA 3FKOA 4FG7A 3QBNA 4CFWA 5M07A 4FK3A 1YHVA 4XLIA 3SHEA 4TYJA 1MQ4A 2XKFA 4CLIA 3M2WA 2YDJA 3W2SA 3W55A 2XH5A 2BZIB 3TKIA 4Z7GA 3CSVA 5EI6A 5BVKA 1P4FA 4PMSA 4PTEA 4G3FA 4ALWA 3HYHA 2FSMX 3HZTA 2UZBA 3EB0A 4TY1A 2YWVA 3DKFA 3N4TA 3KA0A 5IA0A 3F3ZA 3LKMA 3GB2A 2R3JA 3R2BA 2WMQA 2R3HA 5EI2A 4GYIA 4U42A 4EJNA 4ZEGA 3C13A 3TACA 5EDPA 2W4KA 5CI7A 1YWRA 2OI4X 4D1SA 3OW3A 1J91A 2X7GA 1H1PA 3HUCA 5E90A 4FSWA 3QLFA 2VD5A 5LCJA 4MAOA 4BB4A 2OO8X 4L3PA 4ZOGA 3W1FA 4EHVA 1IAHA 5BPYA 4DG2E 2REIA 5DRBA 4JNWA 3Q9WA 3PXFA 2ZDUA 1GAGA 4DG3E 4IC8A 1Q5KA 4IXPA 3EN5A 1KV1A 5H8BA 3DJ5A 3U87A 4L52A 3OP5A 4F9AA 4QMVA 3VUDA 3VJNA 3TNWA 3PUPA 3D15A 5M53A 4JDIA 3QD4A 2QU6A 4QT1A 4RJ5A 4HVIA 1J1CA 5JGDA 3LFFA 5LMKA 2HYYA 3C4ZA 1IA8A 3PIXA 2UVYA 3O2MA 4X3FB 4BDHA 1JNKA 2XNOA 1BKXA 1HCKA 4F9BA 5J1WA 2PWLA 4DTKA 3FLWA 4A07A 1PF8A 1FVTA 2UW7A 4JQ8A 5C8KA 2UV2A 3M1SA 5HNIX 2R3GA 3VJOA 1S9IA 3C9WA 3HV3A 3ZLSA 4CKJA 2F49A 5FDPA 3IW5A 3BV2A 4XG8A 4E73A 1OZ1A 3Q9XA 1K2PA 3KULB 4ZTSA 4GMYA 1B6CB 4LGDA 4K18A 5DN3A 3AOXA 4JQEA 2CPKE 4AW1A 5HE3A 2B1PA 2ITZA 4HVHA 1R39A 4YO4A 5A9UA 4LRKA 3KXXA 3BWFA 3RAIA 2HENA 4GT4A 3OCBA 3LXPA 3NUYA 1PMUA 2NPQA 4KS8A 3HAVA 2RFDA 4RRVA 5AAFA 4ANBA 4L67A 5CEPA 2WMWA 2IZUA 3VHKA 4AGUA 3IW6A 3NW6A 3LLAA 4MX9A 1W83A 4MNEA 3FJQE 4RVLA 2J0LA 3F5XA 4O96A 4XRLA 4YLLA 3Q32A 2W1IA 3ZHPC 5L2WA 3DQXA 5EFQA 5EW8A 3OT8A 4M7IA 4QMLA 4XOYA 3GC7A 2C6LA 5AV0A 3QCXA 3WIGA 4E3CA 3EN4A 4CRSA 4LOQA 4R1VA 4QPSA 2CKOA 1VZOA 3R7YA 4FC0A 2JDOA 1U5QA 4MCVA 4I6HA 1KE9A 2OXYA 3TV7A 2XK6A 3FMLA 2VTQA 2IVTA 5ACBC 3PZEA 4CMUA 2JAMA 5HG5A 3JY0A 5IDNA 2OZAB 5DRDA 5FP5A 3FLNC 3MH1A 2E2BA 1M2RA 1QL6A 5CI6A 3OCTA 2WTJA 2B53A 2X8IA 2CCHA 4FZDB 5KX8A 3EKNA 2OJJA 3IDCA 3BELA 4XMOA 3VRZA 4GFMA 4YZNA 5DIAA 5E8TA 2GHLA 2YIRA 5AEPA 4KABA 1IG1A 3IPHA 4AW5A 2P3GX 3EQHA 4N70A 4QMYA 4UMPA 3REPA 3PWDA 3G33A 3V8TA 2Z7QA 2GMXA 5HBHA 3U9NA 5H2UA 3NPCA 4BF2A 1R0EA 2SRCA 4A9YA 4FVPA 3UNKA 2RG5A 1H0VA 2G2IA 2W1ZA 2P2IA 2BAKA 2J5EA 2C4GA 3CKWA 3PVBA 4YURA 5IF1A 1W82A 1CKJA 2UVXA 2W9ZB 3DOGA 3POZA 3FAAA 3H3CA 