4J95A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic k659n mutation responsible for an unclassified craniosynostosis syndrome in space group c2.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
279
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIYYKNTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
total genus 91
structure length 279
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j95A01
1RE8A 3C4ZA 2C3KA 4IHPA 4D5KA 1XHAA 4EBWA 5B2KA 2ZOQA 5DR2A 2JD5A 4G31A 2UW0A 3HDNA 1OKVA 4E4LA 5IZFA 3QQFA 3SGCA 4C4HA 4II5A 2C4GA 3VBVA 3W8QA 4TN6A 3E62A 3HA6A 1FMOE 4NL0A 4C2VA 5BYZA 2QU6A 2V62A 2ITTA 3ALNA 3HZTA 4ZOGA 4AW0A 4IW0A 5CU0A 2IN6A 4XOYA 3JVRA 2IVTA 2IW8A 3U4UA 4I4EA 2QOBA 3AT2A 3MIYA 4FTAA 2B9HA 3VHKA 4AE9A 1L3RE 5E90A 2W5HA 3VBWA 5A14A 3TT0A 3SRVB 4CFMA 5HG9A 1SVHA 4NTTA 4C38A 4Z9LA 4R5YA 2CMWA 2RFNA 3QALE 3UIBA 4B9DA 1Q8YA 4BR3A 2BAKA 3EQIA 1RJBA 1ZWSA 3KMWA 5E1EA 5E8VA 3KL8A 5EYDA 3ZLSA 4EK3A 4KBKA 4X2FA 5G1XA 3BWJA 2XJ1A 3QZFA 3HAVA 4BDFA 5KMLA 5CT0A 4J8NA 4ZSEA 4I92A 4O0RA 3OUKA 5J87A 3QCSA 4L00A 3ORKA 4GW8A 5ACBC 4YUQA 3P1AA 3ZO3A 4O82A 1RDQE 2XJ0A 4HGSA 2CSNA 3CBLA 1WBPA 2GTMA 4DEHA 3NUUA 3R1YA 3GC9A 4OR5A 1GZNA 1VYZA 4I3ZA 3LM5A 4Q5EA 4GJ3A 4FTQA 4LV5A 4O0XA 3N4TA 3F3ZA 2WOTA 4BDDA 2UZEA 2ZDTA 2GMXA 5KMNA 5C03A 2FVDA 2QO2A 2JAVA 4TTHB 3GQLA 2XYUA 3QGWA 4XG9A 1U59A 5EHYA 1PMEA 3FMNA 4O2ZA 4YU2A 3K3JA 3FKNA 1OKWA 3H3CA 3KRWA 5KMJA 3BV3A 4HJOA 4GYGA 3HKOA 3CCNA 3QBNA 4FSQA 4Z3VA 3DK6A 3MS9A 4YMJA 3TDVA 4P4CA 4JG8A 4DGNA 1XWSA 2E9PA 3QZGA 2FA2A 2CKEA 4N0SA 4AZTA 1CDKA 4I5CA 1KUTA 3O96A 5AMNA 1XH4A 4RLLA 2W9FB 2I1MA 1H1QA 5HIEA 5HTIA 3T9TA 4BKYA 3DFAA 3FKLA 2C1AA 5C01A 3P08A 4W4YA 4C0TA 1CSNA 2FB8A 3LXPA 3UO6A 2EUFB 2WZJA 4KRDA 4RX8A 4GSBA 3KXGA 4OGRA 3N4UA 2EXEA 5AR2A 3UP2A 2BZIB 2YM5A 2HY81 4WUAA 2VD5A 4GUBA 5EHLA 2WO6A 3LCTA 4RMZA 4YSJA 3EN9A 5FQDC 3ZFMA 3OP5A 4MQ1A 4BZDA 2V22A 2CNQA 4JS8A 4CMUA 4ZSAA 4U97A 4HZSA 3M1SA 2WTKB 2B7AA 5CWZA 1WBTA 4FK3A 3WE4A 4O86A 2GTNA 4PDYA 2R3RA 2JBOA 4IB5A 4OBPA 1FVTA 3VW8A 4EK5A 3PA4A 5GIOE 4GMYA 2QODA 1SMHA 5CAVA 3UYTA 5F20A 4F4PA 3U55A 3NUSA 3NUYA 3OWJA 2W5BA 3OTVA 4XJ0A 2HXQA 2HZNA 3IDCA 4O83A 4A9TA 5AA9A 3ENMA 3ITZA 1BMKA 2HELA 5FGKA 3AC3A 3DKGA 4PRJA 4R8QA 3MTFA 4QYEA 4U6RA 3ANRA 4F7JA 1H26A 4UBAA 4EUUA 4FTUA 1OL1A 5E4HA 1H28A 2PUNA 1IAJA 4LOQA 3H30A 3DNDA 4PQNA 2O63A 4N70A 4NSTA 5HTCA 5D7AA 2OXYA 3H10A 2BFYA 3PA3A 2XJ2A 1ZYSA 4LUDA 2XK6A 3BLRA 4QMMA 2IJMA 3KMUA 1PXIA 2ITOA 3BHUA 2XK9A 3ANQA 3EN5A 5HLPA 3GNIB 3UC3A 3VS6A 3PXFA 3ZXZA 3A7FA 4FKIA 4FTRA 4AA4A 2W4JA 3EFLA 4CCBA 3C5UA 3NNUA 4KA3A 4EOMA 1H1PA 4V0GB 2C0IA 3RPOA 2RFSA 3A7IA 1KE8A 3SQQA 2WTKC 4TPTA 3QYZA 3IK3A 2F4JA 3NYVA 4AW1A 4PP9A 4YTCA 2PMNX 1YOJA 2BZJA 2QD9A 4C33A 4BIBA 5BVOA 2OK1A 5FRIA 1JBPE 4FKUA 2BPMA 4V0GA 4APPA 1XJDA 3CGOA 3MB6A 4WUNA 3AGLA 2PWLA 3IW4A 2PUUA 4RG0A 2XNPA 2C5NA 3R22A 4U3YA 3NAYA 3OZ6A 3PIZA 2ERZE 3CD3A 4LL0A 4ENYA 4QMPA 3RWPA 1GZ8A 4BDAA 4EHGA 3RK9A 4ZTMA 4JDHA 4F9WA 3PSDA 3G51A 4RWIA 4TZRA 4ZTQA 3WBLA 4TT7A 3FL5A 4ZTNA 2VRXA 1J3HA 5CENA 4H1JA 3Q9YA 5CALA 3PRFA 4IWDA 2XCHA 4AX8A 3IW6A 3DTCA 4AG8A 2PUIA 2X1NA 3ZC6A 5J1WA 5L3AA 2WMQA 5HVYA 4O7LA 4RWLA 2IW6A 2BCJA 3DTWA 4GT5A 2J7TA 1ZMVA 5AUYA 3OXZA 2X2KA 5C4LA 4UN0C 5J9YA 4EUTA 3L9MA 2BVAA 2R3MA 1BL6A 1VYWA 3MA3A 4LRJA 4XMOA 3UE4A 3IDPA 5IQIA 4GEOA 1YDRE 4FKGA 4GT4A 4YBKA 5CXHA 2VWIA 4ZY5A 4IZAA 3PG3A 4RLKA 3BKBA 5GZ8A 1UV5A 4FV3A 4O6EA 4RWJA 3VBYA 5HE0A 5AR7A 3MFTA 5HCYA 1SNXA 3V5JA 4QYGA 5CSWA 2JDTA 4M67A 5EI2A 2GNGA 2R3LA 3VUTA 3NVKI 1W8CA 1M2QA 5ANIA 1S9IA 4NTSA 4ERWA 3TDWA 4ID7A 1OGUA 3NLBA 4ZTHA 3V8WA 2NO3A 5K3YA 2ITPA 4E1ZA 4C4FA 2JKKA 3RCJA 2I7QA 4PDPA 1Q62A 3ORMA 5J5TA 3PE1A 4ZP5A 3NAXA 4ENXA 1F0QA 3KN6A 4O0TA 4ANOA 2JDRA 4BTMA 2IW9A 3SXFA 4MEDA 5FEQA 3T3UA 3O8TA 4ONAA 4RZWA 2Z02A 4UWBA 3FMEA 2CLXA 5TE0A 4XX9A 1LEWA 3QTXA 4A07A 2P55A 2XA4A 4YC6A 4FIGA 2GHMA 2Z7LA 4E4XA 2C3JA 4XBUA 5C9CA 4GFMA 4DGGA 2PVNA 3ZEWA 4AA0A 3UQGA 5K5NA 2BRMA 1ZYLA 3H9FA 5AIKA 5CU6A 4HPTE 4YO6A 4KIPA 3E8NA 4Y72A 4AAAA 2CNUA 5HBJA 4IM3A 4I5HA 5KNJA 4JAIA 5CF5A 1WBNA 2R3OA 3I4BA 3MH2A 2OZAB 2Y6MA 3TXOA 4EL9A 3PA5A 4Q9SA 1SVEA 4QPAA 2ZV9A 4MWIA 4L6QA 5CS6A 4ASEA 4EH6A 5AAGA 3TWJA 3QUPA 4WD5A 4I93A 4WNOA 2HW7A 3GT8A 2YAAA 5IA2A 2ZV8A 3P5KA 4MF0A 4BZNA 5DRBA 3E87A 4ZS0A 5E8WA 5AAFA 2BFXA 4NH1A 4EQCA 3DBCA 5ANOA 1NW1A 2IG7A 4AGDA 4C8BA 4I0SA 4B4LA 2XNGA 3EQFA 4C3FA 1DM2A 3G6HA 5E92A 5E8XA 4ZK5A 4L9IA 4BCNA 3RBWA 4P2KA 2F7ZE 5CVGA 4CZUA 2C6IA 4K9YA 3Q9XA 4EOIA 4LGHA 3LVPA 4AU8A 3KRRA 2BRHA 2WAJA 3L8VA 4BKZA 5CXZA 3F2AA 3Q4TA 4GVJA 3H9OA 5LMAA 4M97A 2YCQA 1BUHA 4M0YA 5HE2A 1ZYDA 5I3RA 4FEWA 4BKJA 2R3JA 3QD3A 3QCYA 3AG9A 3NYXA 4BBMA 5ANDA 4ZEGA 1UU9A 2Z7QA 4FR4A 2ZB1A 3D2IA 3Q4ZA 2XK4A 4TYHA 3LLAA 4X21A 5IISA 1PMUA 5IKWA 2PVMA 1FBNA 1M7QA 4FSZA 3P86A 3ROYA 3Q3BA 4W4VA 3SA0A 2XP2A 3EN4A 4YNOA 2RKUA 2VTTA 3DB8A 2ITYA 3LJ1A 2GS2A 3HV6A 2CN8A 3LXKA 3R73A 3V5PA 3OCTA 4ZY6A 4C4IA 2PHKA 4BBEA 4KINA 2WNTA 4AA5A 4KRCA 2FSLX 2WTDA 2F7XE 3LQ5A 4BGGA 