4J95A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic k659n mutation responsible for an unclassified craniosynostosis syndrome in space group c2.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
279
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIYYKNTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 279
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j95A01
5IMXA 5D10A 4IWPA 2XP2A 4S2ZA 3HRCA 5EHOA 3HV3A 4YSJA 4O83A 4CG8A 4YPDA 3MIAA 1YW2A 3R7YA 2BAJA 5JFXA 2JFMA 4RVMA 3E92A 4PPBA 3A4PA 2W0JA 1F0QA 1OMWA 3BRBA 4PV0A 4ZP5A 4EK6A 3R7IA 3UC4A 3QHRA 4KSPA 4U6RA 4FGRA 2RFDA 5EW9A 2WTKC 3TUCA 4GFOA 4PMTA 3LJ0A 4FT0A 3ZO3A 2UZWE 1MRYA 4TWOA 4H1MA 1QL6A 5GZ9A 2R3QA 4YHJA 3KF7A 3FHRA 2CGVA 4FICA 3HX4A 3Q6WA 4RQVA 4W9XA 3KCFA 4D4SA 4H36A 1KUTA 4BCKA 4PTCA 4A06A 4NT4A 4LL5A 1RW8A 3GEQA 3TNPC 1SYKA 4MK0A 3FAAA 4CFNA 3E5AA 4AE6A 3BI6A 3EQPA 2ITVA 4G2FA 1PKGA 4E1ZA 5AP5A 5HLWA 5LVLA 4RJ5A 4CZTA 3L8PA 3NCGA 3BGQA 5BVWA 5M4UA 3KRRA 3COHA 3IKAA 2OK1A 2BUJA 1UA2A 4CFMA 3HMIA 1VEBA 2AC3A 3MTLA 5L2WA 3F2NA 4X2GA 3MN3A 2CLXA 3HNGA 4EHEA 4FVQA 3UG1A 2WMXA 4AGDA 5A4EA 4Z7HA 4IB5A 3KRJA 3IS5A 4MBLA 2GHGA 4RQKA 4TKSA 5FGKA 1OL6A 4FG9A 1PXJA 2B1PA 3I5NA 4G6NA 1PF8A 1U4DA 3HRFA 5FXRA 3GU8A 2YIXA 4EK8A 1M2PA 5D7VA 3E3BX 2QURA 3KXNA 3QTIA 2UW3A 2YDJA 2FH9A 3E8CA 3FMEA 4J96A 4BL1A 5I0BA 3KY2A 2J50A 4ZEGA 1XBBA 3FMMA 2XKDA 1H01A 4FR4A 3BPRA 4Z55A 4ZMFA 1CKPA 4KWPA 3M1SA 4TZRA 5GZAA 3LFDA 5DPVA 1UKIA 1BUHA 2VTLA 3IOPA 2BZIB 4HCTA 5AV3A 3AT4A 4JT3A 3LOKA 2JDOA 4U8ZA 2UZOA 3IONA 4P5QA 5EW8A 5CU6A 4K77A 4L52A 3VC4A 4DA5A 4O0SA 2WIPA 4YNEA 5E91A 4LI5A 2P2IA 4YZBA 4U3ZA 3VULA 4GG5A 3K5UA 5I9WA 1KE7A 3NYNA 4FV1A 2QOFA 4IFGA 5HKMA 5J9LA 3K3IA 4FEXA 5D11A 3LXPA 5A54A 4GSBA 5DG5A 5LCJA 4FSMA 5AM6A 3V5TA 4IC8A 2WO6A 4X3FB 4ZTQA 3UTOA 4DGLC 5CVFA 3PRFA 5KMKA 3GCVA 3PXQA 4KBKA 4J8MA 2OJGA 3EB0A 4F1MA 4YO4A 2XYUA 2JDTA 5KCVA 3F9NA 1W82A 4BBFA 4EJ7A 5GIOE 2QO2A 3A7IA 1JLUE 3UC3A 4CYJA 4EKLA 4O84A 3QHWA 2A19B 4IB0A 1I44A 3UVQA 2QR8A 4DITA 3KRLA 4RG0A 4NKAA 2QKRA 3D7TA 2F7EE 3HEGA 3QLFA 4DFYA 1KE5A 2UV2A 5DI1A 3F5PA 1UNGA 3PE1A 4GFMA 4QPAA 1LEWA 2UUEA 4CKRA 4KS7A 2Y8OA 3QTSA 3MFUA 3JR1A 4WG4A 4F9YA 1UKHA 2H34A 3BYMA 3MW1A 3RCJA 3N9XA 3UQCA 3FZRA 1ZLTA 3DDPA 4FKGA 3UO6A 2CN8A 4BTKA 5E4HA 4JBOA 4AOJA 4G34A 4MBJA 4ZTLA 5HG9A 5FXSA 4HVSA 1SNUA 2PMLX 4QMTA 4XG8A 3ZFXA 1XH8A 3CGFA 4AT4A 4XX9A 3H9RA 2BPMA 3NNVA 4Z16A 4MNFA 2ZV2A 5HO7A 3EFKA 4L8MA 3CJGA 2YZLA 3DK6A 5IEXA 3AQVA 4PTEA 4YTCA 3LCTA 2HW6A 4QTAA 5J5SA 2W1HA 2KULA 4AOTA 3PPKA 3QD3A 3OEFX 3QUEA 3PVBA 5T68A 4FV9A 4R8QA 2AC5A 2BRHA 4PPAA 4XV3A 3OCGA 4O7NA 4ZZNA 4X7QA 2HK5A 1KSWA 3FMJA 3SRVB 2UW7A 2R64A 2BVAA 4JJRA 2PU8A 3WF8A 3AD6A 2BCJA 1ZMWA 2WIHA 3CP9A 3PZEA 1K2PA 1H26A 2BRNA 4BCMA 3P23A 4FV0A 4U80A 4QP1A 4C36A 4C59A 4QNAA 2YJSA 4X3FC 3TL8A 2CDZA 5ITAA 4I6HA 4ASDA 3R73A 2C1AA 4BC6A 3PP0A 4AT5A 2QLQA 4KD1A 4B8LA 1PY5A 4S34A 3DBQA 4LUEA 3E87A 3Q9WA 4JRVA 4NM7A 5I9VA 4FBXA 1DM2A 2BZKB 4R5SA 5CSHA 2XBJA 3VUHA 2Z8CA 4AXAA 2XK8A 4YZDA 1PXIA 2B55A 4DTBA 3CQWA 3NX8A 5C26A 3V3VA 1ZY5A 4D55A 4AX8A 3FXZA 4M97A 1YI6A 4IAAA 4EL9A 3CBLA 5GNKA 3RKBA 4M14A 4ZJVA 4OTFA 4E4LA 3GCQA 2W1IA 3BX5A 4KRCA 4RJ4A 2ZDUA 4B99A 4QT1A 1WBPA 4IAZA 4ID7A 1O6KA 4UX9A 3ANQA 2UVXA 4Q9SA 4BWKA 4IQ6A 3DXPA 3Q3BA 3CPBA 4OTQA 3R00A 3KN5A 3EQFA 4DGOA 4QTBA 3LJ1A 4IJPA 3H10A 4ZTMA 4X0MA 1X8BA 2YIYA 2R3LA 2W5AA 3F3UA 3NIEA 5M09A 4BZOA 2HOGA 2YFXA 5AR3A 2YISA 4JOAA 3EN9A 5HVJA 3ZCLA 3HYHA 1LP4A 3HGKA 4O82A 3MB7A 3PVGA 3QGWA 3TNWA 4QYHA 4ZK5A 4AU8A 2WMAA 4IIRA 2W06A 3DXNA 3GU7A 5AM7A 4Y5QA 3MH1A 4A9SA 4BCPA 4B0GA 1G8SA 4RC4A 4D2PA 4C37A 4TYGA 2QODA 3I7BA 4ASXA 4EZ3A 3FC2A 5HCXA 4FMQA 4CLJA 1Q4LA 2QOQA 1XH7A 3Q4CA 2HXQA 5F94A 3VF9A 1U5RA 3UIMA 3FUPA 5FP5A 1E1XA 3Q53A 4K18A 4FKUA 4UWYA 4E4NA 1KOBA 5BYYA 2F49A 1SM2A 2R0UA 2RFNA 1BI7A 4PMMA 5H3QA 3G0FA 1OKWA 3IDCA 2E9UA 2W4KA 2PUPA 4DFLA 4NCTC 4F0IA 4R5YA 4RX9A 2J4ZA 2XIKA 4EHVA 5E1SA 3NZ0A 3RPSA 2ZDTA 2LAVA 4BIBA 1PMVA 2HAKA 3BYVA 3ORZA 5D12A 5C01A 2WXVA 5C4KA 4O0UA 3VHKA 3TNHA 1OUYA 3MVHA 2OLCA 1Q3DA 5JGDA 2BHHA 4G9RA 3ZZEA 4A9UA 4JIKA 4MVFA 4QYGA 2WMSA 4XEYA 3RZFA 2V7OA 4QMOA 1H28A 4FL1A 3RGFA 2F7XE 4BZDA 2YJRA 1H4LA 5CVHA 2WTJA 5I9ZA 2X7FA 4OTWA 3BBWA 2JKOA 3QA0A 4E6DA 4HVDA 3F2AA 4MD8E 1WAKA 1U5QA 5IQFA 4BDAA 3JPVA 4G31A 2E9PA 3AMBA 2IWIA 2UW9A 4I23A 4DFXE 5CX9A 4AUAA 3L9NA 3U51A 3VW6A 5HTCA 4DFUA 5HHWA 2BIYA 2ETMA 5ANGA 5HNIX 4YUQA 2Z7RA 1JKTA 3BLQA 2P33A 1JVPP 2R3JA 3ID6C 5CI7A 1KV2A 4PQNA 3BZ3A 2WOTA 4MNEA 3DKCA 3ZM4A 1G5SA 4BWPA 5FTOA 5KMMA 3GU6A 5M56A 3G33A 4FT5A 5K3YA 4S32A 3CEKA 3G6GA 4CQEA 3R71A 3O0GA 3PVUA 3L9MA 4UMPA 2XNNA 3KMWA 1VR2A 3VUTA 1STCE 4DEGA 5G1XA 4XRJA 5EI2A 4C02A 4G6LA 3LFSA 1ZMUA 3P7AA 2EUFB 2J0KA 3A7GA 3MH3A 4FOBA 5FD2A 3VS2A 3DZQA 1H1WA 4C4FA 1H27A 2ITQA 4Y8DA 2PVKA 4DH8A 2RGPA 4AP7A 5BNJA 4EOMA 3BQCA 3AXWA 4GRBA 4RX5A 4X2KA 4MKCA 4I4EA 4FE2A 1YHVA 4QP8A 4DEDA 2W5HA 4OTHA 2W9FB 4RC2A 4YPSA 1H25A 4QTCA 3TN8A 4APPA 1WVWA 4ZTHA 5JFVA 5J1WA 1Z57A 5EM6A 