4D2PA 3RALA 4JBPA 4Q5EA 4ACGA 1WVWA 4CKIA 5GZ9A 4Q5HA 4O0YA 4F6UA 5A4QA 3JYAA 4O86A 4EYJA 2CN5A 4YUQA 4LRMA 1Z5MA 3GQLA 4K33A 4FT7A 4FT5A 4LL5A 4RX9A 5FTOA 1Z57A 4JVGA 2X2LA 4MQ1A 4AW0A 4IIRA 3BYMA 3ALOA 2YM5A 4TPTA 3FZSA 4ANSA 4MF1A 3DLZA 4MEDA 1YWVA 3D14A 4LI5A 1OBDA 5AUYA 3R7EA 1MRUA 1OB3A 4XYFA 3UIBA 4L3JA 1FVVA 5TF9A 3VHEA 4FUYA 5F4NA 3HMNA 4GT5A 4L42A 1NA7A 3HDMA 3DKCA 3MY0A 4LG4A 5DG5A 4EUUA 3D2KA 3H9OA 3MPTA 3EFWA 4FZFB 3D2IA 3MYGA 4DLIA 2WTWA 4JBQA 4L46A 4U40A 2JEDA 4DBNA 4HVDA 3UVQA 3SVVA 3RCDA 2A1AB 1Q8YA 3AT4A 3HUBA 4O22A 1OUKA 5D7VA 1B38A 3NYNA 4GG5A 4BCNA 3PLSA 2C3JA 4W4VA 3FMEA 4PNKA 5IKWA 4EC8A 3Q6UA 2JITA 3VS0A 5L8JA 3B2TA 2J90A 2WEVA 2WQEA 2BPMA 3FSKA 3EL8A 1UU3A 5CWZA 2W5BA 5H8EA 3EJ1A 4RC3A 3DQWA 3L8VA 4ITHA 4ZP5A 1JKKA 4S2ZA 3UVPA 4AZTA 2RGPA 4KIKB 5AV1A 4BR3A 5L8KA
chains in the Genus database with same CATH superfamily
5IUGA 4MXCA 4IAIA 1MUOA 2QHMA 4L53A 4ZJVA 1KE8A 3QQKA 4GG7A 4QNAA 4NJDA 4LGHA 2ITPA 3UO4A 3COHA 3C4FA 5IUIA 3AT3A 3K54A 4R3RA 2HW7A 5CT7A 3QXPA 2RF9A 4ERKA 3QHRA 2ZVAA 4K8AA 2VX3A 3O0GA 2PVRA 3UVRA 2OZOA 1GY3A 2XJ0A 4HJOA 5C01A 3DS6A 4MH7A 4MNFA 4HOKA 3OS3A 3KVWA 4TL0A 5A4TA 1XH7A 1R1WA 2IVSA 1UWJA 5FLFA 1WBSA 4C57A 3GU6A 4DG0E 1RW8A 5EM5A 3QCSA 5CTPA 3TZMA 4W8DA 1CKPA 3IW7A 3FXZA 3QCYA 4IZAA 3KEXA 2B4SB 4RX5A 2IZTA 3BGQA 3R8VA 1H1RA 4D2SA 1H00A 4DEDA 4FJVA 2BHHA 3RHKA 2XM9A 4EH5A 5K5XA 1KOAA 1XHAA 3JPVA 3EHAA 4FTUA 4W9WA 4ZSAA 5E8UA 4AZEA 3VUGA 2BDJA 5JZJA 2IJMA 5DA3A 2QG7A 1JOWB 2RSVA 2QLQA 5HG7A 5L2IA 1DAWA 3FQEA 3JY9A 1REJA 2OSCA 3AQVA 4D9TA 5TR6A 2PVKA 4FNZA 4GUEA 1JKTA 4IQ6A 2VTRA 5AR7A 4CV9A 4DGMA 4R3PA 2OWBA 3P4KA 2GNLA 4ASDA 4UN0C 4IHPA 5IQBA 3FBVA 3BHTA 2HXQA 3ZUUA 1YXSA 2WQOA 1OPJA 5IU2A 3NVKI 4JDJA 4UZHA 1NVRA 2X7FA 2VRXA 3DK6A 4C2VA 4K1BA 4ZTLA 3SKCA 3ZBFA 5C26A 3NCZA 4KAOA 4EUTA 3CD3A 5AADA 3F7WA 2PVLA 3AC1A 3CS9A 4N4SA 2J0IA 5HO6A 5DBXA 4NFMA 2G01A 5AA9A 3BLQA 3VNTA 4HGTA 2AYPA 2BUJA 5CF8A 5M4CA 4KD1A 4KSQA 2QOKA 1GIIA 4RIYB 4BGQA 4FG9A 3AKJA 2C68A 3G0EA 5EK7A 2CGXA 4HPTE 4JBVA 3NUPA 2CLXA 3MPMA 