4J9EA

Crystal structure of the n114a mutant of the abl-sh3 domain complexed with the high affinity peptide p17
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high affinity peptide P17
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9eA00
2D1XA 2EYZA 2KR3A 1UDLA 2DMOA 2K79A 3IQLA 4J9GA 1PKTA 2EGAA 1NYFA 2JM9A 2PTKA 2OI3A 2J7IA 2MOXA 4F14A 3SHWA 2YUOA 5ECAA 2JTEA 3QWYA 2RQTA 3I5RA 2GTJA 2K6DA 2KEAA 4JJDA 1UTIA 1YCSB 2L3QA 2LZ6B 3I5SA 2HDAA 1G2BA 1JO8A 2J6OA 1QCFA 1UG1A 2DILA 2J05A 3NMZC 1CSKA 2LNHB 2EKHA 1WFWA 2F2WA 2RNAA 2SRCA 1AVZC 1WDXA 5HCKA 3UA7A 1GBRA 1GBQA 2RN8A 3EHQA 2E5KA 2DBKA 2GTOA 2LJ3A 5EC7A 1WXBA 2KXDA 2L3SA 4JZ4A 2YT6A 4RTYA 4F16A 1H92A 1M3BA 5IHNA 2YSQA 2PZ1A 5IH2A 1V1CA 1YWOA 2CDTA 1NEGA 1T3LA 2KBTA 1ZUUA 1WA7A 3M0UA 4LUDA 4JPBW 3TSZA 1TG0A 1EFNA 2DL7A 2DL8A 1OV3A 2XMFA 1JU5C 2C0OA 2KYMA 2W10A 1PNJA 1UFFA 3VS4A 4CC4B 1E7OA 1N5ZA 2ED0A 2GGRA 2KRMA 2DF6A 1ABOA 1KSWA 2J06A 1HD3A 3EG0A 5GJWB 3EHRA 2KXCA 2OJ2A 1OOTA 1X43A 1OEBA 2A08A 2HCKA 3KFVA 2MCNA 1SHFA 2HEQA 2DYBA 3VS3A 1PRLC 1OPLA 2ENMA 4QT7A 2K3BA 2DL4A 4WCIA 2KE9A 2ED1A 1M3AA 1BK2A 2K7AA 1K0SA 1RLPC 3TSWA 4DEYA 2EGCA 3NPFA 2W0ZA 3NGPA 2SEMA 4RTVA 2FPDA 2DL3A 2EGEA 2YUPA 1YP5A 2BTTA 2JW4A 2JXBA 4GLMA 2M0YA 2L2PA 5I11A 2FPFA 2K9GA 2X3XD 1UECA 2KRNA 4K11A 3C0CA 3UF4A 1NG2A 2RMOA 4JJBA 2DLPA 2O9VA 3M0TA 3EG1A 3M0PA 2VKNA 2LQWA 3GBQA 1AOJA 1X27A 2RQWA 1CKAA 2K2MA 4OMMA 2LCSA 2EYXA 2EQIA 4J9EA 3A98A 5FW9A 3I35A 1I1JA 4AFUC 2DX1A 5FWCA 2RF0A 1QKWA 2IIMA 4LE9A 4RTWA 3VS6A 1M3CA 3REBB 1AWOA 4J9FA 4RTZA 1JXOA 1AD5A 1MUZA 1HSQA 1AZGB 2FRWA 4KRTA 2FRYA 1OPKA 2RQRA 4HXJA 2J6KA 4AG2C 2EYWA 4LUEA 1IO6A 3EGUA 2O9SA 4HVVA 2CT3A 2DM1A 2DE0X 1GRIA 1WXUA 2OAWA 4M4ZA 2KRSA 1W1FA 1Z9ZA 1ZLMA 2LJ0A 4AFSC 2CSQA 2VVKA 2KT1A 2P4RA 5L23A 4AG1C 4E6RA 2LQNA 4IIOA 1PHTA 1QKXA 1PWTA 2KGTA 1GCQC 2JMAA 2NUZA 2O31A 1GFCA 1M8MA 3PVQA 2J6FA 1UHFA 2KNBB 4LN2A 4Z88A 2GNCA 1K9AA 3M0SA 1YN8A 1TUCA 1Y57A 4JZ3A 1GL5A 4IIMA 1KFZA 1WXTA 1CKBA 1AZEA 2QDLA 1X6GA 2BZXA 1AEYA 1RI9A 3VRZA 1AWJA 1Y0MA 1RLQC 2JMCA 3THKA 2CSIA 2CH4A 2CH4W 3R6NA 4EIKA 1SPKA 4OMNA 2D0NA 1U5SA 2YDLA 3REAB 4ORZA 2JM8A 2LX7A 1FMKA 4FSSA 4HVWA 2MIOA 2JS2A 3H0FA 4HVUA 2V1RA 2ECZA 3SEMA 1MV3A 2EYYA 1M27C 1S1NA 2DRKA 4RTUA 3VS7A 2RQVA 4HCKA 1VA7A 1H3HA 3H41A 2HSPA 2A36A 1SRLA 3VS1A 3UA6A 3H0HA 2I0NA 1ABQA 2VWFA 1K76A 2A37A 4AFQC 5I22A 1JQQA 3NHNA 4Z8AA 3LH5A 1K0XA 1E6GA 4J9DA 4J9CA 3EG3A 2GBQA 1U3OA 2DA9A 1I0CA 4RTTA 3ZL7C 2GQIA 2X3WD 1U06A 2BZ8A 2EVRA 1NEBA 1PKSA 2FPEA 1ZUKA 2EW3A 1VYTA 1Z9QA 4J9IA 1WI7A 1NLPC 5IXBA 3QWXX 3VS0A 2DNUA 1UJYA 2NWMA 3H0IA 1FYNA 2DVJA 1WX6A 4R0KA 3PVLA 1T0HA 3U23A 4OMPA 3JV3A 2D8HA 3RBBB 2PNIA 1WLPB 1TUDA 1ZBJA 1UGVA 1H8KA 2KT8A 1W70A 3PE0A 1NLOC 2LMJA 1WYXA 2LP5A 4GBQA 2D8JA 4J9HA 4Y92A 1VYUA 3CQTA 2BZYA 4JJCA 1VYVA 4OMQA 2ABLA 1RUWA 4CC2A 4D8KA 4ZNXA 1J3TA 4D8DA 2O88A 1PRMC 5IXFA 1I07A 4Z89A 3VS2A 1QLYA 2F2VA 1UHCA 4LNPA 2ROLA 3FJ5A 2FG0A 1WIEA 2YUNA 2FO0A 1GFDA 1UE9A 2L0AA 3RNJA 2RQUA 2CREA 2H8HA 1ZX6A 2G6FX 4RTXA 1W6XA 1X2KA 2JS0A 3ULRB 5FWBA 2M51A 1SSHA 1ZSGA 1BBZA 1GCQA 1QWEA 1ARKA 3I9QA 1NYGA 4DEXA 2RPNA 3UATA 2AKLA 2KROA 1G83A 1NM7A 2AZSA 1LCKA 2AK5A 2FEIA 3M0QA 1HJDA 1QWFA 5IHKA 1MV0B 4OMOA 2F2XA 2JT4A 1SRMA 1X2QA 2KYBA 4A63B 1T3SA 2DBMA 1AWWA 1XOVA 1SEMA 2YUQA 3M0RA 4X1VA 1BU1A 4ESRA 1M30A 1K1ZA 2A28A 1UUEA 2CUDA 4RUGA 1SHGA 2ESWA 5GJVB 1ZUYA 2C0IA 2CUBA 1UJ0A 4CC3A 2EBPA 3VRYA 1A0NB 2EPDA 2ROTA 4J9BA 2B86A 2DRMA 2L3PA 1GCPA 4OMLA 1K4US 2HBWA 3EG2A 1YWPA 4AFZC 2O2OA 2V1QA 1E6HA 1T0JA 2AKKA 1X69A 1B07A 2DL5A 2LJ1A 4F17A 2DJQA 1KJWA 1X6BA 3VS5A 1B3QA 2AZVA 1JEGA 3TVTA 1YNZA 1KIKA 3O5ZA 1BB9A 2C0TA 2CT4A 5IHIA 4CC7A 1AWXA 1JXMA
chains in the Genus database with same CATH superfamily
4E7ZA 1TU0B 1UGPB 2KR3A 2NUPB 5LJ3h 3CCVQ 3IQLA 4HKEA 4F7UG 1YITA 1PKTA 2EGAA 2JM9A 4ZTFA 2OI3A 1WJQA 2K3XA 2QASA 2HMAA 3QZ9B 4F14A 2JTEA 2XKOC 2QK0A 5CKBA 5HK0A 4JJDA 1YCSB 3S3OA 3S6WA 2LZ6B 2DO3A 2HDAA 3CD6T 3JCMh 2DILA 1U8RA 2YXYA 1I4K1 4OB3B 3H6ZA 4C8QA 2EWNA 2DYIA 1YITQ 2MPXC 1O9SA 1VQ9Q 4M7AG 3P8BB 5GMKi 2F2WA 1XTDA 4XTYA 4PK4A 2ATCB 1GBQA 3GIBA 2RN8A 4WF2A 5KYXA 3CCEA 3CCJA 2L3SA 1YIJA 5GAN6 1VQ4A 4M7AC 2YLBA 2EQKA 4RTYA 4PFZA 3FC3A 1NEGA 3OYJA 1WA7A 3M0UA 3TSZA 1KHIA 1EFNA 2DL7A 1WGSA 1OV3A 1JU5C 2DFUA 1N6AA 1PNJA 1RAAB 3CCEQ 3CCJQ 1E7OA 1N5ZA 2L8DA 1G3SA 2GGRA 2DF6A 3MJXA 1KQSS 4N0AA 2E6NA 4M7AD 4B9XA 1KG1A 1U1SA 5GANe 2FHDA 1OOTA 2A08A 2HCKA 2MCNA 3ME9A 3I56A 1SHFA 4C0GA 3BDUA 4NL3A 2O4XB 1WHGA 2ED1A 1Q81C 1BK2A 2GFAA 4IUTA 4DEYA 4D6WA 2EGCA 3QDFA 2EKOA 2P84A 3NGPA 4PJNA 3M57A 3C12A 4C5EA 1YP5A 2JW4A 3V8JA 1WQWA 2L2PA 2FPFA 2X3XD 3J7AF 1RAFB 3I56Q 4QVCA 3UF4A 2GF7A 4L6V5 1BI0A 4M7AB 2RMOA 3NTIA 3M0TA 1RADB 3GBQA 2RQWA 4QKUA 2LCSA 1SSFA 5CKHA 3JCMQ 3CCSA 1VQ9T 3PTAA 1I1JA 4AFUC 3CCRT 1VQNQ 1C6VX 5CIUA 1QKWA 2Y90A 2YLCA 4HT8A 4FYYB 4KRTA 3J80E 5I2MA 4A54A 3G6ET 5GAOp 2J6KA 3N5BB 1YHQT 4XTWA 3UWNA 2ZPFB 3EGUA 5I21A 2JJ9A 2CYZB 1LJOA 2KK4A 1U1TA 4OGEA 3JCMc 1WXUA 2NYSA 5KCHA 3EFSA 1Q86U 2LJ0A 3M56A 6AT1B 5L23A 2PU9B 4IIOA 1BKBA 2VC8A 2KGTA 5GAN8 1GCQC 1KD1U 4PL6A 5AYFA 3G71A 3PVQA 1K9AA 2KVQG 2AIRB 1Y57A 4JZ3A 4JS5A 4IIMA 1KFZA 5KYYB 2CP3A 4CRIA 1Q86R 3M55A 5GAOr 1QVGA 3TQ7P 3VUBA 2RJCA 4M7DG 3SWNA 2CH4A 3S3MA 2JNGA 4EIKA 2GFUA 4M77G 3X25B 3G4ST 2DXTA 2JN0A 2D0NA 3REAB 4ORZA 4M7DC 2LX7A 1FMKA 4HVWA 1VQPT 2MIOA 3F70A 1QCOA 4M78A 3EGDA 4M77C 3OYYA 5FROA 1VQNT 3VS7A 2DRKA 3P8DA 1IHWA 2A7YA 3VS1A 3MHXA 2VWFA 4AFQC 5I22A 1D3BB 4LDXA 1JQQA 3EG9A 3WXMB 1G3YA 3LH5A 2QEXA 5GAMh 4M7DD 1E6GA 4HT9A 5FRNA 2KY9A 2GBQA 1U3OA 2QQ9A 1I0CA 2RH2A 4PJLA 4RTTA 4DQ2A 3HKSA 1M9SA 1NEBA 4M77D 2EFIA 1ZUKA 2X9HA 4KH1B 1Z9QA 2K3YA 5IXBA 5CCAA 2D9TA 3SDZA 5DY9A 3H0IA 4R0KA 4PNOA 3OYEA 2QEXQ 2OTJT 1T0HA 1YCYA 2RM4A 2DAQA 2RHIA 3JV3A 4MMKA 4LDWA 3T9NA 1ZBJA 1KC8R 4E47A 4MDXA 1WNLA 2F69A 5D6XA 4M7DB 3QXEB 2LMJA 3MPUB 1WYXA 2ZAEA 2LP5A 3V7SA 4XU1A 4M77B 2OTLT 3OQ5A 4OMQA 1IREB 4D8KA 4IUUA 2XDDA 4ZNXA 2O88A 1PRMC 2E1HA 2AHJB 4J6YA 2O01E 4Z89A 4OF1A 2F5KA 3GLXA 5GMKe 3VYGA 3UDCA 1WIEA 