4JRNA 3RINA 3JS2A 4KRDA 4E5AX 2QC6A 4DBXA 1Q41A 3DNDA 4M12A 1MUOA 4R7HA 5F1ZA 5AAFA 4EC8A 4ALWA 4GUEA 4UALA 3FMLA 4W9WA 3COKA 3PJCA 2YM6A 3F3VA 5FEDA 3VJOA 3SGCA 1J7LA 3NCZA 3NPCA 4M69B 4XH6A 5AP0A 4WRSA 5HBEA 2Y9QA 4DG3E 5BYZA 4EC9A 5AX9A 5B7VA 5L2TA 3F6XA 2IVTA 4FKIA 3Q9ZA 3ET7A 3F3TA 4DEBA 4OBQA 3DDQA 4E4XA 5GZ8A 1XH9A 3NMUF 3TKIA 2V7AA 1FGKA 1KWPA 1WBVA 1QPEA 3GCPA 5CAPA 4ANQA 1H24A 3FMKA 3CY2A 4RJ6A 4R3RA 3ZM9A 2E2BA 3Q5ZA 3ACJA 3TG1A 2PVYA 3R1QA 4UMQA 4WIHA 1UNHA 2Z2WA 5C8MA 4BKZA 1MRUA 3QYWA 4DEAA 4AE9A 2YWPA 4LUDA 2PMOX 3MIYA 5DIAA 4YR8A 5TT7A 2CHLA 4C4GA 1CKJA 1M2QA 3R8VA 1FVRA 2HY81 3LW0A 4OTIA 4IX4A 5IA1A 5CT7A 5AR8A 2OXDA 3DJ7A 3PJ3A 3W2CA 5IISA 2ITTA 2X6EA 3D5WA 4IVCA 3VAPA 5CASA 3O71A 2X9EA 4DG2E 4QP7A 4D0WA 2ZB0A 5HNBA 2GMXA 3TDVA 2HYYA 2FO0A 1TVOA 4QMPA 3BHVA 2R4BA 1XQZA 4D4VA 1Y57A 1YHWA 3I79A 2R0IA 1JPAA 4ZSGA 4N57A 4KBAA 3RI1A 3LQ5A 3BBTB 2I6LA 3C4ZA 1R1WA 3EFLA 3FSKA 1PXOA 3RP9A 3VS0A 4A9TA 3OY1A 3KXXA 3UDBA 4BDJA 1XBAA 2QHMA 2RKUA 3QTZA 4HYSA 5AX3A 3ZU7A 4HVIA 2B9FA 5CEMA 2OG8A 5L8JA 3VRYA 2VTHA 4XJ0A 4NUSA 4BBMA 4FV8A 2Y0AA 3R2YA 5B2LA 3HMNA 5FRIA 3C4WA 2W05A 2Z7QA 3F66A 4FZFB 5HEZA 2O5KA 5BVNA 3UP2A 1RDQE 4YLLA 4FTJA 5IA3A 3HV4A 3PUPA 1BL6A 4G16A 1Q24A 2WD1A 3OT3A 1VYWA 1OBDA 3ORIA 4GL9A 4TNDA 2CCHA 4CMUA 4G3DA 2UW6A 2HWPA 4HCUA 3TV7A 3EZVA 2OZAA 4QQJA 1W8CA 3G5DA 3DV3A 3QZHA 3R01A 4FTMA 3RMFA 5M55A 2R3RA 2C5VA 2VX3A 2XKFA 4KAOA 5LXMA 2NO3A 3BELA 3KXMA 4JL9A 4FKOA 4FTOA 3QZGA 3MH0A 4FYNA 5JRSA 4XV9A 3WIKA 1WFCA 4APCA 2XCKA 4HGSA 4IB1A 4ACDA 3OY3A 3QKKA 2CKQA 3UOJA 1H1RA 1GY3A 4A9YA 3SRVA 2V22A 4JS8A 3TZMA 2IVUA 5BUEA 4OW8A 5IQDA 2F7ZE 4BFMA 4ZY4A 3FLQA 4RSSA 1V1KA 2OICA 4U9AA 3EOCA 2OGVA 4GH2A 4FTKA 2WTDA 4R1YA 4L6QA 5FTGA 4IHPA 4W4XA 4V0GA 1Y91A 3PY1A 3DKOA 3OWJA 4NCTA 5JKGA 1T46A 2HZ0A 3VS7A 3QTQA 4PX6A 3ZUVA 5IQAA 2ZV8A 3NUNA 4JR7A 2E9OA 3D5UA 1CTPE 1PHKA 4FL2A 3A62A 3CS9A 3FC1X 3QL8A 2I0VA 4I21A 1IAJA 2CNUA 1IEPA 4LOOA 3FI4A 4RJ7A 3KKVA 4L7FA 2YLFA 2OSCA 2C6KA 4FEQA 4NEUA 5FM3A 2Z7SA 3QX4A 2QG7A 5A46A 3ROCA 5LVNA 4J53A 1YDRE 4EOLA 3R28A 1H8FA 3FBVA 4A7CA 4DLJA 3PXZA 3GP0A 4IADA 5TR6A 5FQDC 4AN3A 4AW2A 4KKEA 4F0GA 4EH9A 3UNKA 3D7TB 4XP3A 1FQ1B 2H8HA 2A27A 4Z7GA 2B54A 3II5A 4PF4A 3CR0A 3EQBA 4TW9A 4JAJA 4LOQA 4EOPA 2XJ1A 1OM1A 2E9VA 4EOOA 3DQXA 3FZOA 3EH9A 3GI3A 2YITA 3D14A 5HGIA 3MVLA 4ANOA 3SG9A 2EWAA 2OIDA 1QPJA 4JDIA 5D1JA 4K8AA 2OO8X 2YDKA 1ERKA 1WBTA 4CV9A 5CQWA 4QMSA 3DT1A 2Y6OA 4L9IA 3VBXA 3FKNA 5AUTA 2G9XA 3C1XA 5H8GA 3WARA 4D4YA 2GFSA 3IGGA 4O0TA 4BICA 3FLZA 2B9JA 4ENXA 5L3AA 3UJGA 1J7UA 3SOCA 4O1PA 4BKJA 3T3VA 1DS5A 3L8SA 3ENHA 4FT7A 3V8WA 3OG7A 4HYHA 3H9OA 4I41A 4GU6A 4PY1A 3OXIA 4DH3A 4U5JA 5C8KA 3RBWA 3C51A 5AV2A 2JDVA 3O8PA 2WB8A 3BWJA 5ACKA 4FSZA 4HNFA 1V0BA 1UWHA 4B7TA 4ASZA 5IF1A 2ZV9A 3DGKA 2B9IA 2YDIA 5L2QA 2VTSA 3T9TA 3RVGA 5KHXA 3REPA 1U59A 2H6DA 3QTWA 3KGAA 5EKOA 4WNOA 2EXMA 3ZEPA 5KHWA 4RZWA 3R1SA 1FVVA 4O0RA 2YACA 3RNIA 2PHKA 3CTJA 2OU7A 3V5LA 4GJ2A 1REJA 3L9LA 2Q83A 1RQQA 3QD0A 5IH5A 4FSNA 2GHLA 4AZSA 4IMYA 4X2NA 3VS4A 4BKYA 4E5WA 5IQEA 2YCSA 3HZTA 4LG4A 5ANDA 2ITXA 5C03A 1FBNA 5DHJA 2FSLX 3FKLA 4CFUA 4JDHA 5AJQA 5AR7A 3EQGA 2R3GA 2BFYA 3ZRMA 3UPZA 3PZHA 1OVEA 3LFCA 4C34A 3Q52A 3WYXA 4DC2A 3WZUA 2PPQA 4DTKA 3JUHA 2VWXA 3VBVA 2Y6MA 4RVTA 2P3GX 4JBPA 3MFSA 2CN5A 3UG2A 5CAUA 2VNWA 1R0EA 3C4XA 5HIBA 3RPOA 2RG5A 5HIEA 3ZLSA 3UZTA 5DGZA 1ZMVA 4ZJJA 4XBRA 2B7AA 2BILB 2X4ZA 1YVJA 3ETAA 4QMXA 4CFFA 3IW4A 2WELA 1ZOHA 4G3GA 5AUWA 4E26A 4K6ZA 4ERKA 3BYSA 3ALOA 4PWNA 5LVMA 3PA4A 3U4UA 5F95A 4O0WA 4R7BA 4EH4A 4E4MA 3OEZA 3FL4A 1QCFA 5J95A 1XR1A 3HA6A 4HGTA 4IE9A 3CTQA 1GZOA 3W2PA 5ICPA 4I0TA 3EYHA 5LCKA 4EOQA 1ZRZA 3AGLA 3DK7A 3PE2A 1PJKA 4JQ7A 4ACGA 3R6XA 4CD0A 3OZ6A 3HDMA 2WQMA 1BX6A 3GC7A 3R9HA 3ZUUA 3ERKA 4IFCA 2G2HA 2HY0A 3QU0A 4BI2A 3MY0A 3IW7A 5IQIA 4YURA 3V04A 3V51A 3CC6A 3GU4A 2XEZA 2XEYA 4X3JA 2QR7A 3IG7A 3W8QA 3Q2MA 4EI4A 5E7RA 3NUAA 2I0EA 4X6QC 4ZSLA 3ZYAA 4NYEA 1U54B 4E6AA 3F5UA 3PJ8A 1URCA 3JVSA 4CTBA 3P0MA 4M84A 1Z9XA 3DBDA 4M69A 1WCCA 3E64A 2B9HA 2J6MA 3QQKA 4AA0A 1GZNA 3RM6A 1OIRA 5LOHA 3U55A 4OLIA 1GJOA 4O0XA 4S33A 4DGMA 3R04A 3VUMA 5BVFA 4A4LA 4QQTA 2OWBA 5GINE 3EN6A 3QF9A 2C5NA 2JAVA 2YWVA 3ZMMA 5IDPA 5J1VA 3O96A 3NUPA 4LMUA 4L3JA 4NU1A 4TT7A 5EM7A 4YLJA 2FVDA 4G6OA 5HU9A 2J5FA 3DPKA 4PL3A 4CKIA 4ZTRA 5IEVA 4DFBA 4FV3A 2WU6A 2WMQA 5EK7A 3VS5A 4GVJA 3EQCA 5DVRA 3OBGA 4J8NA 4MXOA 3HAVA 4AWIA 2J2IB 4W8DA 2QLUA 2ZYBA 2DQ7X 2J9MA 4UYNA 1OUKA 2XNPA 4MEDA 4M67A 3ZRKA 4MNEB 2PWLA 2XNEA 5H2UA 3RWQA 1Q99A 4YJTA 2JIVA 3SVVA 1FINA 4QPMA 2WEVA 5J7HA 3LVPA 1XH5A 4XCUA 4EYMA 5KNJA 3C50A 3PFQA 4X6RA 5J8IA 3MJ1A 3MY1A 3FZSA 3NNWA 2O3PA 4J97A 2YCFA 2JKKA 3EL7A 4XG6A 3OMVA 3UIUA 4FIGA 4RPVA 5C4LA 4AGCA 2F9GA 3SC1A 3D7ZA 2FA2A 2WTCA 2X0GA 3HMPA 3LFBA 3LZBA 5FTQA 3EN7A 3D0EA 5BPYA 4AFJA 3HKOA 3CKWA 5DYJA 4EH7A 3F2RA 3LCDA 4FSRA 3WZDA 4H05A 3MI9A 5E8WA 5FXQA 2XIRA 3FZTA 4CV8A 4QP2A 4F63A 3U8WA 4BDBA 4AG8A 3Q32A 4HVHA 5A4QA 2WHBA 3UIXA 3P79A 4QO9A 3C4EA 4DN5A 3BV2A 3QCQA 3QRIA 