4J9EA

Crystal structure of the n114a mutant of the abl-sh3 domain complexed with the high affinity peptide p17
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high affinity peptide P17
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9eA00
1SRMA 3FJ5A 2VWFA 3UATA 3EG2A 2V1RA 1UFFA 5IHNA 2EYZA 4AFQC 2KYBA 2DBKA 4QT7A 1M3BA 2KT8A 2O31A 1AVZC 1UG1A 3TVTA 2DE0X 1AZGB 2B86A 1ZSGA 2D8HA 3VS1A 3VS2A 1Z9QA 4GBQA 1JXMA 1PNJA 1U3OA 3M0QA 1SEMA 1U06A 2FPDA 4AG1C 1E7OA 2GBQA 2M0YA 2YUPA 1XOVA 2FPFA 2ESWA 2RQWA 2FO0A 2BTTA 4Z8AA 2DA9A 3NHNA 1NYGA 3IQLA 2KBTA 1WI7A 4J9DA 1BK2A 2J6FA 2ED0A 1ZUUA 1CKAA 2K9GA 2SRCA 1JEGA 1OPLA 1JU5C 2CUBA 1I07A 1QKXA 1OV3A 1Y0MA 1X69A 5IHIA 2J06A 4AFUC 1WLPB 2KYMA 2CT3A 2ABLA 1M8MA 2HEQA 2ECZA 2EVRA 4Z88A 2DL7A 3QWYA 3VRZA 2X3XD 2BZ8A 2ED1A 3RNJA 1ZBJA 4LNPA 3O5ZA 3H0HA 1VYVA 2A28A 2LQWA 2KEAA 3M0SA 4F17A 2DLPA 4K11A 2MCNA 1YCSB 4RUGA 2DL5A 1UUEA 2GQIA 3ULRB 1WFWA 4LUDA 3H0FA 2JXBA 1TUCA 2GTJA 2YT6A 2M51A 1MUZA 3I35A 3RBBB 2JM9A 1WYXA 5EC7A 1T3SA 2AZVA 4LUEA 4CC3A 2EW3A 3A98A 5GJWB 1X2KA 2KRNA 3EHRA 2KE9A 4RTXA 4OMLA 2FEIA 1G83A 2CH4W 3EG3A 2FG0A 2ROLA 2DL4A 1UHCA 4OMOA 1GRIA 3LH5A 1WDXA 2BZYA 3REBB 5IXBA 1X6GA 1WA7A 1GCQA 1U5SA 1RUWA 1ABQA 1S1NA 2K79A 2K7AA 1YWPA 2JS2A 3QWXX 1AWXA 3I5RA 4J9CA 1JO8A 1T3LA 5FWBA 1AWJA 1GBQA 1SHGA 1UDLA 4HVUA 2CSQA 1AWOA 2HCKA 2KROA 2EKHA 1W70A 2GGRA 1ARKA 2HBWA 3NPFA 2F2WA 2LX7A 1TG0A 2YDLA 2FRWA 4CC4B 2A37A 2PNIA 1ZUYA 1WX6A 4FSSA 1JXOA 1KFZA 4OMMA 2FRYA 3ZL7C 2JM8A 2ROTA 4J9GA 2KNBB 3VS3A 1VYTA 1PKSA 2KT1A 4OMPA 1MV3A 4CC7A 5IHKA 1WIEA 2CT4A 2K6DA 3M0UA 2VVKA 2CREA 3VS6A 3EG1A 4J9FA 3NGPA 1YN8A 3SHWA 4CC2A 2EYXA 2ENMA 3KFVA 1RI9A 3M0TA 5FWCA 1QLYA 2KXDA 5HCKA 1VA7A 3GBQA 4HVVA 1H92A 3I9QA 1UJ0A 3JV3A 1M27C 2DMOA 2K3BA 3U23A 