3HHTB 4FU6A 2PVDB 1ZSZA 2HAXA 4RCBA 4RTXA 1KC8C 3JB9H 2LX9A 1QVFS 4DBFA 4KT0E 2M51A 3LGLA 4Z02A 1VQOA 5GANd 5J39A 2EIFA 1QWEA 3OYCA 1PD1A 3H9NA 3I9QA 1ARKA 1M2VA 3UATA 2JOYA 4XK8E 3OS2A 1NM7A 3JCMX 4JRKA 3M0QA 3QJYA 3L42A 1HJDA 5IHKA 4ZGDB 4EMKC 2F2XA 1SRMA 1X2QA 1IZ6A 2YUQA 1BU1A 1VQOQ 1K1ZA 1IB8A 3CC7T 1SHGA 4XTXA 3M53A 1TOVA 4FYXB 3SFMA 3A8GB 1C0MA 2EBPA 2E12A 3ER0A 4PJOA 2WACA 4FW1A 1NBEB 4OMLA 5GAOm 3I55Q 4JJNK 2HBWA 2Z0WA 1E6HA 5I2SA 5LJ3j 1IXDA 3CBMA 2DJQA 3NFCA 3VS5A 1B3QA 1VUBA 2K5IA 1KIKA 3OYDA 1BB9A 2HL3A 2C0TA 3CEYA 3OBYA 1RAEB 2MF2A 3JCMV 4A4KA 4OGCA 4C92G 2J7IA 3H8ZA 3QWYA 1UGSB 2L89A 3NTKA 5GMKl 5A2QE 2X35A 2GTJA 2D0QB 2NUTB 1M1FA 1OYXA 1UTIA 2DK3A 3PMTA 4C92C 1FMVA 1QCFA 3L1AA 5IT9E 3EFOB 4BE0A 3CD6A 1Y96B 1MHNA 1EIFA 2LNHB 2MAMA 3G1JA 4NL2A 2V8JA 2PUOB 4M75A 3UA7A 1GBRA 3EHQA 2E5KA 4C8QF 2GTOA 4C92D 3OA6A 4ZTJA 5LL6S 2YT6A 2V26A 1H92A 4BE2A 5A0GA 2PZ1A 4FW2A 4BI3A 2CDTA 2ZPHB 1T3LA 1OU9A 3CBOA 4PFPA 3JB9F 2XMFA 4OB1B 3AT1B 2DJZA 2C0OA 2W10A 2E4HA 1YJ9T 3VS4A 4UC4A 3S3NA 5LJ3f 4N4GA 4KGZB 2PVOB 4Y91A 4AMCA 4ELZC 2J06A 2CKKA 3KBGA 3META 4LD9K 3DKMA 3A8HB 1OEBA 2FVUA 4C92B 2DYBA 5A0LA 1YFNA 3VS3A 1PRLC 1OPLA 1QP2A 2ZPBB 5GAOq 4C8QE 4J8OA 1BIAA 1K0SA 1RLPC 3TSWA 3JCMf 3NPFA 2VYTA 5A0DA 3MEVA 4F7UE 3JCMW 2FPDA 2RJFA 2E3HA 2EGEA 2YUPA 2BTTA 3LWIA 3PT9A 2M0YA 1D0XA 4J6XA 1VQ8T 1BI2A 4ATOA 3OS1A 4QQDA 1UECA 2KRNA 1LPLA 3RDVA 1LVKA 1R77A 4JRIA 1PG5B 4JLIA 2O9VA 3EG1A 4KUDK 2QQRA 2VKNA 2LQWA 1AOJA 2F5TX 2Y4YA 4PLLA 3M58A 1VQKT 3QYGB 2QQBA 3JB9J 2EYXA 4OMFB 1YBYA 5CVIA 2KI7A 3A98A 4HCBA 2LT4A 3I35A 2DEUA 3FIFA 2DX1A 2RF0A 1O75A 1VQ9A 5GAMg 2QQAA 1HK9A 3CCRA 2HD0A 1K8AC 1HXDA 2XD0A 5CR2A 2EJFA 4XTZA 2K2VA 1HSQA 2X4WA 1AZGB 5L8RE 2EAYA 1I8FA 4FSXA 4JDSA 4MMLA 2KSSA 1Q81U 4IUQA 5HKCA 5LJ5g 4AG2C 3NTHA 4JRQA 3G6EA 5DLQE 1F1BB 4LUEA 2O9SA 2P0PA 1OZ3A 2DM1A 5CO7A 1YHQA 3TEEA 3CMET 2IVWA 4E7HA 3CCRQ 4F7UA 2VUBA 3ZBDA 2KRSA 1W1FA 8AT1B 1GXIE 3CMAQ 2VVKA 1H641 3JCMJ 4BDYA 3HFOA 1S72Q 1Q81R 1VQLQ 4RKUE 2DZ9A 2O31A 1M8MA 3G6EQ 2KNBB 1NJIC 2DXUA 4Z88A 2QXFA 1YN8A 1GL5A 1YHQQ 2EJ9A 4PKCC 5IN1A 1CKBA 5J3BA 1AZEA 1X6GA 2BZXA 5IAYA 4BD3A 3L2UA 1AWJA 1Y0MA 3CC2T 4M7AA 3THKA 1FXXA 2CSIA 3DLLA 1Q7YC 2JTFA 2FZCB 3LX7A 2CH4W 2R5AA 1SPKA 1VIFA 2YDLA 2MYSA 3PFSA 2QA4T 4MZPA 3JB9I 2LCCA 2RB6A 4FSSA 3CCMQ 3G4SA 9ATCB 4C8QB 2DIGA 1MMDA 4EMGA 5GAMj 5GAN3 1VQPA 2CP7A 3FDRA 2XDPA 3SEMA 1MV3A 1S1NA 1M27C 2EYYA 4RTUA 2RD1A 4HCKA 5FU7C 4A4GA 1UB4A 5D6YA 1VQNA 1K76A 5HY6A 2DIQA 2LTOA 3CCUT 2H3EB 3NHNA 4M78F 2X4JA 5LJ5j 4XAXB 2EQJA 2JZ2A 4FYWB 4J9DA 2GQVA 3G4SQ 1R8OB 2WSEE 3HPWA 3PNWC 5C6SA 1JJ2A 4E7KA 4X9DA 3OW2P 1VQPQ 2DTOA 4KGVB 2LRQA 5EG2A 1FWZA 3MKDA 4J9IA 1NLPC 3GP8A 2QGGA 2NWMA 1WQ7A 1FYNA 2HSEB 3A8OB 4O6JA 3U23A 3CMAT 3X20B 3RBBB 2OX7A 1S72T 1QCNA 5KCOA 3LGFA 4AT1B 1VQLT 5KYYA 1NLOC 3QKJA 3MEUA 2QQSA 1PD0A 3L2WA 2D8JA 2LQKA 3GF5A 4M78E 1M4ZA 4C5IA 1NE8A 3HRSA 3CQTA 4C0ZA 2LCLA 2FL7A 5FU7B 1Q82C 4A4HA 2ZZDA 1WHLA 2OTLA 2A3LA 4ME7A 2OTJQ 1I07A 2E5QA 2F2VA 2QTXA 1WHMA 1M1GA 2RJEA 4YTLA 2YUNA 3CCMT 1PCXA 3ZEHA 3RIRA 1TWBA 5GAMf 1UE9A 1ACMB 2CREA 1W6XA 2VASA 1X2KA 3V7RA 5GMKj 2JS0A 2DEQA 3ULRB 2OTLQ 3BFMA 5M9OA 2V8IA 1ZSGA 3OSVA 1GCQA 1W4SA 3MEAA 3QYHB 3CPWP 1I81A 1X6OA 2WSFE 3CXCP 1RL2A 1W2BP 2G3RA 1TUGB 4DEXA 3JAME 2ZPGB 3OYBA 2RO0A 2KROA 5D6WA 4ELYC 2DKGA 3OMCA 5HK3A 1G3WA 1MV0B 4OMOA 4OP0A 1QVGS 1AWWA 1SEMA 3E2UA 1Q95G 4ESRA 1EZZB 4LDUA 2A28A 4RUGA 5FRMA 2RI3A 4II1A 4M7DA 5LJ3d 3CC7A 5GJVB 2Y4XA 2RHZA 2EPDA 2ROTA 3BE3A 4M77A 2L3PA 1GCPA 2E64A 2LVMA 1KC8U 1G5VA 1WJSA 4AFZC 1T0JA 3RMQA 3FEOA 1X69A 4QQ6A 5LJ5h 2DETA 4PLIA 4PJOF 1M8VA 3JCMd 3Q1JA 1KJWA 4V2SA 1X6BA 2MI6A 5CQYA 3CC7Q 3DLMA 3O5ZA 8ATCB 3LW5E 5IHIA 3WVEB 4CC7A 1AWXA 2COYA 3CCLT 2D1XA 1M1KC 2EYZA 2X51A 1UEBA 2DMOA 1VOMA 2DVEA 2K79A 4R56A 1MMGA 1NYFA 3EGDB 5J26A 4E7IA 3E1SA 3PGGA 3FLGA 2YUOA 5ECAA 3SHWA 3MP1A 2RQTA 1MMAA 3I5RA 2MK5A 1IHVA 2PVGB 2K6DA 1B34A 1N9SA 2L3QA 2CZ7B 2E3IA 3I5SA 1VQ7Q 1VQMT 3CC4Q 1JO8A 3RKWA 3LWHA 5GAN2 1I5OB 2J05A 1VQ5T 3NMZC 3TREA 4PJOE 3BY7A 1CSKA 2QTVA 2EKHA 1ZSZC 1X01A 1WFWA 2SRCA 2BUDA 1AVZC 3PIOA 5HCKA 5KYUB 2MMPA 1JB0E 1LNXA 2LT1A 3L2RA 2EQUA 2VXFA 1M2OA 2DBKA 2K57A 3JRZA 5EC7A 2XICA 1WXBA 4QVDA 3L2ZA 3A1PA 1SG5A 4M75F 1M3BA 2ZGWA 2AT1B 1QQJA 5IH2A 5GMKh 2RJDA 1YWOA 4EPCA 5CAIA 1N9RA 1TG0A 3QHSA 2DL8A 4FCYA 2M0OA 2KYMA 3OS0A 1UFFA 1YJNT 1KQSP 3CCQT 3I55A 1KSWA 2KXCA 2ZCFB 1YI2T 1YJ9A 2OJ2A 3LYIA 3RR6A 1X43A 3HFNA 3KFVA 1BCOA 2HEQA 1M90R 3OMGA 3QPHA 4QT7A 2DL4A 4MZMA 2P4TA 1PC0A 4WCIA 2KE9A 1D1CA 4FM4B 4EMKA 1AT1B 3QUIA 1V76A 3SD4A 2K7AA 1ZSZB 4RTVA 4M75E 3VJPA 3GOXA 3QO3A 3OW2A 2NUTA 2DL3A 1VQ6T 1V29B 4WTOB 2JXBA 1YJ9Q 2BE9B 4GLMA 4JLGA 5I11A 2RA2A 2K9GA 3QSUA 3C0CA 2VGMA 1G3TA 1VQ7T 5GAN4 1NG2A 3EFOA 4O5VA 3CC4T 4L59A 4MDWA 2DLPA 1VQ8A 2M9UA 3M0PA 4A53A 1PM3A 1M2VB 1JJ2P 4ZGEB 1SKUB 1X27A 4PJOD 1CKAA 2K2MA 4OMMA 2X4XA 4DBRA 3BW1A 4LDYA 4DBQA 1M90C 1VQKA 5KYWA 3M5AA 5FWCA 2QI2A 4C5GA 4LE9A 1M3CA 4JS4A 3X26B 4IUPA 5GANg 3REBB 1AWOA 4J9FA 1AD5A 1MUZA 1VQ8Q 2FZKB 2CP6A 2FRYA 3D7SB 4B9WA 2DTHA 2RQRA 4HXJA 4XU0A 1K9MU 5GAN7 4P5NA 5FLXE 2EYWA 1VQKQ 4PJOB 3RERA 2CT3A 4F04B 1FMWA 2DE0X 3M59A 1GRIA 1QVPA 2IG0A 4OVAA 2OAWA 4C92A 1ZLMA 4FT4A 3CMEA 2VB6A 4J6WA 5GMKm 1PHTA 1PWTA 1K9MR 1B7TA 3CPWA 4F7UF 1OX8A 1UHFA 2J6FA 3PIPA 3CXCA 1W2BA 1KHCA 3M0SA 2K4YA 1TUCA 2HBPA 1YJWT 5KE3A 3EGXA 3BDLA 3C95A 1MGQA 2LQ8A 5KE2A 1DJ7B 3VRZA 4X9CA 1WJRA 3CMEQ 5GAMd 1RLQC 2JMCA 2BE7D 1K8AU 2VV5A 3R6NA 3CC2A 3HL8A 4OMNA 3O8VA 1TS9A 1U5SA 2JM8A 5FU6C 2NUPA 4M7AF 3OSSC 2JS2A 1K9MC 2QA4A 5GANj 2V1RA 1WHKA 1K8AR 3H41A 2DXBA 5KYNA 3X24B 1SRLA 3UA6A 3H0HA 1ABQA 4DBHA 3CC2Q 4Z8AA 4OB0B 1K0XA 3EH1A 3CCUA 5LJ3e 3ZL7C 2GQIA 1XNIA 1NJIU 2X3WD 2YRVA 1U06A 2JVVA 4VUBA 2QA4Q 1FX7A 2EW3A 2XG8D 2QGFB 1WI7A 1ZA2B 4HA8A 3QWXX 4TVRA 3AHUA 1VIEA 2DNUA 1UJYA 4KULA 4A4EA 3JCMb 4M7AE 2DD4A 2VGNA 1Q7YU 2XK0A 2E6ZA 1K73C 3JCMe 2D8HA 1NJIR 3CCUQ 4C8QG 2PNIA 2K5FA 3CMAA 2MWOA 1WZOA 4QVZA 1TUDA 1UGVA 1H8KA 5FU6B 1W70A 3M54A 2KDSA 4B6MA 1S72A 3R6OA 1VQLA 1ZBXA 