5D10A 3OVVA 2OF2A 1YXSA 2HCKA 4ZJVA 2A2AA 4JVGA 4ZS4A 3LQ8A 3IO7A 3KGAA 4TKSA 5LARA 5JQ8A 4LI5A 2ONLA 4MAOA 4DA5A 4UWYA 5B2LA 1QPCA 4FMQA 3R2YA 5IDPA 2P3GX 2A4LA 3ZBFA 4RJ5A 4G6LA 3COHA 5HHWA 1K9AA 2QLQA 1ZZLA 5HEZA 2BAQA 3PTGA 1W84A 3GFEA 2JGZA 4TRLA 3VS0A 3UQFA 2F9GA 3KREA 4QNYA 5KMIA 3DK3A 2ZMDA 2J5EA 3O23A 4K77A 2Z8CA 3CEKA 4U7ZA 1GJOA 1J7LA 2OBJA 3KC3A 4AXAA 3OC1A 4D4RA 5M07A 2I0YA 3AMBA 5AUUA 4CG9A 3GEQA 1WVWA 2H9VA 3ZC5A 5ACKA 2R3FA 2W96B 4G6NA 4MBLA 1CTPE 4ZSLA 4JG7A 1SVGA 3RHXA 2OXXA 3QF9A 4F0IA 3D94A 1YWRA 5HG8A 4FA2A 3MH1A 3PLAE 5A4EA 3CPCA 4GYIA 2NP8A 5IA0A 3JPVA 2JDOA 1YI4A 4JT3A 4JLCA 5F9EA 3VBQA 4AE6A 3E88A 2QO7A 3HRFA 3NCGA 3VHEA 4L3JA 3GVUA 3FQSA 1PXJA 4NU1A 3R01A 2CLQA 3R28A 3FMHA 3QKKA 4FTIA 4YJSA 5DA3A 4NEUA 3A4PA 3WF6A 3ZTXA 2OFUA 4F99A 1OBDA 2XF0A 3U9NA 4X6QC 3QTQA 2AYPA 4AOTA 5JFSA 5JGAA 1RQQA 3OROA 1ZOGA 3HMNA 4ALVA 2JKOA 4EQMA 3Q9ZA 3R1QA 4F70A 4NFMA 4FIFA 4CV9A 4M13A 4QPSA 4RJ3A 3SAYA 4BDBA 2P2IA 4JAJA 4I41A 5DR9A 4M69B 5HOAA 2O5KA 3WIGA 4YC3A 2BTSA 1HCLA 4HGTA 4NM7A 3WYYA 4BCFA 3RHKA 3W2RA 4XYFA 3VUMA 3GUBA 5KMOA 3COKA 4TW9A 1R39A 4TL0A 3ZFXA 4ZLZA 4CFUA 1O9UA 1XBAA 2X2MA 2XKDA 3R00A 4AFEA 5CVFA 4DH7A 3CY3A 2JDVA 2QR8A 4LV8A 4EJNA 4M69A 4X3FA 4TWCA 3NNVA 4X2NA 5L8JA 2ITQA 3QA8A 5HESA 3CKXA 4E6CA 2WTCA 4FKRA 2WD1A 3WOWA 3E92A 4D2TA 5HX8A 3LFDA 5L6PA 3ORLA 1ERKA 1IA8A 4EWHA 3AD4A 4FYOA 1YDSE 5EHOA 2BAJA 4WHZA 4UX9A 4LOPA 2ETRA 3O8UA 4MTAA 3KXNA 4A9YA 4FTOA 5AR5A 3DZQA 5LOHA 3E5AA 2EB3A 4QOXA 4QNAA 4IX4A 4D1SA 2XBJA 1URCA 3QCXA 4FV8A 2Z2WA 4XRJA 4ZY4A 5CEKA 5EM7A 2UZTA 4IIRA 5AV4A 5A9UA 5A4LA 2WMUA 3MW1A 2BMCA 3DAKA 4RVTA 2PYWA 3OY1A 2QHMA 4DTKA 2G2HA 3LFQA 2B55A 3OWKA 3BHTA 4P7EA 3QLGA 4EH4A 3P79A 4KNBA 4G17A 4RC4A 3D15A 2QOQA 2XIZA 2B1PA 3QHWA 4M66A 3C7QA 4FT5A 4D55A 3C13A 2AC5A 4AN2A 3ID6C 3BV2A 2WHBA 2W1GA 2YEXA 2X81A 4WOVA 2X6EA 2YWPA 5E7RA 5JMSA 1PY5A 5FD2A 5IG1A 4H05A 4EJ7A 3BLHA 4FKSA 1MUOA 4QYFA 2QOLA 3BEGA 2QOHA 3I60A 2HK5A 3R1SA 4YJVA 3BHHA 4EOQA 3U6IA 1XH7A 4D5HA 2IVSA 4O0WA 2W1IA 2JKMA 4L43A 4K11A 3C0GA 1U54A 4FOCA 4FSWA 4LGDA 3V8SA 3O8PA 5JFXA 3P4KA 3D2KA 5AP5A 1NXKA 3A99A 3CQUA 3LAUA 2C47A 2R9SA 1Q4LA 3FQEA 3ORNA 5BYYA 4RSSA 4K8AA 4MXOA 4DAWA 3LKMA 1NA7A 4RQKA 2VWUA 4R1VA 3GOKA 3UOKA 2DWBA 2BIYA 4UMRA 3PIXA 5KZIA 3TCPA 2VUWA 4Q5HA 2PVYA 2XM8A 4XG2A 1J91A 2PK9A 4FT3A 3OOGA 4PY1A 4O2PA 4Y5QA 1QPEA 4XG8A 1OPJA 1UKIA 4EOKA 1OZ1A 5AX9A 1JSTA 1LUFA 5I9ZA 4NT4A 3TUCA 3KMMA 5FTGA 1OIYA 3I7BA 3P9JA 4EHVA 4EOPA 4FZDB 3QTIA 4I0TA 3ETAA 4I1ZA 2C68A 1S9JA 4UMQA 4A4OA 4LM5A 4JOAA 2VTJA 5E8TA 1WBSA 1OL6A 1REJA 4FSUA 4U79A 1J1BA 3DXNA 5EDRA 3F69A 4L7FA 3Q5IA 3NYNA 2YZAA 3OT8A 5FXQA 4YP8A 2GNLA 2VTHA 3FLSA 3I1AA 4O38A 3PFQA 4V04A 3ZYAA 3AT4A 3F88A 5IH4A 3ORXA 3VWAA 5IUIA 2NRYA 1ZMWA 3DU8A 3OXIA 3GXLA 4FV9A 5DT4A 4CV8A 3JY0A 5J9LA 3PVGA 2ETMA 4BRXA 2WMSA 3L9LA 3Q4CA 2YFXA 4FV7A 4AOIA 4DC2A 2GNJA 3LMHA 3ORIA 2ZDUA 2OKRA 3MIAA 4GUEA 5JSMA 5KKRB 2OH4A 1Q8TA 5KMKA 1WVYA 1IG1A 4O96A 4G6OA 3LW0A 4G16A 4D0XA 1CKIA 4DFLA 2ITNA 3DXQA 4O7VA 3IW7A 3OW4A 1KE7A 3O50A 4OTIA 4Z7GA 4IVDA 3W32A 3W55A 4QPMA 3FZ1A 5JZNA 2BKZA 1LP4A 2UVXA 4C58A 4JX3A 5AR8A 4BF2A 2GQRA 4O0VA 1OIRA 3UPXA 2XEZA 5HG5A 3ZLXA 2UVZA 3F3VA 2VO7A 3EQPA 2QOKA 4ARKA 5EOLA 3FXXA 4U40A 3R7UA 4RWKA 4BIEA 1DAWA 3PDTA 3V5TA 5FUTA 4KABA 2YZLA 3P78A 4EH3A 2CNVA 3K2LA 3LFAA 3HGKA 3WILA 5HIDA 4FV6A 5DOSA 5E8SA 5FWKK 3JXWA 5HBHA 3TJDA 5LWMA 3DKCA 2JIVA 2YCFA 4C4GA 1H0VA 3O71A 3H9RA 3IOKA 4ZJJA 1P4OA 4DFBA 2UZOA 4FKJA 4L46A 4M84A 4D0WA 4DFYA 1YKRA 4NW6A 5DI1A 3R7OA 4DGOA 4EH2A 5BVFA 4WT6A 3FXWA 2X0GA 4DH1A 5IA4A 5EKOA 4K0YA 5BPYA 4RIOA 5AV2A 3R8VA 3MVLA 1LPUA 4I23A 3SRVA 4XH6A 4BDGA 2O8YA 3G2FA 5AP1A 4YR8A 3ACKA 3OXTA 2VZ6A 3TZ8A 2VNYA 4USDA 4ORKA 2XNMA 3C0HA 3E3BX 2QURA 2VO3A 3OMVA 2WIPA 4FUYA 4GFOA 4ITIA 4JQ7A 3NUPA 1U5QA 4L01A 2ZJWA 1E1VA 2O3PA 4QMNA 1PHKA 4UMUA 5KE0A 1UU3A 5DR6A 4WRSA 5CSVA 3ZBXA 4GJ2A 4L8MA 4MD9E 4YPSA 4MXYA 3HL7A 4GS6A 2E2BA 3V51A 3MWUA 2BHHA 1IAHA 3U87A 4BTFA 3MBLA 1OL7A 2PMIA 4EOJA 5CF8A 4EH9A 3DDPA 4CTBA 4F7LA 3FMDA 2OO8X 5CNOA 3H0ZA 2G2FA 2B9IA 4C36A 3SDJA 1CM8A 4ASZA 1A06A 2C6KA 2FUMA 1V0OA 5LCKA 5EQEA 3HA8A 5KUPA 4D2VA 4M0ZA 3NCZA 4BGQA 4PTCA 5HIBA 4NM0A 3AC1A 4MXAA 3V5LA 2XKCA 3EZRA 3R30A 2Q0BA 4G3FA 4DEBA 2HYYA 4MCVA 4U44A 4IADA 4EH5A 5J95A 3KXHA 2OJ9A 3DB6A 4QTDA 4C57A 1NVQA 4L52A 5IA5A 3HP5A 4QQJA 4LMUA 1R78A 3HYHA 3HNGA 4G9RA 3UOLA 3E8DA 3LMGA 4LFIA 2BDFA 4C3PA 4S34A 1XQZA 4FGBA 4WNPA 4U9AA 4PTGA 4GKHA 2J0JA 3RCDA 3UNKA 3THBA 2PVHA 4I22A 4J71A 4AACA 2CJMA 5CASA 4YHJA 4F6UA 3PLSA 4HNFA 3R9NA 5L2SA 4WRGA 4GG5A 3OS3A 2ESMA 5CEMA 2YCSA 2YN8A 3MY5A 3MJ1A 3CTJA 3M2WA 4NM3A 5I9VA 3GENA 2H34A 2XK8A 5HO6A 4FSRA 5KO1A 2J90A 3FC1X 3GFWA 3W2QA 3SV0A 2BR1A 2UZBA 4D4VA 3F82A 2KTYA 4FSNA 3FI8A 5CYIA 1Q5KA 5AV3A 3CR0A 2UW5A 3HAMA 4H3PA 4YZ9A 3ZRMA 3VQHA 3F3UA 5I5ZA 3GB2A 1QCFA 2PVFA 2WIHA 1BKXA 3BYOA 4IE9A 4PMTA 3AOXA 3D0EA 3ZUTA 3N9XA 3POZA 4CT2A 2PMLX 4CQEA 2C5YA 3W2SA 2W99B 4C37A 2IZUA 5L2QA 4MQ2A 4RJ4A 5IEXA 3PIYA 5C4KA 5AP4A 3EHAA 