1Z9ZA 1K0XA 2LZ6B 1AOJA 2EGAA 2EYYA 1B07A 1SRLA 2A36A 2LNHB 2YSQA 1BB9A 1GFDA 3PVLA 1K9AA 4JZ3A 1I0CA 1K0SA 2DVJA 2J6OA 2YUNA 2DYBA 1FMKA 1PRMC 1NEGA 2O88A 3PE0A 1UECA 1YP5A 1NLPC 1UGVA 1SSHA 2KR3A 2LJ1A 2W10A 4DEYA 2BZXA 2VKNA 4ZNXA 3UF4A 1TUDA 2L2PA 4J9IA 4ORZA 4RTTA 1AZEA 2V1QA 1V1CA 2GTOA 1AWWA 1QKWA 1VYUA 1UE9A 5I22A 2RNAA 1X43A 2MIOA 1T0JA 3M0PA 1G2BA 1NEBA 2H8HA 2CDTA 2F2XA 3TSZA 2I0NA 3CQTA 1K1ZA 4Y92A 4J9BA 2O9VA 3C0CA 1BU1A 2PTKA 3THKA 1GFCA 5I11A 1CKBA 1UTIA 4E6RA 1PRLC 1OOTA 1QCFA 1SHFA 1X27A 1WXTA 1BBZA 4WCIA 2DL3A 2JW4A 2E5KA 3EHQA 1OEBA 3H41A 3VS4A 2KGTA 2RMOA 4AFSC 2KRSA 2XMFA 2AKLA 1SPKA 2CH4A 2DX1A 1YNZA 2JMCA 3EGUA 1W6XA 2J6KA 4RTZA 2DF6A 2J05A 1EFNA 1E6GA 1X6BA 2FPEA 1AD5A 4HXJA 4HVWA 1T0HA 4Z89A 5IXFA 2O9SA 1IO6A 1OPKA 2W0ZA 1GL5A 3R6NA 1AEYA 2D0NA 2A08A 2KRMA 2EPDA 1LCKA 2C0OA 4RTUA 2IIMA 2RQRA 1H8KA 2DILA 1RLPC 2EGCA 2G6FX 1HD3A 2DJQA 1PHTA 5L23A 2RQUA 2C0IA 2D8JA 3EG0A 3PVQA 4R0KA 2P4RA 4GLMA 1KIKA 2AKKA 2OAWA 2QDLA 2DRMA 3H0IA 1WXUA 5GJVB 4AG2C 1QWEA 2DL8A 2AK5A 3UA7A 2EBPA 2C0TA 3I5SA 1I1JA 1PWTA 4KRTA 3REAB 1UJYA 4F14A 2RF0A 1ZUKA 4RTVA 4F16A 4OMNA 2HDAA 2JTEA 5IH2A 2X3WD 2CSIA 2L0AA 2EGEA 4JJCA 2AZSA 4A63B 5ECAA 1KSWA 4JJDA 4RTYA 2RPNA 1JQQA 1W1FA 2L3QA 4RTWA 1YWOA 2JS0A 4M4ZA 4EIKA 1K76A 1GCQC 2NUZA 1H3HA 3UA6A 4JJBA 2DM1A 3VS0A 1A0NB 1M3AA 2CUDA 1QWFA 2RN8A 1PKTA 4DEXA 2DBMA 1CSKA 2LJ3A 2OI3A 1NLOC 3TSWA 4D8DA 2JMAA 4D8KA 1KJWA 1J3TA 2EYWA 2OJ2A 4HCKA 3VS7A 1E6HA 1N5ZA 1WXBA 1K4US 2O2OA 2F2VA 1X2QA 2KXCA 4JZ4A 1NM7A 1RLQC 1FYNA 2NWMA 4IIOA 2DRKA 2RQTA 1GCPA 2J7IA 2L3PA 2LQNA 1UHFA 2PZ1A 2DNUA 4J9HA 1GBRA 1HJDA 4JPBW 2LCSA 2EQIA 1M3CA 2LMJA 2D1XA 2HSPA 4X1VA 4OMQA 2YUQA 2JT4A 3VRYA 1NYFA 1HSQA 2LJ0A 2YUOA 4LE9A 4ESRA 2GNCA 3NMZC 2L3SA 1Y57A 2LP5A 2RQVA 4IIMA 1ZX6A 4J9EA 2MOXA 3SEMA 2K2MA 4AFZC 1ABOA 3VS5A 2SEMA 1M30A 3M0RA 4LN2A 1NG2A 1MV0B 5FW9A 1ZLMA 1B3QA