1ND4A 3PLAE 5E90A 3FDNA 2OJJA 4M0ZA 2FSMX 5B2KA 5BQ0A 2PZIA 4K33A 4CCUA 1IAHA 3EZRA 3BQRA 4IM3A 3HUBA 3OS3A 4DTAA 3W18A 3ZFMA 3NW5A 5DRBA 5IQGA 3RPVA 4BF2A 4TYJA 4NWMA 4B8MA 5FG8A 2ITYA 2UZEA 4RX8A 4GK3A 5IQBA 3UQGA 4IANA 2YAAA 4IX6A 5CF6A 3R63A 3ALNA 2XJ0A 3RZBA 2JDRA 1JNKA 3DB6A 2HZIA 3TI1A 4I6BA 4EK3A 2RFSA 1U46A 3HVCA 3LQ8A 4O2PA 4WBOA 2WPAA 1ATPE 2OI4X 1Z5MA 4FTCA 1OECA 3EQIA 4R3PA 4XRLA 3RPRA 4F08A 5FUTA 4GVAA 4I5MA 4L3PA 3EIDA 5BYLA 2JAMA 2ITPA 1P14A 3KC3A 1M17A 2XA4A 3GQIA 4CTCA 3GCUA 3MV5A 4FKLA 3AC5A 5ANEA 3G15A 4CG9A 3F82A 2CKOA 3DS6A 3POOA 5FEEA 4CNHA 4A4XA 3PA5A 1XO2B 3FI3A 4LYNA 5JRQA 3M11A 1Q5KA 1UWJA 3O8TA 3PG1A 3HL7A 3N4VA 1J3HA 2CGXA 3CTHA 2W1ZA 3MJ2A 1CSNA 5EDQA 5EH0A 2V55A 3PSCA 4I93A 4LV8A 4N0SA 2XM8A 2ITUA 2CMWA 4DT8A 3C0IA 4BTJA 2GNGA 3E88A 5HX6A 4IH8A 4FOCA 2G2FA 4UXQA 5D9HA 4QQ5A 3RK7A 4LRKA 2QD9A 4DAWA 1Y8YA 3DU8A 1TQIA 1YI3A 3W2RA 4K11A 3VN9A 3MPAA 3PG3A 4JX3A 2NRUA 5ANIA 1UVRA 2XRUA 5I3RA 2ETRA 2BDFA 1JQHA 2XNGA 2JD5A 4KIKB 4XV2A 4D58A 4D4RA 3DJ5A 1FVTA 3FLWA 4O38A 1V0PA 4FVPA 4TTHB 4HW7A 3IDBA 5AFVA 1MQ4A 3PIYA 2VGPA 3FL5A 5A4TA 2UW0A 3SA0A 4EBVA 3CXWA 2EXCX 5JFWA 2OZAB 4N6YA 3BCEA 3GC0A 4CGAA 2OFUA 3FQEA 1SVGA 2C6OA 5AADA 3PRIA 2BRBA 4FA2A 4LFIA 3S00A 4O81A 4FZAB 1EH4A 1GOLA 3LFEA 1YDSE 1Q62A 3A2CA 2I0HA 4U97A 1QMZA 4NTSA 3D4QA 4PDOA 4GYGA 4QMUA 3GGFA 5KMJA 4GEOA 3G51A 4RFYA 3PWYA 4Z3VA 3AMAA 3U9NA 3SX9A 4PP9A 5K5XA 4A9RA 2PUUA 5JFSA 4V0GB 3UP7A 4M66A 5H8BA 4O7RA 3AC4A 2YN8A 2BTRA 5EYDA 3FQHA 2DUVA 4BHZA 2WTIA 3KVWA 3OUNB 3VQUA 3LXLA 4BGQA 5AUYA 1W84A 2CGWA 2X9FA 4PPCA 4YSMA 3ZBFA 5K5NA 3S0OA 4NH1A 4O7ZA 5CALA 2HCKA 2ZMDA 3BYOA 3QFVA 4RIXA 3UZRA 3RTPA 3WYYA 2QG5A 3LCKA 4C3RA 4BTMA 2XS0A 4D9TA 5JZJA 3ODZX 2XKEA 2GS7A 3QA8A 2ITNA 2GQSA 2RFEA 5IUIA 4ZOGA 2XKCA 1IRKA 4LL0A 2ACXA 3R8MA 3RNYA 3TEIA 2R9SA 2C30A 1OIQA 4LGGA 2HIWA 4EOJA 5EYMA 3SXSA 2ITOA 3MA6A 2IO6A 2VU3A 2WKMA 4OTRA 3C4CA 2W96B 3G0EA 2DWBA 4QTEA 3FI2A 4IDTA 4W8EA 4AA5A 3R7GA 3HV6A 5ETIA 3ZSHA 4U40A 3UBDA 4CCBA 3LFAA 4WT6A 1M2RA 4M8TA 5CU0A 4EQCA 5JT2A 4FSUA 3IGOA 4BDFA 2HENA 2QU6A 3C7QA 3CY3A 3GUBA 4EBWA 3E8EA 4R3CA 4FKTA 4ITHA 4BZNA 4RVKA 3VS6A 3R2BA 4D1ZA 3TNIA 2CSNA 2R7BA 1UNLA 2SRCA 3NYVA 2IZSA 3S95A 4IZYA 2R3KA 5JQ8A 3PWDA 4IAKA 5GIPE 3ULZA 4ITJA 3ORTA 5CZHA 5LMKC 3UQFA 4UN0C 3VS3A 4FEUA 3PYYA 2IZUA 2C3IB 4G3CA 4M15A 5HX8A 2XNOA 1B39A 2VZ6A 4MH7A 4Y5HA 3KU2A 3DAKA 4FIIA 5CY3A 5CAQA 3UNZA 3FLSA 5AP4A 4AZFA 2NNWB 4L3LA 2C6DA 3THBA 3ZRLA 3V6RA 4G3EA 2BZHB 3ELJA 3OROA 3R8UA 3DKFA 3TXOA 3KA0A 2HW7A 1H1QA 1ZOGA 3ZONA 4YMJA 1U54A 3KVXA 3LCOA 2IW8A 5AA8A 5KMLA 4HCVA 4F0FA 4IACA 4ZTSA 5A9UA 3C5UA 3LLTA 4GCJA 3NW7A 4ZSEA 2RL5A 3NIZA 4BR3A 3NEWA 5AIKA 4XLVA 4RFZA 2RF9A 3GOPA 4QOXA 3TJDA 3AC8A 3AOXA 4EQUA 3KMUA 4MQ2A 4LRMA 4EQMA 4KIQA 2QCSA 1Q8WA 4BRXA 4BGHA 3DQWA 4FC0A 4O6LA 5CI6A 4B4LA 4WNKA 1KE9A 1PMNA 4CEGA 1LEZA 2BDJA 5D7AA 2PMNX 4I6QA 5KX8A 2JGZA 2YLEA 3FHIA 3VBYA 3VVHA 3DY7A 5IH4A 2R3MA 4RJ8A 2JLDA 3AG9A 4FNYA 2GPHA 3RAWA 2YIWA 3WF5A 3D5VA 5JH6A 1Q3WA 2P2HA 2VUWA 3QQHA 4FSWA 4U44A 1APME 4I24A 3SV0A 1WBNA 1J91A 5DMZA 5EHYA 3I60A 4C4HA 4Y95A 5FBNC 3WZJA 4G3FA 4DYMA 3L8XA 4IB3A 4I94A 2BRMA 5CSWA 2I0YA 2UW5A 5AP3A 3ZSIA 2BKZA 1H1PA 4FZDB 3N4UA 3UMWA 2GS6A 3ZLXA 3PDTA 5A6OA 2YM5A 3P7CA 5DR9A 5K9IA 3NDMA 3ITZA 5HG7A 4O2ZA 2GDOA 3NYOA 4YJSA 3OTUA 3H0YA 3PXRA 4PDPA 4GYIA 3TCPA 5CSPA 4FIHA 3FMHA 3KFAA 4YGAA 5GJGA 5CAVA 3OBJA 3QRKA 5ACBC 3Q2JA 1BYGA 5LWNA 5AIRA 5IKWA 4C0TA 4GU9A 3S3IA 4MXZA 2J0IA 3VQHA 2XK6A 3NRMA 5CNNA 1NA7A 1TKIA 3ZDIA 4LOPA 2X1NA 4D28A 4Q5HA 4O7YA 4IAIA 4TYIA 1XH6A 3OTVA 5CWZA 5E8XA 4F6WA 2CKEA 4KS8A 4BY9E 2J5EA 3HP5A 3I0QA 4BDKA 1OPJA 1H1SA 4O86A 2PL0A 3TUDA 1OBGA 2WQEA 5H8EA 5ANOA 4BCIA 4DH7A 2JKMA 3GU5A 2C0IA 2BRGA 3S1HA 3W8LA 4TWPA 5TOZA 4YC6A 4FTAA 2VTPA 4HZRA 5AMNA 2VTAA 3R8PA 1REKA 3TNQB 4ZS0A 3ATSA 3MESA 2PE2A 4BDGA 4BWXA 1B6CB 2ONLC 1OPKA 4UEUA 3UOLA 3FZPA 4L00A 3UVRA 4CFXA 5LMBA 5L2SA 3V8SA 3ORPA 4QMYA 5DT4A 2G1TA 4NFMA 3TZ7A 5L8LA 4J95A 3EN5A 3MSSA 3PXKA 3Q9YA 2VTIA 3E93A 4M0YA 3MPTA 4U79A 1SNXA 4KB8A 4U0IA 3EHAA 2UW4A 4FKWA 3RAIA 2F57A 4JG7A 2UZDA 4A4OA 4CZUA 3IECA 5I3OA 3ZTXA 3HA8A 4IVDA 2GTMA 2ZM1A 3E62A 4BI0A 5CT0A 4ZY5A 1TQMA 2C5XA 3Q96A 4MXCA 2WEIA 4DH1A 4EH3A 1OIYA 3BU3A 2O2UA 2VTTA 3UZPA 1UU3A 4WSQA 4C38A 2Z02A 4EJNA 3FY2A 3OWLA 3BHTA 3K3JA 5HCYA 1JSTA 2C3JA 2VAGA 3ORLA 4E5BA 3BIZA 4YJUA 4ORKA 5M53A 4AW5A 1LUFA 2WGJA 4IM0A 4QYEA 3FY0A 4IXPA 3ROYA 5ETAA 4BCHA 1H0WA 1WMKA 4CLIA 5M4FA 1HOWA 3UOKA 3MFTA 3NUYA 1YWNA 4XG3A 2XK7A 3NVMB 3Q60A 4CQGA 3UO5A 1YXVA 3PPZA 4AZTA 4TL0A 1OB3A 3BYUA 3NNUA 2ZB1A 2BMCA 3U54A 4GK4A 4GKHA 3D2IA 3UPXA 2BDWA 5L2IA 4AZVA 2ESMA 2VO7A 4KIKA 5J9YA 1YXSA 2OJ9A 2WMRA 2UVYA 4JQ8A 4I3ZA 2YEXA 5HBJA 4XMOA 4DGGA 3F88A 3GFEA 3LCSA 4XP0A 3K5VA 5B2MA 2C5YA 2VWZA 4XP2A 3NNXA 1AD5A 4PL4A 5CEKA 1S9JA 2JDSA 1R3CA 4O0VA 4YJVA 4GV1A 5A4CA 2RIOA 3CIKA 3NWWA 3QCYA 4BYJA 4FTQA 2WTVA 4AGUA 5EI6A 4JDKA 4EEVA 1MQBA 4JVGA 1OKYA 5JZNA 3SOAA 4ZLYA 3FMNA 3DBEA 1IA9A 4S31A 2OW3A 2PVJA 3LM0A 3QAME 3RM7A 