4U43A 2W1ZA 4X7QA 4DEEA 3E8EA 1ZYCA 4GH2A 5AUTA 3FZRA 2VWYA 3QQHA 4QTCA 2OIDA 4E6DA 3QD2B 2UZLA 4WBBB 2H96A 2ZV2A 3ZLWA 1JOWB 4QP4A 4D2WA 4PNKA 5IH5A 5LVOA 5TR6A 1A48A 2J6MA 4KAOA 3Q52A 1CKPA 1NY3A 4MVFA 3PVUA 2VTAA 3TN8A 2W4KA 2JKQA 3D5WA 4HYIA 5HD7A 4S31A 1H07A 4IB1A 4RC2A 4YJQA 4O0UA 5K0XA 4FEUA 4TWNA 3OWLA 3DAEA 4MNFA 1CMKE 3VUHA 4I21A 3GU4A 5D12A 3QQGA 3VC4A 1UNLA 3QZHA 2XKFA 2X4FA 3DGKA 3KEXA 5JRSA 3ATTA 3ZM4A 5M53A 1EH4A 1ZLTA 5E9EA 1G5SA 2VU3A 2IWIA 3SG9A 3E7VA 4RBLA 2FSMX 3CJGA 3D83A 2VWBA 1XBCA 3TKHA 4I5MA 3ZXTA 3VIDA 5LCJA 4N6YA 1YRPA 3FAAA 3QYWA 3MSSA 4DT9A 4S2ZA 2WQNA 1REKA 3FJQE 2GCDA 2R4BA 5DLSA 4YZDA 2XCKA 4EC9A 2XUUA 3ZRKA 2Z7RA 4FI1A 4RC3A 2G1TA 4CSVA 4D2SA 5C8NA 5GJDA 3VUGA 4EQUA 5E8YA 5H9BA 5DN3A 5J8IA 4C4EA 3CTQA 3MV5A 4BCHA 3KCFA 4BCKA 3F5UA 4BCPA 5BUEA 4LGGA 3R21A 5L2IA 4FV2A 5AUZA 1SNUA 4R7HA 4UXQA 4GU6A 4DG3E 2O64A 4GG7A 1NT2A 3UPZA 3AQVA 3R8UA 4EORA 3NVMB 1XR1A 4RX7A 5IPJA 1YWNA 1XO2B 2VX0A 3D5XA 4EOSA 4F09A 5LQFA 3R7IA 4ACDA 3HV3A 5I4NA 4O91A 5L2WA 3IDBA 5DGZA 3GU8A 2J0KA 3FYJX 5B7VA 4IQ6A 3UOJA 1DI8A 4RQVA 4E4NA 1O6LA 5EM8A 3BWFA 3HMPA 4E3CA 3FL4A 2X9EA 3EWHA 2PTKA 4KKHA 4FK6A 4H3BA 4IXPA 4WNKA 2W4OA 1YI3A 1YHSA 3ZH8A 5TF9A 4TYGA 5DH3A 1IR3A 4ERKA 2REIA 4QP8A 3ORZA 2NNWB 3FSKA 2G2IA 4QMOA 4RA5A 2BTRA 4RJ8A 5BVKA 3UBDA 4QQTA 3L8SA 3TKIA 4ZAUA 3GQIA 4LMNA 5GINE 4FE2A 2VTLA 3Q5ZA 4PTEA 3CJFA 4JBPA 5KKRC 4FEVA 3BQRA 2WU6A 4XG6A 2EVAA 3DT1A 4PPBA 5AUXA 4BI2A 2YLEA 3JUHA 3QTRA 2Q83A 3RNIA 3BHVA 4CLIA 3R0TA 4M68A 2V7AA 4U3ZA 4ZZNA 2PY3A 5CZHA 4NZWB 4CRSA 3AMAA 4FG7A 4EH7A 3JY9A 3VBXA 3C4CA 5I9YA 2R2PA 2EXCX 3DZOA 2RL5A 3OW3A 3PYYA 3MA6A 1XKKA 5AM7A 5EFQA 2XS0A 3P23A 3QX2A 3ZFYA 5K4JA 3KA0A 3PVBA 4EHEA 2UZWE 4WSQA 5FDPA 2YA9A 2WTIA 3QRJA 3MVMA 3CD8A 4EH8A 4IX6A 5C26A 2R0UA 1OUYA 1QL6A 5CEOA 5IQAA 2AC3A 4DINA 3FLQA 4X3JA 3EN7A 1QPJA 1RW8A 5HD4A 3QQUA 3BCEA 3FI3A 4FNZA 3MH0A 4RIYA 4ANLA 1I09A 4NK9A 2IVUA 1VR2A 3EQGA 3O7LB 3V3VA 3FEGA 3F5PA 3HLLA 4RIXA 3R1NA 4U42A 4J52A 1Q3WA 4QD6A 3DK7A 2WEVA 3KULB 2QVSE 3NW7A 4IWQA 4XLIA 1A9UA 1I44A 4NCTC 5TKDA 2YDIA 4KS7A 2C30A 5ANGA 3RKBA 3II5A 1V0BA 3DBDA 4QTBA 3OFMA 2YIQA 2F57A 4GVAA 5FG8A 3TKUA 3O51A 1R0PA 2GNIA 3RK7A 3OCSA 4FTLA 4A4XA 5EQPA 1U46A 3R63A 4O27B 3NUAA 2HENA 1ZAOA 4JIKA 4FNWA 5CQWA 4CFVA 5CI6A 3UTOA 4K2RA 4A4LA 4BWKA 5DBXA 3U6HA 4RJ7A 4TYHB 4IAFA 3KVWA 1URWA 2JAMA 4I6QA 2ACXA 3KXXA 2VTMA 4J98A 2XNEA 3NEWA 5E91A 2X7FA 4WNMA 5M06A 3P7CA 2VWWA 1ZXEA 3NGAA 2JFMA 2W5AA 2F49A 4FKLA 3MN3A 1FINA 1XH5A 3FPQA 2V7OA 3EFJA 1XH8A 2F2UA 3HMMA 3R8MA 2UW3A 4DF3A 5F94A 4KSPA 2PULA 4BDHA 4AUAA 1PXLA 1QPDA 2CGUA 1JKLA 3IW8A 1FOTA 2UZDA 3WI6A 1P5EA 4G3DA 2Y4IC 4N6ZA 4DFUA 1JVPP 3RK5A 4ANSA 3V5QA 4D58A 4NCTA 5CVHA 1KV1A 5FTQA 5AR3A 5FBOA 3LM0A 3WF7A 4YJTA 2QOCA 4YZCA 2JBPA 5TT7A 3FMJA 5M56A 1TQMA 1YXXA 3FZSA 4FNXA 3MFSA 4BC6A 2A27A 2R7IA 4RJ6A 3R9OA 2VX3A 3A8XA 4D2PA 1KE9A 1M2RA 2ERKA 1X8BA 5FTOA 4LG4A 4KBCA 2BUJA 3SW7A 2IVVA 5AP0A 3BYUA 3QZIA 4PDSA 3D5UA 4NFNA 3PJ3A 5FEDA 5IUHA 1AD5A 4QMTA 1PXOA 4ZMEA 4G1WA 4J99A 2XNOA 3AC2A 1H1RA 1Q99A 1VZOA 4IM0A 4AQCA 1UNGA 4BCIA 3SG8A 4YJRA 4HVGA 4RZVA 2QKRA 5EG3A 3D7ZA 4MXCA 4O0YA 5CTPA 4AP7A 1W7HA 2X6DA 4YZNA 2RGPA 4XOZA 5ETFA 3TNWA 3DKFA 4E5BA 3LE6A 3IW5A 3PSBA 2UW4A 3S0OA 1YXVA 3UIXA 1XH9A 2FO0A 4QMYA 2JC6A 3KULA 2X8IA 4XG4A 4OTFA 3VF9A 1R3CA 4GRBA 4IC7A 2I0EA 4K18A 3P0MA 1JQHA 2UVYA 5CAOA 2VTIA 4XP2A 1Y6AA 5EDQA 3AT3A 3R6XA 4O7NA 1JLUE 4QMLA 5BUIA 2PZPA 3QGYA 4B6LA 2X7GA 3GI3A 2ZMCA 4OT6A 3VS4A 4KWPA 1WVXA 1ZYJA 4J96A 2J51A 4L44A 4NIFA 3FBVA 4R3PA 3CTHA 4ZJIA 4GK3A 3LJ0A 4BDEA 2B9JA 2FSTX 3ALOA 3B2WA 4IFCA 2YHVA 3G9LX 3I79A 3TNPC 3ZS5A 3VW6A 4AGCA 4NYEA 1WFCA 2VWXA 3PXYA 1W0XC 4DEGA 4PL5A 3LLTA 3CIKA 4I20A 3EZVA 5JFWA 3OBGA 5BMMA 2X8DA 5IQHA 4XP0A 3NX8A 2RG5A 5T68A 4C62A 2R3GA 2QCSA 1PXKA 4FYNA 4EWQA 4IACA 3OBJA 4HCVA 1Z57A 3TV6A 2WQBA 5M4CA 1PMNA 5D7VA 5EYMA 2VX1A 3LFFA 4YJPA 2YM6A 1OKZA 1TVOA 2OIBA 3MY0A 3TM0A 3TZMA 2FYSA 3R71A 3LIJA 2X4ZA 5L6WL 4QP7A 1P14A 5FP6A 2PZ5A 2GFCA 2OF4A 2YDKA 5J7HA 1ND4A 2XIRA 3TZ7A 3KN5A 5BNJA 4NJ3A 4P5QA 4HW7A 2DQ7X 2YM8A 4CFWA 2WGJA 3DJ7A 2VN9A 2IZRA 2CKPA 3LXLA 5J1VA 3PJ2A 3VQUA 3V6SA 5IQEA 4XEYA 3Q4UA 2RSVA 4IDVA 2HIWA 4FL1A 4JR7A 4M14A 2QOFA 1BX6A 2YERA 4KKEA 4W4XA 2VTNA 2OXDA 4L3LA 5IQCA 2X8EA 3N4VA 2VAGA 5CAUA 3UJGA 3DKOA 4MF1A 3RM7A 1TQPA 4V01A 4X2KA 1V0PA 3OEZA 3C4WA 4FF8A 2CCHA 3NIEA 4C59A 4C7TA 5IMEA 4F7SA 3TUDA 2VWZA 1Z9XA 3AD6A 4Y83A 3FPMA 3RINA 3ODYX 1XBBA 1UA2A 3EJ1A 4BYIA 4DEAA 1ZY4A 5A54A 2CKQA 4HPUE 2VO0A 4MXXA 4KBAA 4X3FC 2YIRA 2A1AB 2YM7A 5JH6A 2OGVA 1PXNA 1OB3A 1U5RA 5DHJA 2OSCA 4BFMA 4E4MA 5J7BA 2VV9A 5AWMA 3QLFA 2OJGA 3QU0A 2GQGA 2E9OA 2J2IB 2JIIA 2PL0A 3FY2A 3OD6X 4IVCA 5AR4A 4CD0A 5HLNA 5IUGA 3QQLA 4AGUA 1HCKA 4TY1A 3RAKA 3BU5A 4JI9A 3KFAA 3V8TA 2CGVA 4GIHA 4Z7HA 5ANEA 4MNEA 5C8MA 3Q9WA 3QX4A 2QLUA 3SKCA 3D14A 2ETKA 5L8LA 1O6YA 2W9ZB 4IJ9A 3FLYA 4IVAA 4F6SA 3ZUUA 4DFZE 4EBVA 3SD0A 1WBOA 2C1BA 2J0MB 4OLIA 1F5QA 5IU2A 3RM6A 4WKQA 2O0UA 2BKKA 3MFRA 2GSFA 4W8DA 2V0DA 1E9HA 4O7SA 