chains in the Genus database with same CATH superfamily
3FJ5A 3CPWA 3EG2A 1B7TA 1UFFA 3L2WA 2EQJA 1YFNA 2DBKA 2KT8A 1AVZC 1UG1A 1PD1A 2B86A 4M75E 2O01E 5I21A 4QVZA 1M90C 5GMKe 2D8HA 4O5VA 2V8JA 2F5TX 1U3OA 2LC4A 3BDLA 1SEMA 2E6ZA 1U06A 2FPDA 2MPXC 3CBPA 4KT0E 2PQWA 4JDSA 4OB3B 2RQWA 5IAYA 3X25B 3QUIA 1HK9A 1BI2A 1HYOA 4FL6A 3E2UA 2GFAA 1BK2A 1RL2A 1KQ1A 1CKAA 2RB6A 5LJ5g 3P8BB 2SRCA 2XG8D 2O4XB 4M75G 1IB8A 3DKMA 3GLXA 2CUBA 4QW2A 1I07A 1QKXA 4UC4A 5GMKh 4M7AG 2J06A 1S72A 1TS9A 2XHCA 3CPWS 2ECZA 4Z88A 4HCZA 3G71A 3VRZA 3RKWA 2BZ8A 4EMGA 3C12A 2KAFA 1QVPA 2QGFB 3PMTA 3EH1A 4F17A 4K11A 3LWHA 2DJZA 4M78F 1I81A 3OBYA 1UUEA 3CCLA 1BCOA 4WTOB 2WSFE 5J39A 4E47A 2VXEA 2FZCB 1ACMB 5GAMe 5D6YA 3RBBB 1W2BP 1QW1A 1NE8A 1WYXA 2JM9A 2V8KA 1T3SA 5LJ3g 1UEBA 2EW3A 1ZSZB 1NBEB 2M9UA 2KE9A 4M7AE 4OMLA 2CH4W 3P8DA 1ZHIA 3EFOB 2E65A 2ROLA 2DL4A 2QA4Q 1WDXA 3CCQA 4YTLA 5IXBA 1WA7A 1Q82U 2JUFA 3MJXA 2JS2A 3TU4K 4ZTFA 1PCXA 4KUDK 3QWXX 4IUTA 3M56A 2D6FA 3I5RA 5GAN3 1JO8A 1T3LA 2KMTA 1SF9A 1GBQA 3META 1SHGA 1UDLA 2CSQA 3L2RA 4HCCA 2EKHA 3RUXA 1M2VB 4BDYA 4C5EA 3QG1A 4EMKA 1QCNA 2F2WA 1TG0A 2FRWA 2K3YA 2DTOA 2A37A 4FSSA 3C95A 9ATCB 3OYIA 2HMAA 2K2VA 3CBOA 3QIIA 1R77A 3A5ZB 4Y91A 5IHKA 1X01A 3VV0A 1JRIA 3V7SA 2VVKA 3VS6A 3G4ST 4J9FA 3PFSA 3JB9I 1RI9A 1QLYA 2A7YA 1PD0A 1EZZB 3MCAB 1BYMA 3GP8A 4C0ZA 4M78E 3S3NA 4M7AC 4OVAA 2CZ1B 1Z9ZA 1QVGA 1G3TA 4C92E 1VQ6T 3UT1A 2A36A 2LNHB 3EH2A 1BB9A 4DBHA 2K57A 3LH0A 2DYIA 3FIFA 1K9AA 3LX7A 2J6OA 2YUNA 2CZ7B 2RA2A 3X28B 1NEGA 2LQKA 2X9HA 3EG9A 1YP5A 1Q81C 2KR3A 2LJ1A 2DETA 5CR2A 4ZNXA 2L2PA 2XKOC 1Q95G 1WQ7A 1AZEA 2V1QA 3GNGA 4IUPA 1V1CA 1AWWA 1QKWA 3JCMe 5HK0A 5GAN6 