5C1QB 2J50A 2PZYA 3PXYA 2AC5A 2R3KA 5JGBA 3PJ8A 2XIXA 3R1SA 4R3CA 5CU2A 4ENXA 4NUSA 1S9JA 4ACMA 3FC1X 5LVLA 4H58A 5E1SA 2QLUA 4NW6A 4DH7A 3SG9A 4L43A 3MB6A 1XMMA 4JIAA 5KMJA 3QUPA 4AW2A 4G6NA 2UZDA 2X1NA 1APME 4AA4A 4ZTRA 4ZY5A 2IO6A 1LR4A 4KKEA 5CZHA 4A4OA 4BN1A 3VBVA 1FGKA 4Q9ZA 4C4FA 3TDVA 2Y7JA 5AP7A 4EWHA 5EQYA 1H26A 4MD8E 5T3QA 4O82A 2X4ZA 2BRMA 3ZONA 4GT3A 2XKCA 1UNGA 2O64A 3ORLA 5CVGA 4AFEA 2WPAA 2XB7A 4EZ5A 2VGOA 1G8SA 3I81A 4FV6A 5JN2A 2XAOA 2FGIA 4DA5A 4EONA 3W0OA 4R6VA 3WF7A 5CF4A 2Y4IC 2YFXA 3C7QA 4O0SA 3P9JA 3MFTA 5HE2A 4BYIA 2FA2A 2GHGA 3HMPA 1P14A 5FDXA 3DBDA 3TZ9A 3ACKA 2C6OA 5ANIA 3W16A 3GNIB 4JIKA 4KRCA 1ZY4A 2GTMA 3BQRA 4H36A 1REKA 2VTNA 3OCSA 4EORA 5LMBA 2NYAA 1J7IA 2YIQA 5LQFA 4V01A 4I0RA 4AGWA 5A14A 4RJ7A 3U54A 4RG0A 2XJ1A 3G2FA 3DFAA 2BAJA 2GTNA 4NYEA 5CQUA 2JKKA 3W8LA 5IG1A 4QYEA 2PU8A 5IA2A 4O7RA 2VTPA 4N57A 4H3QA 4O81A 3WF6A 3A8XA 4ZLZA 1PXLA 2HWOA 4EI4A 4DHJA 2WMRA 4JXFA 4U8ZA 2PTKA 4EOSA 4W8EA 5BUIA 3R9HA 4LUEA 1GZNA 5GNKA 2IZSA 4ZSJA 4IH8A 3RK7A 3DXPA 5DOSA 5DEWA 4PP7A 2GNGA 3A7IA 3NR9A 3SA0A 2YCFA 2Z2WA 3UOKA 2UZEA 4QP8A 5CU3A 4QMPA 3L8XA 4GV1A 1JPAA 3LJ2A 2IW6A 3OY1A 4F0FA 3QTIA 4Y8DA 4O7VA 3DBCA 4I1ZA 2W1CA 2HZIA 4O21A 3SLSA 1HCLA 4PPCA 2V7AA 4F7JA 5BNJA 3KIOC 5CF6A 3LCKA 3A8WA 4JG7A 2R3FA 2BRHA 3QGYA 5ANJA 2OJGA 4BWPA 2R9SA 3HV4A 3OF0A 3BLHA 4QYFA 3LMGA 4RBLA 4QP3A 3COMA 4YR8A 4WG5A 3QRUA 4ZZMA 3SG8A 3IO7A 5IDPA 5TT7A 1SVHA 4TRLA 4GJ3A 4QMNA 3NUUA 3EQDA 4BHNA 4FT3A 4ZK5A 2JDSA 4USEA 3SXSA 2RIOA 2PE2A 3CTQA 4M13A 4DEGA 4EWQA 3OD6X 3ZFXA 3GT8A 4EOMA 2O0UA 4ZY4A 1Q61A 2VX1A 3N51A 4YJSA 5AR5A 2BCJA 1OL2A 3MH3A 4KBKA 3U4WA 3VBTA 4FSUA 2XF0A 3G6GA 5E4HA 2OFVA 3LPBA 3DAEA 1YKRA 3FMDA 4PTGA 5AAGA 2UW4A 3FLZA 2J2IB 3NNXA 3BGZA 4FKIA 4O7NA 3ULZA 1F3MC 3TM0A 3V8SA 3NNWA 3BHVA 2XS0A 4O1OA 4C35A 2V5QA 5HTIA 2YIXA 3TNPC 2I0EA 4BDEA 4APPA 3UYTA 4DGLC 3BYVA 3TCPA 4F7NA 4FV5A 4ZTQA 5ETCA 3HDNA 4PDPA 5J5SA 4TW9A 4XJ0A 3GXLA 4OTIA 2WB8A 4FTOA 4RLKA 2XBJA 3R22A 5E8SA 3R7IA 1E1XA 4BRXA 2Z02A 3HRCA 2A0CX 2CJMA 3WZUA 3AMBA 4QMSA 3S3IA 