3NUNA 2PE0A 4FG9A 2XKEA 4FODA 4WSYA 2DS1A 5HE1A 3ERKA 1YI6A 3BU6A 4F6WA 4JL9A 1UKHA 1Y6BA 2PE2A 1MRVA 3UO4A 3BE9A 4BDIA 4Q2AA 4YZMA 2HWOA 4ZTRA 4YURA 3VJOA 4TWOA 4NKAA 2WMRA 2UW8A 3O7LD 4FKTA 2JIUA 4WO5A 5M08A 4QMQA 4BGHA 3PUPA 3JR1A 2XBAA 2XH5A 4JDJA 4APCA 1Y91A 1YW2A 5I3OA 3HUBA 1FGKA 2VO6A 4MK0A 4QP9A 2LAVA 4FX3A 3G5DA 4Y46A 3NDMA 2F2CB 4EHZA 4KUJA 4GL9A 3VS1A 2GHLA 4BWPA 2Y6OA 5HTBA 4ALWA 3A8WA 1XH6A 4I6BA 2CDZA 3QQKA 5DFPA 4FEXA 2QG7A 5HGIA 2QI8A 3F2NA 4XV2A 5FEEA 2PZYA 3LFSA 1OMWA 1OPKA 3EYHA 4BB4A 1Q8ZA 4B0GA 4UYAA 2O2UA 3Q6WA 3ODZX 4PDOA 2OIQA 4F1TA 5AAEA 3UZTA 4GFGA 4G3GA 2PVLA 4RFMA 3VF8A 3QWJA 2UZVA 5HNGA 3FHIA 4BVUA 3POOA 5BMSA 1JKSA 3N51A 4FKOA 2P4IA 4YNEA 4AZSA 3WF8A 4F64A 4FT9A 1JKKA 3FUPA 4QMUA 5IQGA 3UC4A 2E9UA 4FTMA 2CN5A 1Q41A 3QTSA 5HLWA 5EM5A 3DBQA 2J5FA 3EQHA 3Q2JA 5H3QA 3V6RA 3B8RA 5FXSA 5D9HA 4UMPA 4BIDA 4ACMA 5LMKC 1H08A 3RP9A 4KIKA 5DNRA 3E3PA 2XYNA 2J9MA 4RIWB 2B4SB 4ZXTA 4MBIA 3QKMA 5BQ0A 3A2CA 3DDQA 1H4LA 1PXMA 5F95A 4U41A 2C6EA 4O81A 4DFXE 3OCBA 3CPBA 4PMSA 1J7UA 4P5ZA 3REPA 4A9SA 3C51A 5F1ZA 4KIKB 5I0BA 4IB0A 4CFNA 5BVNA 4PV0A 1BL7A 3HUCA 3I6UA 5ICPA 3LOKA 1WBVA 5K4IA 1GIHA 4PMMA 3ZM9A 3QXOA 3VN9A 2WMWA 3NNWA 3ORPA 3R8LA 3F5XA 5HO7A 1ZZ2A 3UOHA 4UYNA 2C0OA 3G0FA 3I0QA 3F2RA 2LGCA 1Q61A 1B39A 2GS7A 2W06A 3DQXA 4Y85A 4DH5A 3COIA 3CQWA 5CZIA 5HKMA 3BELA 4IWOA 2XMYA 4D9TA 4YO4A 3MPMA 3TIZA 3UZPA 5EQYA 5M09A 5EKNA 2PVRA 2VTRA 4FC0A 1GOLA 4PWNA 4XNEA 3KKVA 2BDWA 3SHEA 1G3NA 3FLNC 3W1FA 4ZZOA 4IDTA 4V05A 3O17A 2YAKA 4CQGA 4USEA 4IJPA 3FSFA 4M3QA 1SZMA 4O1PA 5KHXA 2Z60A 3HDMA 3DQWA 3JVSA 3QL8A 3QA0A 4CYJA 2PZIA 5AP3A 2VTPA 4O0SA 4AZEA 5LWNA 4F9AA 4IEBA 4BCGA 5HX6A 3PVWA 3W2OA 2ZM3A 2RG6A 2C6LA 3QCQA 5ETCA 1H1WA 2A19B 5JGDA 4A9UA 2OLCA 4MXZA 5DMZA 2QR7A 1OM1A 3AD5A 2CGXA 5T3QA 4C3RA 2R3KA 3LXNA 5F4NA 1HOWA 3PY3A 2WB8A 4IVBA 5JT2A 4USFA 4U5JA 3M11A 2R3NA 4A06A 2I0HA 2DYLA 3CS9A 4BICA 5JGBA 3A7JA 3MPTA 2PU8A 3DFCB 3CP9A 3FC2A 4N4SA 4HGEA 4LOOA 5T6KA 3W18A 4CKRA 2QU5A 4XP3A 4ZTSA 5BX0A 3IPHA 3G33A 3MYGA 4W9XA 4DBXA 3U4WA 3UVPA 2P0CA 4ITHA 3VS2A 2J50A 3C0IA 4WIHA 3SXSA 2WMVA 4L7SA 3RAWA 5H2UA 2R3HA 3FZPA 2B52A 5TO8A 4R7IA 2Y8OA 4ZLYA 3KRJA 3U8WA 4QRCA 2XRWA 3PXZA 4J8MA 2UV2A 4IM2A 5EI6A 5G6VA 2WOUA 3ZONA 2UUEA 4LYNA 3PXRA 3HV7A 4F7NA 4RIXB 3A60A 3G15A 5AUVA 3T8OA 5M4FA 3R2BA 4QYHA 3RPYA 1GAGA 2PPQA 4D4YA 4D4SA 3FV8A 3PY1A 4TYEA 1W98A 4IB3A 4NUSA 1ZOEA 3U9CA 4EK6A 4O7YA 4AZWA 4S30A 4UWCA 2QQ7A 4PPAA 4YHFA 5IQFA 5CU3A 5AX3A 3MDYA 3OT3A 4AW5A 4W9WA 3BHYA 1Y57A 3ULIA 3UG2A 4RFZA 1JWHA 5HCZA 5FXRA 3ULZA 4N57A 4IX5A 3SW4A 3AGMA 4EI4A 3AC4A 1M17A 1OVEA 2X39A 4FTTA 4KIOA 4BI1A 2GQSA 4JNWA 3WF5A 4P90A 2YITA 4BTJA 3MJ2A 4FTCA 2C6MA 5KCVA 4BDJA 2QG5A 1W82A 3OUNB 1E1XA 3PE2A 1WMKA 5ETAA 2VTQA 3I5NA 5I9WA 3Q6UA 3R9RA 2GS6A 3CY2A 2QOIA 4DT8A 2VGOA 4KB8A 4AF3A 4NIFB 2EXMA 3RZFA 3IOPA 5IH6A 4E8AA 3QRIA 2ITUA 5DE2A 4ASDA 3QD0A 5AIRA 2E9NA 1KWPA 5GZ9A 5BVWA 4QTAA 5IQDA 1SM2A 2VWVA 5JFVA 4CRLA 4D2RA 2XK3A 2EU9A 2R0IA 3OHTA 1PXPA 3PJ8A 3C50A 3KU2A 3EQRA 4ZLOA 4DH3A 5ANJA 1SYKA 1WBWA 3CLYA 2ZVAA 2CPKE 4E5WA 3GCUA 4HGLA 5EK7A 2BALA 2PZRA 5DVRA 4KD1A 2J0LA 3UYSA 4DH8A 4QQCA 5D1JA 4E6QA 3MPAA 3QWKA 5EM6A 4B8MA 3FDNA 4WG5A 1AGWA 2YM4A 4Y5HA 3S2PA 4AZFA 1ZY5A 3QFVA 3ZDIA 2RF9A 3PWYA 4W4WA 5D11A 3NSZA 4QP1A 4ZSGA 3I5ZA 2HZ0A 4PNIA 4AT4A 2XRUA 3PP1A 4OTRA 3NPCA 4CKIA 3L8PA 4HYUA 3QD4A 1KSWA 5HE3A 5KZ0A 4OT5A 4G2FA 4RVMA 2HW6A 4JXFA 4ZMFA 5HVKA 3G6GA 3FZOA 3KXMA 4OTHA 3JS2A 5DT0A 4C4JA 4E7WA 2XZSA 2GHGA 3D5VA 2XB7A 4BCJA 3C9WA 3R7YA 3PG1A 2YIWA 4TWPA 2UW6A 3OG7A 2QKWB 4WG4A 3ZMMA 5AA8A 4DHFA 3D9VA 4D9UA 3Q04A 2WTJA 5IEYA 4UZHA 3GCQA 3KCKA 3L1SA 3FE3A 4TNBA 3BX5A 5KBRA 3F6XA 3KRLA 4GK2A 4ASXA 3ELJA 5BVEA 1IA9A 4DG0E 3GC8A 4RIYB 3DXPA 3QTZA 3KVXA 1H8FA 2XNBA 4FEQA 4E93A 3ZZWA 2B0QA 4RFYA 4JIAA 5GJGA 5CSPA 1IEPA 4JRNA 2QHNA 5FP5A 2C6OA 2I0VA 1GZOA 3UMWA 4C02A 3UQCA 3ZDUA 3R8ZA 3IKAA 4UALA 5EYCA 2FGIA 2PMOX 2XIYA 3C4XA 4QP2A 4RPVA 4X6RA 4AFJA 1CKJA 4RVKA 4CZTA 3S00A 3RAHA 2OFVA 2HY0A 3G90X 4IANA 4L45A 4F65A 4NW5A 1T46A 2OJIA 3EIDA 4JR3A 3GCPA 3P7AA 4DITA 3A62A 3D7TA 4L3PA 5J5SA 3DS6A 4H36A 3RVGA 5A4TA 4YJOA 5JZJA 3R04A 2G01A 4F1OA 3QTWA 2ITZA 3GP0A 4NKSA 5CAPA 5DYJA 4FV0A 4JBOA 3BBTB 2WMTA 3T3VA 3TV7A 4FKWA 4F9CA 2WTVA 4LL5A 1OECA 4UV0A 1JSUA 5M57A 2YDJA 2JEDA 2KULA 4FZAB 4OTGA 4QMVA 5EH0A 3ZHPC 1T45A 4MWHA 4ANBA 2EB2A 2P2HA 3UDBA 3TNIA 2BRNA 2ZYBA 1R1WA 2X9FA 3MH3A 4JX7A 3FYKX 4LRMA 3F3WA 3EN6A 3HVCA 4FKVA 4HYSA 1OBGA 4QMZA 3GU6A 3TL8A 3SOCA 3R83A 4IAZA 3UGCA 1OI9A 3IONA 1Q8WA 2H8HA 3CSVA 5CY3A 5CEPA 5AM6A 4BI0A 3LZBA 4PX6A 3EKKA 3R9HA 3SC1A 4DFNA 2WMXA 3MESA 3IECA 3RI1A 2UW9A 1ZARA 4AS0A 2I40A 4QP6A 5IA1A 5HZNA 1OITA 1FVVA 2J4ZA 2JITA 2E9VA 5AP7A 4OAUC 1ATPE 4PUZA 4J7BA 1B6CB 3R7VA 3W16A 4XRLA 5DIAA 4QTEA 1JNKA 2Y7JA 4JDIA 5L4QA 3TV4A 4H58A 3BPRA 1PYXA 3S95A 3B8QA 3RTPA 3PZEA 5IA3A 3DA6A 4G3EA 3HMIA 4WA9A 4DN5A 5AV1A 1WZYA 3FLWA 4DYMA 2RFEA 4CMTA 4GT3A 3BE2A 4NM5A 2ZV7A 4HVSA 3NW6A 1PJKA 1PMVA 3MTLA 3B2TA 4IX3A 2B54A 3ZO1A 3UO5A 