1T0JA 4J7IA 5GAN2 4VUBA 1G2BA 1N27A 2CDTA 2F2XA 2DERA 4PJOE 1KD1C 3ZBDA 2XDBA 4HKEA 2OTLA 1ZA2B 4J9BA 3E9GA 2O9VA 2G3RA 1MGQA 2PTKA 1BI0A 4PJOF 5GMKl 5C6SA 1CKBA 4E6RA 1WZOA 2YHTA 1QCFA 4L5GA 4XQ3A 4F7UF 2EYQA 3KXTA 3C4SA 4KGZB 1W2BA 4RCCA 2LCLA 2JW4A 3H41A 2QGGA 1SPKA 2CH4A 3OYYA 1MMDA 1W6XA 2EWNA 3CCVQ 2J6KA 4C5HA 2DF6A 1ZQ1A 3KUFA 2B8AA 5HY6A 3OBWA 1YHQA 5IXFA 4ME7A 2AT1B 1GXIE 1YJNT 3HKSA 4E7KA 2DXCA 3G71Q 1AEYA 3CPWP 3A8LB 2HKNA 1QP3A 2MAMA 1MMAA 3HPWA 2RQRA 4C8QG 1H8KA 1OX9A 1DJ7B 3DLMA 2DKGA 3QZ9B 3M53A 5FLXE 5FU6C 1PHTA 2EAYA 2C0IA 3EG0A 1MNEA 4M7DD 2RJCA 3CCEQ 4GLMA 4WF2A 4XTYA 3WVDB 4AG2C 5FRMA 3G4SQ 2FB7A 1W2BS 3CMAT 3I55T 2BUDA 1KD1R 5LJ5d 4PFZA 2OAUA 2RF0A 2CP7A 4OMNA 2KY9A 4B9WA 3EGXB 4C8QA 4E7SA 4R55A 2MWPA 3CC4A 3OYHA 4RTYA 2LQ8A 3G6ET 1W1FA 4FT4A 3A8MB 2JS0A 4EIKA 3PTAA 4ZN1A 2FZKB 3P8HA 4JJBA 1IZ6A 1M3AA 4V2SA 1D09B 1IGQA 1KD1U 1X75C 2EYWA 2E5QA 3VS7A 4BI4A 1N5ZA 1M1FA 1K4US 1K73R 4JZ4A 4PLLA 3SWNB 1FYNA 3OMGA 3OMCA 4M7AF 1GCPA 2A0FB 1VQMQ 1UB4A 1FMVA 2X4WA 2PZ1A 1P92A 2DNUA 3M4GA 4F7UA 4ZN3A 1RADB 4M75A 4JPBW 5IT9E 1M3CA 2K4YA 2D1XA 1NPRA 1K8AC 4X1VA 2YUQA 1YJNQ 1WGSA 1LPLA 4LE9A 3X26B 4M75D 3CCUA 2RQVA 3FRNA 4IIMA 1OU9A 2MOXA 3SD4A 3SEMA 2K2MA 5GMKm 3QYGB 2ZGWA 1M30A 4LN2A 3V7RA 3CCVT 3G7ZA 1SRMA 3E1SA 4F7UG 2VWFA 3OYNA 3CCUT 2NUPA 4DA4A 3HFOA 1VQ7A 2V8IA 2EYZA 1QP2A 3JCMP 2DXUA 4QT7A 3R6OA 1YJ9T 2DEUA 2DK3A 1AZGB 4XTXA 1YJNA 4Z02A 3VS2A 1VQKT 3BY7A 1PNJA 3MEWA 3GNFB 4OP0A 4AG1C 2YUPA 5HK3A 3NTIA 4C92G 1VQOQ 4FYYB 3CC2T 3M54A 2DA9A 5KCHA 2OTJA 2E12A 4FYXB 1N8RU 2ZZDA 2ED0A 2JVVA 4M77B 2OTJQ 5GAOm 1VQPT 2L89A 1JEGA 1OPLA 2YXYA 1VQNT 5A0DA 3PIOA 2ZPGB 1Y0MA 1X69A 4PJNA 3CXCS 2OTJT 4JRIA 2CT3A 2RHYA 2ABLA 2E4HA 5GAN4 1M8MA 5CKHA 2HEQA 3J80E 4QVDA 2I2LA 4E7ZA 5CKEA 