4CD0A 5AIKA 5LMKC 4XBRA 3CKXA 3PVGA 3UO5A 5BYLA 3QF9A 1IA9A 3SAYA 4QP2A 3ROCA 3PXZA 3D9VA 2ZDTA 1J3HA 4FE2A 3POOA 3ZEPA 3TJDA 2B9JA 3DY7A 4FMQA 4G16A 5DE2A 4B8MA 3ENHA 3IKAA 3G9NA 3WZKA 2C3KA 4QP7A 2I0YA 3SOAA 2Y4IB 2YLEA 5FBOA 3WZDA 5CQWA 4RWKA 2X39A 5HG8A 5CS6A 3R1QA 2E9VA 3KN5A 3D5UA 3BYOA 4YU2A 3ID6C 4L45A 4U6RA 4MK0A 4XV2A 5CVFA 3VIDA 4FBXA 4RFYA 1FBNA 2VO3A 1VEBA 3Q3BA 2YHVA 5AR4A 4F1MA 5ICPA 1K9AA 2Y4PA 2J0MB 5E7RA 4DH5A 3QHWA 1T45A 4AN3A 3LCSA 4QMOA 3F88A 4FTCA 1CDKA 4U7ZA 4O6LA 3DCVA 3IGGA 3KMWA 5GIOE 1UU7A 3VW8A 1Q8TA 5EI8A 2CKQA 4FF8A 4MVFA 1Y91A 3VS5A 3NRMA 2VTIA 4IB5A 5HBEA 2X7OA 2PMNX 3CD8A 3MW1A 4FIHA 5CXHA 4YGAA 4ZTNA 3AC8A 3THBA 4ENYA 2FYSA 3VS1A 3UOHA 4RPVA 3TN8A 5A4EA 4QDVA 2W96B 2YAKA 2UUEA 3KXMA 4FIEA 4FKPA 3Q4ZA 4NM0A 5E8XA 3TTIA 5IEXA 4HZSA 1UA2A 4L9IA 3QD2B 1Y6AA 3R0TA 4TWPA 5DWRA 5EOBA 5HHWA 2UZLA 4U5JA 3MVHA 4UB7A 5HZNA 5K5NA 2HWPA 4QQJA 2YAAA 2NO3A 3BYSA 5GJDA 2Y6OA 4QP9A 5HO7A 3QRTA 4G3EA 3R28A 2QODA 3HV6A 3NGAA 2OXDA 5FEEA 4QMTA 2QO7A 4CFNA 2OW3A 3ANQA 5GJFA 1YVJA 3ZLWA 5F9EA 2XYNA 4C8BA 4EK5A 1SNUA 1U59A 4UMRA 4BL1A 4J53A 4FV4A 3IG7A 4RX7A 4YBJA 4CMOA 3EYHA 3TJCA 2VU3A 3BU6A 4WBOA 2ZMCA 1V0PA 1MRYA 3OCGA 2PZPA 3HMIA 2R7BA 3DDQA 3H10A 4DFXE 5IQHA 3R8ZA 4ZJIA 4WIHA 4DH3A 1M7QA 1QPDA 1ZZ2A 2YACA 4GEOA 5EHOA 5DEYA 3DBQA 2OICA 5LWMA 3QTXA 3GU5A 3HA6A 4UZDA 1VYZA 3U8WA 4DE4A 5K0KA 1UVRA 4H39A 4CG8A 2XUUA 2WMVA 4JRNA 3EN7A 3W8QA 4LYNA 4BDDA 2ETRA 4N0SA 5BYYA 4RIXA 3C4EA 3ATTA 5EHLA 3FEGA 3NCGA 2DQ7X 3UQCA 1Q8UA 3VS6A 5JSMA 5EYMA 2GCDA 4EQCA 5JFWA 1XR1A 4JRVA 3LJ0A 4O1PA 5A6OA 4J8MA 4OTWA 4WOVA 3ZO3A 3ZUVA 2C0OA 2YM4A 4UXLA 5I9WA 4OLIA 5ETAA 2BRNA 3OEFX 3KVXA 1G3NA 4LV8A 2I6LA 3QTUA 4EK8A 3B8RA 3W0MA 4I20A 4IAFA 2GQGA 4PMTA 5CZIA 2C6MA 2CGVA 2AC3A 4CXAA 3NW7A 5LJJA 3TEIA 5HGIA 1PXKA 4YP8A 5M4UA 3SDJA 4FNWA 2C47A 3ZZEA 4BHZA 1YHSA 3I4BA 1M2QA 3FMKA 4FV2A 2W17A 5C03A 1LPUA 2ITNA 3LXLA 4FTKA 3OG7A 2BALA 5DR2A 5D9HA 4P90A 5JFXA 4YC6A 3EKKA 4O0RA 4NKSA 2Y6MA 3QD0A 1M2PA 2CN8A 4B8LA 4ASEA 4F1OA 4CZUA 5CLPA 5BYZA 3MS9A 4WG4A 1YQJA 