3ENMA 5LMKA 2VWBA 4GIIA 3KK9A 3BU5A 4W4WA 3ZO2A 4ZLOA 4I4FA 4IX5A 4RA5A 3R9DA 3OCSA 2W5BA 4AQCA 3MTFA 3KB7A 5AA9A 4EWQA 3V01A 2J0MB 4JX7A 2FYSA 2JEDA 1OKZA 4OT5A 2XRWA 3F61A 3RK5A 3R1NA 2WFYA 2YM4A 1Y8GA 2X2KA 3OFMA 4KIOA 2VNYA 4XHKB 3DOGA 2GQRA 3ZLYA 3OP5A 2R3NA 5JGAA 1FGIA 2A0CX 4K2RA 1PW2A 4C58A 3LMIA 4IVAA 3HV5A 4O96A 5DRDA 5LARA 5BMSA 5BVOA 4C3FA 3GFWA 1PKDA 1K3AA 4HNIA 4FKRA 5KUPA 3MDYA 4GKIA 4YC3A 4BGGA 4PMPA 2DYLA 1GNGA 2WTWA 3CJFA 3EKKA 3EQHA 3NS9A 4FSQA 4AAAA 4DG0E 4OAVB 4MWIA 1FMKA 3DCVA 4F7NA 5DEWA 4I5PA 4MCVA 4WOVA 4BHNA 4IEBA 3RAHA 3VRZA 3LFNA 5HO6A 3JY9A 3GCSA 3QC9A 2QO7A 4HGEA 2WQOA 3MY5A 5IA2A 5C1QB 4FF8A 4I20A 4NM5A 2ZJWA 4KABA 4USEA 5HBHA 3H0ZA 2R3FA 3H30A 4R7IA 2C6LA 4CMOA 3OW4A 2CKPA 4NW5A 5JMSA 4GG7A 3NSZA 3UO4A 1NT2A 1PYEA 3KXZA 1A06A 2YCRA 3AGMA 4O7TA 4ACMA 5IZFA 2WOUA 3Q4ZA 4RWIA 5HO8A 3QX2A 5KE0A 5HU3A 4C62A 4H3PA 3V5WA 5KBQA 1I09A 1O6YA 4PNIA 5EQEA 2VTJA 3A7FA 3Q4UA 3QUPA 4FTUA 4L43A 4P90A 1YOJA 3QGYA 4ANLA 4FTTA 4FV7A 4GT3A 4PL5A 3F5GA 4ERWA 3R8ZA 4FZ7A 3FMDA 5TO8A 3AT3A 4ALUA 3IO7A 4O91A 3AD4A 5CAOA 3LXKA 5DT0A 3R7UA 1ZYSA 2PVMA 3BEAA 3FE3A 4DEEA 3BU6A 4BDHA 5CANA 1S9IA 2J0LA 2C4GA 4X21A 4D2WA 3KULB 3Q9XA 3QQLA 5AUXA 3VIDA 4F99A 3UOHA 3ULIA 4C4EA 5BX0A 3KEXA 4CRSA 3LHJA 3TACA 5C8NA 2BAKA 3QXOA 5CS6A 2JITA 2VTMA 4G9CA 3ZC6A 4RWLA 5EYKA 3SG8A 5BUJA 3COIA 2BZJA 4UY9A 2WMWA 4EH2A 2A4LA 2PUIA 4RIWB 1IA8A 1VJYA 5GHVA 1DAYA 2X7OA 3PIZA 4IX3A 3FJQE 1A9UA 4YTFA 2LGCA 4F6SA 2OXXA 2W1GA 4RIYB 4BCOA 2VWWA 4WUNA 2ZV7A 3VO3A 2ITZA 3R83A 4FGBA 5AAEA 3GENA 2C69A 3LPBA 3WZKA 5EQYA 2XUUA 3DZOA 1R39A 1PYXA 4RIXB 3BKBA 4TXCA 4U42A 3KL8A 2QOBA 4YZNA 5FBOA 1UU8A 4FNWA 4QMZA 2XIXA 2Q0BA 4LM5A 4W4YA 3NYXA 4QP3A 4L53A 4FEWA 3CPCA 4MQ1A 2ONLA 2OZOA 3MGYA 3QLGA 4FX3A 5DT3A 2IPXA 1JKLA 1XWSA 2GNJA 2ITWA 3AD5A 3PSDA 4M13A 4YZMA 1ZARA 3W33A 4V04A 1YOLA 1ZY4A 2O64A 1LR4A 1PMEA 4IZ5A 1YXTA 4KKGA 4QD6A 4YZ9A 4ZMEA 5CSVA 3ZLWA 5JK3A 3CGOA 2XNBA 2OIBA 3POZA 4QTDA 3EMGA 2R7IA 3GT8A 4WG3A 4TY1A 2EXEA 1GZKA 3QC4A 2I1MA 4XV1A 5IQHA 5JGBA 4LGDA 4MF0A 3C5IA 1FOTA 2EVAA 2WMVA 2UZUE 3GC8A 1KE8A 5DH3A 3G2FA 4AT3A 1AQ1A 1IG1A 4WG5A 4E8AA 5I4NA 1OL5A 3NLBA 2WAJA 2VWVA 4NKSA 5AP2A 2EB3A 4OUCA 3LLAA 2V0DA 5EQPA 2YHVA 4D5HA 3C4FA 4JR3A 3MA3A 2VO6A 3A60A 5E8TA 4WD5A 4JBQA 1DI8A 2XNMA 2VX1A 3T9IA 5FDPA 4F7SA 4GFGA 2R3IA 3EQRA 3P08A 4WNPA 3LMHA 4HZSA 4N4SA 1OL2A 4PNKA 4H39A 2XK3A 3HMOA 4BBEA 2W9ZB 4S30A 4NJDA 4RLKA 4C61A 5M51A 2PUNA 2C0OA 2PVHA 4CYIA 5GJFA 3ZDUA 2C3LA 2AUHA 3OC1A 4IM2A 5HG8A 3KMMA 3OHTA 2C6EA 3F69A 1WVYA 1ZYLA 4FT9A 3DBFA 5HTBA 2GU8A 5HCZA 4C7TA 3ZBXA 5AV4A 4F70A 2QNJA 2R5TA 3K54A 4IC7A 4UB7A 4TWCA 5DLSA 4C8BA 2HELA 3QTUA 5CF8A 2UZNA 5M07A 4MAOA 3FPMA 3OCBA 5B0XA 3RHXA 4GK2A 1W7HA 2GFCA 3B2WA 5CU3A 3NUSA 3R0TA 1J1CA 5CU2A 4OTPA 5C9CA 3W1FA 3A99A 3DLSA 3GVUA 3OCTA 3BE9A 3R22A 4RA4A 2ZMCA 3R7OA 3LQ3A 4BIDA 3OW3A 4MD9E 4YBJA 3L9PA 3P78A 3R21A 5CVGA 5DOSA 1BMKA 5DN3A 4ZSAA 5IG1A 3NVKI 1LPUA 4ZSJA 1CMKE 4QQCA 2PK9A 4XOYA 5HTIA 2QQ7A 5K4JA 3R9OA 2XIZA 1H07A 4QP6A 4MHAA 2B53A 1CDKA 1VYZA 1JKSA 2X7GA 3A4OX 2XIYA 5GJDA 4NZWB 3QWJA 3WIGA 2ZM3A 3AC3A 1YDTE 4EH8A 4BTFA 1JAMA 2YAKA 4MXAA 3BHHA 4RX7A 3P7BA 4WHZA 2C1BA 4BVUA 5HE1A 3WF6A 3I81A 3OXZA 4MF1A 3WF9A 2BKKA 4CRLA 3JY0A 4H1JA 1GZ8A 3W10A 3F7WA 4LGHA 1Y6AA 2P55A 4O7SA 5AP7A 3QZIA 5AR2A 4L7SA 4D2RA 4ZS4A 4RBLA 1JKKA 4RFMA 3LE6A 1IR3A 4YTIA 5LJJA 3ZZWA 2PTKA 2X81A 4RJ3A 4TYHB 1XBCA 4Y46A 5DFPA 5EI8A 4XS2A 5F20A 4AN9A 3ATTA 1YXXA 3BWFA 3TKHA 2OH4A 3AC1A 4DGNA 4F6UA 5J5TA 2G15A 3P4KA 4HYUA 4KSQA 4RZVA 2F2UA 2W4OA 4IWDA 2E9NA 2GS2A 2WZJA 5EYCA 2PZRA 2FB8A 2J7TA 4ZAUA 4JDJA 5KMNA 3QALE 5HI2A 3U87A 5TF9A 5M06A 3PXYA 3VNTA 3KRWA 5HLPA 3FV8A 3AT2A 4J52A 1NVRA 2I7QA 3KREA 1CKIA 1BL7A 1PMUA 4TRLA 4UZDA 3R7VA 4U7ZA 4AZWA 2ERZE 2J51A 4M3QA 5HE3A 5HE0A 4ARKA 4F9BA 5IA4A 3HMMA 3C9WA 2W99B 5DNRA 2XVDA 3MB6A 3QXPA 2JFLA 4D2SA 2G2IA 3H9FA 4HGLA 1KOAA 1YQJA 2C6IA 5CF5A 2CNVA 2GNFA 1UV5A 4QYFA 4XG2A 4O7VA 5BVDA 2GSFA 2R3OA 4ALVA 2W1FA 5AP6A 3FZ1A 1YI4A 3I6UA 5CZIA 4ASEA 4KBCA 1OGUA 4B6LA 3ZEWA 4XG9A 3WBLA 4G17A 4EHGA 4IW0A 3ORXA 3DK3A 3TZ8A 1NVQA 2PY3A 1DAWA 1NW1A 2VWUA 4ONAA 3SQQA 4R77A 4G5PA 4OR5A 2GNIA 3MVMA 3OOGA 3VWAA 2JKQA 2PE1A 2X6DA 4N70A 4QMLA 4Y83A 5F9EA 4EYJA 1AGWA 4F64A 5CXHA 2Z60A 3IW5A 4E73A 5EDPA 4L68A 4OTDA 4RWKA 1NXKA 3TV4A 5HG5A 3CLYA 1SVEA 4BYIA 2WU7A 4NM0A 2IN6A 4UWCA 3E63A 2VGOA 4E20A 4O27B 3ZXZA 3UODA 4IZ7A 4C4IA 4D0XA 2C6TA 1XHAA 3UNJA 3SXRA 2Y7JA 4FKPA 4IAYA 4AW0A 2X8DA 4WKQA 3ZXTA 4FTIA 3G6HA 3BLHA 5HESA 3V5JA 5DE2A 5H9BA 1J7IA 4NIFB 3DAEA 2WNTA 4UMUA 4YP8A 2NPQA 2PULA 4OT6A 3DA6A 3KK8A 3R7EA 5M08A 1M7QA 2A2AA 2XBAA 3EQDA 3MS9A 5L6OA 4EHZA 3VBWA 3KXHA 3HAMA 4OBOA 2PZ5A 4KA3A 5EM8A 2WMBA 5BVEA 3RCDA 3S2PA 1YHSA 3ZO4A 4AGWA 4NFNA 4FT3A 5IEYA 5DBXA 3NUUA 4HVGA 3FQSA 5HOAA 4AACA 3O51A 1ZWSA 1H00A 3QWKA 3U6JA 3P5KA 3QD4A 3SDJA 3H3CA 1K9AA 4PRJA 3UYSA 4XNEA 5E8SA 2UVZA 3TUBA 4YZCA 2H9VA 3KULA 4YO6A 4ZY6A 4JG6A 5AEPA 2I40A 4MTAA 2B4SB 4ZLZA 3JVRA 4YJPA 5ETFA 5IMEA 2J0JA 3V5QA 