4BE1A 2QDYB 3V7CA 3C4SA 4C8QC 3OYIA 2BZYA 4KBMB 1Q7YR 3JB9G 3E19A 4CC2A 3OYMA 3QIIA 4D8DA 1D0ZA 2CGHA 5IXFA 5CK9A 3VV0A 3VS2A 1QLYA 2O4XA 4LNPA 3EFRA 3FJ5A 2FG0A 1N8RC 1H3ZA 2FO0A 4C8QD 1IGQA 1D1AA 4FL6A 5GANf 3V8LA 2RQUA 1QVFP 3CCMA 2JTMA 3OYGA 3OYAA 5DM7R 2DTIA 7AT1B 1KQSA 3RKXA 3JB9D 4N0AC 2ZPEB 3V8KA 1LOJA 1NYGA 3M4YA 3DB3A 2RPNA 5D7UA 3L2VA 1G83A 1LCKA 2PUKB 3ZFJA 2H3JA 3UT1A 1UGQB 4A63B 2KYBA 1Y7XA 2HKQB 2JUFA 1T3SA 3GNGA 1NZ9A 1YIJQ 1Q82U 1OU8A 1VQ4Q 2P0KA 4E2FB 4L5GA 4F7UB 3HRUA 3OYKA 3QJ6A 3E9FA 1SF9A 2M02A 3RMSA 2HNIA 5KYXB 1R0BG 4BY6C 2CS7A 5GANh 2C0IA 1UJ0A 3CCVT 4CC3A 3CPFA 1A0NB 3ASKA 4J9BA 2DRMA 4XU2A 1Q82R 1WHHA 2RI5A 3A8LB 2E10A 3EG2A 4M7DF 2RK2A 2V1QA 1XQHA 1TXQA 3MCAB 2LJ1A 4M77F 4F17A 5CKDA 2AZVA 4BACA 1JEGA 1RAGB 2MWPA 1YNZA 4FYVB 2YRCA 4C0DC 1JJ2S 2OTJA 2BKDN 1YITT 2COWA 2P0QA 3TCJA 2HKNA 1UDLA 4BB7A 4J9GA 4JRPA 3CCLA 3MP8A 2PTKA 2F1LA 2CZ0B 2MOXA 3MEWA 1RABB 4XQ3A 4QQGA 2KEAA 1OX9A 4PJMA 2DPPB 1G2BA 1G8XA 4FT2A 4RG2A 2J6OA 4M7DE 3OB9A 4BY6B 3CCSQ 5AT1B 1UG1A 2D6FA 4IUVA 1VQMA 1RAHB 4M77E 3CCLQ 2CP0A 1RI0A 1WPYA 2XIDA 3INZA 3QBYA 3M9QA 2DERA 2DD5A 3CCET 3CCJT 1VQ5A 2RNAA 1WDXA 2R58A 1YIJT 1VQ4T 1D3BA 2LJ3A 3OYFA 2KXDA 3OBWA 1HYOA 4JZ4A 3QG1A 3SWNC 5LJ5f 3C94A 5DLOA 4C0FA 4F16A 1VQMQ 1OQKA 5IHNA 2YSQA 4C0DB 4RMOA 2CZ6B 4M78G 2XDBA 1M1KU 3G7ZA 4GY5A 4KUIA 3P8HA 1V1CA 1I5LA 3MO8A 2KBTA 1VQ5Q 1ZUUA 4LUDA 4JPBW 3MP6A 4IURA 1KQ2A 4NOYA 2BIVA 1R0CB 4M78C 4CC4B 2ED0A 2KRMA 4ANJA 1ABOA 5GJWB 3EG0A 1HD3A 3I56T 3EHRA 1KD1R 5GAMe 1Y71A 1D09B 1YJNA 2B8AA 1C1AA 4XU3A 3G71Q 3VYHB 2GCXA 3CCQA 1BI1A 1M1KR 1ZQ1A 1YI2A 4LDVA 2DXCA 2ENMA 2K3BA 2RI2A 4RG8A 4HCCA 1M3AA 5CQXA 1NPRA 5LJ5e 1ZA1B 1IGUA 4M78D 2EJGA 2L3RA 3WVDB 2HL5C 1PSFA 2W0ZA 2SEMA 2WSCE 3RUXA 4A4FA 4X34A 1YJNQ 1Q86C 3CCQQ 2HQXA 1M5Q1 4K11A 1VQ6A 1YI2Q 4C5HA 2RHYA 4LXCA 3SWNB 3UPUA 4JJBA 3A8MB 3CCST 3TU4K 1KD1C 1ZHIA 4ZN3A 1VQ7A 3CC4A 3L2QA 2EQIA 2EYQA 5KYUA 4J9EA 3HP9A 5FW9A 2R5MA 3RESA 2IIMA 4M78B 4RTWA 3VS6A 1D0YA 2M16A 5KH6A 2VXEA 1BIBA 1VQ6Q 4J5YA 4RTZA 5GAOn 1JXOA 2XI9A 3EAEA 4DA4A 1QMCA 2FRWA 3VUZA 3EG9B 2KAFA 4ZN1A 4DOWA 1OPKA 1N27A 1KQ1A 4Y28E 1KK7A 1WHJA 2C06A 4QW2A 3E9GA 1IO6A 4BI4A 4HVVA 4EDUA 4XTVA 1RACB 3OY9A 4M4ZA 1QVFA 4J7FA 3OYNA 1Z9ZA 4AFSC 2CSQA 2KT1A 2DZCA 2P4RA 4XTUA 3G71T 4AG1C 5LJ3g 4E6RA 2LQNA 1EX4A 1QKXA 3LH0A 4KGXB 2JMAA 2NUZA 1GFCA 3JSCA 4LN2A 2YWWA 2GNCA 4C92F 3J81E 1M90U 1WXTA 1AHJB 2LNVA 2QDLA 4J83A 1AEYA 1RI9A 1YJWA 5CKEA 4E7JA 4FIBA 3JCMg 4DOVA 2QAZA 2HQHA 5GAN5 1JBMA 1B34B 3FRNA 4PJOG 2YRDA 2E65A 5GAOl 1P92A 2RHUA 3HRTA 3SB2A 2FB7A 4BI8B 2YHTA 3RKYA 4N4HA 3H0FA 1BCMA 2FZGB 4HVUA 1YJWQ 4PJOC 1PSEA 3KUFA 2ECZA 3A5ZB 2RQVA 1VA7A 1H3HA 2HSPA 2A36A 3DB4A 2QEXT 1JRIA 4C92E 2I0NA 2A37A 1UGRB 4IKFA 3OS5A 3VU3C 4J9CA 2HQEA 3EG3A 1OULA 2DA9A 1Y96A 2LC4A 4PFOA 2BZ8A 2EVRA 3JCMP 1TH7A 1PKSA 1BYMA 2FPEA 2X4YA 4J7IA 3FB9A 4HCZA 4MZTA 1VYTA 3OW2S 3VS0A 2M1HA 2DVJA 2QYZA 1WX6A 2K5LA 3PVLA 2EQMA 2CZ1B 4OMPA 3EH2A 1MMNA 2FYKA 1MNDA 2LDMA 1WLPB 2V8KA 2KT8A 3GNFB 2RK1A 3PE0A 4M75G 4KH0B 4EMKB 4GBQA 3VKIA 4J9HA 2PQWA 4Y92A 1VYUA 4JJCA 1VYVA 2ABLA 2RHXA 3CBPA 1RUWA 4M75C 2XU8A 3LLRA 2XHCA 1J3TA 2KQWA 1UHCA 2ROLA 3M4GA 3X28B 2CP2A 2IPOB 2A0FB 1GFDA 1QP3A 2L0AA 3RNJA 2H8HA 1ZX6A 2G6FX 4OB2B 3OYHA 2HZYA 2L5QA 4NS5A 5C0MA 4M75D 1VQOT 4E7LA 3HSBA 1D1BA 4RCCA 2CP5A 3GPLA 5KYWB 1XJWB 5FWBA 1SSHA 3QDRB 4CI0C 3KXTA 1K73U 1BBZA 2KMTA 4GLKA 4ZGJB 4E7SA 1BI3A 1Y07A 4PJJA 3CPWS 3CD6Q 4JUVA 3HTRA 3CXCS 1NPPA 2I2LA 1W2BS 1OZ2A 2AKLA 2AZSA 4LD6A 2E41A 2AK5A 2FEIA 3OYLA 3I55T 5LJ5d 1QWFA 2E70A 2JT4A 5CKFA 1QVGP 2DBMA 1XOVA 1K73R 3M0RA 4X1VA 2OAUA 4EMHA 1M30A 1UUEA 2CUDA 4M75B 1X75C 2COZA 3FJPA 2ESWA 1RAIB 1ZUYA 1N8RU 2CUBA 3PMIA 3QZ5B 3VRYA 2B86A 2QG9B 2R57A 1K4US 1QW1A 1IRXA 3CCVA 3EGXB 1YWPA 4Q5WA 2O2OA 1MNEA 2AKKA 2NLUA 1B07A 2DL5A 3URGA 1TTHB 4N4IA 2ZPIB 4BUGA 1N8RR 4BDZA 3TVTA 4R55A 2CT4A 1TSFA 1JXMA 1OI1A
chains in the Genus database with same CATH topology
2D1XA 2EYZA 2KR3A 1UDLA 2DMOA 2K79A 3IQLA 4J9GA 1PKTA 2EGAA 1NYFA 2JM9A 2PTKA 2OI3A 2J7IA 2MOXA 4F14A 3SHWA 2YUOA 5ECAA 2JTEA 3QWYA 2RQTA 3I5RA 2GTJA 2K6DA 2KEAA 4JJDA 1UTIA 1YCSB 2L3QA 2LZ6B 3I5SA 2HDAA 1G2BA 1JO8A 2J6OA 1QCFA 1UG1A 2DILA 2J05A 3NMZC 1CSKA 2LNHB 2EKHA 1WFWA 2F2WA 2RNAA 2SRCA 1AVZC 1WDXA 5HCKA 3UA7A 1GBRA 1GBQA 2RN8A 3EHQA 2E5KA 2DBKA 2GTOA 2LJ3A 5EC7A 1WXBA 2KXDA 2L3SA 4JZ4A 2YT6A 4RTYA 4F16A 1H92A 1M3BA 5IHNA 2YSQA 2PZ1A 5IH2A 1V1CA 1YWOA 2CDTA 1NEGA 1T3LA 2KBTA 1ZUUA 1WA7A 3M0UA 4LUDA 4JPBW 3TSZA 1TG0A 1EFNA 2DL7A 2DL8A 1OV3A 2XMFA 1JU5C 2C0OA 2KYMA 2W10A 1PNJA 1UFFA 3VS4A 4CC4B 1E7OA 1N5ZA 2ED0A 2GGRA 2KRMA 2DF6A 1ABOA 1KSWA 2J06A 1HD3A 3EG0A 5GJWB 3EHRA 2KXCA 2OJ2A 1OOTA 1X43A 1OEBA 2A08A 2HCKA 3KFVA 2MCNA 1SHFA 2HEQA 2DYBA 3VS3A 1PRLC 1OPLA 2ENMA 4QT7A 2K3BA 2DL4A 4WCIA 2KE9A 2ED1A 1M3AA 1BK2A 2K7AA 1K0SA 1RLPC 3TSWA 4DEYA 2EGCA 3NPFA 2W0ZA 3NGPA 2SEMA 4RTVA 2FPDA 2DL3A 2EGEA 2YUPA 1YP5A 2BTTA 2JW4A 2JXBA 4GLMA 2M0YA 2L2PA 5I11A 2FPFA 2K9GA 2X3XD 1UECA 2KRNA 4K11A 3C0CA 3UF4A 1NG2A 2RMOA 4JJBA 2DLPA 2O9VA 3M0TA 3EG1A 3M0PA 2VKNA 2LQWA 3GBQA 1AOJA 1X27A 2RQWA 1CKAA 2K2MA 4OMMA 2LCSA 2EYXA 2EQIA 4J9EA 3A98A 5FW9A 3I35A 1I1JA 4AFUC 2DX1A 5FWCA 2RF0A 1QKWA 2IIMA 4LE9A 4RTWA 3VS6A 1M3CA 3REBB 1AWOA 4J9FA 4RTZA 1JXOA 1AD5A 1MUZA 1HSQA 1AZGB 2FRWA 4KRTA 2FRYA 1OPKA 2RQRA 4HXJA 2J6KA 4AG2C 2EYWA 4LUEA 1IO6A 3EGUA 2O9SA 4HVVA 2CT3A 2DM1A 2DE0X 1GRIA 1WXUA 2OAWA 4M4ZA 2KRSA 1W1FA 1Z9ZA 1ZLMA 2LJ0A 4AFSC 2CSQA 2VVKA 2KT1A 2P4RA 5L23A 4AG1C 4E6RA 2LQNA 4IIOA 1PHTA 1QKXA 1PWTA 2KGTA 1GCQC 2JMAA 2NUZA 2O31A 1GFCA 1M8MA 3PVQA 2J6FA 1UHFA 2KNBB 4LN2A 4Z88A 2GNCA 1K9AA 3M0SA 1YN8A 1TUCA 1Y57A 4JZ3A 1GL5A 4IIMA 1KFZA 1WXTA 1CKBA 1AZEA 2QDLA 1X6GA 2BZXA 1AEYA 1RI9A 3VRZA 1AWJA 1Y0MA 1RLQC 2JMCA 3THKA 2CSIA 2CH4A 2CH4W 3R6NA 4EIKA 1SPKA 4OMNA 2D0NA 1U5SA 2YDLA 3REAB 4ORZA 2JM8A 2LX7A 1FMKA 4FSSA 4HVWA 2MIOA 2JS2A 3H0FA 4HVUA 2V1RA 2ECZA 3SEMA 1MV3A 2EYYA 1M27C 1S1NA 2DRKA 4RTUA 3VS7A 2RQVA 4HCKA 1VA7A 1H3HA 3H41A 2HSPA 2A36A 1SRLA 3VS1A 3UA6A 3H0HA 2I0NA 