3EZVA 2CDZA 3CJGA 3PPKA 4IVBA 4ONAA 4LMUA 5LVPA 4QTAA 2YM7A 3KF7A 4FKLA 2OXXA 3QA8A 3UMXA 1OIUA 3FL4A 2ZYBA 3O17A 3RI1A 3CC6A 3GFEA 3UE4A 3GI3A 4F65A 2OH0E 5I9ZA 1L8TA 4A4XA 2VTOA 1ERKA 4JR7A 4G5JA 4I41A 4EZ7A 5HVJA 1OIYA 4MNEB 4DLJA 1WAKA 3QQFA 1Q24A 5GZAA 4IADA 4WA9A 1JLUE 4AF3A 4FOBA 2PUNA 2QNJA 4G6OA 2R4BA 2BIKB 2H9VA 4KNBA 3FY0A 5HD7A 5KCVA 2OF2A 4IZ7A 3RPYA 4BWKA 5B7VA 4X3JA 3GCQA 1YOLA 3HP5A 5IQDA 3PFQA 4AOIA 5DLSA 3ZS5A 3OWLA 5BQ0A 2IEWA 5F1ZA 2Y9QA 4YMJA 4K0YA 3U9CA 3LFBA 4MQ2A 4KB8A 3P08A 1PJKA 3BIZA 1R0PA 2WMAA 3O71A 2WQMA 4OTPA 5AM7A 1NVSA 2XYUA 5HD4A 1V0BA 3HX4A 4RWJA 4D0XA 5KUPA 4C4GA 4E4XA 4WUAA 3VQUA 1H1WA 2ZB0A 4HZRA 4OT6A 3KRJA 4M15A 2QOHA 5IZFA 4G2FA 3PJ3A 4Q9SA 4BIEA 4B4LA 1BI8A 1XO2B 4I6QA 2PE1A 4PTCA 3E62A 2R3NA 4NSTA 2VTTA 3BKBA 2JBOA 2ITTA 3DAJA 5DR6A 5JMSA 3ZRMA 1TKIA 4WSYA 4YPSA 2XP2A 3ZXZA 3OBGA 5LOHA 1YOJA 5DGZA 5AUZA 4R7BA 2GS6A 2XKEA 4S34A 4I93A 1PMVA 4X2FA 5BVEA 3CGFA 4RC2A 5AUXA 2ZM3A 1JBPE 3R9OA 2UW8A 3BQCA 4IX5A 5FTQA 3PY1A 4FNYA 2WIHA 4W4WA 3SXRA 4I21A 1IRKA 1YI4A 3OROA 4YZDA 3UMWA 1P5EA 3PXRA 5I9YA 4QPMA 2XIKA 4FKOA 3SRVB 3FZTA 4RFMA 3OXZA 5AP6A 2WEIA 3NAXA 4JDKA 4U3ZA 3MFRA 2ZV2A 2VWBA 3MA6A 5DPVA 3VAPA 3VS7A 3JR1A 3F5UA 3AD5A 3KF4A 3ZLYA 3BEAA 2QO9A 4J96A 3RAKA 3S1HA 4YNOA 3LM5A 5CSXA 3NFGB 3TWJA 2IVUA 3ORXA 3AD4A 2OFUA 5DVRA 4E6CA 4FEVA 2YERA 3PSCA 2WFYA 4O4CA 4DT8A 3VULA 2VX0A 5GINE 4E5AX 2VZ6A 5I3OA 5M56A 2KTYA 2RKUA 3VUKA 4O0VA 2O2UA 5C4LA 5EDRA 3DT1A 4EHZA 3EQFA 4EOLA 2UZOA 4O4BB 4NWMA 4OAVB 5JRSA 3T9TA 2C3IB 4EQMA 3R8LA 5ITAA 4FGBA 2W1GA 2JDVA 4UEUA 2PULA 2GHMA 2Z7RA 4PNIA 5IEVA 2W1FA 1P2AA 5EM8A 4HVSA 2YCSA 4FEQA 3GC0A 4CLJA 3HLLA 3II5A 4BI0A 2JIVA 4E4NA 1B39A 2E9OA 5EQEA 3DZOA 4GKHA 1Y8GA 5G1XA 5J5TA 4HCUA 1URCA 3E64A 1BMKA 2A4LA 3OOGA 4XG6A 1WBOA 3P7AA 3DXNA 4OT5A 5LARA 4XNEA 3DNDA 4D1ZA 3FV8A 3DAKA 3EZRA 3R04A 2J4ZA 2ZV8A 4S30A 2PZIA 2RFNA 3V8WA 2F2CB 2PVMA 3P79A 4KS7A 2WO6A 3HNGA 4FTJA 5DI1A 3FQSA 3V01A 4QP6A 3LQ3A 4AXFA 3Q5IA 3BL7A 2PMLX 4KA3A 2CGWA 3GEQA 3I1AA 3FZ1A 3OUKA 4OGRA 2PZRA 3EQCA 4XP2A 