4FV1A 4TYIA 2IPXA 3UNZA 4RA4A 3EFKA 2W0JA 4FL3A 2XNNA 5EW8A 3S1HA 4R3CA 5BUJA 3L8XA 3RGFA 4EONA 3BZ3A 3I0OA 4YZBA 5K9IA 3AMYA 4M12A 1YXUA 2QC6A 4L53A 2G15A 3QTUA 3ORTA 5K0KA 4EOOA 5A4QA 4DCAA 4OBOA 4RRVA 3HV4A 3E64A 3TTIA 4BBFA 3QRUA 2YLFA 3JYAA 3UZRA 3G0EA 4HYHA 4F9BA 2BROA 4FT7A 4OTQA 5DG5A 4J53A 2WFYA 1UWJA 4BN1A 4IWPA 1UU8A 3LPBA 4NJDA 2NPQA 1B38A 4FBXA 1P2AA 1PKDA 3KQ7A 2FH9A 2XK7A 3I6WA 2ITXA 2H6DA 4J95A 4YBJA 4FL2A 3NUXA 5CU2A 2O65A 5HNIX 4HNIA 3FWQA 3I81A 4ACGA 1J1CA 3TUBA 3WF9A 2WQEA 2C69A 3PJCA 4KSQA 5H8GA 4E26A 3KRXA 1PYEA 2OI4X 5DEWA 4EC8A 3QHRA 4BY9E 2XM9A 3E93A 3GCVA 2Y0AA 5AADA 4X2JA 3LCOA 1KOBA 3C4EA 5GZAA 4L68A 4IBMA 1GZKA 3BYMA 4FICA 4KIQA 1YOLA 5EW9A 3MFUA 5LVLA 4FV4A 1LEZA 4UB7A 3BQCA 3DBFA 4IAYA 4MD7E 1PRYA 4FIIA 5CT7A 5HG7A 3F5GA 4TNDA 2X7OA 2RIOA 3QC9A 4IAIA 4YGAA 1NVRA 5HNBA 3IQ7A 3BYSA 3VS3A 3VUKA 3ZZEA 3WZKA 3W2PA 3IGGA 4AWIA 4EZ5A 3DCVA 4YLKA 5C27A 3Q60A 1O6KA 4H1MA 5FM3A 3WE8A 1ZOHA 5B2MA 2CCIA 5AV0A 4YJNA 3PSCA 4QQ5A 4YTHA 3LMIA 4DTAA 2W1CA 5HBEA 3IG7A 4FTKA 4YPDA 2FSOX 3BLQA 3HMOA 3IS5A 3TI1A 1U4DA 2OW3A 5C8KA 4IH8A 1W83A 4TYJA 4O7RA 2AUHA 4BDCA 1FGIA 3NW5A 5DEYA 3RMFA 5KHWA 3A4OX 2Y4IB 2PVJA 4BCMA 3VBTA 4C61A 2OZAA 4TXCA 3MVJA 5A4CA 4FIHA 4ZTLA 5CLPA 3K5VA 3VS5A 5EYKA 3GBZA 4DEDA 2G9XA 4G9CA 4MD8E 4QO9A 1Q97A 4GV1A 3RNYA 3WARA 4CZYB 3H4JA 1PW2A 4Z16A 1KE6A 2OJFE 1STCE 3NMUF 3KXZA 4PPCA 4UMTA 4FZ7A 5CF6A 2YJRA 3UODA 1J7IA 4M8TA 3TNHA 4CLJA 4A9RA 1L8TA 3QUDA 5E1SA 2WEIA 1YOMA 3ZO4A 5IEVA 4HZRA 3DY7A 5IDNA 3PRIA 4XBRA 3BGQA 3PZHA 4E6AA 4X2GA 2BZKB 3MI9A 1FMKA 3MVHA 4X0MA 4XUFA 2PE1A 3ROCA 3I7CA 3QQJA 5GJFA 4FVPA 5I9UA 4H39A 4R3RA 5M4IA 4CT1A 4U80A 2YIXA 4PL4A 3RAIA 4HVDA 4QMXA 3DLSA 1YVJA 4FTJA 5IMXA 5JN2A 2BDJA 5CEQA 3ZSIA 2B9FA 4I5PA 3VJNA 4J97A 5HQ0A 3LCSA 1YHVA 3DPKA 4W8EA 5E8ZA 3Q53A 1PF8A 4GK4A 4XG7A 4ALUA 2CHLA 4CVAA 3PPZA 3FZTA 5LMBA 4HOKA 4JG6A 4GIIA 4R5SA 4R1YA 2PUPA 3VRZA 5KMMA 3NZ0A 4EYJA 1H27A 3AXWA 2OJJA 3BI6A 2OWBA 3ET7A 2W1EA 3MY1A 2RFDA 3Q96A 4O22A 5HI2A 3AC8A 2XVDA 3ZLYA 4AT5A 3HP2A 4JBQA 2WMBA 3CKWA 4EKKA 4FKQA 4O6LA 4ANNA 3H0YA 3BRBA 5AP2A 5DWRA 2W1HA 5LVPA 4O84A 2OG8A 4BZOA 4YLLA 5ITAA 3R7GA 1Q3DA 5HCXA 1ZMUA 2WQMA 5GHVA 4CKJA 2JDSA 4Y8DA 3FMLA 4F1MA 2C5VA 1QMZA 3A7GA 4MH7A 3RPSA 3UP7A 1H0WA 4D28A 4JQEA 2WTWA 1BYGA 2C5OA 1UU7A 3FI4A 3NR9A 3ZU7A 4MKCA 3OEFX 1FQ1B 2HAKA 4FIEA 4OTPA 3VVHA 3W33A 4OBQA 3CC6A 2YISA 4FVQA 3F3TA 3CGFA 5CEIA 4C2WA 4Q9ZA 3KK8A 1NVSA 4G5PA 2WPAA 4FSTA 4LRKA 5CX9A 2YJSA 5DRDA 4G34A 3LFCA 4QMSA 4YC8A 1MRYA 5CANA 5KX8A 3L9NA 4R6VA 5CI7A 2GNFA 3SVVA 4K1BA 4CMOA 5LXMA 5DPVA 3FI2A 1YXTA 2UZUE 3D7TB 3WIKA 4EOLA 2C6TA 3O2MA 4FKPA 3KB7A 5JKGA 2DUVA 4YHTA 3K3IA 3KK9A 3BYVA 4BYJA 4OUCA 5I9XA 2HXLA 2JFLA 1OPLA 1Y8GA 3F7WA 4XV9A 4CG8A 4BCOA 4CYIA 3ACJA 3RWQA 5A6OA 3EOCA 3QKLA 2ONLC 5CU4A 4OTDA 5M51A 3A61A 1M7NA 1G8SA 3OWPA 2WMAA 3TG1A 5LVMA 3M42A 4XLVA 4PMPA 3VAPA 1Z5MA 4XS2A 3UMXA 3K5UA 3W2CA 3ENHA 4UEUA 2W05A 2GDOA 4LQMA 2PVKA 4BWXA 2Z7SA 2YM3A 3HV5A 4S33A 5ETIA 4EYMA 2ZB0A 3LFEA 3O0GA 3FQHA 4U8ZA 3BEAA 4AZVA 3TJCA 3GOPA 2W17A 3OY3A 3ZOSA 5A46A 4QMWA 2ITWA 4J1RA 4E73A 3QC4A 2OU7A 2QO9A 3A7HA 2C0TA 4FVRA 3E8CA 4FSMA 4F0FA 2BRGA 4HVIA 4E20A 3HECA 4E5AX 4K6ZA 2C6DA 2YIYA 4CFFA 5JQ5A 3HX4A 5DT3A 2WKMA 2QNJA 3LQ3A 1KE5A 3EKNA 4DEIA 3LCKA 4O7WA 2R3IA 4RVLA 3ZO2A 5JK3A 4O7TA 4AGWA 3PPJA 3FMKA 4CFXA 3WZJA 1BLXA 3V04A 4BDKA 2X2LA 3NYOA 2HWPA 4IFGA 3U51A 5HVJA 3Q2MA 3EL8A 3UIUA 3RPRA 1DS5A 4G5JA 2WQOA 4F9YA 3K54A 3VNTA 5J9ZA 3HEGA 2QOOA 3UVRA 2OZOA 5L8KA 2J0IA 3LHJA 3QXPA 3CE3A 3P7BA 3W10A 4BHNA 4DGLC 3PP0A 2R64A 3VO3A 2I6LA 4MHAA 5J79A 4XV1A 1UVRA 3E63A 3F7ZA 4JJRA 5CSXA 4C34A 4YJUA 5AUWA 3EFWA 1TQIA 1MQ4A 1UNHA 4CXAA 1FPUA 2UW7A 3LCDA 4UZDA 3ATSA 4I0RA 3VRYA 5BYLA 3DBEA 4IAAA 4Y73A 4YTIA 4FV5A 2WELA 3F66A 2R3PA 3NS9A 2IZTA 3G9NA 3S4QA 3COMA 1IASA 3GU5A 2CGWA 3RPVA 4DBNA 4RX9A 4F08A 3MGYA 5EI8A 3SOAA 1KV2A 4S32A 3TTJA 2CKOA 3R7EA 1WCCA 3PY0A 1H01A 2W1FA 4PP7A 2BILB 2EWAA 3QRTA 5LMKA 3DJ6A 3GCSA 4JDKA 2YACA 4MX9A 5E8UA 5M4UA 3MB7A 3AC5A 1H00A 4WBOA 2GNHA 1APME 1JAMA 4WG3A 1V1KA 4EK4A 4IZ7A 4LUEA 1GIIA 5AEPA 4EEVA 4FZ6A 2HOGA 3IGOA 2V5QA 4FGRA 4B8LA 4I6FA 4M7IA 3TNQB 4R78A 4UXLA 4OTWA 4JBVA 3OF0A 4IMYA 2R3QA 3LFBA 3EYGA 4YTFA 1MP8A 2R5TA 1U54B 4EKLA 3ZSHA 2C3LA 5FLFA 4EK8A 5JEBA 1YQJA 5A6NA 1OIQA 2W7XA 3EMGA 2XIKA 3NWWA 4DLIA 2W1DA 3DNEA 3QAME 4DTBA 4MBJA 5ANKA 4I94A 3NIZA 3OOMA 4FZFB 2GU8A 1MRUA 4YLJA 1P4FA 4CGAA 5FBNC 3UG1A 4CCUA 3WYXA 1R0EA 3BBWA 3KF7A 4YSMA 5HU3A 2V55A 1GIJA 4RT7A 5CQUA 2BIKB 3C5IA 2ZM1A 5LVNA 1Q8UA 1PKGA 5K5XA 1OL2A 4OW8A 3UIMA 4F0GA 2JLDA 5TOZA 3RJCA 2YCRA 2IZSA 3ZRLA 4RGJA 4L67A 3DV3A 3GGFA 3FLZA 3U6JA 2VNWA 3T9IA 5KBQA 2SRCA 4GCJA 3HRBA 3ZUVA 4U45A 4F63A 3VULA 5JRQA 3U54A 3F61A 3OCGA 4FSYA 3FXZA 3EQCA 3TZ9A 4JRVA 3S3IA 4FIJA 5LJJA 2ZM4A 3FHRA 4AOJA 4D1XA 5HU9A 4HVHA 3BGPA 1K3AA 2WXVA 4XG3A 5M44A 4FOBA 2Q0NA 5FM2A 3TIYA 4O1OA 3HRCA 4DCEA 5GNKA 2WU7A 4Y95A 3UNJA 5GIPE 1DAYA 3PJ1A 3CQEA 5C1QB 1BI7A 4RX5A 3PXKA 1LR4A 4XCUA 4O21A 3FKOA 3VS7A 3DLZA 