3VUGA 1W0XC 5AUVA 1KV1A 4II5A 2F4JA 2IJMA 4O1OA 1ZAOA 4JLCA 2VTRA 3PTGA 4LV5A 5IUHA 3P86A 1SMHA 4EK4A 4RIWA 1JSUA 3H4JA 5EG3A 3RHKA 2X4FA 3BHUA 2EB2A 2GCDA 3WOWA 4F9CA 3BLRA 4ITIA 4BCJA 3PJ1A 4X2JA 4FUXA 1YRPA 4RIYA 4YTHA 4ANBA 4C4JA 4FZ6A 4ZZOA 3FXXA 2VWIA 3BEGA 3C0HA 2ZOQA 4N6ZA 4NJ3A 1OZ1A 3VBQA 4BDEA 4C2WA 3Q6UA 3TWJA 4Y85A 2CGUA 3QTXA 4J1RA 5D41A 4K0YA 3EN4A 4XYFA 4BDCA 5L6WL 3RWPA 2C6MA 4X2FA 3Q4TA 2CLQA 2BROA 3PJ2A 4C33A 4EKKA 3LAUA 4F09A 3OT8A 1P5EA 3E7OA 2GTNA 1PRYA 3FPQA 4OBPA 3QUDA 5CNOA 2BAQA 4KIPA 2OH0E 1OL7A 4TPTA 4BCGA 4FEVA 2R3PA 4A07A 2UZBA 3B8QA 3E8NA 5AR4A 3MFRA 4I6FA 4F1TA 2FSOX 4I0RA 4RRVA 1R78A 3DTCA 1YOMA 2CPKE 4CKJA 1L3RE 3OWPA 4AFEA 3ACKA 3ZH8A 1NVSA 3P9JA 3ZOSA 1VZOA 4IBMA 1QPCA 1ZYCA 3Q04A 2HZNA 4TNBA 1ZYDA 4F9WA 4DLIA 4EZ7A 4AOIA 3FEGA 5IDNA 3QZFA 3TZ9A 5KMIA 3U6IA 4CVAA 4FL3A 4L01A 4DEIA 4MXXA 5CXZA 4UXLA 4BCFA 2WQBA 4C3PA 3I4BA 5A3XA 4EK5A 3BE2A 4YC8A 3M2WA 1JWHA 4FV6A 4GW8A 4EUUA 4I5CA 5BVKA 5E8UA 4ANSA 5BUIA 3PSBA 3O17A 2X2MA 4TYEA 4ZIMA 4MBIA 2ZVAA 3B8RA 3MVJA 5CENA 2W17A 2OFVA 3LFQA 1GAGA 4IAFA 3WE4A 3DAJA 3I1AA 3HLLA 3FYJX 3A8WA 3LM5A 3OF0A 4WSYA 4GJ3A 3KN6A 3TJCA 3FXWA 3O2MA 4Q2AA 4BI1A 1OPLA 4FVRA 3BGPA 2XM9A 2QKWB 3ZS5A 1PXNA 1XKKA 3E3PA 3OWKA 3PY3A 4F7LA 3D15A 2O65A 4XOZA 5EDRA 2RG6A 3GB2A 4BIEA 3DNEA 4P2KA 4QPSA 5TE0A 2W7XA 2OXYA 4NW6A 3T8OA 3QYZA 4M7IA 4RGJA 4KNBA 5HE2A 4TN6A 4L67A 3QCSA 4QYYA 3IK3A 2AYPA 1BKXA 2GQGA 1NY3A 2IVSA 2QI8A 2XYNA 3D2KA 5FDXA 1PXLA 4Y72A 2QOKA 4JAIA 2B0QA 3WI6A 2HXLA 2X8EA 4QMNA 1PXMA 4QMQA 2JIUA 5J79A 4R6VA 4CMTA 2OF2A 4Q5EA 3IPHA 3A7HA 3MWUA 4L45A 3ZO1A 5K0XA 2PVRA 2YABA 4WO5A 4KKHA 3FSFA 3U6HA 4ACCA 3SD0A 4FG8A 4XLIA 3ANRA 3SAYA 3G9LX 4GIHA 3I5ZA 3L1SA 2VN9A 5CEPA 2ZAZA 4HYIA 4FYOA 1Q8UA 2FGIA 3ZSGA 4C57A 4DH5A 2C3KA 2J90A 1OI9A 1G3NA 2PVLA 3EWHA 3O23A 3PA3A 4GT5A 4FTNA 2CJMA 4TYHA 5KKRB 4MWHA 4BDIA 4GS6A 2VO0A 5HLNA 3QKLA 1V0OA 2O8YA 3F3ZA 2W1DA 2A1AB 3IOKA 4FSTA 5AAGA 2QONA 4WBBB 3RPYA 3SKCA 4AN2A 3GOKA 2JC6A 3NAYA 3D5XA 4D9UA 5F4NA 1Q97A 4H58A 2PZPA 3EFWA 3TV6A 4ANNA 2VTNA 4BB4A 5FEQA 3CSVA 5KZ0A 4DFZE 3C0GA 5J9ZA 1W98A 4YJOA 2YERA 2Z7LA 4CFWA 2QO9A 2YIQA 2HWOA 3UGCA 5DA3A 3QQJA 5C27A 3R9NA 5EFQA 2EU9A 2W1CA 2BR1A 2V5QA 3F5XA 4FK6A 2XH5A 3PXFA 1SZMA 4JQEA 4QRCA 3W2OA 2O63A 3ODYX 1PXKA 3GQLA 3IW6A 4KUJA 4JG8A 3NR9A 4H3QA 3DXQA 1FPUA 3AC2A 4ENYA 3HUCA 3U9CA 4BDDA 4AS0A 2R3HA 4FODA 5T6KA 2V62A 4J7BA 4U3YA 3HV7A 4NK9A 1F3MC 1UU9A 4D5KA 3V5PA 2PMIA 2W4JA 5E92A 3PVWA 3ZHPC 2PE0A 3NW6A 2NRYA 1J1BA 1JOWB 2C68A 2FUMA 5K0KA 4H3BA 1YWVA 3D83A 4CSVA 1WVXA 3VW8A 2VRXA 3NAXA 5DWRA 3WZEA 4AA4A 3FWQA 3LKMA 3HDNA 4NSTA 1O9UA 3T3UA 3WF7A 4W4VA 3B2TA 2PVFA 1M52A 4EZ5A 3O8UA 2Q0NA 4YU2A 2IW6A 1ZOEA 2OJIA 4V01A 3VUIA 5LVPA 3EFJA 3PPJA 3W2QA 4NL0A 3DLZA 4RMZA 4O21A 3E8DA 3VBTA 4JIAA 4JXFA 4ZJIA 3BGZA 4PDSA 5E9EA 5KKRC 2XK9A 5J7BA 5AV1A 1KE6A 3EJ1A 3FLNC 4FNZA 3JYAA 4O6EA 4RIOA 3LJ2A 3RALA 3O50A 3V6SA 3NGAA 4X3FA 3TIYA 4IZAA 4FV2A 5A6NA 4USFA 3WILA 2YM8A 3MYGA 4QMWA 4D1XA 5DEYA 2UZTA 1E1VA 1GIHA 3QQUA 4NIFA 2C5OA 4QMVA 2FSTX 3SLSA 2QVSE 4DBNA 5A4LA 1Y6BA 4PUZA 3KQ7A 3A7JA 4J71A 3A8XA 4YNOA 3TTJA 5EOLA 4CT1A 3CKXA 2QOOA 3QBNA 5CQUA 1R0PA 1WBSA 3COMA 3D94A 4MD7E 5L6PA 4CT2A 2ETKA 5CEQA 2B52A 4FV5A 4I5HA 4WUAA 2IW9A 4R78A 3O7LB 1JSVA 2R2PA 2OIQA 2PVNA 2XB7A 5A14A 3BHYA 1GIJA 1MRVA 2DS1A 4YJNA 3ORMA 4ZZMA 3L8VA 2VO3A 3MBLA 1ZYJA 1O6LA 4QNYA 2PZYA 3W2SA 4E3CA 4FNXA 3R1YA 4E7WA 4OAUC 5JEBA 3EL8A 2VD5A 5LWMA 4R1VA 4TWNA 1IASA 4DFNA 3FLYA 4FV4A 2BTSA 4IWQA 2UW8A 3LIJA 4YJQA 4UV0A 2BHEA 5CLPA 4XG4A 4B9DA 3QKMA 3FYKX 4E6QA 5EHLA 2VTQA 3KCKA 5IA0A 1G8AA 2YM3A 4RT7A 4GT4A 3DKGA 4FK3A 1ZZLA 3SHEA 2Y4IB 3VF8A 5ANJA 4YJRA 3RAKA 3DB8A 1F5QA 3R02A 3TTIA 2XZSA 2OF4A 4Z9LA 1OL1A 3W55A 4D1SA 4L42A 4FG7A 4ZXTA 4FKSA 1P2AA 4XUFA 5E1EA 5K4IA 4GUBA 5LMAA 5TKDA 4UZHA 4DCAA 2BALA 2WMTA 4Y73A 3ZUTA 2VV9A 1Q61A 5IH6A 1YKRA 4UWBA 4ANMA 3P1AA 3VJNA 1BI8A 3QQGA 3TT0A 5EW3A 5HNGA 1PXPA 4D2TA 4EWHA 3N51A 4IVBA 4DE4A 3HRBA 1FMOE 3VS1A 4BCQA 3DJ6A 4PMSA 5I9YA 2QOLA 2W1EA 3F3WA 2YZAA 3CD3A 3CQUA 3OUKA 3R30A 4UBAA 3I7CA 2QHNA 1MP8A 3ORKA 3IQ7A 3RJCA 1SVHA 3R9RA 1JBPE 4EUTA 3NUXA 4F65A 4RLLA 5M4CA 2VWYA 4C2VA 4EORA 4P4CA 5JN2A 1CM8A 3TIZA 4EH6A 4CZYB 1T45A 3O7LD 3DFCB 4FIFA 5JQ5A 2IZTA 2X39A 3SW7A 5LVOA 5HICA 1ZZ2A 4K9YA 4O7LA 2UZVA 2P0CA 1WZYA 2QOHA 4F7JA 5FM2A 5HD4A 4DEHA 5ETCA 3QCXA 2GNLA 3Q5IA 4P5ZA 4BCNA 3DFAA 4XBUA 5AUUA 1DI9A 4HPUE 3I0OA 4L46A 2GHMA 4BN1A 1GIIA 2OJFE 1OKVA 4MYGA 5E8YA 3TKUA 3PY0A 3W16A 5HVKA 4YBKA 5AUZA 1L8TA 3DBCA 2PSQA 2CNQA 5G6VA 3QRTA 4FTLA 3CE3A 3UYTA 3N4TA 5KBRA 4O7WA 3BV3A 3D9VA 2UZLA 4OTGA 4E6CA 3OXTA 4FI1A 3DTWA 4KINA 2C0TA 3QRUA 4G1WA 1B38A 5M44A 2PYWA 5HZNA 5CEIA 3GC9A 5BMMA 3S4QA 4M68A 2Y4IC 5J87A 3F7ZA 3GBZA 4WA9A 3JXWA 1Q8YA 2HZ4A 3KF4A 3OD6X 2CCIA 5DR6A 2P4IA 3CCNA 3QQFA 4L44A 5T3QA 5LQFA 4RC3A 3PIXA 2XJ2A 3HECA 4CFVA 3HP2A 4FKJA 3M42A 5DR2A 4YLKA 5CYIA 3E7VA 4USDA 4G5JA 4V05A 3KXGA 5IA5A 2OKRA 4I1ZA 3UIBA 3R8LA 4DCEA 4HOKA 4JNWA 4QMMA 5EOBA 4DF3A 2REIA 1YWRA 3FKOA 