5CX9A 4OR5A 4FSYA 5HCZA 1WMKA 5GZ8A 2YCRA 4G9RA 3UQFA 3A7JA 1V0OA 4BCQA 3TMOA 3LFAA 1H8FA 3MTFA 4K11A 4CFFA 3QXOA 4F6WA 2XCHA 4C61A 5HNBA 5DR9A 4UMTA 4UALA 4IB1A 2C6IA 3MVJA 4BYJA 5FM3A 1URWA 3R2YA 1H4LA 3BLAA 3VO3A 4WG3A 5ANOA 4IBMA 5JK3A 4GCJA 4C59A 4E4MA 4YJTA 5BVNA 4FSMA 4Z3VA 4Y5QA 4OTFA 4R7IA 1ZWSA 2XK8A 3QAME 2R0UA 2YJRA 3QGWA 4BGGA 3FI8A 1OKYA 3ODYX 3C0IA 3DTWA 2OH4A 5CEQA 3VONA 1GZKA 5IA3A 5GIPE 4IE9A 4GH2A 5LCKA 4O7LA 2H6DA 3GU7A 2GS7A 3C51A 2YM8A 3W32A 2XNNA 3WOWA 1ST4A 1ZYLA 1W7HA 3FC2A 3H4JA 2NNWB 5FBNC 2OLCA 4IFCA 4MBIA 4O7ZA 4PWNA 4O0WA 1PXMA 3D94A 4YPDA 3NVMB 2VTMA 3ATSA 2FSLX 5KNJA 4FL3A 1ZYSA 4Y85A 5JFVA 4OAUC 2XEZA 4AXDA 5L2TA 3QD3A 4JL9A 2X2MA 4GL9A 3P0MA 4G5PA 2JBPA 3NUXA 4IX3A 3M42A 4CFMA 4WNOA 5EOLA 4ZZNA 3IQ7A 3KK8A 3CLYA 4NIFB 4QP4A 5CSHA 3ZTXA 1UU9A 1XWSA 2ZM1A 4QQ5A 4BBEA 1RDQE 2VTJA 5AUUA 4GK3A 5IPJA 3AGMA 4M69A 4JG6A 2W1EA 4BCPA 2DUVA 4D2VA 4A9TA 4XBUA 4AE6A 1U54A 4YSJA 4DF3A 1YW2A 2HZNA 2ITOA 3Q5ZA 4E5WA 2J6MA 5HCYA 2IWIA 5ANDA 5C8MA 3RINA 4TWOA 3ZO4A 5IA5A 4AN2A 3RJCA 1W8CA 2BZHB 2ZV7A 4ZSLA 3QTWA 5EYKA 4N6ZA 3LXNA 4IX6A 5DT4A 4D2WA 4EOKA 2R3PA 3K5VA 3I6WA 2UZUE 3LM0A 1T46A 5K9IA 2NP8A 3G9LX 1ZMVA 3RM6A 1JSTA 2Z8CA 4UYAA 4C02A 4CG9A 1A06A 4Z55A 2ITWA 2WHBA 4J71A 2F4JA 1XH4A 4IAZA 4A9SA 3NNUA 5TOZA 2YEXA 3W18A 1H1QA 3QALE 3VBWA 3ODZX 4L44A 2X8EA 2BROA 3DK3A 3TKHA 4BFMA 5J9LA 2UW5A 5AP5A 1PKGA 1SYKA 3GOKA 4G34A 5IH5A 1Q41A 3PDTA 4H05A 5A4LA 3LFSA 2WMBA 2YIWA 5KKRC 4QMZA 5CSVA 2KULA 3O96A 3B8QA 4JDHA 4Y72A 1WVYA 1YDTE 2GDOA 4R77A 3UDTA 3WE8A 4JMQA 3A7GA 5IQCA 4FTRA 4C36A 4USFA 1PRYA 1IEPA 4O4DA 2Y8OA 3OY3A 2ERKA 4CMTA 1SVEA 2OK1A 4E4LA 2NRUA 4RLLA 3C0HA 3TIYA 2R5TA 3UIMA 4BCMA 1I09A 1SNXA 4KRDA 3DXQA 4U79A 5J87A 2ESMA 5HI2A 3FMMA 2CSNA 4FIJA 4FZ7A 5HE0A 1RQQA 2X81A 3QWKA 2O63A 5CU6A 3D5WA 2CLQA 3O8TA 3VF9A 4A7CA 1JSUA 2GQSA 3F3WA 4C38A 3QZHA 4NU1A 4IJ9A 1ZRZA 2BHEA 3KRRA 3RZBA 3AGLA 3T9IA 5IQFA 2BRBA 2C0IA 2VO6A 2YISA 5IQIA 4FTIA 1Q97A 3QLGA 4AZFA 2OKRA 2FSOX 4MXZA 2R3RA 2WMSA 4YJOA 2F9GA 1F5QA 1XKKA 3KFAA 4BKZA 5K4IA 