1RAAB 4JRQA 2X3XD 2ED1A 3MKDA 2V26A 3O5ZA 3OQ5A 4PJLA 2A28A 2LQWA 3QDFA 5GANd 2FVUA 1FXXA 1WHMA 4PNOA 1YCSB 4RUGA 2DL5A 2P0PA 2VYTA 2NUTA 3ULRB 4LUDA 5LJ5j 4JRPA 1YITQ 3JB9D 2GTJA 4XU1A 5DM7R 3I35A 3L2VA 3GPLA 3J81E 3I56A 3BW1A 5EC7A 1BI1A 3CC7Q 1YI2Q 3A98A 5GJWB 2KRNA 2MK5A 3EHRA 1NJIU 4BACA 4E7JA 2FEIA 4MMKA 2CP3A 1VQ4Q 3CXCA 3NTKA 2FG0A 1VQ8T 1GRIA 3V8LA 5FU6B 8ATCB 2BZYA 1Q86U 1GCQA 4FW2A 1VQMA 3M55A 5FRNA 2K79A 4M77D 3X20B 2HZYA 5CKBA 1YJ9Q 1AWXA 2K5FA 2QAZA 5CVIA 1QCOA 5GAMd 2DAQA 2WSCE 3FB9A 3BDUA 2HBWA 2CGHA 4M78C 5I2MA 3JB9F 5A0GA 4M75B 2EQUA 1KQSS 1VQ8A 2PNIA 2NYSA 3JB9G 4BUGA 1TUGB 2Y4YA 4KULA 2EQMA 3DB3A 1D1AA 1KFZA 2C06A 4OMMA 2FRYA 2FZGB 2KVQG 3MP1A 2VXFA 4XTUA 4M78D 3VS3A 1VYTA 2HD0A 1ZA1B 1PKSA 4OMPA 4CC7A 5A0LA 4LD9K 4JS4A 2QQAA 3OS5A 4XTWA 4XTVA 3M0UA 2BIVA 2EJGA 4MDWA 5LJ3f 4MDXA 2CREA 3EG1A 3L42A 2F69A 3NGPA 3KFVA 4LDVA 2CP2A 1VA7A 4J5YA 4HVVA 2E1HA 2E41A 2DMOA 2MWOA 3U23A 2KDSA 1QVGP 1D0YA 4J6WA 1TWBA 1SRLA 4KUIA 2YLBA 2YSQA 2CP5A 4FW1A 1IHWA 2DVJA 2QQRA 2DYBA 4A4FA 2O88A 1PSFA 1UECA 4IUUA 1OX8A 5DY9A 1M1KR 1UGPB 4DEYA 3OYEA 3UF4A 4KGVB 2FL7A 4GLKA 4J9IA 4J8OA 1YHQQ 4ORZA 1VQNA 4RTTA 5LJ3e 5CQYA 1HXDA 2VC8A 2PVDB 4EMKB 2LRQA 1BCMA 1D0ZA 4B9XA 1R0CB 3OYKA 3TSZA 1PG5B 3CQTA 2HQXA 3EGDB 4M7DB 1TH7A 4Y92A 5GANg 4XTZA 1D0XA 4BE2A 4N0AA 5LJ5e 4FM4B 2RK1A 2HL5C 4C92A 1LJOA 2RHUA 1QVGS 4QKUA 5LJ3j 5GAN8 4MZTA 1SHFA 3QJ6A 1X27A 2VUBA 3VYHB 5GAMj 1WXTA 2BE9B 4WCIA 4C0DB 4XU0A 4JRKA 3SFMA 3EHQA 3S3OA 1K73U 2RMOA 4XAXB 2XMFA 4LXCA 1BI3A 1YNZA 3H8ZA 2L8DA 4RTZA 3CBMA 3OYAA 1YJWQ 2JTMA 2LX9A 1ZSZA 2FPEA 3NTHA 5IN1A 3L2ZA 3CCJT 1T0HA 1YIJQ 2K5IA 3BFMA 3ZFJA 1IO6A 1WHJA 3FEOA 1YJWA 1KC8C 3AHUA 2QG9B 2VV5A 4A4GA 2A08A 2RHZA 2KRMA 2EPDA 5KYYA 1W4SA 4RTUA 3CCJA 2IIMA 3OYMA 3A8OB 4B6MA 