2VX0A 2ERKA 4HJOA 2WQNA 5L8KA 4UMTA 5CF4A 3AMYA 5HVYA 3OVVA 2IG7A 4PP7A 3K2LA 3G90X 4FKVA 5HORA 4LRJA 1HCKA 3G9NA 1URWA 4AZEA 3LFFA 2YIRA 4F9AA 1HCLA 1M14A 4RWJA 4Q9ZA 4O22A 1QPDA 5CTPA 3VUKA 4WRGA 4AW1A 1OIUA 4EONA 1OITA 1WBOA 1XH4A 3I6WA 5E8ZA 3CD8A 5CU4A 2Y4PA 3QD2B 1A48A 4WNMA 1P4FA 1ZXEA 2BIKB 3MPMA 3UVPA 2GNHA 1BLXA 1RE8A 2WMUA 4PTGA 4C35A 5FWKK 3UMXA 5I5ZA 5IU2A 5KMOA 4E93A 5HD7A 5M4IA 2VTOA 3EYGA 3ORNA 4NTTA 3U4WA 4D2VA 1Q8TA 4FIJA 4U41A 4J98A 1RJBA 3LXNA 5I9UA 4I22A 5IUGA 4JI9A 4F1OA 2YM7A 2ZM4A 4DINA 2RSVA 3UE4A 4I0SA 4U43A 2C47A 3ZFYA 5FP6A 3ZC5A 2G01A 3QTRA 4NM3A 4UYAA 4CXAA 3IW8A 4FUYA 5L4QA 4IWOA 4MXYA 4LQMA 5M57A 1UU7A 1YXUA 2H96A 4F4PA 5HQ0A 2WTKB 1P4OA 5CEOA 5IQCA 5AWMA 4U81A 2XMYA 5ANKA 2NP8A 3WE8A 4PDYA 5I9XA 2QU5A 3OOMA 1TQPA 1WBWA 4K1BA 3V8TA 2YCQA 3C13A 4OGRA 2OBJA 4DT9A 1H0VA 4FSYA 1H08A 4IDVA 4JBVA 5EM5A 2O0UA 5HIDA 3PP1A 4XG7A 2IVVA 5CSXA 3W32A 4EOIA 3RK9A 3VUDA 4J99A 4ZTNA 2IZRA 5AP1A 2QOIA 1XJDA 4I92A 4P7EA 3SXFA 4EOKA 4EH5A 3TM0A 4GMYA 5AR5A 3TDWA 3QRJA 4U45A 3FI8A 4FTRA 4HPTE 4YHFA 4EOSA 3KRXA 4DHFA 2BFXA 4QP4A 3MH2A 2KTYA 2X2LA 5FLFA 2YA9A 5E8VA 5KO1A 4O0YA 4RVLA 4FIEA 4ACHA 3CQEA 4MX9A 3PLSA 3VHEA 3EKNA 4LMNA 4YHTA 5EKNA 5AV0A 4IJ9A 3SW4A 2XCHA 3IDPA 5JSMA 1E9HA 2XF0A 3LMGA 3GNIB 2F2CB 2JBOA 2XK4A 2X8IA 2JIIA 3GXLA 4FKQA 5IPJA 4QP9A 2JBPA 3A61A 2QOCA 4AF3A 1Q8ZA 1M7NA 4UMRA 1W83A 5KZIA
chains in the Genus database with same CATH superfamily
5IMXA 4O4CA 5D10A 4IWPA 2XP2A 4S2ZA 3HRCA 5EHOA 3HV3A 4YSJA 4O83A 4CG8A 4YPDA 3MIAA 1YW2A 3R7YA 2BAJA 5JFXA 2JFMA 4RVMA 3E92A 4PPBA 3A4PA 2W0JA 1F0QA 1OMWA 3BRBA 4PV0A 4ZP5A 4EK6A 3R7IA 3UC4A 3QHRA 4KSPA 4U6RA 4FGRA 2RFDA 3W0NA 5EW9A 2WTKC 3TUCA 4GFOA 4PMTA 3LJ0A 4FT0A 3ZO3A 2UZWE 1MRYA 4TWOA 4H1MA 1QL6A 5GZ9A 2R3QA 4YHJA 3KF7A 3FHRA 2CGVA 4FICA 3HX4A 3Q6WA 4RQVA 4W9XA 3KCFA 4D4SA 4H36A 1KUTA 4BCKA 4PTCA 4A06A 4NT4A 4LL5A 1RW8A 3GEQA 3TNPC 1SYKA 4MK0A 3FAAA 4CFNA 3E5AA 4AE6A 3BI6A 3EQPA 2ITVA 4G2FA 1PKGA 4E1ZA 5AP5A 5HLWA 5LVLA 4RJ5A 4CZTA 3L8PA 3NCGA 3BGQA 5BVWA 5M4UA 3KRRA 3COHA 3IKAA 2OK1A 2BUJA 3BLAA 1UA2A 4CFMA 3HMIA 1G8JA 1VEBA 2AC3A 3MTLA 5L2WA 3F2NA 4X2GA 3MN3A 2CLXA 3HNGA 4EHEA 4FVQA 3UG1A 2WMXA 4AGDA 5A4EA 4Z7HA 4IB5A 3KRJA 3IS5A 4MBLA 2GHGA 4RQKA 4TKSA 5FGKA 1OL6A 4FG9A 1PXJA 2B1PA 3I5NA 4G6NA 1PF8A 1U4DA 3HRFA 5FXRA 3GU8A 2YIXA 4EK8A 1M2PA 5D7VA 3E3BX 2QURA 3KXNA 3QTIA 2UW3A 2YDJA 2FH9A 3E8CA 3FMEA 4J96A 4BL1A 5I0BA 3KY2A 2J50A 4ZEGA 1XBBA 3FMMA 3NFGB 2A98A 2XKDA 1H01A 4FR4A 3BPRA 4Z55A 4ZMFA 1CKPA 4KWPA 3M1SA 4TZRA 5GZAA 3LFDA 5DPVA 1UKIA 1BUHA 2VTLA 3IOPA 2BZIB 4HCTA 5AV3A 3AT4A 4JT3A 3LOKA 2JDOA 4U8ZA 2UZOA 3IONA 4P5QA 5EW8A 5CU6A 4K77A 4L52A 3VC4A 4DA5A 4O0SA 2WIPA 4YNEA 5E91A 4LI5A 2P2IA 4YZBA 4U3ZA 3VULA 4GG5A 3K5UA 5I9WA 1KE7A 3NYNA 4FV1A 2QOFA 4IFGA 5HKMA 5J9LA 3K3IA 4FEXA 5D11A 3W0RA 3LXPA 5A54A 4GSBA 5DG5A 5LCJA 4FSMA 5AM6A 3V5TA 4IC8A 2WO6A 4X3FB 4ZTQA 3UTOA 4DGLC 5CVFA 3PRFA 5KMKA 3GCVA 3PXQA 4KBKA 4J8MA 2OJGA 3EB0A 4F1MA 4YO4A 2XYUA 2JDTA 5KCVA 3F9NA 1W82A 4BBFA 4EJ7A 5GIOE 2QO2A 3A7IA 4AXEA 1JLUE 3UC3A 4CYJA 4EKLA 4O84A 3QHWA 2A19B 4IB0A 1I44A 3UVQA 2QR8A 4DITA 3KRLA 4RG0A 4NKAA 2QKRA 3D7TA 2F7EE 3HEGA 3QLFA 4DFYA 1KE5A 2UV2A 5DI1A 3F5PA 1UNGA 3PE1A 4GFMA 4QPAA 1LEWA 2UUEA 4CKRA 4KS7A 2Y8OA 3QTSA 3MFUA 3JR1A 4WG4A 4F9YA 1UKHA 2H34A 3BYMA 3MW1A 3RCJA 3N9XA 3UQCA 3FZRA 1ZLTA 3DDPA 4FKGA 3UO6A 2CN8A 4BTKA 5E4HA 4JBOA 4AOJA 4G34A 4MBJA 4ZTLA 5HG9A 5FXSA 4HVSA 1SNUA 2PMLX 4QMTA 4XG8A 3ZFXA 1XH8A 3CGFA 4AT4A 3TMOA 4XX9A 3H9RA 2BPMA 3NNVA 4Z16A 4MNFA 2ZV2A 5HO7A 3EFKA 4L8MA 3CJGA 2YZLA 3DK6A 5IEXA 3AQVA 4PTEA 4YTCA 3LCTA 2HW6A 4QTAA 5J5SA 2W1HA 2KULA 3AKKA 4AOTA 3PPKA 3QD3A 3OEFX 3QUEA 3PVBA 5T68A 4FV9A 4R8QA 2AC5A 2BRHA 4PPAA 4XV3A 3OCGA 4O7NA 4ZZNA 4X7QA 2HK5A 1KSWA 3FMJA 3SRVB 2UW7A 2R64A 2BVAA 4JJRA 2PU8A 3WF8A 3AD6A 2BCJA 1ZMWA 2WIHA 3CP9A 3PZEA 1K2PA 1H26A 2BRNA 4BCMA 3P23A 4FV0A 4U80A 1ST0A 4QP1A 4C36A 4C59A 4QNAA 2YJSA 4X3FC 3TL8A 2CDZA 5ITAA 4I6HA 4ASDA 3R73A 2C1AA 4BC6A 3PP0A 4AT5A 2QLQA 4KD1A 4B8LA 1PY5A 4S34A 3DBQA 4LUEA 3E87A 3Q9WA 4JRVA 4NM7A 5I9VA 4FBXA 1DM2A 2BZKB 4R5SA 5CSHA 2XBJA 3VUHA 2Z8CA 4AXAA 2XK8A 4YZDA 1PXIA 2B55A 4DTBA 3CQWA 3NX8A 5C26A 3V3VA 1ZY5A 4D55A 4AX8A 3FXZA 4M97A 1YI6A 4IAAA 4EL9A 3CBLA 5GNKA 3RKBA 4M14A 4ZJVA 4OTFA 4E4LA 3GCQA 2W1IA 3BX5A 4KRCA 4RJ4A 2ZDUA 4B99A 4QT1A 1WBPA 4IAZA 4ID7A 1O6KA 4UX9A 3ANQA 2UVXA 4Q9SA 4BWKA 4IQ6A 3DXPA 3Q3BA 3CPBA 4OTQA 3R00A 3KN5A 3EQFA 4DGOA 4QTBA 3LJ1A 4IJPA 3H10A 4ZTMA 4X0MA 1X8BA 2YIYA 2R3LA 2W5AA 3F3UA 3NIEA 5M09A 4BZOA 2HOGA 2YFXA 5AR3A 2YISA 4JOAA 3EN9A 5HVJA 3ZCLA 3HYHA 1LP4A 3HGKA 4O82A 3MB7A 3PVGA 3QGWA 3TNWA 4QYHA 4ZK5A 4AU8A 2WMAA 4IIRA 2W06A 3DXNA 3GU7A 5AM7A 4Y5QA 3MH1A 4A9SA 4BCPA 4B0GA 1G8SA 4RC4A 4D2PA 4C37A 4TYGA 2QODA 3I7BA 4ASXA 4EZ3A 3FC2A 5HCXA 4FMQA 4CLJA 1Q4LA 2QOQA 1XH7A 3Q4CA 2HXQA 5F94A 3VF9A 1U5RA 3UIMA 4QDEA 3FUPA 5FP5A 1E1XA 3Q53A 4K18A 4FKUA 4UWYA 4E4NA 1KOBA 5BYYA 2F49A 1SM2A 2R0UA 2RFNA 1BI7A 4PMMA 5H3QA 3G0FA 2X0PA 1OKWA 3IDCA 