1ABQA 2VWFA 1K76A 2A37A 4AFQC 5I22A 1JQQA 3NHNA 4Z8AA 3LH5A 1K0XA 1E6GA 4J9DA 4J9CA 3EG3A 2GBQA 1U3OA 2DA9A 1I0CA 4RTTA 3ZL7C 2GQIA 2X3WD 1U06A 2BZ8A 2EVRA 1NEBA 1PKSA 2FPEA 1ZUKA 2EW3A 1VYTA 1Z9QA 4J9IA 1WI7A 1NLPC 5IXBA 3QWXX 3VS0A 2DNUA 1UJYA 2NWMA 3H0IA 1FYNA 2DVJA 1WX6A 4R0KA 3PVLA 1T0HA 3U23A 4OMPA 3JV3A 2D8HA 3RBBB 2PNIA 1WLPB 1TUDA 1ZBJA 1UGVA 1H8KA 2KT8A 1W70A 3PE0A 1NLOC 2LMJA 1WYXA 2LP5A 4GBQA 2D8JA 4J9HA 4Y92A 1VYUA 3CQTA 2BZYA 4JJCA 1VYVA 4OMQA 2ABLA 1RUWA 4CC2A 4D8KA 4ZNXA 1J3TA 4D8DA 2O88A 1PRMC 5IXFA 1I07A 4Z89A 3VS2A 1QLYA 2F2VA 1UHCA 4LNPA 2ROLA 3FJ5A 2FG0A 1WIEA 2YUNA 2FO0A 1GFDA 1UE9A 2L0AA 3RNJA 2RQUA 2CREA 2H8HA 1ZX6A 2G6FX 4RTXA 1W6XA 1X2KA 2JS0A 3ULRB 5FWBA 2M51A 1SSHA 1ZSGA 1BBZA 1GCQA 1QWEA 1ARKA 3I9QA 1NYGA 4DEXA 2RPNA 3UATA 2AKLA 2KROA 1G83A 1NM7A 2AZSA 1LCKA 2AK5A 2FEIA 3M0QA 1HJDA 1QWFA 5IHKA 1MV0B 4OMOA 2F2XA 2JT4A 1SRMA 1X2QA 2KYBA 4A63B 1T3SA 2DBMA 1AWWA 1XOVA 1SEMA 2YUQA 3M0RA 4X1VA 1BU1A 4ESRA 1M30A 1K1ZA 2A28A 1UUEA 2CUDA 4RUGA 1SHGA 2ESWA 5GJVB 1ZUYA 2C0IA 2CUBA 1UJ0A 4CC3A 2EBPA 3VRYA 1A0NB 2EPDA 2ROTA 4J9BA 2B86A 2DRMA 2L3PA 1GCPA 4OMLA 1K4US 2HBWA 3EG2A 1YWPA 4AFZC 2O2OA 2V1QA 1E6HA 1T0JA 2AKKA 1X69A 1B07A 2DL5A 2LJ1A 4F17A 2DJQA 1KJWA 1X6BA 3VS5A 1B3QA 2AZVA 1JEGA 3TVTA 1YNZA 1KIKA 3O5ZA 1BB9A 2C0TA 2CT4A 5IHIA 4CC7A 1AWXA 1JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1X A;  2EYZ A;  2KR3 A;  1UDL A;  2DMO A;  2K79 A;  3IQL A;  4J9G A;  1PKT A;  2EGA A;  1NYF A;  2JM9 A;  2PTK A;  2OI3 A;  2J7I A;  2MOX A;  4F14 A;  3SHW A;  2YUO A;  5ECA A;  2JTE A;  3QWY A;  2RQT A;  3I5R A;  2GTJ A;  2K6D A;  2KEA A;  4JJD A;  1UTI A;  1YCS B;  2L3Q A;  2LZ6 B;  3I5S A;  2HDA A;  1G2B A;  1JO8 A;  2J6O A;  1QCF A;  1UG1 A;  2DIL A;  2J05 A;  3NMZ C;  1CSK A;  2LNH B;  2EKH A;  1WFW A;  2F2W A;  2RNA A;  2SRC A;  1AVZ C;  1WDX A;  5HCK A;  3UA7 A;  1GBR A;  1GBQ A;  2RN8 A;  3EHQ A;  2E5K A;  2DBK A;  2GTO A;  2LJ3 A;  5EC7 A;  1WXB A;  2KXD A;  2L3S A;  4JZ4 A;  2YT6 A;  4RTY A;  4F16 A;  1H92 A;  1M3B A;  5IHN A;  2YSQ A;  2PZ1 A;  5IH2 A;  1V1C A;  1YWO A;  2CDT A;  1NEG A;  1T3L A;  2KBT A;  1ZUU A;  1WA7 A;  3M0U A;  4LUD A;  4JPB W;  3TSZ A;  1TG0 A;  1EFN A;  2DL7 A;  2DL8 A;  1OV3 A;  2XMF A;  1JU5 C;  2C0O A;  2KYM A;  2W10 A;  1PNJ A;  1UFF A;  3VS4 A;  4CC4 B;  1E7O A;  1N5Z A;  2ED0 A;  2GGR A;  2KRM A;  2DF6 A;  1ABO A;  1KSW A;  2J06 A;  1HD3 A;  3EG0 A;  5GJW B;  3EHR A;  2KXC A;  2OJ2 A;  1OOT A;  1X43 A;  1OEB A;  2A08 A;  2HCK A;  3KFV A;  2MCN A;  1SHF A;  2HEQ A;  2DYB A;  3VS3 A;  1PRL C;  1OPL A;  2ENM A;  4QT7 A;  2K3B A;  2DL4 A;  4WCI A;  2KE9 A;  2ED1 A;  1M3A A;  1BK2 A;  2K7A A;  1K0S A;  1RLP C;  3TSW A;  4DEY A;  2EGC A;  3NPF A;  2W0Z A;  3NGP A;  2SEM A;  4RTV A;  2FPD A;  2DL3 A;  2EGE A;  2YUP A;  1YP5 A;  2BTT A;  2JW4 A;  2JXB A;  4GLM A;  2M0Y A;  2L2P A;  5I11 A;  2FPF A;  2K9G A;  2X3X D;  1UEC A;  2KRN A;  4K11 A;  3C0C A;  3UF4 A;  1NG2 A;  2RMO A;  4JJB A;  2DLP A;  2O9V A;  3M0T A;  3EG1 A;  3M0P A;  2VKN A;  2LQW A;  3GBQ A;  1AOJ A;  1X27 A;  2RQW A;  1CKA A;  2K2M A;  4OMM A;  2LCS A;  2EYX A;  2EQI A;  4J9E A;  3A98 A;  5FW9 A;  3I35 A;  1I1J A;  4AFU C;  2DX1 A;  5FWC A;  2RF0 A;  1QKW A;  2IIM A;  4LE9 A;  4RTW A;  3VS6 A;  1M3C A;  3REB B;  1AWO A;  4J9F A;  4RTZ A;  1JXO A;  1AD5 A;  1MUZ A;  1HSQ A;  1AZG B;  2FRW A;  4KRT A;  2FRY A;  1OPK A;  2RQR A;  4HXJ A;  2J6K A;  4AG2 C;  2EYW A;  4LUE A;  1IO6 A;  3EGU A;  2O9S A;  4HVV A;  2CT3 A;  2DM1 A;  2DE0 X;  1GRI A;  1WXU A;  2OAW A;  4M4Z A;  2KRS A;  1W1F A;  1Z9Z A;  1ZLM A;  2LJ0 A;  4AFS C;  2CSQ A;  2VVK A;  2KT1 A;  2P4R A;  5L23 A;  4AG1 C;  4E6R A;  2LQN A;  4IIO A;  1PHT A;  1QKX A;  1PWT A;  2KGT A;  1GCQ C;  2JMA A;  2NUZ A;  2O31 A;  1GFC A;  1M8M A;  3PVQ A;  2J6F A;  1UHF A;  2KNB B;  4LN2 A;  4Z88 A;  2GNC A;  1K9A A;  3M0S A;  1YN8 A;  1TUC A;  1Y57 A;  4JZ3 A;  1GL5 A;  4IIM A;  1KFZ A;  1WXT A;  1CKB A;  1AZE A;  2QDL A;  1X6G A;  2BZX A;  1AEY A;  1RI9 A;  3VRZ A;  1AWJ A;  1Y0M A;  1RLQ C;  2JMC A;  3THK A;  2CSI A;  2CH4 A;  2CH4 W;  3R6N A;  4EIK A;  1SPK A;  4OMN A;  2D0N A;  1U5S A;  2YDL A;  3REA B;  4ORZ A;  2JM8 A;  2LX7 A;  1FMK A;  4FSS A;  4HVW A;  2MIO A;  2JS2 A;  3H0F A;  4HVU A;  2V1R A;  2ECZ A;  3SEM A;  1MV3 A;  2EYY A;  1M27 C;  1S1N A;  2DRK A;  4RTU A;  3VS7 A;  2RQV A;  4HCK A;  1VA7 A;  1H3H A;  3H41 A;  2HSP A;  2A36 A;  1SRL A;  3VS1 A;  3UA6 A;  3H0H A;  2I0N A;  1ABQ A;  2VWF A;  1K76 A;  2A37 A;  4AFQ C;  5I22 A;  1JQQ A;  3NHN A;  4Z8A A;  3LH5 A;  1K0X A;  1E6G A;  4J9D A;  4J9C A;  3EG3 A;  2GBQ A;  1U3O A;  2DA9 A;  1I0C A;  4RTT A;  3ZL7 C;  2GQI A;  2X3W D;  1U06 A;  2BZ8 A;  2EVR A;  1NEB A;  1PKS A;  2FPE A;  1ZUK A;  2EW3 A;  1VYT A;  1Z9Q A;  4J9I A;  1WI7 A;  1NLP C;  5IXB A;  3QWX X;  3VS0 A;  2DNU A;  1UJY A;  2NWM A;  3H0I A;  1FYN A;  2DVJ A;  1WX6 A;  4R0K A;  3PVL A;  1T0H A;  3U23 A;  4OMP A;  3JV3 A;  2D8H A;  3RBB B;  2PNI A;  1WLP B;  1TUD A;  1ZBJ A;  1UGV A;  1H8K A;  2KT8 A;  1W70 A;  3PE0 A;  1NLO C;  2LMJ A;  1WYX A;  2LP5 A;  4GBQ A;  2D8J A;  4J9H A;  4Y92 A;  1VYU A;  3CQT A;  2BZY A;  4JJC A;  1VYV A;  4OMQ A;  2ABL A;  1RUW A;  4CC2 A;  4D8K A;  4ZNX A;  1J3T A;  4D8D A;  2O88 A;  1PRM C;  5IXF A;  1I07 A;  4Z89 A;  3VS2 A;  1QLY A;  2F2V A;  1UHC A;  4LNP A;  2ROL A;  3FJ5 A;  2FG0 A;  1WIE A;  2YUN A;  2FO0 A;  1GFD A;  1UE9 A;  2L0A A;  3RNJ A;  2RQU A;  2CRE A;  2H8H A;  1ZX6 A;  2G6F X;  4RTX A;  1W6X A;  1X2K A;  2JS0 A;  3ULR B;  5FWB A;  2M51 A;  1SSH A;  1ZSG A;  1BBZ A;  1GCQ A;  1QWE A;  1ARK A;  3I9Q A;  1NYG A;  4DEX A;  2RPN A;  3UAT A;  2AKL A;  2KRO A;  1G83 A;  1NM7 A;  2AZS A;  1LCK A;  2AK5 A;  2FEI A;  3M0Q A;  1HJD A;  1QWF A;  5IHK A;  1MV0 B;  4OMO A;  2F2X A;  2JT4 A;  1SRM A;  1X2Q A;  2KYB A;  4A63 B;  1T3S A;  2DBM A;  1AWW A;  1XOV A;  1SEM A;  2YUQ A;  3M0R A;  4X1V A;  1BU1 A;  4ESR A;  1M30 A;  1K1Z A;  2A28 A;  1UUE A;  2CUD A;  4RUG A;  1SHG A;  2ESW A;  5GJV B;  1ZUY A;  2C0I A;  2CUB A;  1UJ0 A;  4CC3 A;  2EBP A;  3VRY A;  1A0N B;  2EPD A;  2ROT A;  4J9B A;  2B86 A;  2DRM A;  2L3P A;  1GCP A;  4OML A;  1K4U S;  2HBW A;  3EG2 A;  1YWP A;  4AFZ C;  2O2O A;  2V1Q A;  1E6H A;  1T0J A;  2AKK A;  1X69 A;  1B07 A;  2DL5 A;  2LJ1 A;  4F17 A;  2DJQ A;  1KJW A;  1X6B A;  3VS5 A;  1B3Q A;  2AZV A;  1JEG A;  3TVT A;  1YNZ A;  1KIK A;  3O5Z A;  1BB9 A;  2C0T A;  2CT4 A;  5IHI A;  4CC7 A;  1AWX A;  1JXM A; 