2VTSA 4EOIA 4RJ3A 4DTAA 4ACCA 1YI6A 3AC4A 1CSNA 3H0ZA 4GVJA 4LRJA 5B2MA 1OIRA 2P2HA 4ZJJA 1VR2A 2WTIA 4DEAA 3KN6A 4X2KA 1YWNA 3LMHA 4K9YA 2PVJA 1OIQA 4M3QA 1HOWA 2PVNA 3QFVA 3Q52A 3AMAA 4ZSGA 4APCA 3QYWA 2PY3A 3VW6A 3Q9ZA 2ERZE 4UMQA 3UC3A 3BBWA 5EKNA 4I22A 4PY1A 2W4OA 2WD1A 2PHKA 2E9UA 2H8HA 3DGKA 4RVMA 1BX6A 3R01A 5HG9A 2EVAA 2CKEA 3ORNA 1Q62A 1VYWA 2UZTA 2HW6A 5L4QA 3FL5A 1K3AA 4O91A 4M66A 2QONA 5HX6A 2ZM4A 4PL5A 3QQJA 3I6UA 3OXIA 2VWIA 3F82A 4KBAA 4LM5A 5JFSA 3GCVA 1PXOA 3DV3A 3EYGA 2ONLA 3BRBA 5CU0A 3LAUA 5CNOA 4BCJA 4TYGA 4L7SA 4BC6A 1XQZA 1L3RE 1RJBA 3L9MA 4AE9A 4HGLA 4XLVA 4M0YA 2GQRA 4I0SA 4HW7A 2QOIA 4UWYA 1BLXA 1WBPA 3BE2A 4RC4A 4FKGA 5HESA 4BIDA 5CAQA 4OBOA 5HICA 2X9EA 3W2PA 4GFOA 2QCSA 4CFXA 3CP9A 4CGAA 1GJOA 2LAVA 5D41A 2I1MA 2UZNA 3R9NA 4TWCA 5AV2A 4FSZA 4OTQA 1KSWA 4IWDA 4CYJA 2UW0A 5HIBA 5I4NA 3RAHA 1XBBA 3E3BX 3OW4A 3UC4A 4EK4A 3D7ZA 3GCSA 4W4XA 4LOPA 5FXQA 4HCTA 4CV8A 3RP9A 4MXXA 4FT9A 3KKVA 4M12A 4TNDA 5KMMA 1P4OA 3A62A 3R7UA 3D5XA 2F2UA 2P0CA 2A2AA 4YJUA 1YXVA 5H3QA 3QTRA 4B0GA 1SMHA 1ZYJA 3NYOA 3PG3A 4RVKA 3N4UA 4XH6A 3TNIA 3RPOA 4UX9A 5CY3A 2X0QA 1CTPE 3QU0A 5D1JA 5KKRB 2BILB 3GGFA 4FVRA 2WAJA 2YA9A 3LE6A 3MTLA 3NIZA 4JG8A 3IOPA 4DHFA 3AKKA 1SZMA 4QDEA 4YHFA 5M55A 4D4SA 3FPMA 1PYXA 1AD5A 3C4WA 3PY3A 4RFZA 5CALA 5A54A 5AAEA 3FI3A 1XH9A 2PE0A 4O7TA 4PMMA 5DT3A 5K3YA 1VLRA 3HMOA 2WZJA 4FV3A 4MBJA 4F99A 2XCKA 3CQEA 4PL3A 3SV0A 3RNYA 2QOOA 4GIIA 4BBFA 2BFYA 4E5BA 5DHJA 3ANRA 4XG3A 4EH9A 5HU9A 1W2DA 4HYHA 3U4UA 5D12A 1OVEA 4DC2A 1FPUA 1ZAOA 3TV4A 3NLBA 5B2KA 4LUDA 3FMNA 4RA5A 3OTUA 1QCFA 2HCKA 5CAUA 3GUBA 1O6LA 3UP2A 4BDGA 2PMIA 4O0UA 4R5YA 4YSMA 4X2NA 3FMHA 4XV1A 3ITZA 4G6LA 2ZOQA 3QZGA 4BDIA 3BU5A 4PPBA 4AQCA 4YTFA 4FYNA 4DITA 2QVSE 2GFCA 2GNJA 3A99A 3PRFA 2XK7A 5GJGA 4I0TA 4C58A 3FZOA 3W2OA 4DFYA 3T3UA 4S32A 3PWYA 1QPCA 3FHIA 4L8MA 4RZWA 4XS2A 4XRJA 1G8AA 2JD5A 4BCFA 4IAKA 4EHEA 3R9RA 4B9DA 4G3GA 2XM8A 3F3UA 3LFQA 1LEZA 4S31A 3ZO2A 3OWKA 5AR8A 4CCBA 1UU8A 4TYIA 2OJIA 4ACHA 4QRCA 2Q0BA 2W05A 3E8EA 4KINA 4OTHA 5E9EA 5EYDA 1WFCA 3GC8A 