2E9UA 2W4KA 2PUPA 4DFLA 4NCTC 4F0IA 4R5YA 4RX9A 4AXCA 2J4ZA 2XIKA 4EHVA 5E1SA 3NZ0A 3RPSA 2ZDTA 2LAVA 4BIBA 1PMVA 2HAKA 3BYVA 3ORZA 5D12A 5C01A 2WXVA 5C4KA 4O0UA 3VHKA 3TNHA 1OUYA 3MVHA 2OLCA 1Q3DA 5JGDA 2BHHA 4G9RA 3ZZEA 4A9UA 4JIKA 4MVFA 4QYGA 2WMSA 4XEYA 3RZFA 2V7OA 4QMOA 1H28A 4FL1A 3RGFA 2F7XE 4BZDA 2YJRA 1H4LA 5CVHA 2WTJA 5I9ZA 2X7FA 4OTWA 3BBWA 2JKOA 3QA0A 4E6DA 4HVDA 3F2AA 4MD8E 1WAKA 1U5QA 5IQFA 4BDAA 3JPVA 4G31A 2E9PA 3AMBA 2IWIA 2UW9A 4I23A 4DFXE 5CX9A 4AUAA 3L9NA 3U51A 3VW6A 5HTCA 4DFUA 5HHWA 2BIYA 2ETMA 5ANGA 5HNIX 4YUQA 2Z7RA 1JKTA 3BLQA 2P33A 1JVPP 2R3JA 3ID6C 5CI7A 1KV2A 4PQNA 3BZ3A 2WOTA 4MNEA 3DKCA 3ZM4A 1G5SA 4BWPA 5FTOA 5KMMA 3GU6A 5M56A 3AKLA 3G33A 4FT5A 5K3YA 4S32A 3CEKA 3G6GA 4CQEA 3R71A 3O0GA 3PVUA 3L9MA 4UMPA 2XNNA 3KMWA 1VR2A 3VUTA 1STCE 4DEGA 5G1XA 4XRJA 5EI2A 4C02A 4G6LA 3LFSA 1ZMUA 3P7AA 2EUFB 2J0KA 3A7GA 3MH3A 4FOBA 5FD2A 3VS2A 3DZQA 1H1WA 4C4FA 1H27A 2ITQA 4Y8DA 2PVKA 4DH8A 2RGPA 4AP7A 5BNJA 4EOMA 3BQCA 3AXWA 4GRBA 4RX5A 4X2KA 4MKCA 4I4EA 4FE2A 1YHVA 4QP8A 4DEDA 2W5HA 4OTHA 2W9FB 4RC2A 4YPSA 1H25A 4QTCA 3TN8A 4APPA 1WVWA 4ZTHA 5JFVA 5J1WA 1Z57A 5EM6A 4JRNA 3RINA 3JS2A 4KRDA 4O4DA 4E5AX 2QC6A 4DBXA 1W2CA 1Q41A 3DNDA 4M12A 1MUOA 4R7HA 5F1ZA 5AAFA 4EC8A 4ALWA 4GUEA 4UALA 3FMLA 4W9WA 3COKA 3PJCA 2YM6A 3F3VA 5FEDA 3VJOA 3SGCA 1J7LA 3NCZA 3NPCA 4M69B 4XH6A 5AP0A 4WRSA 5HBEA 2Y9QA 4DG3E 5BYZA 4EC9A 5AX9A 5B7VA 5L2TA 3F6XA 2IVTA 4FKIA 3Q9ZA 3ET7A 3F3TA 4DEBA 4OBQA 3DDQA 4E4XA 5GZ8A 1XH9A 3NMUF 3TKIA 2V7AA 1FGKA 1KWPA 1WBVA 1QPEA 3GCPA 5CAPA 4ANQA 1H24A 3FMKA 3CY2A 4RJ6A 4R3RA 3ZM9A 2E2BA 3Q5ZA 3ACJA 3TG1A 2PVYA 3R1QA 4UMQA 4WIHA 1UNHA 2Z2WA 5C8MA 4BKZA 1MRUA 3QYWA 4DEAA 4AE9A 2YWPA 4LUDA 2PMOX 3MIYA 5DIAA 4YR8A 5TT7A 2CHLA 4C4GA 1CKJA 1M2QA 3R8VA 1FVRA 2HY81 3LW0A 4OTIA 4IX4A 5IA1A 5CT7A 5AR8A 2OXDA 3DJ7A 3PJ3A 3W2CA 5IISA 2ITTA 2X6EA 3D5WA 4IVCA 3VAPA 5CASA 3O71A 2X9EA 4DG2E 4QP7A 4D0WA 2ZB0A 5HNBA 2GMXA 3TDVA 2HYYA 2FO0A 1TVOA 4QMPA 3BHVA 2R4BA 1XQZA 4D4VA 1Y57A 1YHWA 3I79A 2R0IA 1JPAA 4ZSGA 4N57A 4KBAA 3RI1A 3LQ5A 3BBTB 2I6LA 3C4ZA 1R1WA 3EFLA 3FSKA 1PXOA 3RP9A 3VS0A 4A9TA 4DDIA 3OY1A 3KXXA 3UDBA 4BDJA 1XBAA 2XARA 2QHMA 2RKUA 3QTZA 4HYSA 5AX3A 3ZU7A 4HVIA 2B9FA 5CEMA 2OG8A 5L8JA 3VRYA 2VTHA 4XJ0A 4NUSA 4BBMA 4FV8A 2Y0AA 3R2YA 5B2LA 3HMNA 5FRIA 3C4WA 2W05A 2Z7QA 3F66A 4FZFB 5HEZA 2O5KA 5BVNA 3UP2A 1RDQE 4YLLA 4FTJA 5IA3A 3HV4A 3PUPA 1BL6A 4G16A 1Q24A 2WD1A 3OT3A 1VYWA 1OBDA 3ORIA 1OGYA 4GL9A 4TNDA 2CCHA 4CMUA 4G3DA 2UW6A 2HWPA 4HCUA 3TV7A 3EZVA 2OZAA 4QQJA 1W8CA 3G5DA 3DV3A 3QZHA 3R01A 4FTMA 3RMFA 5M55A 2R3RA 2C5VA 2VX3A 2XKFA 4KAOA 5LXMA 2NO3A 3BELA 3KXMA 4JL9A 4FKOA 4FTOA 3QZGA 3MH0A 4FYNA 5JRSA 4XV9A 3WIKA 1WFCA 4APCA 2XCKA 4HGSA 4IB1A 4ACDA 3OY3A 3QKKA 2CKQA 3UOJA 1H1RA 1GY3A 4A9YA 3SRVA 2V22A 4JS8A 3TZMA 2IVUA 5BUEA 4OW8A 5IQDA 2F7ZE 4BFMA 4ZY4A 3FLQA 4RSSA 4BJJA 1V1KA 2OICA 4U9AA 3EOCA 2OGVA 4GH2A 4FTKA 2WTDA 4R1YA 4L6QA 5FTGA 4IHPA 4W4XA 4V0GA 1Y91A 3PY1A 3DKOA 3OWJA 4NCTA 5JKGA 1T46A 2HZ0A 3VS7A 3QTQA 4PX6A 3ZUVA 5IQAA 2IEWA 2ZV8A 3NUNA 4JR7A 4AXDA 2E9OA 3D5UA 1CTPE 1PHKA 4FL2A 3A62A 3CS9A 3FC1X 3QL8A 2I0VA 4I21A 1IAJA 2CNUA 1IEPA 4LOOA 3FI4A 4RJ7A 3KKVA 4L7FA 2YLFA 2OSCA 2C6KA 4FEQA 4NEUA 5FM3A 2Z7SA 3QX4A 2QG7A 5A46A 3ROCA 5LVNA 4J53A 1YDRE 4EOLA 3R28A 1H8FA 3FBVA 4A7CA 4DLJA 3PXZA 3GP0A 4IADA 5TR6A 5FQDC 4AN3A 4AW2A 4KKEA 4F0GA 4EH9A 3UNKA 1G8KA 3D7TB 4XP3A 4I6LA 1FQ1B 2H8HA 2A27A 2XANA 4Z7GA 4FJVA 2B54A 1XMLA 3II5A 4PF4A 3CR0A 3EQBA 4TW9A 4JAJA 4LOQA 4EOPA 2XJ1A 1OM1A 2E9VA 3UDZA 4EOOA 3DQXA 3FZOA 3EH9A 3GI3A 2YITA 3D14A 5HGIA 3MVLA 4ANOA 3SG9A 2EWAA 2OIDA 1QPJA 4JDIA 5D1JA 4K8AA 2OO8X 2YDKA 1ERKA 1WBTA 4CV9A 5CQWA 4QMSA 3DT1A 2Y6OA 4L9IA 3VBXA 3FKNA 5AUTA 2G9XA 3C1XA 5H8GA 3WARA 4D4YA 2GFSA 3IGGA 4O0TA 4BICA 3FLZA 2B9JA 4ENXA 5L3AA 3UJGA 1J7UA 3SOCA 4O1PA 4BKJA 3T3VA 1DS5A 3L8SA 3ENHA 4FT7A 3V8WA 3OG7A 4HYHA 3H9OA 4I41A 4GU6A 4PY1A 3OXIA 4DH3A 4U5JA 5C8KA 3RBWA 3C51A 5AV2A 3W0OA 2JDVA 3O8PA 2WB8A 3BWJA 5ACKA 4FSZA 4HNFA 1V0BA 1UWHA 4B7TA 4ASZA 5IF1A 2ZV9A 3DGKA 2B9IA 2YDIA 5L2QA 2VTSA 3T9TA 3RVGA 5KHXA 3REPA 1U59A 2H6DA 3QTWA 3KGAA 5EKOA 4WNOA 2EXMA 3ZEPA 5KHWA 4RZWA 3R1SA 1FVVA 4O0RA 2YACA 3RNIA 2NYAA 2PHKA 3CTJA 2OU7A 3V5LA 4GJ2A 1REJA 3L9LA 2Q83A 1RQQA 3QD0A 5IH5A 4FSNA 2GHLA 4AZSA 4IMYA 4X2NA 3VS4A 4BKYA 4E5WA 5IQEA 2YCSA 3HZTA 4LG4A 5ANDA 2ITXA 5C03A 1FBNA 5DHJA 2FSLX 3FKLA 4CFUA 4JDHA 5AJQA 5AR7A 3EQGA 2R3GA 2BFYA 3ZRMA 3UPZA 3PZHA 1OVEA 3LFCA 4C34A 3Q52A 3WYXA 4DC2A 3WZUA 2PPQA 4DTKA 3JUHA 2VWXA 3VBVA 2Y6MA 4RVTA 2P3GX 4JBPA 3MFSA 2CN5A 3UG2A 5CAUA 2VNWA 1R0EA 3C4XA 5HIBA 3RPOA 2RG5A 5HIEA 3ZLSA 3UZTA 5DGZA 1ZMVA 4ZJJA 4XBRA 2B7AA 2BILB 2X4ZA 1YVJA 3ETAA 4QMXA 4CFFA 3W0PA 3IW4A 2WELA 1ZOHA 4G3GA 5AUWA 4E26A 4K6ZA 4ERKA 3BYSA 3ALOA 4PWNA 5LVMA 3PA4A 3U4UA 5F95A 4O0WA 4R7BA 4EH4A 4E4MA 3OEZA 3FL4A 1QCFA 5J95A 1XR1A 3HA6A 4HGTA 4IE9A 3CTQA 1GZOA 3W2PA 5ICPA 4I0TA 3EYHA 5LCKA 4EOQA 1ZRZA 3AGLA 3DK7A 3PE2A 1PJKA 4JQ7A 4ACGA 3R6XA 4CD0A 3OZ6A 3HDMA 2WQMA 1BX6A 3GC7A 3R9HA 