2DILA 2EGCA 4BD3A 5GAOq 1Y96B 1HD3A 2MF2A 3TCJA 5L23A 2RQUA 4R0KA 4RCBA 1M1KU 2AIRB 3A8HB 1WXUA 2ATCB 3M59A 1M90U 2XDPA 4M75F 4M7AA 5CIUA 2AK5A 3N5BB 4D6WA 1PWTA 1QQJA 4MMLA 4F14A 4RTVA 2HQEA 3GF5A 4F16A 3OW2S 3CC2Q 2HDAA 3G71T 3PGGA 4DBFA 1LNXA 2CSIA 2L0AA 2PVOB 4ELZC 2RH2A 4A63B 3CD6A 2P0KA 3CCMT 3GOXA 3CMEA 3OYFA 4ATOA 4M77F 4E7LA 1VQNQ 4X34A 1XNIA 1V29B 2RI3A 2NUZA 1VQ9Q 2DM1A 1YJ9A 2YWWA 4DEXA 1PKTA 2LJ3A 4C8QF 2E64A 2JMAA 2OJ2A 2Y4XA 1E6HA 1OQKA 1WQWA 1Y07A 2O2OA 1X2QA 1WPYA 1XQHA 5KYWA 4DQ2A 3QJYA 2QQ9A 3CCSQ 1RLQC 2ZAEA 1VQ4A 1KC8R 2EKOA 2DRKA 3JB9H 2L3PA 4JLGA 3JCMc 1BKBA 2P84A 2PUOB 4PKCC 4RMOA 3RMQA 1C1AA 2LQNA 2LCCA 1UHFA 4IURA 5KYXB 3VUZA 2RJFA 4BB7A 5KYUA 4ZGJB 2GQVA 5GAOp 3M9QA 5KCOA 4NS5A 2LMJA 2HSPA 2FYKA 5CCAA 2E70A 4C0FA 5LJ3h 4J7FA 1HSQA 2LJ0A 3QKJA 2E3HA 5KYWB 3HRTA 2YUOA 1I8FA 4M78A 1TTHB 2DXTA 2LP5A 2DO3A 5GMKj 5CKFA 1G5VA 2Y90A 3PNWC 3RKXA 1VQ4T 1B34B 4AFZC 2ZPBB 1VQ8Q 4KH0B 3M0RA 3PT9A 5FROA 2COYA 1G8XA 1NJIC 3FLGA 5C0MA 5FW9A 1JBMA 2CS7A 2PUKB 2RD1A 1Q81U 3JCMW 5IHNA 1NZ9A 5D7UA 3QBYA 1M3BA 4ZGEB 4M7DF 2O31A 3TVTA 2M0OA 3CCRQ 1ZSGA 3VS1A 3M0QA 4DOVA 1Q82R 2QA4T 2KQWA 1R0BG 1RAFB 2ESWA 2HQHA 4OGCA 1VQ6Q 2FO0A 3LGLA 2MMPA 5EG2A 3UWNA 1VQLA 3SB2A 3NHNA 3QXEB 1TOVA 1NYGA 3IQLA 1ZBXA 4DOWA 4J9DA 2J6FA 1ZUUA 1Q7YC 5KE2A 2K9GA 5GAN5 1VQ5T 1JU5C 1M5Q1 2MYSA 2PVGB 5GANh 3OYDA 1VQ9T 5GAOl 1OV3A 4DBRA 1I4K1 1F1BB 1YBYA 5IHIA 2BE7D 4N4GA 1WLPB 1VQKQ 2KYMA 1C0MA 4PJOC 4MZPA 2EVRA 3Q1JA 3RNJA 4LNPA 3ZEHA 3TEEA 3H0HA 2OTLT 1YITT 1VYVA 3CPFA 2KEAA 3M0SA 5DLOA 2HKQB 3EG9B 3OYBA 1WJQA 4LDYA 1UGSB 2A3LA 3RKYA 3T9NA 1TUCA 2ZCFB 2YT6A 3MHXA 2HSEB 1N9SA 1K8AU 1PSEA 1D1BA 3HTRA 2AZVA 2CP0A 2JZ2A 4LUEA 4CC3A 1X2KA 2DTHA 2H3JA 2DD5A 3OS0A 4BE0A 4M78B 2JJ9A 3EG3A 4ZTJA 4M7DE 4OMOA 