5HCXA 5FRIA 5FGKA 3P1AA 3DDPA 4QOXA 1GZOA 3V04A 3UZRA 1BL7A 3VVHA 5D11A 3E7VA 3GC9A 4EH8A 5IQGA 4TXCA 3EFJA 2ITVA 2XK3A 4KKGA 4YNEA 5J7HA 3IECA 3DBFA 1W2FA 3OT3A 4G3DA 4USDA 4QYGA 5CEMA 3PG1A 4BZOA 3TNQB 2C5NA 4X6RA 5BVWA 2GNHA 2ITUA 5EDQA 4JOAA 4MKCA 4DHZA 4QMWA 5M57A 4DFUA 2W9FB 3O51A 1PXPA 3LHJA 3ZMMA 4ANQA 2VNYA 4D4RA 4TN6A 5F94A 1OL6A 3IK3A 4I5CA 5EW9A 2Z7LA 3O50A 3PYYA 1PKDA 3FY2A 4AT5A 5BUJA 4J1RA 5JQ8A 3PA4A 3E93A 5DT0A 2JKOA 5KO1A 3Q6WA 4FZ6A 2R3QA 4YJNA 4RIXB 2HY81 3I60A 3PLAE 4RQVA 4BCKA 4OBQA 2VN9A 4UMUA 2AUHA 2QG5A 5B0XA 4OW8A 4ACDA 3F61A 2AQXA 4DDIA 4ZSEA 3ZFMA 3QX4A 4FIGA 1CM8A 3CIKA 5KMLA 2QKRA 5AP2A 3MDYA 1YXUA 1Q3DA 3QL8A 4NK9A 5AUVA 4L01A 3RWPA 2YDKA 2QURA 2BZKB 2X9FA 3JVRA 4J7BA 4U43A 3O7LB 5BX0A 4AAYA 2F7EE 3TTJA 1FMOE 3Q4TA 4G3CA 4FTTA 3RZFA 4F0IA 3LCDA 4KUJA 3W0NA 2YM3A 2XK9A 3LVPA 5CAVA 1Q8ZA 3I5NA 4IVCA 3F3TA 3EQPA 2EXMA 5E92A 3LOKA 3LFCA 5K4JA 4FTAA 3E8NA 4FL1A 2CGUA 2H34A 1Q3WA 1PHKA 3WF9A 3R8UA 3ZH8A 3NX8A 3PXQA 3OTVA 3RK5A 4FTQA 5JEBA 5HOAA 1ZMUA 4F4PA 5LXMA 3PE1A 5IH4A 2OJFE 1KOBA 1TQMA 1TVOA 4FVQA 4HYIA 4L00A 4O2PA 4FKUA 3ZU7A 3GVUA 3VUHA 4GS6A 4BBMA 4E6AA 2GSFA 4II5A 3ELJA 2JAVA 3BPRA 3LZBA 3MH0A 4MXOA 4BDBA 2V62A 5M4IA 4IB3A 4RQKA 3SX9A 2W1DA 2WOUA 3PSDA 4AG8A 3CQUA 3DB8A 3ZC5A 4A9UA 4F09A 4CCUA 2PVHA 2EWAA 5DNRA 2PVYA 3ZDIA 4HNIA 3BEGA 4C4HA 2XIRA 4YJPA 1I44A 2BKKA 1J1BA 2R3LA 4F7SA 4O27B 4DEIA 4GSBA 3UDSA 2HZ4A 3R9DA 4QMMA 4BJJB 3B2WA 3P23A 4WSQA 3MJ2A 4I6FA 4HPUE 2O5KA 4BDKA 4ID7A 4GKIA 2B52A 1ZXEA 2JFLA 5L8LA 3LFDA 3WIKA 4XP3A 4ITJA 5KE0A 2BTRA 2OF4A 3HV7A 4EJ7A 3RNIA 4FV1A 2C69A 2UVZA 3NW5A 4BZNA 4Z7HA 1AQ1A 4WD5A 2F7ZE 2WELA 4NM5A 1GOLA 1U46A 5KMIA 3E63A 4IWPA 4E8AA 1MRVA 1UWHA 3R63A 5AP0A 4XHKB 1JQHA 3Q04A 3VS2A 2CCIA 2JKMA 1F0QA 3ROYA 1KE5A 1PXJA 4DBXA 4ALUA 5I3RA 3MIYA 2H96A 4I6BA 5EG3A 4YLKA 3EWHA 3KB7A 4IZYA 5I9XA 3QKLA 5CANA 3V6RA 3AC3A 4RIWA 5KHXA 4DDGA 2QU5A 4HVGA 2IZRA 4EBVA 4CVAA 3G6HA 3QQGA 3QUDA 4QP1A 3W2QA 3UG2A 5ETIA 3VRYA 4IVDA 4OTRA 2WOTA 2XARA 3DA6A 2J51A 3PXKA 4FOCA 2XNEA 3FYJX 4J97A 4K6ZA