4IZ5A 1GNGA 1OIUA 2Y9QA 3TEIA 3V01A 3EH9A 4ANQA 4K33A 2ITVA 3FY0A 1F3MC 2VGPA 3GC7A 3PXQA 1GY3A 1YHWA 3R02A 4Z55A 1JSVA 2VTSA 1VJYA 4U0IA 4A7CA 4ACHA 4BL1A 4HCTA 4ZSJA 2GPHA 4GU9A 3BIZA 1OKYA 3EL7A 5EDPA 4HCUA 4AN3A 4QT1A 1H24A 1UWHA 4O7ZA 4FT0A 3WZDA 4IC8A 3VUDA 5CAQA 2R7BA 1H1SA 3BU3A 3ZCLA 4JQ8A 4IZYA 1H25A 4I6HA 5BVDA 2NRUA 4G3CA 3TACA 3R9DA 5AFVA 4M15A 5AJQA 3EQDA 4KS8A 4AT3A 2P33A 2ZAZA 3EQBA 5AP6A 1TKIA 5CF4A 4DGMA 3DAJA 4PL3A 4NWMA 3WZEA 3F9NA 4B7TA 2YWVA 3KF4A 1YDTE 1OUKA 3QRKA 4QYYA 4I4FA 2PSQA 1YWVA 2IO6A 3SLSA 4FNYA 4ACCA 5H8EA 2XEYA 2UZNA 1JPAA 4IAKA 5IF1A 3BGZA 2OH0E 2XIXA 4BHZA 4C35A 1G8AA 4U81A 5D41A 2HZIA 5A3XA 2Y4PA 5EOBA 4L42A 3V5WA 4I24A 4CNHA 1DI9A 4GKIA 3LFNA 3PWDA 3L9PA 4EZ7A 4ITJA 4AW2A 3SX9A 3C1XA 4PF4A 3CXWA 4ZZMA 3GC0A 3PPKA 3D4QA 3FMMA 5EW3A 1MQBA 2QONA 1Y8YA 3DJ5A 2F7EE 3KY2A 4XHKB 2A0CX 3VUIA 2OICA 3DOGA 5HICA 3WZUA 4D1ZA 4R77A 3SXRA 5HO8A 1Q24A 3C4FA 1OL5A 1VEBA 5H8BA 3R8PA 1M52A 4X3FB 3GU7A 2HZ4A 4ANMA 1ZRZA 2C5XA 4KKGA 1M14A 4H3QA 5CNNA 4ZIMA 5IQBA 1BI8A 2BZHB 1K2PA 3UVQA 3RZBA 2B53A 3ZSGA 2VTOA 3NNXA 3OTUA 4AN9A 4EZ3A 5L6OA 3RALA 4R7BA 4RIWA 5L2TA 1M2PA 4UY9A 5HORA 4FG8A 1IRKA 1FVRA 1AQ1A 4DG2E 4FUXA 4OAVB 2YABA 1JKTA 3EB0A 1KOAA 3QUEA 4XV3A 5CSHA 4BTKA 4DLJA 5M55A 4CTCA 4BCQA 1WAKA 3LJ2A 4QP3A 3W8LA 4B99A 5B0XA 4MYGA 3Q32A 2GFSA 4CEGA 3NRMA 3E7OA 4FTNA 2BHEA 4DE4A 5FDXA 3ZEPA 4MNEB 2C3IB 2BRBA
chains in the Genus database with same CATH superfamily
1RE8A 3C4ZA 2C3KA 4IHPA 4D5KA 1XHAA 2A98A 4EBWA 5B2KA 2ZOQA 5DR2A 2JD5A 4G31A 2UW0A 3HDNA 1OKVA 4E4LA 5IZFA 3QQFA 3SGCA 4C4HA 4II5A 2C4GA 3VBVA 3W8QA 4TN6A 3E62A 3HA6A 1FMOE 4NL0A 4C2VA 5BYZA 2QU6A 2V62A 2ITTA 3ALNA 3HZTA 4ZOGA 4AW0A 4IW0A 5CU0A 2IN6A 4XOYA 3JVRA 4BJJA 2IVTA 2IW8A 3U4UA 4I4EA 2QOBA 3AT2A 3MIYA 4FTAA 2B9HA 3VHKA 4AE9A 1L3RE 5E90A 2W5HA 3VBWA 5A14A 3TT0A 3SRVB 4CFMA 5HG9A 1SVHA 4NTTA 4C38A 4Z9LA 4R5YA 4AXCA 2CMWA 2RFNA 3QALE 3UIBA 4B9DA 1Q8YA 4BR3A 2BAKA 3EQIA 1RJBA 1ZWSA 3KMWA 5E1EA 5E8VA 3KL8A 5EYDA 3ZLSA 4EK3A 1TFFA 4KBKA 4X2FA 5G1XA 3BWJA 2XJ1A 3QZFA 3HAVA 4BDFA 5KMLA 5CT0A 4J8NA 4ZSEA 4I92A 4O0RA 3OUKA 5J87A 3QCSA 4L00A 3ORKA 4GW8A 5ACBC 4YUQA 3P1AA 3ZO3A 4O82A 1RDQE 2XJ0A 4HGSA 2CSNA 3CBLA 1WBPA 2GTMA 4DEHA 3NUUA 3R1YA 3GC9A 4OR5A 1GZNA 1VYZA 4I3ZA 3LM5A 4Q5EA 4GJ3A 4FTQA 4LV5A 4O0XA 3N4TA 3F3ZA 2WOTA 4BDDA 2UZEA 2ZDTA 2GMXA 5KMNA 5C03A 2FVDA 2QO2A 2JAVA 4TTHB 3GQLA 2XYUA 3QGWA 4XG9A 1U59A 5EHYA 1PMEA 3FMNA 4O2ZA 4YU2A 3K3JA 3FKNA 1OKWA 3H3CA 3KRWA 5KMJA 3BV3A 4HJOA 4GYGA 3HKOA 3CCNA 3QBNA 4FSQA 4Z3VA 3DK6A 3MS9A 4YMJA 3TDVA 4P4CA 4JG8A 4DGNA 1XWSA 2E9PA 3QZGA 2FA2A 2CKEA 4N0SA 4AZTA 1CDKA 4I5CA 1KUTA 3O96A 5AMNA 1XH4A 4RLLA 2W9FB 2I1MA 1H1QA 5HIEA 5HTIA 3T9TA 4BKYA 3DFAA 3FKLA 2C1AA 5C01A 3P08A 4W4YA 4C0TA 1CSNA 2FB8A 3LXPA 3UO6A 2EUFB 2WZJA 4LDTA 4KRDA 4RX8A 4GSBA 3KXGA 4OGRA 3N4UA 2EXEA 5AR2A 3UP2A 1ST0A 2BZIB 2YM5A 2HY81 4WUAA 2VD5A 4GUBA 5EHLA 2WO6A 3LCTA 4RMZA 4YSJA 3EN9A 5FQDC 3ZFMA 3OP5A 4MQ1A 4BZDA 2V22A 2CNQA 4JS8A 4CMUA 4ZSAA 4U97A 4HZSA 3M1SA 2WTKB 2B7AA 5CWZA 1WBTA 4FK3A 3WE4A 4O86A 2GTNA 4PDYA 2R3RA 2JBOA 4IB5A 4OBPA 1FVTA 3VW8A 4EK5A 3PA4A 5GIOE 4GMYA 2QODA 1SMHA 5CAVA 3UYTA 5F20A 4F4PA 3U55A 3NUSA 3NUYA 3OWJA 4LV7A 2W5BA 3OTVA 4XJ0A 2HXQA 2HZNA 3IDCA 4O83A 4A9TA 5AA9A 3ENMA 3ITZA 1BMKA 2HELA 5FGKA 3AC3A 3DKGA 4PRJA 4R8QA 3MTFA 4QYEA 4U6RA 3ANRA 4F7JA 1H26A 4UBAA 4EUUA 4FTUA 1OL1A 5E4HA 1H28A 2PUNA 1IAJA 4LOQA 3H30A 3DNDA 4PQNA 2O63A 4N70A 4NSTA 5HTCA 5D7AA 4DHZA 2OXYA 3H10A 2BFYA 3PA3A 2XJ2A 1ZYSA 4LUDA 2XK6A 3BLRA 4QMMA 2IJMA 3KMUA 1PXIA 2ITOA 3BHUA 2XK9A 3ANQA 3EN5A 5HLPA 3GNIB 3UC3A 3VS6A 3PXFA 3ZXZA 3A7FA 4FKIA 4FTRA 4AA4A 2W4JA 3EFLA 4CCBA 3C5UA 3NNUA 4KA3A 4EOMA 1H1PA 4V0GB 2C0IA 3RPOA 2RFSA 3A7IA 1KE8A 3SQQA 2WTKC 4TPTA 3QYZA 3IK3A 2F4JA 3NYVA 4AW1A 4PP9A 4YTCA 2PMNX 1YOJA 2BZJA 2QD9A 4C33A 4BIBA 5BVOA 2OK1A 5FRIA 1JBPE 4FKUA 2BPMA 4V0GA 4APPA 1XJDA 3CGOA 3MB6A 4WUNA 3AGLA 2PWLA 3IW4A 2PUUA 4RG0A 2XNPA 2C5NA 3R22A 4U3YA 3NAYA 3OZ6A 3PIZA 2ERZE 3CD3A 4LL0A 4ENYA 4QMPA 3RWPA 1GZ8A 4BDAA 4EHGA 3RK9A 4ZTMA 4JDHA 4F9WA 3PSDA 3G51A 4RWIA 4TZRA 4ZTQA 3WBLA 4TT7A 3FL5A 4ZTNA 2VRXA 1J3HA 5CENA 4H1JA 3Q9YA 5CALA 3PRFA 4IWDA 2XCHA 4AX8A 3IW6A 3DTCA 4AG8A 2PUIA 2X1NA 3ZC6A 5J1WA 5L3AA 2WMQA 5HVYA 4O7LA 4RWLA 4DDIA 2IW6A 2BCJA 3DTWA 4GT5A 2J7TA 1ZMVA 5AUYA 3OXZA 2X2KA 5C4LA 4UN0C 5J9YA 4EUTA 3L9MA 2BVAA 2R3MA 1BL6A 1VYWA 3MA3A 4LRJA 4XMOA 3UE4A 3IDPA 5IQIA 4GEOA 1YDRE 4FKGA 4GT4A 4YBKA 5CXHA 2VWIA 4ZY5A 3PUFC 4IZAA 3PG3A 4RLKA 3BKBA 5GZ8A 1UV5A 4FV3A 4O6EA 4RWJA 3VBYA 5HE0A 5AR7A 3MFTA 5HCYA 1SNXA 3V5JA 4QYGA 5CSWA 2JDTA 4M67A 5EI2A 2GNGA 2R3LA 3VUTA 3NVKI 1W8CA 1M2QA 5ANIA 1S9IA 4NTSA 4ERWA 3TDWA 4ID7A 1OGUA 3NLBA 4ZTHA 3V8WA 2NO3A 5K3YA 2ITPA 4E1ZA 4C4FA 2JKKA 3RCJA 2I7QA 4PDPA 1Q62A 3ORMA 5J5TA 3PE1A 4ZP5A 3NAXA 4ENXA 1F0QA 3KN6A 4O0TA 4ANOA 2JDRA 4BTMA 2IW9A 3SXFA 4MEDA 5FEQA 3T3UA 3O8TA 4ONAA 4RZWA 2Z02A 4UWBA 3FMEA 2CLXA 5TE0A 4XX9A 1LEWA 3QTXA 4A07A 2P55A 2XA4A 4YC6A 4FIGA 2GHMA 2Z7LA 4E4XA 2C3JA 4XBUA 