#chains in the Genus database with same CATH topology
 4E7Z A;  1TU0 B;  1UGP B;  2KR3 A;  2NUP B;  5LJ3 h;  3CCV Q;  3IQL A;  4HKE A;  4F7U G;  1YIT A;  1PKT A;  2EGA A;  2JM9 A;  4ZTF A;  2OI3 A;  1WJQ A;  2K3X A;  2QAS A;  2HMA A;  3QZ9 B;  4F14 A;  2JTE A;  2XKO C;  2QK0 A;  5CKB A;  5HK0 A;  4JJD A;  1YCS B;  3S3O A;  3S6W A;  2LZ6 B;  2DO3 A;  2HDA A;  3CD6 T;  3JCM h;  2DIL A;  1U8R A;  2YXY A;  1I4K 1;  4OB3 B;  3H6Z A;  4C8Q A;  2EWN A;  2DYI A;  1YIT Q;  2MPX C;  1O9S A;  1VQ9 Q;  4M7A G;  3P8B B;  5GMK i;  2F2W A;  1XTD A;  4XTY A;  4PK4 A;  2ATC B;  1GBQ A;  3GIB A;  2RN8 A;  4WF2 A;  5KYX A;  3CCE A;  3CCJ A;  2L3S A;  1YIJ A;  5GAN 6;  1VQ4 A;  4M7A C;  2YLB A;  2EQK A;  4RTY A;  4PFZ A;  3FC3 A;  1NEG A;  3OYJ A;  1WA7 A;  3M0U A;  3TSZ A;  1KHI A;  1EFN A;  2DL7 A;  1WGS A;  1OV3 A;  1JU5 C;  2DFU A;  1N6A A;  1PNJ A;  1RAA B;  3CCE Q;  3CCJ Q;  1E7O A;  1N5Z A;  2L8D A;  1G3S A;  2GGR A;  2DF6 A;  3MJX A;  1KQS S;  4N0A A;  2E6N A;  4M7A D;  4B9X A;  1KG1 A;  1U1S A;  5GAN e;  2FHD A;  1OOT A;  2A08 A;  2HCK A;  2MCN A;  3ME9 A;  3I56 A;  1SHF A;  4C0G A;  3BDU A;  4NL3 A;  2O4X B;  1WHG A;  2ED1 A;  1Q81 C;  1BK2 A;  2GFA A;  4IUT A;  4DEY A;  4D6W A;  2EGC A;  3QDF A;  2EKO A;  2P84 A;  3NGP A;  4PJN A;  3M57 A;  3C12 A;  4C5E A;  1YP5 A;  2JW4 A;  3V8J A;  1WQW A;  2L2P A;  2FPF A;  2X3X D;  3J7A F;  1RAF B;  3I56 Q;  4QVC A;  3UF4 A;  2GF7 A;  4L6V 5;  1BI0 A;  4M7A B;  2RMO A;  3NTI A;  3M0T A;  1RAD B;  3GBQ A;  2RQW A;  4QKU A;  2LCS A;  1SSF A;  5CKH A;  3JCM Q;  3CCS A;  1VQ9 T;  3PTA A;  1I1J A;  4AFU C;  3CCR T;  1VQN Q;  1C6V X;  5CIU A;  1QKW A;  2Y90 A;  2YLC A;  4HT8 A;  4FYY B;  4KRT A;  3J80 E;  5I2M A;  4A54 A;  3G6E T;  5GAO p;  2J6K A;  3N5B B;  1YHQ T;  4XTW A;  3UWN A;  2ZPF B;  3EGU A;  5I21 A;  2JJ9 A;  2CYZ B;  1LJO A;  2KK4 A;  1U1T A;  4OGE A;  3JCM c;  1WXU A;  2NYS A;  5KCH A;  3EFS A;  1Q86 U;  2LJ0 A;  3M56 A;  6AT1 B;  5L23 A;  2PU9 B;  4IIO A;  1BKB A;  2VC8 A;  2KGT A;  5GAN 8;  1GCQ C;  1KD1 U;  4PL6 A;  5AYF A;  3G71 A;  3PVQ A;  1K9A A;  2KVQ G;  2AIR B;  1Y57 A;  4JZ3 A;  4JS5 A;  4IIM A;  1KFZ A;  5KYY B;  2CP3 A;  4CRI A;  1Q86 R;  3M55 A;  5GAO r;  1QVG A;  3TQ7 P;  3VUB A;  2RJC A;  4M7D G;  3SWN A;  2CH4 A;  3S3M A;  2JNG A;  4EIK A;  2GFU A;  4M77 G;  3X25 B;  3G4S T;  2DXT A;  2JN0 A;  2D0N A;  3REA B;  4ORZ A;  4M7D C;  2LX7 A;  1FMK A;  4HVW A;  1VQP T;  2MIO A;  3F70 A;  1QCO A;  4M78 A;  3EGD A;  4M77 C;  3OYY A;  5FRO A;  1VQN T;  3VS7 A;  2DRK A;  3P8D A;  1IHW A;  2A7Y A;  3VS1 A;  3MHX A;  2VWF A;  4AFQ C;  5I22 A;  1D3B B;  4LDX A;  1JQQ A;  3EG9 A;  3WXM B;  1G3Y A;  3LH5 A;  2QEX A;  5GAM h;  4M7D D;  1E6G A;  4HT9 A;  5FRN A;  2KY9 A;  2GBQ A;  1U3O A;  2QQ9 A;  1I0C A;  2RH2 A;  4PJL A;  4RTT A;  4DQ2 A;  3HKS A;  1M9S A;  1NEB A;  4M77 D;  2EFI A;  1ZUK A;  2X9H A;  4KH1 B;  1Z9Q A;  2K3Y A;  5IXB A;  5CCA A;  2D9T A;  3SDZ A;  5DY9 A;  3H0I A;  4R0K A;  4PNO A;  3OYE A;  2QEX Q;  2OTJ T;  1T0H A;  1YCY A;  2RM4 A;  2DAQ A;  2RHI A;  3JV3 A;  4MMK A;  4LDW A;  3T9N A;  1ZBJ A;  1KC8 R;  4E47 A;  4MDX A;  1WNL A;  2F69 A;  5D6X A;  4M7D B;  3QXE B;  2LMJ A;  3MPU B;  1WYX A;  2ZAE A;  2LP5 A;  3V7S A;  4XU1 A;  4M77 B;  2OTL T;  3OQ5 A;  4OMQ A;  1IRE B;  4D8K A;  4IUU A;  2XDD A;  4ZNX A;  2O88 A;  1PRM C;  2E1H A;  2AHJ B;  4J6Y A;  2O01 E;  4Z89 A;  4OF1 A;  2F5K A;  3GLX A;  5GMK e;  3VYG A;  3UDC A;  1WIE A;  3HHT B;  4FU6 A;  2PVD B;  1ZSZ A;  2HAX A;  4RCB A;  4RTX A;  1KC8 C;  3JB9 H;  2LX9 A;  1QVF S;  4DBF A;  4KT0 E;  2M51 A;  3LGL A;  4Z02 A;  1VQO A;  5GAN d;  5J39 A;  2EIF A;  1QWE A;  3OYC A;  1PD1 A;  3H9N A;  3I9Q A;  1ARK A;  1M2V A;  3UAT A;  2JOY A;  4XK8 E;  3OS2 A;  1NM7 A;  3JCM X;  4JRK A;  3M0Q A;  3QJY A;  3L42 A;  1HJD A;  5IHK A;  4ZGD B;  4EMK C;  2F2X A;  1SRM A;  1X2Q A;  1IZ6 A;  2YUQ A;  1BU1 A;  1VQO Q;  1K1Z A;  1IB8 A;  3CC7 T;  1SHG A;  4XTX A;  3M53 A;  1TOV A;  4FYX B;  3SFM A;  3A8G B;  1C0M A;  2EBP A;  2E12 A;  3ER0 A;  4PJO A;  2WAC A;  4FW1 A;  1NBE B;  4OML A;  5GAO m;  3I55 Q;  4JJN K;  2HBW A;  2Z0W A;  1E6H A;  5I2S A;  5LJ3 j;  1IXD A;  3CBM A;  2DJQ A;  3NFC A;  3VS5 A;  1B3Q A;  1VUB A;  2K5I A;  1KIK A;  3OYD A;  1BB9 A;  2HL3 A;  2C0T A;  3CEY A;  3OBY A;  1RAE B;  2MF2 A;  3JCM V;  4A4K A;  4OGC A;  4C92 G;  2J7I A;  3H8Z A;  3QWY A;  1UGS B;  2L89 A;  3NTK A;  5GMK l;  5A2Q E;  2X35 A;  2GTJ A;  2D0Q B;  2NUT B;  1M1F A;  1OYX A;  1UTI A;  2DK3 A;  3PMT A;  4C92 C;  1FMV A;  1QCF A;  3L1A A;  5IT9 E;  3EFO B;  4BE0 A;  3CD6 A;  1Y96 B;  1MHN A;  1EIF A;  2LNH B;  2MAM A;  3G1J A;  4NL2 A;  2V8J A;  2PUO B;  4M75 A;  3UA7 A;  1GBR A;  3EHQ A;  2E5K A;  4C8Q F;  2GTO A;  4C92 D;  3OA6 A;  4ZTJ A;  5LL6 S;  2YT6 A;  2V26 A;  1H92 A;  4BE2 A;  5A0G A;  2PZ1 A;  4FW2 A;  4BI3 A;  2CDT A;  2ZPH B;  1T3L A;  1OU9 A;  3CBO A;  4PFP A;  3JB9 F;  2XMF A;  4OB1 B;  3AT1 B;  2DJZ A;  2C0O A;  2W10 A;  2E4H A;  1YJ9 T;  3VS4 A;  4UC4 A;  3S3N A;  5LJ3 f;  4N4G A;  4KGZ B;  2PVO B;  4Y91 A;  4AMC A;  4ELZ C;  2J06 A;  2CKK A;  3KBG A;  3MET A;  4LD9 K;  3DKM A;  3A8H B;  1OEB A;  2FVU A;  4C92 B;  2DYB A;  5A0L A;  1YFN A;  3VS3 A;  1PRL C;  1OPL A;  1QP2 A;  2ZPB B;  5GAO q;  4C8Q E;  4J8O A;  1BIA A;  1K0S A;  1RLP C;  3TSW A;  3JCM f;  3NPF A;  2VYT A;  5A0D A;  3MEV A;  4F7U E;  3JCM W;  2FPD A;  2RJF A;  2E3H A;  2EGE A;  2YUP A;  2BTT A;  3LWI A;  3PT9 A;  2M0Y A;  1D0X A;  4J6X A;  