3ZUUA 3ERKA 4IFCA 2G2HA 2HY0A 3QU0A 4BI2A 3MY0A 3IW7A 5IQIA 4YURA 3V04A 3V51A 3CC6A 3GU4A 2XEZA 2XEYA 4X3JA 2QR7A 3IG7A 3W8QA 3Q2MA 4EI4A 5E7RA 3NUAA 2I0EA 4X6QC 4ZSLA 3ZYAA 4NYEA 1U54B 4E6AA 3F5UA 3PJ8A 1URCA 3JVSA 4CTBA 3P0MA 4M84A 1Z9XA 3DBDA 4M69A 1WCCA 3E64A 2B9HA 2J6MA 3QQKA 4AA0A 1GZNA 3RM6A 1OIRA 5LOHA 3U55A 4OLIA 1GJOA 4O0XA 4S33A 4DGMA 3R04A 3VUMA 5BVFA 4A4LA 4QQTA 1TZDA 2OWBA 3EN6A 3QF9A 5GINE 2C5NA 2JAVA 2YWVA 3ZMMA 5IDPA 5J1VA 3O96A 3NUPA 4LMUA 3W0MA 4L3JA 4NU1A 4TT7A 5EM7A 4YLJA 2FVDA 4G6OA 5HU9A 2J5FA 3DPKA 4PL3A 4CKIA 4ZTRA 5IEVA 4DFBA 4FV3A 2WU6A 2WMQA 5EK7A 3VS5A 4GVJA 3EQCA 5DVRA 3OBGA 4J8NA 4MXOA 3HAVA 4AWIA 2J2IB 4W8DA 2QLUA 2ZYBA 2DQ7X 2J9MA 4UYNA 1OUKA 2XNPA 4MEDA 4M67A 3ZRKA 4MNEB 2PWLA 2XNEA 5H2UA 3RWQA 1Q99A 4YJTA 2JIVA 3SVVA 1FINA 4QPMA 2WEVA 5J7HA 3LVPA 1XH5A 4XCUA 4EYMA 5KNJA 3C50A 3PFQA 4X6RA 5J8IA 3MJ1A 3MY1A 3FZSA 3NNWA 3ML1A 2O3PA 4J97A 2YCFA 2JKKA 3EL7A 4XG6A 3OMVA 3UIUA 4FIGA 4RPVA 5C4LA 4AGCA 2F9GA 3SC1A 3D7ZA 4DHZA 2FA2A 2WTCA 2X0GA 3HMPA 3LFBA 3LZBA 5FTQA 3EN7A 3D0EA 2IF8A 5BPYA 4AFJA 3HKOA 3CKWA 5DYJA 4EH7A 3F2RA 3LCDA 4FSRA 3WZDA 4H05A 3MI9A 5E8WA 5FXQA 2XIRA 3FZTA 4CV8A 4QP2A 4F63A 3U8WA 4BDBA 4AG8A 3Q32A 4HVHA 5A4QA 2WHBA 3UIXA 3P79A 4QO9A 3C4EA 4DN5A 3BV2A 3QCQA 3QRIA 1ND4A 3PLAE 5E90A 3FDNA 2OJJA 4M0ZA 2FSMX 5B2KA 5BQ0A 2PZIA 4K33A 4CCUA 3BL9A 1IAHA 3EZRA 3BQRA 4IM3A 3HUBA 3OS3A 4DTAA 3W18A 3ZFMA 3NW5A 5DRBA 5IQGA 3RPVA 4BF2A 4TYJA 4NWMA 4B8MA 5FG8A 2ITYA 2UZEA 4RX8A 4GK3A 5IQBA 3UQGA 4IANA 2YAAA 4IX6A 5CF6A 3R63A 3ALNA 2XJ0A 3RZBA 2JDRA 1JNKA 3DB6A 2HZIA 3TI1A 4I6BA 4EK3A 2RFSA 1U46A 3HVCA 3LQ8A 4O2PA 4WBOA 2WPAA 1ATPE 2OI4X 1Z5MA 4FTCA 1OECA 3EQIA 4R3PA 4XRLA 3RPRA 4F08A 5FUTA 4GVAA 4I5MA 4L3PA 3EIDA 5BYLA 2JAMA 2ITPA 1P14A 3KC3A 1M17A 2XA4A 3GQIA 4CTCA 3GCUA 3MV5A 4FKLA 3AC5A 5ANEA 3G15A 4CG9A 3F82A 2CKOA 3DS6A 3POOA 5FEEA 4CNHA 4A4XA 3PA5A 1XO2B 3FI3A 4LYNA 5JRQA 3M11A 1Q5KA 1UWJA 3O8TA 3PG1A 3HL7A 3N4VA 1J3HA 2CGXA 3CTHA 2W1ZA 3MJ2A 1CSNA 5EDQA 5EH0A 2V55A 3PSCA 4I93A 4LV8A 4N0SA 2XM8A 2ITUA 2CMWA 4DT8A 3C0IA 4BTJA 2GNGA 3E88A 5HX6A 4IH8A 4FOCA 2G2FA 4UXQA 5D9HA 4QQ5A 3RK7A 4LV7A 4LRKA 2QD9A 4DAWA 1Y8YA 3DU8A 1TQIA 1YI3A 3W2RA 4K11A 3VN9A 3MPAA 3PG3A 4JX3A 2NRUA 5ANIA 1UVRA 2XRUA 5I3RA 2ETRA 2BDFA 1JQHA 2XNGA 2JD5A 4KIKB 4XV2A 4D58A 4D4RA 3DJ5A 1FVTA 3FLWA 4O38A 1V0PA 4FVPA 4TTHB 4HW7A 3IDBA 5AFVA 1MQ4A 3PIYA 2VGPA 3FL5A 5A4TA 2UW0A 3SA0A 4EBVA 3CXWA 2EXCX 5JFWA 2OZAB 4N6YA 3BCEA 3GC0A 4CGAA 2OFUA 3FQEA 1SVGA 2C6OA 5AADA 3PRIA 2BRBA 4FA2A 4LFIA 3S00A 4O81A 4FZAB 1EH4A 1GOLA 3LFEA 1YDSE 1Q62A 3A2CA 2I0HA 4U97A 1QMZA 4NTSA 3D4QA 4PDOA 4GYGA 4QMUA 4BJJB 3GGFA 5KMJA 4GEOA 3G51A 4RFYA 3PWYA 4Z3VA 3AMAA 3U9NA 3SX9A 4PP9A 5K5XA 4A9RA 2PUUA 5JFSA 4V0GB 3UP7A 4M66A 5H8BA 4O7RA 3AC4A 2YN8A 2BTRA 5EYDA 2XAMA 3FQHA 2DUVA 4BHZA 2WTIA 3KVWA 3OUNB 3VQUA 3LXLA 4BGQA 5AUYA 4AAYA 1W84A 2CGWA 2X9FA 4PPCA 4YSMA 3ZBFA 5K5NA 3S0OA 4NH1A 4O7ZA 5CALA 2HCKA 2ZMDA 3BYOA 3QFVA 4RIXA 3UZRA 3RTPA 3WYYA 2QG5A 3LCKA 4C3RA 4BTMA 2XS0A 4D9TA 5JZJA 3ODZX 2XKEA 2GS7A 3QA8A 2ITNA 2GQSA 2RFEA 5IUIA 4ZOGA 2XKCA 1IRKA 4LL0A 2ACXA 3R8MA 3RNYA 3TEIA 2AQXA 2R9SA 2C30A 1OIQA 4LGGA 2HIWA 4EOJA 5EYMA 3SXSA 2ITOA 3MA6A 2IO6A 2VU3A 2WKMA 4OTRA 3C4CA 2W96B 3G0EA 2DWBA 4QTEA 3FI2A 4IDTA 4W8EA 4AA5A 3R7GA 3HV6A 5ETIA 3ZSHA 4U40A 3UBDA 4CCBA 3LFAA 4WT6A 1M2RA 4M8TA 5CU0A 4EQCA 5JT2A 4FSUA 3IGOA 4BDFA 2HENA 2QU6A 3C7QA 3CY3A 3GUBA 4EBWA 3E8EA 4R3CA 4FKTA 4ITHA 4BZNA 4RVKA 3VS6A 3R2BA 4D1ZA 3TNIA 2CSNA 2R7BA 1UNLA 2SRCA 3NYVA 2IZSA 3S95A 4IZYA 2R3KA 4QDVA 5JQ8A 3PWDA 4IAKA 5GIPE 3ULZA 4ITJA 3ORTA 5CZHA 5LMKC 3UQFA 4UN0C 3VS3A 4FEUA 3PYYA 2IZUA 2C3IB 4G3CA 4M15A 5HX8A 2XNOA 1B39A 2VZ6A 4MH7A 4Y5HA 3KU2A 3DAKA 4FIIA 5CY3A 5CAQA 3UNZA 3FLSA 5AP4A 4AZFA 2NNWB 4L3LA 2C6DA 3THBA 3ZRLA 3V6RA 4G3EA 2BZHB 3ELJA 3OROA 3R8UA 3DKFA 3TXOA 3KA0A 2HW7A 1H1QA 1ZOGA 3ZONA 4YMJA 1U54A 3KVXA 3LCOA 2IW8A 5AA8A 5KMLA 4HCVA 4F0FA 4IACA 4ZTSA 5A9UA 3C5UA 3LLTA 4GCJA 3NW7A 4ZSEA 2RL5A 3NIZA 4BR3A 3NEWA 5AIKA 4XLVA 3VONA 4RFZA 2RF9A 3GOPA 4QOXA 3TJDA 3AC8A 3AOXA 4EQUA 3KMUA 4MQ2A 4LRMA 4EQMA 4KIQA 2QCSA 1Q8WA 4BRXA 4BGHA 3DQWA 4FC0A 4O6LA 5CI6A 4B4LA 4WNKA 1KE9A 1PMNA 4CEGA 1LEZA 2BDJA 5D7AA 2PMNX 4I6QA 5KX8A 2JGZA 2YLEA 3FHIA 3VBYA 3VVHA 3DY7A 5IH4A 2R3MA 4RJ8A 2JLDA 3AG9A 4FNYA 2GPHA 3RAWA 2YIWA 3WF5A 3D5VA 5JH6A 1Q3WA 2P2HA 2VUWA 3QQHA 4FSWA 4U44A 1APME 4I24A 3SV0A 1WBNA 1J91A 5DMZA 5EHYA 3I60A 4C4HA 4Y95A 5FBNC 3WZJA 4G3FA 4DYMA 3L8XA 4IB3A 4I94A 2BRMA 5CSWA 2I0YA 2UW5A 5AP3A 3ZSIA 2BKZA 1H1PA 4FZDB 3N4UA 3UMWA 2GS6A 3ZLXA 3PDTA 5A6OA 2YM5A 3P7CA 5DR9A 5K9IA 3NDMA 3ITZA 5HG7A 4O2ZA 2GDOA 3NYOA 4YJSA 3OTUA 3H0YA 3PXRA 4PDPA 4GYIA 3TCPA 5CSPA 4FIHA 3FMHA 3KFAA 4YGAA 5GJGA 5CAVA 3OBJA 3QRKA 5ACBC 3Q2JA 1BYGA 5LWNA 5AIRA 5IKWA 4C0TA 4GU9A 3S3IA 4MXZA 2J0IA 3VQHA 2XK6A 3NRMA 5CNNA 1NA7A 1TKIA 3ZDIA 4LOPA 2X1NA 4D28A 4Q5HA 4O7YA 4IAIA 4TYIA 1XH6A 3OTVA 5CWZA 5E8XA 4F6WA 2CKEA 4KS8A 4BY9E 2J5EA 3HP5A 3I0QA 4BDKA 1OPJA 1H1SA 4O86A 2PL0A 3TUDA 1OBGA