5C9CA 4GFMA 4DGGA 2PVNA 3ZEWA 4AA0A 3UQGA 5K5NA 2BRMA 1ZYLA 3H9FA 5AIKA 5CU6A 4HPTE 4YO6A 4KIPA 3E8NA 4Y72A 4AAAA 2CNUA 5HBJA 4IM3A 4I5HA 5KNJA 4JAIA 5CF5A 1WBNA 2R3OA 3I4BA 3MH2A 2OZAB 2Y6MA 3TXOA 4EL9A 3PA5A 4Q9SA 1SVEA 4QPAA 2ZV9A 4MWIA 4L6QA 5CS6A 4ASEA 4EH6A 5AAGA 3TWJA 3QUPA 4WD5A 4I93A 4WNOA 2HW7A 3GT8A 2YAAA 5IA2A 2ZV8A 3P5KA 4MF0A 4BZNA 5DRBA 3E87A 4ZS0A 5E8WA 5AAFA 2BFXA 4NH1A 4EQCA 3DBCA 5ANOA 1NW1A 2IG7A 4AGDA 4C8BA 4I0SA 4B4LA 2XNGA 3EQFA 4C3FA 2IF8A 1DM2A 3G6HA 5E92A 5E8XA 4ZK5A 4L9IA 4BCNA 3RBWA 4P2KA 2F7ZE 3PFYA 5CVGA 4CZUA 2C6IA 4K9YA 3Q9XA 4EOIA 4LGHA 3LVPA 4AU8A 3KRRA 2BRHA 2WAJA 3L8VA 4BKZA 5CXZA 3F2AA 3Q4TA 4GVJA 3H9OA 5LMAA 4M97A 2YCQA 1BUHA 4M0YA 5HE2A 2X0OA 1ZYDA 5I3RA 4FEWA 4BKJA 2R3JA 3QD3A 3QCYA 3AG9A 3NYXA 4BBMA 5ANDA 4ZEGA 1UU9A 2Z7QA 4FR4A 2ZB1A 3D2IA 3Q4ZA 2XK4A 4TYHA 3LLAA 4X21A 5IISA 1PMUA 5IKWA 2PVMA 1FBNA 1M7QA 4FSZA 3P86A 3ROYA 3Q3BA 2X0PA 4W4VA 3SA0A 2XP2A 3EN4A 4YNOA 2RKUA 2VTTA 3DB8A 2ITYA 3LJ1A 2GS2A 3HV6A 2CN8A 3LXKA 3R73A 3V5PA 3OCTA 4ZY6A 4C4IA 2PHKA 4BBEA 2XALA 4KINA 2NYAA 2WNTA 4AA5A 4KRCA 2FSLX 2WTDA 2F7XE 3LQ5A 4BGGA 5D10A 3OVVA 2OF2A 1YXSA 2HCKA 4ZJVA 2A2AA 4JVGA 4ZS4A 3LQ8A 3IO7A 3KGAA 4TKSA 5LARA 5JQ8A 4LI5A 2ONLA 4MAOA 4DA5A 4UWYA 5B2LA 1QPCA 4FMQA 3R2YA 5IDPA 2P3GX 2A4LA 3ZBFA 4RJ5A 4G6LA 3COHA 5HHWA 1K9AA 2QLQA 1ZZLA 5HEZA 2BAQA 3PTGA 1W84A 3GFEA 2JGZA 4TRLA 3VS0A 3UQFA 2F9GA 3KREA 4QNYA 5KMIA 3DK3A 2ZMDA 2J5EA 3O23A 4K77A 2Z8CA 3CEKA 4U7ZA 1GJOA 1J7LA 2OBJA 3KC3A 4AXAA 3OC1A 4D4RA 5M07A 2I0YA 3AMBA 5AUUA 4CG9A 3GEQA 1WVWA 2H9VA 3ZC5A 5ACKA 2R3FA 2W96B 4G6NA 4MBLA 1CTPE 4ZSLA 4JG7A 1SVGA 3RHXA 2OXXA 3QF9A 4F0IA 3D94A 1YWRA 5HG8A 4FA2A 3MH1A 3PLAE 5A4EA 3CPCA 4GYIA 2NP8A 5IA0A 3JPVA 2JDOA 1YI4A 4JT3A 4JLCA 5F9EA 3VBQA 4AE6A 3E88A 2QO7A 3HRFA 3NCGA 3VHEA 4L3JA 3GVUA 3FQSA 1PXJA 4NU1A 3R01A 2CLQA 3R28A 3FMHA 3QKKA 4FTIA 4YJSA 5DA3A 4NEUA 3A4PA 3WF6A 3ZTXA 2OFUA 4F99A 1OBDA 2XF0A 3U9NA 4X6QC 3QTQA 2AYPA 4AOTA 5JFSA 5JGAA 1RQQA 3OROA 1ZOGA 3HMNA 3BL9A 4ALVA 2JKOA 4EQMA 3Q9ZA 3R1QA 4F70A 4NFMA 4FIFA 4CV9A 4M13A 4QPSA 4RJ3A 3SAYA 4BDBA 2P2IA 4JAJA 4I41A 5DR9A 4M69B 5HOAA 2O5KA 3WIGA 4YC3A 2BTSA 1HCLA 4HGTA 4NM7A 3WYYA 4BCFA 3RHKA 3W2RA 4XYFA 3VUMA 3GUBA 5KMOA 3COKA 4TW9A 1R39A 4TL0A 3ZFXA 4ZLZA 4CFUA 1O9UA 1XBAA 2X2MA 2XKDA 1VLRA 3R00A 4AFEA 5CVFA 4DH7A 3CY3A 2JDVA 2QR8A 4LV8A 4EJNA 4M69A 4X3FA 4TWCA 3NNVA 4X2NA 5L8JA 4AXEA 2ITQA 3QA8A 5HESA 3CKXA 4E6CA 2WTCA 4FKRA 2WD1A 3WOWA 3E92A 4D2TA 5HX8A 3LFDA 5L6PA 3W0PA 3ORLA 1ERKA 1IA8A 1W2DA 4EWHA 3AD4A 4FYOA 1YDSE 5EHOA 2BAJA 4WHZA 4UX9A 4LOPA 2ETRA 3O8UA 4MTAA 3KXNA 4A9YA 4FTOA 5AR5A 3DZQA 5LOHA 3E5AA 2EB3A 4QOXA 4QNAA 4IX4A 4D1SA 2XBJA 1URCA 3QCXA 4FV8A 2Z2WA 4XRJA 4ZY4A 5CEKA 5EM7A 2UZTA 4IIRA 5AV4A 5A9UA 5A4LA 2WMUA 3MW1A 2BMCA 3DAKA 4RVTA 2PYWA 3OY1A 2QHMA 4DTKA 2G2HA 3LFQA 2B55A 3OWKA 3BHTA 4P7EA 3QLGA 4EH4A 3P79A 4KNBA 4G17A 4RC4A 3D15A 2QOQA 2XIZA 2B1PA 3QHWA 4M66A 3C7QA 4FT5A 4D55A 3C13A 2AC5A 4AN2A 3ID6C 3BV2A 2WHBA 2W1GA 2YEXA 2X81A 4WOVA 2X6EA 2YWPA 5E7RA 5JMSA 1PY5A 5FD2A 5IG1A 4H05A 4EJ7A 3BLHA 4FKSA 1MUOA 4QYFA 2QOLA 3BEGA 2QOHA 3I60A 2HK5A 3R1SA 4YJVA 3BHHA 4EOQA 3U6IA 1XH7A 4D5HA 2IVSA 4O0WA 2W1IA 2JKMA 3W0QA 4L43A 4K11A 3C0GA 1U54A 4FOCA 4FSWA 4LGDA 3V8SA 3O8PA 5JFXA 3UDZA 3P4KA 3D2KA 5AP5A 1NXKA 4QDEA 3A99A 3CQUA 3LAUA 2C47A 2R9SA 1Q4LA 3FQEA 3ORNA 5BYYA 4RSSA 4K8AA 4MXOA 4DAWA 3LKMA 1NA7A 4RQKA 2VWUA 4R1VA 3GOKA 3UOKA 2DWBA 2BIYA 4UMRA 3PIXA 5KZIA 3TCPA 2VUWA 4Q5HA 2PVYA 2XM8A 4XG2A 1J91A 2PK9A 4FT3A 3OOGA 4PY1A 4O2PA 4Y5QA 1QPEA 4XG8A 1OPJA 1UKIA 4EOKA 1OZ1A 5AX9A 1JSTA 1LUFA 5I9ZA 4NT4A 3TUCA 3KMMA 5FTGA 1OIYA 3I7BA 3P9JA 4EHVA 4EOPA 4FZDB 3QTIA 4I0TA 3ETAA 4I1ZA 2C68A 1S9JA 4UMQA 4A4OA 3W0MA 4LM5A 4JOAA 2VTJA 5E8TA 1WBSA 1OL6A 1REJA 3UDSA 4FSUA 4U79A 1J1BA 3DXNA 5EDRA 3F69A 4L7FA 3Q5IA 3NYNA 2YZAA 3OT8A 5FXQA 4YP8A 2GNLA 2VTHA 3FLSA 3I1AA 4O38A 3PFQA 4V04A 3ZYAA 3AT4A 3F88A 5IH4A 3ORXA 3VWAA 5IUIA 2NRYA 1ZMWA 3DU8A 3OXIA 3GXLA 4FV9A 5DT4A 4CV8A 3JY0A 5J9LA 3PVGA 2ETMA 4BRXA 2WMSA 3W0OA 3L9LA 3Q4CA 2YFXA 4FV7A 4AOIA 4DC2A 2GNJA 3LMHA 3ORIA 2ZDUA 2OKRA 3MIAA 4GUEA 5JSMA 5KKRB 2OH4A 1Q8TA 5KMKA 1WVYA 1IG1A 4O96A 4G6OA 3LW0A 4G16A 4D0XA 1CKIA 4DFLA 2ITNA 3DXQA 4O7VA 3IW7A 3OW4A 1KE7A 3O50A 4OTIA 4Z7GA 4IVDA 3W32A 3W55A 4QPMA 3FZ1A 5JZNA 2BKZA 1LP4A 2UVXA 4C58A 4JX3A 5AR8A 4BF2A 2GQRA 4O0VA 1OIRA 3UPXA 2XEZA 5HG5A 3ZLXA 2UVZA 3F3VA 2VO7A 3EQPA 2QOKA 4ARKA 5EOLA 3FXXA 4U40A 3R7UA 4RWKA 4BIEA 1DAWA 3PDTA 3V5TA 5FUTA 4KABA 2YZLA 3P78A 4EH3A 2CNVA 3K2LA 3LFAA 3HGKA 3WILA 5HIDA 4FV6A 5DOSA 5E8SA 5FWKK 3JXWA 5HBHA 3TJDA 5LWMA 3DKCA 2JIVA 2YCFA 4C4GA 1H0VA 3O71A 3H9RA 3IOKA 4ZJJA 1P4OA 4DFBA 2UZOA 4FJVA 4FKJA 4L46A 4M84A 4D0WA 4DFYA 1YKRA 4NW6A 5DI1A 3R7OA 4DGOA 4EH2A 5BVFA 4WT6A 3FXWA 2X0GA 4DH1A 5IA4A 5EKOA 4K0YA 5BPYA 4RIOA 5AV2A 3R8VA 3MVLA 1LPUA 4I23A 3SRVA 4XH6A 4BDGA 2O8YA 3G2FA 5AP1A 4YR8A 3ACKA 3OXTA 2VZ6A 3TZ8A 2VNYA 4USDA 4ORKA 2XNMA 3C0HA 3E3BX 2QURA 2VO3A 3OMVA 2WIPA 4FUYA 4GFOA 4ITIA 4JQ7A 3NUPA 1U5QA 