1VQ8 T;  1BI2 A;  4ATO A;  3OS1 A;  4QQD A;  1UEC A;  2KRN A;  1LPL A;  3RDV A;  1LVK A;  1R77 A;  4JRI A;  1PG5 B;  4JLI A;  2O9V A;  3EG1 A;  4KUD K;  2QQR A;  2VKN A;  2LQW A;  1AOJ A;  2F5T X;  2Y4Y A;  4PLL A;  3M58 A;  1VQK T;  3QYG B;  2QQB A;  3JB9 J;  2EYX A;  4OMF B;  1YBY A;  5CVI A;  2KI7 A;  3A98 A;  4HCB A;  2LT4 A;  3I35 A;  2DEU A;  3FIF A;  2DX1 A;  2RF0 A;  1O75 A;  1VQ9 A;  5GAM g;  2QQA A;  1HK9 A;  3CCR A;  2HD0 A;  1K8A C;  1HXD A;  2XD0 A;  5CR2 A;  2EJF A;  4XTZ A;  2K2V A;  1HSQ A;  2X4W A;  1AZG B;  5L8R E;  2EAY A;  1I8F A;  4FSX A;  4JDS A;  4MML A;  2KSS A;  1Q81 U;  4IUQ A;  5HKC A;  5LJ5 g;  4AG2 C;  3NTH A;  4JRQ A;  3G6E A;  5DLQ E;  1F1B B;  4LUE A;  2O9S A;  2P0P A;  1OZ3 A;  2DM1 A;  5CO7 A;  1YHQ A;  3TEE A;  3CME T;  2IVW A;  4E7H A;  3CCR Q;  4F7U A;  2VUB A;  3ZBD A;  2KRS A;  1W1F A;  8AT1 B;  1GXI E;  3CMA Q;  2VVK A;  1H64 1;  3JCM J;  4BDY A;  3HFO A;  1S72 Q;  1Q81 R;  1VQL Q;  4RKU E;  2DZ9 A;  2O31 A;  1M8M A;  3G6E Q;  2KNB B;  1NJI C;  2DXU A;  4Z88 A;  2QXF A;  1YN8 A;  1GL5 A;  1YHQ Q;  2EJ9 A;  4PKC C;  5IN1 A;  1CKB A;  5J3B A;  1AZE A;  1X6G A;  2BZX A;  5IAY A;  4BD3 A;  3L2U A;  1AWJ A;  1Y0M A;  3CC2 T;  4M7A A;  3THK A;  1FXX A;  2CSI A;  3DLL A;  1Q7Y C;  2JTF A;  2FZC B;  3LX7 A;  2CH4 W;  2R5A A;  1SPK A;  1VIF A;  2YDL A;  2MYS A;  3PFS A;  2QA4 T;  4MZP A;  3JB9 I;  2LCC A;  2RB6 A;  4FSS A;  3CCM Q;  3G4S A;  9ATC B;  4C8Q B;  2DIG A;  1MMD A;  4EMG A;  5GAM j;  5GAN 3;  1VQP A;  2CP7 A;  3FDR A;  2XDP A;  3SEM A;  1MV3 A;  1S1N A;  1M27 C;  2EYY A;  4RTU A;  2RD1 A;  4HCK A;  5FU7 C;  4A4G A;  1UB4 A;  5D6Y A;  1VQN A;  1K76 A;  5HY6 A;  2DIQ A;  2LTO A;  3CCU T;  2H3E B;  3NHN A;  4M78 F;  2X4J A;  5LJ5 j;  4XAX B;  2EQJ A;  2JZ2 A;  4FYW B;  4J9D A;  2GQV A;  3G4S Q;  1R8O B;  2WSE E;  3HPW A;  3PNW C;  5C6S A;  1JJ2 A;  4E7K A;  4X9D A;  3OW2 P;  1VQP Q;  2DTO A;  4KGV B;  2LRQ A;  5EG2 A;  1FWZ A;  3MKD A;  4J9I A;  1NLP C;  3GP8 A;  2QGG A;  2NWM A;  1WQ7 A;  1FYN A;  2HSE B;  3A8O B;  4O6J A;  3U23 A;  3CMA T;  3X20 B;  3RBB B;  2OX7 A;  1S72 T;  1QCN A;  5KCO A;  3LGF A;  4AT1 B;  1VQL T;  5KYY A;  1NLO C;  3QKJ A;  3MEU A;  2QQS A;  1PD0 A;  3L2W A;  2D8J A;  2LQK A;  3GF5 A;  4M78 E;  1M4Z A;  4C5I A;  1NE8 A;  3HRS A;  3CQT A;  4C0Z A;  2LCL A;  2FL7 A;  5FU7 B;  1Q82 C;  4A4H A;  2ZZD A;  1WHL A;  2OTL A;  2A3L A;  4ME7 A;  2OTJ Q;  1I07 A;  2E5Q A;  2F2V A;  2QTX A;  1WHM A;  1M1G A;  2RJE A;  4YTL A;  2YUN A;  3CCM T;  1PCX A;  3ZEH A;  3RIR A;  1TWB A;  5GAM f;  1UE9 A;  1ACM B;  2CRE A;  1W6X A;  2VAS A;  1X2K A;  3V7R A;  5GMK j;  2JS0 A;  2DEQ A;  3ULR B;  2OTL Q;  3BFM A;  5M9O A;  2V8I A;  1ZSG A;  3OSV A;  1GCQ A;  1W4S A;  3MEA A;  3QYH B;  3CPW P;  1I81 A;  1X6O A;  2WSF E;  3CXC P;  1RL2 A;  1W2B P;  2G3R A;  1TUG B;  4DEX A;  3JAM E;  2ZPG B;  3OYB A;  2RO0 A;  2KRO A;  5D6W A;  4ELY C;  2DKG A;  3OMC A;  5HK3 A;  1G3W A;  1MV0 B;  4OMO A;  4OP0 A;  1QVG S;  1AWW A;  1SEM A;  3E2U A;  1Q95 G;  4ESR A;  1EZZ B;  4LDU A;  2A28 A;  4RUG A;  5FRM A;  2RI3 A;  4II1 A;  4M7D A;  5LJ3 d;  3CC7 A;  5GJV B;  2Y4X A;  2RHZ A;  2EPD A;  2ROT A;  3BE3 A;  4M77 A;  2L3P A;  1GCP A;  2E64 A;  2LVM A;  1KC8 U;  1G5V A;  1WJS A;  4AFZ C;  1T0J A;  3RMQ A;  3FEO A;  1X69 A;  4QQ6 A;  5LJ5 h;  2DET A;  4PLI A;  4PJO F;  1M8V A;  3JCM d;  3Q1J A;  1KJW A;  4V2S A;  1X6B A;  2MI6 A;  5CQY A;  3CC7 Q;  3DLM A;  3O5Z A;  8ATC B;  3LW5 E;  5IHI A;  3WVE B;  4CC7 A;  1AWX A;  2COY A;  3CCL T;  2D1X A;  1M1K C;  2EYZ A;  2X51 A;  1UEB A;  2DMO A;  1VOM A;  2DVE A;  2K79 A;  4R56 A;  1MMG A;  1NYF A;  3EGD B;  5J26 A;  4E7I A;  3E1S A;  3PGG A;  3FLG A;  2YUO A;  5ECA A;  3SHW A;  3MP1 A;  2RQT A;  1MMA A;  3I5R A;  2MK5 A;  1IHV A;  2PVG B;  2K6D A;  1B34 A;  1N9S A;  2L3Q A;  2CZ7 B;  2E3I A;  3I5S A;  1VQ7 Q;  1VQM T;  3CC4 Q;  1JO8 A;  3RKW A;  3LWH A;  5GAN 2;  1I5O B;  2J05 A;  1VQ5 T;  3NMZ C;  3TRE A;  4PJO E;  3BY7 A;  1CSK A;  2QTV A;  2EKH A;  1ZSZ C;  1X01 A;  1WFW A;  2SRC A;  2BUD A;  1AVZ C;  3PIO A;  5HCK A;  5KYU B;  2MMP A;  1JB0 E;  1LNX A;  2LT1 A;  3L2R A;  2EQU A;  2VXF A;  1M2O A;  2DBK A;  2K57 A;  3JRZ A;  5EC7 A;  2XIC A;  1WXB A;  4QVD A;  3L2Z A;  3A1P A;  1SG5 A;  4M75 F;  1M3B A;  2ZGW A;  2AT1 B;  1QQJ A;  5IH2 A;  5GMK h;  2RJD A;  1YWO A;  4EPC A;  5CAI A;  1N9R A;  1TG0 A;  3QHS A;  2DL8 A;  4FCY A;  2M0O A;  2KYM A;  3OS0 A;  1UFF A;  1YJN T;  1KQS P;  3CCQ T;  3I55 A;  1KSW A;  2KXC A;  2ZCF B;  1YI2 T;  1YJ9 A;  2OJ2 A;  3LYI A;  3RR6 A;  1X43 A;  3HFN A;  3KFV A;  1BCO A;  2HEQ A;  1M90 R;  3OMG A;  3QPH A;  4QT7 A;  2DL4 A;  4MZM A;  2P4T A;  1PC0 A;  4WCI A;  2KE9 A;  1D1C A;  4FM4 B;  4EMK A;  1AT1 B;  3QUI A;  1V76 A;  3SD4 A;  2K7A A;  1ZSZ B;  4RTV A;  4M75 E;  3VJP A;  3GOX A;  3QO3 A;  3OW2 A;  2NUT A;  2DL3 A;  1VQ6 T;  1V29 B;  4WTO B;  2JXB A;  1YJ9 Q;  2BE9 B;  4GLM A;  4JLG A;  5I11 A;  2RA2 A;  2K9G A;  3QSU A;  3C0C A;  2VGM A;  1G3T A;  1VQ7 T;  5GAN 4;  1NG2 A;  3EFO A;  4O5V A;  3CC4 T;  4L59 A;  4MDW A;  2DLP A;  1VQ8 A;  2M9U A;  3M0P A;  4A53 A;  1PM3 A;  1M2V B;  1JJ2 P;  4ZGE B;  1SKU B;  1X27 A;  4PJO D;  1CKA A;  2K2M A;  4OMM A;  2X4X A;  4DBR A;  3BW1 A;  4LDY A;  4DBQ A;  1M90 C;  1VQK A;  5KYW A;  3M5A A;  5FWC A;  2QI2 A;  4C5G A;  4LE9 A;  1M3C A;  4JS4 A;  3X26 B;  4IUP A;  5GAN g;  3REB B;  1AWO A;  4J9F A;  1AD5 A;  1MUZ A;  1VQ8 Q;  2FZK B;  2CP6 A;  2FRY A;  3D7S B;  4B9W A;  2DTH A;  2RQR A;  4HXJ A;  4XU0 A;  1K9M U;  5GAN 7;  4P5N A;  5FLX E;  2EYW A;  1VQK Q;  4PJO B;  3RER A;  2CT3 A;  4F04 B;  1FMW A;  2DE0 X;  3M59 A;  1GRI A;  1QVP A;  2IG0 A;  4OVA A;  2OAW A;  4C92 A;  1ZLM A;  4FT4 A;  3CME A;  2VB6 A;  4J6W A;  5GMK m;  1PHT A;  1PWT A;  1K9M R;  1B7T A;  3CPW A;  4F7U F;  1OX8 A;  1UHF A;  2J6F A;  3PIP A;  3CXC A;  1W2B A;  1KHC A;  3M0S A;  2K4Y A;  1TUC A;  2HBP A;  1YJW T;  5KE3 A;  3EGX A;  3BDL A;  3C95 A;  1MGQ A;  2LQ8 A;  5KE2 A;  1DJ7 B;  3VRZ A;  4X9C A;  1WJR A;  3CME Q;  5GAM d;  1RLQ C;  2JMC A;  2BE7 D;  1K8A U;  2VV5 A;  3R6N A;  3CC2 A;  3HL8 A;  4OMN A;  3O8V A;  1TS9 A;  1U5S A;  2JM8 A;  5FU6 C;  2NUP A;  4M7A F;  3OSS C;  2JS2 A;  1K9M C;  2QA4 A;  5GAN j;  2V1R A;  1WHK A;  1K8A R;  3H41 A;  2DXB A;  5KYN A;  3X24 B;  1SRL A;  3UA6 A;  3H0H A;  1ABQ A;  4DBH A;  3CC2 Q;  4Z8A A;  4OB0 B;  1K0X A;  3EH1 A;  3CCU A;  5LJ3 e;  3ZL7 C;  2GQI A;  1XNI A;  1NJI U;  2X3W D;  2YRV A;  1U06 A;  2JVV A;  4VUB A;  2QA4 Q;  1FX7 A;  2EW3 A;  2XG8 D;  2QGF B;  1WI7 A;  1ZA2 B;  4HA8 A;  3QWX X;  4TVR A;  3AHU A;  1VIE A;  2DNU A;  1UJY A;  4KUL A;  4A4E A;  3JCM b;  4M7A E;  2DD4 A;  2VGN A;  1Q7Y U;  2XK0 A;  2E6Z A;  1K73 C;  3JCM e;  2D8H A;  1NJI R;  3CCU Q;  4C8Q G;  2PNI A;  2K5F A;  3CMA A;  2MWO A;  1WZO A;  4QVZ A;  1TUD A;  1UGV A;  1H8K A;  5FU6 B;  1W70 A;  3M54 A;  2KDS A;  4B6M A;  1S72 A;  3R6O A;  1VQL A;  1ZBX A;  4BE1 A;  2QDY B;  3V7C A;  3C4S A;  4C8Q C;  3OYI A;  2BZY A;  4KBM B;  1Q7Y R;  3JB9 G;  3E19 A;  4CC2 A;  3OYM A;  3QII A;  4D8D A;  1D0Z A;  2CGH A;  5IXF A;  5CK9 A;  3VV0 A;  3VS2 A;  1QLY A;  2O4X A;  4LNP A;  3EFR A;  3FJ5 A;  2FG0 A;  1N8R C;  1H3Z A;  2FO0 A;  4C8Q D;  1IGQ A;  1D1A A;  4FL6 A;  5GAN f;  3V8L A;  2RQU A;  1QVF P;  3CCM A;  2JTM A;  3OYG A;  3OYA A;  5DM7 R;  2DTI A;  7AT1 B;  1KQS A;  3RKX A;  3JB9 D;  4N0A C;  2ZPE B;  3V8K A;  1LOJ A;  1NYG A;  3M4Y A;  3DB3 A;  2RPN A;  5D7U A;  3L2V A;  1G83 A;  1LCK A;  2PUK B;  3ZFJ A;  2H3J A;  3UT1 A;  1UGQ B;  4A63 B;  2KYB A;  1Y7X A;  2HKQ B;  2JUF A;  1T3S A;  3GNG A;  1NZ9 A;  1YIJ Q;  1Q82 U;  1OU8 A;  1VQ4 Q;  2P0K A;  4E2F B;  4L5G A;  4F7U B;  3HRU A;  3OYK A;  3QJ6 A;  3E9F A;  1SF9 A;  2M02 A;  3RMS A;  2HNI A;  5KYX B;  1R0B G;  4BY6 C;  2CS7 A;  5GAN h;  2C0I A;  1UJ0 A;  3CCV T;  4CC3 A;  3CPF A;  1A0N B;  3ASK A;  4J9B A;  2DRM A;  4XU2 A;  1Q82 R;  1WHH A;  2RI5 A;  3A8L B;  2E10 A;  3EG2 A;  4M7D F;  2RK2 A;  2V1Q A;  1XQH A;  1TXQ A;  3MCA B;  2LJ1 A;  4M77 F;  4F17 A;  5CKD A;  2AZV A;  4BAC A;  1JEG A;  1RAG B;  2MWP A;  1YNZ A;  4FYV B;  2YRC A;  4C0D C;  1JJ2 S;  2OTJ A;  2BKD N;  1YIT T;  2COW A;  2P0Q A;  3TCJ A;  2HKN A;  1UDL A;  4BB7 A;  4J9G A;  4JRP A;  3CCL A;  3MP8 A;  2PTK A;  2F1L A;  2CZ0 B;  2MOX A;  3MEW A;  1RAB B;  4XQ3 A;  4QQG A;  2KEA A;  1OX9 A;  4PJM A;  2DPP B;  1G2B A;  1G8X A;  4FT2 A;  4RG2 A;  2J6O A;  4M7D E;  3OB9 A;  4BY6 B;  3CCS Q;  5AT1 B;  1UG1 A;  2D6F A;  4IUV A;  1VQM A;  1RAH B;  4M77 E;  3CCL Q;  2CP0 A;  1RI0 A;  1WPY A;  2XID A;  3INZ A;  3QBY A;  3M9Q A;  2DER A;  2DD5 A;  3CCE T;  3CCJ T;  1VQ5 A;  2RNA A;  1WDX A;  2R58 A;  1YIJ T;  1VQ4 T;  1D3B A;  2LJ3 A;  3OYF A;  2KXD A;  3OBW A;  1HYO A;  4JZ4 A;  3QG1 A;  3SWN C;  5LJ5 f;  3C94 A;  5DLO A;  4C0F A;  4F16 A;  1VQM Q;  1OQK A;  5IHN A;  2YSQ A;  4C0D B;  4RMO A;  2CZ6 B;  4M78 G;  2XDB A;  1M1K U;  3G7Z A;  4GY5 A;  4KUI A;  3P8H A;  1V1C A;  1I5L A;  3MO8 A;  2KBT A;  1VQ5 Q;  1ZUU A;  4LUD A;  4JPB W;  3MP6 A;  4IUR A;  1KQ2 A;  4NOY A;  2BIV A;  1R0C B;  4M78 C;  4CC4 B;  2ED0 A;  2KRM A;  4ANJ A;  1ABO A;  5GJW B;  3EG0 A;  1HD3 A;  3I56 T;  3EHR A;  1KD1 R;  5GAM e;  1Y71 A;  1D09 B;  1YJN A;  2B8A A;  1C1A A;  4XU3 A;  3G71 Q;  3VYH B;  2GCX A;  3CCQ A;  1BI1 A;  1M1K R;  1ZQ1 A;  1YI2 A;  4LDV A;  2DXC A;  2ENM A;  2K3B A;  2RI2 A;  4RG8 A;  4HCC A;  1M3A A;  5CQX A;  1NPR A;  5LJ5 e;  1ZA1 B;  1IGU A;  4M78 D;  2EJG A;  2L3R A;  3WVD B;  2HL5 C;  1PSF A;  2W0Z A;  2SEM A;  2WSC E;  3RUX A;  4A4F A;  4X34 A;  1YJN Q;  1Q86 C;  3CCQ Q;  2HQX A;  1M5Q 1;  4K11 A;  1VQ6 A;  1YI2 Q;  4C5H A;  2RHY A;  4LXC A;  3SWN B;  3UPU A;  4JJB A;  3A8M B;  3CCS T;  3TU4 K;  1KD1 C;  1ZHI A;  4ZN3 A;  1VQ7 A;  3CC4 A;  3L2Q A;  2EQI A;  2EYQ A;  5KYU A;  4J9E A;  3HP9 A;  5FW9 A;  2R5M A;  3RES A;  2IIM A;  4M78 B;  4RTW A;  3VS6 A;  1D0Y A;  2M16 A;  5KH6 A;  2VXE A;  1BIB A;  1VQ6 Q;  4J5Y A;  4RTZ A;  5GAO n;  1JXO A;  2XI9 A;  3EAE A;  4DA4 A;  1QMC A;  2FRW A;  3VUZ A;  3EG9 B;  2KAF A;  4ZN1 A;  4DOW A;  1OPK A;  1N27 A;  1KQ1 A;  4Y28 E;  1KK7 A;  1WHJ A;  2C06 A;  4QW2 A;  3E9G A;  1IO6 A;  4BI4 A;  4HVV A;  4EDU A;  4XTV A;  1RAC B;  3OY9 A;  4M4Z A;  1QVF A;  4J7F A;  3OYN A;  1Z9Z A;  4AFS C;  2CSQ A;  2KT1 A;  2DZC A;  2P4R A;  4XTU A;  3G71 T;  4AG1 C;  5LJ3 g;  4E6R A;  2LQN A;  1EX4 A;  1QKX A;  3LH0 A;  4KGX B;  2JMA A;  2NUZ A;  1GFC A;  3JSC A;  4LN2 A;  2YWW A;  2GNC A;  4C92 F;  3J81 E;  1M90 U;  1WXT A;  1AHJ B;  2LNV A;  2QDL A;  4J83 A;  1AEY A;  1RI9 A;  1YJW A;  5CKE A;  4E7J A;  4FIB A;  3JCM g;  4DOV A;  2QAZ A;  2HQH A;  5GAN 5;  1JBM A;  1B34 B;  3FRN A;  4PJO G;  2YRD A;  2E65 A;  5GAO l;  1P92 A;  2RHU A;  3HRT A;  3SB2 A;  2FB7 A;  4BI8 B;  2YHT A;  3RKY A;  4N4H A;  3H0F A;  1BCM A;  2FZG B;  4HVU A;  1YJW Q;  4PJO C;  1PSE A;  3KUF A;  2ECZ A;  3A5Z B;  2RQV A;  1VA7 A;  1H3H A;  2HSP A;  2A36 A;  3DB4 A;  2QEX T;  1JRI A;  4C92 E;  2I0N A;  2A37 A;  1UGR B;  4IKF A;  3OS5 A;  3VU3 C;  4J9C A;  2HQE A;  3EG3 A;  1OUL A;  2DA9 A;  1Y96 A;  2LC4 A;  4PFO A;  2BZ8 A;  2EVR A;  3JCM P;  1TH7 A;  1PKS A;  1BYM A;  2FPE A;  2X4Y A;  4J7I A;  3FB9 A;  4HCZ A;  4MZT A;  1VYT A;  3OW2 S;  3VS0 A;  2M1H A;  2DVJ A;  2QYZ A;  1WX6 A;  2K5L A;  3PVL A;  2EQM A;  2CZ1 B;  4OMP A;  3EH2 A;  1MMN A;  2FYK A;  1MND A;  2LDM A;  1WLP B;  2V8K A;  2KT8 A;  3GNF B;  2RK1 A;  3PE0 A;  4M75 G;  4KH0 B;  4EMK B;  4GBQ A;  3VKI A;  4J9H A;  2PQW A;  4Y92 A;  1VYU A;  4JJC A;  1VYV A;  2ABL A;  2RHX A;  3CBP A;  1RUW A;  4M75 C;  2XU8 A;  3LLR A;  2XHC A;  1J3T A;  2KQW A;  1UHC A;  2ROL A;  3M4G A;  3X28 B;  2CP2 A;  2IPO B;  2A0F B;  1GFD A;  1QP3 A;  2L0A A;  3RNJ A;  2H8H A;  1ZX6 A;  2G6F X;  4OB2 B;  3OYH A;  2HZY A;  2L5Q A;  4NS5 A;  5C0M A;  4M75 D;  1VQO T;  4E7L A;  3HSB A;  1D1B A;  4RCC A;  2CP5 A;  3GPL A;  5KYW B;  1XJW B;  5FWB A;  1SSH A;  3QDR B;  4CI0 C;  3KXT A;  1K73 U;  1BBZ A;  2KMT A;  4GLK A;  4ZGJ B;  4E7S A;  1BI3 A;  1Y07 A;  4PJJ A;  3CPW S;  3CD6 Q;  4JUV A;  3HTR A;  3CXC S;  1NPP A;  2I2L A;  1W2B S;  1OZ2 A;  2AKL A;  2AZS A;  4LD6 A;  2E41 A;  2AK5 A;  2FEI A;  3OYL A;  3I55 T;  5LJ5 d;  1QWF A;  2E70 A;  2JT4 A;  5CKF A;  1QVG P;  2DBM A;  1XOV A;  1K73 R;  3M0R A;  4X1V A;  2OAU A;  4EMH A;  1M30 A;  1UUE A;  2CUD A;  4M75 B;  1X75 C;  2COZ A;  3FJP A;  2ESW A;  1RAI B;  1ZUY A;  1N8R U;  2CUB A;  3PMI A;  3QZ5 B;  3VRY A;  2B86 A;  2QG9 B;  2R57 A;  1K4U S;  1QW1 A;  1IRX A;  3CCV A;  3EGX B;  1YWP A;  4Q5W A;  2O2O A;  1MNE A;  2AKK A;  2NLU A;  1B07 A;  2DL5 A;  3URG A;  1TTH B;  4N4I A;  2ZPI B;  4BUG A;  1N8R R;  4BDZ A;  3TVT A;  4R55 A;  2CT4 A;  1TSF A;  1JXM A;  1OI1 A; 