4L01A 2ZJWA 1E1VA 2O3PA 4QMNA 1PHKA 4UMUA 5KE0A 1UU3A 5DR6A 4WRSA 5CSVA 3ZBXA 4GJ2A 4L8MA 1W2FA 4MD9E 4YPSA 4MXYA 3HL7A 4GS6A 2E2BA 3V51A 3MWUA 2BHHA 1IAHA 3U87A 4BTFA 3MBLA 1OL7A 2PMIA 4EOJA 5CF8A 4EH9A 3DDPA 4CTBA 4F7LA 3FMDA 2OO8X 5CNOA 3H0ZA 2G2FA 2B9IA 4C36A 3SDJA 1CM8A 4ASZA 1A06A 2C6KA 2FUMA 1V0OA 5LCKA 5EQEA 3HA8A 5KUPA 4D2VA 4M0ZA 3NCZA 4BGQA 4PTCA 5HIBA 4NM0A 3AC1A 4MXAA 3V5LA 2XKCA 3EZRA 3R30A 2Q0BA 4G3FA 4DEBA 2HYYA 4MCVA 4U44A 4IADA 4EH5A 5J95A 3KXHA 2OJ9A 3DB6A 4QTDA 4C57A 1NVQA 4L52A 5IA5A 3HP5A 4QQJA 4LMUA 1R78A 3HYHA 3HNGA 4G9RA 3UOLA 3E8DA 3LMGA 4LFIA 2BDFA 4C3PA 4S34A 1XQZA 4FGBA 4WNPA 4U9AA 4PTGA 4GKHA 2J0JA 3RCDA 3UNKA 3THBA 2PVHA 4I22A 4J71A 4AACA 2CJMA 5CASA 4YHJA 4F6UA 3PLSA 4HNFA 3R9NA 5L2SA 4WRGA 4GG5A 3OS3A 2ESMA 5CEMA 2YCSA 2YN8A 3MY5A 3MJ1A 3CTJA 3M2WA 4NM3A 5I9VA 3GENA 2H34A 2XK8A 5HO6A 4FSRA 5KO1A 2J90A 3FC1X 3GFWA 3W2QA 3SV0A 2BR1A 2UZBA 4D4VA 3F82A 2KTYA 4FSNA 3FI8A 5CYIA 1Q5KA 5AV3A 3CR0A 2UW5A 3HAMA 4H3PA 4YZ9A 3ZRMA 3VQHA 3F3UA 5I5ZA 3GB2A 1QCFA 2PVFA 2WIHA 1BKXA 3BYOA 4IE9A 4PMTA 3AOXA 3D0EA 3ZUTA 3N9XA 3POZA 4CT2A 2PMLX 4CQEA 2C5YA 3W2SA 2W99B 4C37A 2IZUA 5L2QA 4MQ2A 4RJ4A 5IEXA 3PIYA 5C4KA 5AP4A 3EHAA 4U43A 2W1ZA 4X7QA 4DEEA 3E8EA 1ZYCA 4GH2A 5AUTA 3FZRA 2VWYA 3QQHA 4QTCA 2OIDA 4E6DA 3QD2B 2UZLA 4WBBB 2H96A 2ZV2A 3ZLWA 1JOWB 4QP4A 4D2WA 4PNKA 5IH5A 5LVOA 5TR6A 1A48A 2J6MA 4KAOA 3Q52A 1CKPA 1NY3A 4MVFA 3PVUA 2VTAA 3TN8A 2W4KA 2JKQA 3D5WA 4HYIA 5HD7A 4S31A 1H07A 4IB1A 4RC2A 4YJQA 4O0UA 5K0XA 4FEUA 4TWNA 3OWLA 3DAEA 4MNFA 1CMKE 3VUHA 4I21A 3GU4A 5D12A 3QQGA 3VC4A 1UNLA 3QZHA 2XKFA 2X4FA 3DGKA 3KEXA 5JRSA 3ATTA 3ZM4A 5M53A 1EH4A 1ZLTA 5E9EA 1G5SA 2VU3A 2IWIA 3SG9A 3E7VA 4RBLA 2FSMX 3CJGA 3D83A 2VWBA 1XBCA 3TKHA 4I5MA 3ZXTA 3VIDA 5LCJA 4N6YA 1YRPA 3FAAA 3QYWA 3MSSA 4DT9A 4S2ZA 2WQNA 1REKA 3FJQE 2GCDA 2R4BA 5DLSA 4YZDA 4MUQA 2XCKA 4EC9A 2XUUA 3ZRKA 2Z7RA 4FI1A 4RC3A 2G1TA 4CSVA 4D2SA 5C8NA 5GJDA 3VUGA 4EQUA 5E8YA 5H9BA 5DN3A 5J8IA 4C4EA 3CTQA 3MV5A 4BCHA 3KCFA 4BCKA 3F5UA 4BCPA 5BUEA 4LGGA 3R21A 5L2IA 4FV2A 5AUZA 1SNUA 4R7HA 4UXQA 4GU6A 4DG3E 2O64A 4GG7A 1NT2A 3UPZA 3AQVA 3R8UA 4EORA 3NVMB 1XR1A 4RX7A 5IPJA 3D5XA 1YWNA 1XO2B 2VX0A 4EOSA 4F09A 5LQFA 3R7IA 4ACDA 3HV3A 5I4NA 4O91A 5L2WA 3IDBA 5DGZA 3GU8A 2J0KA 3FYJX 5B7VA 4IQ6A 3UOJA 1DI8A 4RQVA 4E4NA 1O6LA 5EM8A 3BWFA 3HMPA 4F78A 4E3CA 3FL4A 2X9EA 3EWHA 2PTKA 4KKHA 4FK6A 4H3BA 4IXPA 4WNKA 4DDGA 2W4OA 1YI3A 1YHSA 3ZH8A 5TF9A 4TYGA 5DH3A 1IR3A 4ERKA 2REIA 4QP8A 3ORZA 2NNWB 3FSKA 2G2IA 4QMOA 4RA5A 2BTRA 4RJ8A 5BVKA 3UBDA 4QQTA 3L8SA 3TKIA 4ZAUA 3GQIA 4LMNA 5GINE 4FE2A 2VTLA 3Q5ZA 4PTEA 3CJFA 4JBPA 5KKRC 4FEVA 3BQRA 2WU6A 4XG6A 2EVAA 3DT1A 4PPBA 5AUXA 4BI2A 2YLEA 3JUHA 3QTRA 2Q83A 3RNIA 3BHVA 4CLIA 3R0TA 4M68A 2V7AA 4U3ZA 4ZZNA 2PY3A 5CZHA 4NZWB 4CRSA 3AMAA 4FG7A 4EH7A 3JY9A 3VBXA 3C4CA 5I9YA 2R2PA 2EXCX 3DZOA 2RL5A 3OW3A 3PYYA 3MA6A 1XKKA 5AM7A 5EFQA 2XS0A 3P23A 3QX2A 3ZFYA 5K4JA 3KA0A 3PVBA 4EHEA 2UZWE 4WSQA 5FDPA 2YA9A 2WTIA 3QRJA 3MVMA 3CD8A 4EH8A 4IX6A 5C26A 2R0UA 1OUYA 1QL6A 5CEOA 5IQAA 2AC3A 4DINA 3FLQA 4X3JA 3EN7A 1QPJA 1RW8A 5HD4A 3QQUA 3AKLA 3BCEA 3FI3A 4FNZA 3MH0A 4RIYA 4ANLA 1I09A 4NK9A 2IVUA 1VR2A 3EQGA 3O7LB 3V3VA 3FEGA 3F5PA 3HLLA 4RIXA 3R1NA 4U42A 4J52A 1Q3WA 4QD6A 3DK7A 2WEVA 3KULB 2QVSE 3NW7A 4IWQA 4XLIA 1A9UA 1I44A 1XMMA 4NCTC 5TKDA 3KIOC 2YDIA 4KS7A 2C30A 5ANGA 3RKBA 3II5A 1V0BA 3DBDA 4QTBA 3OFMA 2YIQA 2F57A 4GVAA 5FG8A 3TKUA 3O51A 1R0PA 2GNIA 3RK7A 3OCSA 4FTLA 4A4XA 5EQPA 1U46A 3R63A 4O27B 3NUAA 2HENA 1ZAOA 4JIKA 4FNWA 5CQWA 4CFVA 5CI6A 4O4FA 3UTOA 4K2RA 4A4LA 4BWKA 5DBXA 3U6HA 4RJ7A 4TYHB 4IAFA 3KVWA 1URWA 2JAMA 4I6QA 2ACXA 3KXXA 2VTMA 4J98A 2XNEA 3NEWA 5E91A 2X7FA 4WNMA 5M06A 3P7CA 2VWWA 1ZXEA 3NGAA 2JFMA 2W5AA 2F49A 4FKLA 3MN3A 1FINA 1XH5A 3FPQA 2V7OA 3EFJA 1XH8A 2F2UA 3HMMA 3R8MA 2UW3A 4DF3A 5F94A 4KSPA 2PULA 4BDHA 4AUAA 1PXLA 1QPDA 2CGUA 1JKLA 3IW8A 1FOTA 2UZDA 3WI6A 1P5EA 4G3DA 2Y4IC 4N6ZA 4DFUA 1JVPP 3RK5A 4ANSA 3V5QA 4D58A 4NCTA 5CVHA 2XAMA 1KV1A 5FTQA 5AR3A 5FBOA 3LM0A 3WF7A 4YJTA 2QOCA 4YZCA 2JBPA 5TT7A 3FMJA 5M56A 1TQMA 1YXXA 3FZSA 4FNXA 3MFSA 4BC6A 2A27A 2R7IA 4RJ6A 3R9OA 2VX3A 3A8XA 4D2PA 1KE9A 1M2RA 2ERKA 1X8BA 5FTOA 4LG4A 4KBCA 2BUJA 3SW7A 2IVVA 5AP0A 3BYUA 3QZIA 4PDSA 3D5UA 4NFNA 3PJ3A 5FEDA 5IUHA 1AD5A 4QMTA 1PXOA 4ZMEA 4G1WA 4J99A 2XNOA 3AC2A 1H1RA 1Q99A 1VZOA 4IM0A 4AQCA 1UNGA 4BCIA 3SG8A 4YJRA 4HVGA 4RZVA 3UDTA 2QKRA 5EG3A 3D7ZA 4MXCA 4O0YA 5CTPA 4AP7A 1W7HA 2X6DA 4YZNA 2RGPA 4XOZA 5ETFA 3TNWA 3DKFA 4E5BA 3LE6A 3IW5A 3PSBA 2UW4A 3S0OA 1YXVA 3UIXA 1XH9A 2FO0A 4QMYA 2JC6A 3KULA 2X8IA 4XG4A 4OTFA 3VF9A 1R3CA 4GRBA 4IC7A 2I0EA 4K18A 3P0MA 1JQHA 2UVYA 5CAOA 2VTIA 4XP2A 1Y6AA 5EDQA 3AT3A 3R6XA 4O7NA 1JLUE 4QMLA 5BUIA 2PZPA 3QGYA 4JMQA 4B6LA 2X7GA 3GI3A 2ZMCA 4OT6A 3VS4A 4KWPA 1WVXA 1ZYJA 4J96A 2J51A 4L44A 4NIFA 3FBVA 4R3PA 4BJJB 3CTHA 4ZJIA 4GK3A 3LJ0A 4BDEA 2B9JA 2FSTX 3ALOA 3B2WA 4IFCA 2YHVA 3G9LX 3I79A 3TNPC 3ZS5A 3VW6A 4AGCA 4NYEA 1WFCA 3AKJA 2VWXA 3PXYA 1W0XC 4DEGA 4PL5A 3LLTA 3CIKA 4I20A 3EZVA 5JFWA