#chains in the Genus database with same CATH homology
 2D1X A;  2EYZ A;  2KR3 A;  1UDL A;  2DMO A;  2K79 A;  3IQL A;  4J9G A;  1PKT A;  2EGA A;  1NYF A;  2JM9 A;  2PTK A;  2OI3 A;  2J7I A;  2MOX A;  4F14 A;  3SHW A;  2YUO A;  5ECA A;  2JTE A;  3QWY A;  2RQT A;  3I5R A;  2GTJ A;  2K6D A;  2KEA A;  4JJD A;  1UTI A;  1YCS B;  2L3Q A;  2LZ6 B;  3I5S A;  2HDA A;  1G2B A;  1JO8 A;  2J6O A;  1QCF A;  1UG1 A;  2DIL A;  2J05 A;  3NMZ C;  1CSK A;  2LNH B;  2EKH A;  1WFW A;  2F2W A;  2RNA A;  2SRC A;  1AVZ C;  1WDX A;  5HCK A;  3UA7 A;  1GBR A;  1GBQ A;  2RN8 A;  3EHQ A;  2E5K A;  2DBK A;  2GTO A;  2LJ3 A;  5EC7 A;  1WXB A;  2KXD A;  2L3S A;  4JZ4 A;  2YT6 A;  4RTY A;  4F16 A;  1H92 A;  1M3B A;  5IHN A;  2YSQ A;  2PZ1 A;  5IH2 A;  1V1C A;  1YWO A;  2CDT A;  1NEG A;  1T3L A;  2KBT A;  1ZUU A;  1WA7 A;  3M0U A;  4LUD A;  4JPB W;  3TSZ A;  1TG0 A;  1EFN A;  2DL7 A;  2DL8 A;  1OV3 A;  2XMF A;  1JU5 C;  2C0O A;  2KYM A;  2W10 A;  1PNJ A;  1UFF A;  3VS4 A;  4CC4 B;  1E7O A;  1N5Z A;  2ED0 A;  2GGR A;  2KRM A;  2DF6 A;  1ABO A;  1KSW A;  2J06 A;  1HD3 A;  3EG0 A;  5GJW B;  3EHR A;  2KXC A;  2OJ2 A;  1OOT A;  1X43 A;  1OEB A;  2A08 A;  2HCK A;  3KFV A;  2MCN A;  1SHF A;  2HEQ A;  2DYB A;  3VS3 A;  1PRL C;  1OPL A;  2ENM A;  4QT7 A;  2K3B A;  2DL4 A;  4WCI A;  2KE9 A;  2ED1 A;  1M3A A;  1BK2 A;  2K7A A;  1K0S A;  1RLP C;  3TSW A;  4DEY A;  2EGC A;  3NPF A;  2W0Z A;  3NGP A;  2SEM A;  4RTV A;  2FPD A;  2DL3 A;  2EGE A;  2YUP A;  1YP5 A;  2BTT A;  2JW4 A;  2JXB A;  4GLM A;  2M0Y A;  2L2P A;  5I11 A;  2FPF A;  2K9G A;  2X3X D;  1UEC A;  2KRN A;  4K11 A;  3C0C A;  3UF4 A;  1NG2 A;  2RMO A;  4JJB A;  2DLP A;  2O9V A;  3M0T A;  3EG1 A;  3M0P A;  2VKN A;  2LQW A;  3GBQ A;  1AOJ A;  1X27 A;  2RQW A;  1CKA A;  2K2M A;  4OMM A;  2LCS A;  2EYX A;  2EQI A;  4J9E A;  3A98 A;  5FW9 A;  3I35 A;  1I1J A;  4AFU C;  2DX1 A;  5FWC A;  2RF0 A;  1QKW A;  2IIM A;  4LE9 A;  4RTW A;  3VS6 A;  1M3C A;  3REB B;  1AWO A;  4J9F A;  4RTZ A;  1JXO A;  1AD5 A;  1MUZ A;  1HSQ A;  1AZG B;  2FRW A;  4KRT A;  2FRY A;  1OPK A;  2RQR A;  4HXJ A;  2J6K A;  4AG2 C;  2EYW A;  4LUE A;  1IO6 A;  3EGU A;  2O9S A;  4HVV A;  2CT3 A;  2DM1 A;  2DE0 X;  1GRI A;  1WXU A;  2OAW A;  4M4Z A;  2KRS A;  1W1F A;  1Z9Z A;  1ZLM A;  2LJ0 A;  4AFS C;  2CSQ A;  2VVK A;  2KT1 A;  2P4R A;  5L23 A;  4AG1 C;  4E6R A;  2LQN A;  4IIO A;  1PHT A;  1QKX A;  1PWT A;  2KGT A;  1GCQ C;  2JMA A;  2NUZ A;  2O31 A;  1GFC A;  1M8M A;  3PVQ A;  2J6F A;  1UHF A;  2KNB B;  4LN2 A;  4Z88 A;  2GNC A;  1K9A A;  3M0S A;  1YN8 A;  1TUC A;  1Y57 A;  4JZ3 A;  1GL5 A;  4IIM A;  1KFZ A;  1WXT A;  1CKB A;  1AZE A;  2QDL A;  1X6G A;  2BZX A;  1AEY A;  1RI9 A;  3VRZ A;  1AWJ A;  1Y0M A;  1RLQ C;  2JMC A;  3THK A;  2CSI A;  2CH4 A;  2CH4 W;  3R6N A;  4EIK A;  1SPK A;  4OMN A;  2D0N A;  1U5S A;  2YDL A;  3REA B;  4ORZ A;  2JM8 A;  2LX7 A;  1FMK A;  4FSS A;  4HVW A;  2MIO A;  2JS2 A;  3H0F A;  4HVU A;  2V1R A;  2ECZ A;  3SEM A;  1MV3 A;  2EYY A;  1M27 C;  1S1N A;  2DRK A;  4RTU A;  3VS7 A;  2RQV A;  4HCK A;  1VA7 A;  1H3H A;  3H41 A;  2HSP A;  2A36 A;  1SRL A;  3VS1 A;  3UA6 A;  3H0H A;  2I0N A;  1ABQ A;  2VWF A;  1K76 A;  2A37 A;  4AFQ C;  5I22 A;  1JQQ A;  3NHN A;  4Z8A A;  3LH5 A;  1K0X A;  1E6G A;  4J9D A;  4J9C A;  3EG3 A;  2GBQ A;  1U3O A;  2DA9 A;  1I0C A;  4RTT A;  3ZL7 C;  2GQI A;  2X3W D;  1U06 A;  2BZ8 A;  2EVR A;  1NEB A;  1PKS A;  2FPE A;  1ZUK A;  2EW3 A;  1VYT A;  1Z9Q A;  4J9I A;  1WI7 A;  1NLP C;  5IXB A;  3QWX X;  3VS0 A;  2DNU A;  1UJY A;  2NWM A;  3H0I A;  1FYN A;  2DVJ A;  1WX6 A;  4R0K A;  3PVL A;  1T0H A;  3U23 A;  4OMP A;  3JV3 A;  2D8H A;  3RBB B;  2PNI A;  1WLP B;  1TUD A;  1ZBJ A;  1UGV A;  1H8K A;  2KT8 A;  1W70 A;  3PE0 A;  1NLO C;  2LMJ A;  1WYX A;  2LP5 A;  4GBQ A;  2D8J A;  4J9H A;  4Y92 A;  1VYU A;  3CQT A;  2BZY A;  4JJC A;  1VYV A;  4OMQ A;  2ABL A;  1RUW A;  4CC2 A;  4D8K A;  4ZNX A;  1J3T A;  4D8D A;  2O88 A;  1PRM C;  5IXF A;  1I07 A;  4Z89 A;  3VS2 A;  1QLY A;  2F2V A;  1UHC A;  4LNP A;  2ROL A;  3FJ5 A;  2FG0 A;  1WIE A;  2YUN A;  2FO0 A;  1GFD A;  1UE9 A;  2L0A A;  3RNJ A;  2RQU A;  2CRE A;  2H8H A;  1ZX6 A;  2G6F X;  4RTX A;  1W6X A;  1X2K A;  2JS0 A;  3ULR B;  5FWB A;  2M51 A;  1SSH A;  1ZSG A;  1BBZ A;  1GCQ A;  1QWE A;  1ARK A;  3I9Q A;  1NYG A;  4DEX A;  2RPN A;  3UAT A;  2AKL A;  2KRO A;  1G83 A;  1NM7 A;  2AZS A;  1LCK A;  2AK5 A;  2FEI A;  3M0Q A;  1HJD A;  1QWF A;  5IHK A;  1MV0 B;  4OMO A;  2F2X A;  2JT4 A;  1SRM A;  1X2Q A;  2KYB A;  4A63 B;  1T3S A;  2DBM A;  1AWW A;  1XOV A;  1SEM A;  2YUQ A;  3M0R A;  4X1V A;  1BU1 A;  4ESR A;  1M30 A;  1K1Z A;  2A28 A;  1UUE A;  2CUD A;  4RUG A;  1SHG A;  2ESW A;  5GJV B;  1ZUY A;  2C0I A;  2CUB A;  1UJ0 A;  4CC3 A;  2EBP A;  3VRY A;  1A0N B;  2EPD A;  2ROT A;  4J9B A;  2B86 A;  2DRM A;  2L3P A;  1GCP A;  4OML A;  1K4U S;  2HBW A;  3EG2 A;  1YWP A;  4AFZ C;  2O2O A;  2V1Q A;  1E6H A;  1T0J A;  2AKK A;  1X69 A;  1B07 A;  2DL5 A;  2LJ1 A;  4F17 A;  2DJQ A;  1KJW A;  1X6B A;  3VS5 A;  1B3Q A;  2AZV A;  1JEG A;  3TVT A;  1YNZ A;  1KIK A;  3O5Z A;  1BB9 A;  2C0T A;  2CT4 A;  5IHI A;  4CC7 A;  1AWX A;  1JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...