2X35A 1XJWB 1VQOA 2L3RA 3LGFA 1U5SA 1RUWA 2DFUA 2K7AA 3MEVA 7AT1B 1Q7YR 3MP6A 4J9CA 5FWBA 1WHHA 1AWJA 3ER0A 3V7CA 4LDWA 4BI8B 4HVUA 4M77A 1AWOA 2XD0A 2LNVA 3CC4Q 2YLCA 4P5NA 5LJ3d 3H9NA 3NPFA 4XK8E 2X51A 1QVFA 2QQBA 3JCMf 1QVFP 2YDLA 1SKUB 5J3BA 1WX6A 1D3BA 3ME9A 1FMWA 4A53A 4QVCA 3FDRA 1MV3A 1WIEA 1M4ZA 2JNGA 2CT4A 3CC7T 2K6DA 1N8RR 3E19A 2CYZB 4C8QB 5KYXA 4JJNK 1VQLQ 4C0GA 4CC2A 5GAMf 2EYXA 2ENMA 4PJOG 1G3YA 8AT1B 3GBQA 1VQLT 4PJOB 1UJ0A 1U1SA 2JN0A 1PC0A 3CC7A 5GANj 1TU0B 3JV3A 3I56Q 1M27C 2K3BA 2EJFA 1OZ3A 3G6EA 1M1KC 1K0XA 1OI1A 2LZ6B 1B07A 5A2QE 2LT4A 3JCMQ 4LDXA 1K0SA 1QVFS 1FMKA 5GAMh 3PE0A 2COZA 1UGVA 1SSHA 1YJWT 3DB4A 2W10A 4BDZA 2BZXA 2DTIA 2XI9A 3JCMV 4J83A 3CCMQ 2IVWA 2K3XA 3OB9A 5KH6A 3CCST 4BI3A 3J7AF 4MZMA 4E7IA 1VUBA 2GTOA 3QPHA 4CI0C 4LD6A 5I22A 1FWZA 1OZ2A 3JCMd 3M0PA 3I56T 3RERA 1H3ZA 5D6WA 3CMAQ 3HHTB 3CCLT 2ZPHB 1O75A 4PFPA 5AT1B 4A4EA 1G3WA 3OSVA 1VOMA 2RJDA 3C0CA 3THKA 1Q86R 2HL3A 5I11A 1FX7A 1N8RC 1OOTA 4GY5A 3LLRA 3CCSA 2DL3A 1EIFA 3QO3A 2X4YA 5FU7C 4PFOA 3RMSA 5LJ5f 2E5KA 5I2SA 3VS4A 2KGTA 4AFSC 2KRSA 4PK4A 1UGQB 4IKFA 2DX1A 1Y96A 2QDYB 3OW2A 3EGUA 1EFNA 1VQ9A 4FIBA 1X6BA 4JUVA 4HXJA 2YRVA 2KI7A 1BIBA 4HVWA 4M75C 2FHDA 2O9SA 3TQ7P 3V8JA 3FC3A 3R6NA 2LDMA 1KHIA 4JS5A 2D0NA 4O6JA 1SG5A 1LCKA 2ZPIB 1YI2T 3CC2A 2EIFA 1M2VA 2G6FX 4A4KA 3EFSA 3QSUA 4XU2A 3I55A 2DJQA 3PVQA 2D8JA 4ELYC 1KIKA 1PM3A 1VQMT 4OGEA 2DZCA 3H0IA 1OYXA 2DRMA 1U1TA 2EQKA 5GJVB 1D3BB 1QWEA 3SDZA 3WXMB 2DIQA 2OTLQ 3CCRT 4X9DA 2DL8A 1MHNA 4E7HA 2KSSA 3EFOA 2C0TA 5J26A 1I1JA 3VUBA 1U8RA 3JCMg 1V76A 1ZUKA 2LTOA 2EGEA 1Q86C 4E2FB 3EAEA 4F7UE 3OW2P 2QQSA 3CCRA 2QXFA 2DVEA 5KYUB 2CKKA 1BIAA 3MEUA 2P4TA 1JQQA 1YIJA 2ZPFB 2YRCA 1OU8A 1H3HA 1Q7YU 1A0NB 3OYLA 2CUDA 3M58A 4M77E 1QWFA 4PL6A 2DBMA 1CSKA 2OI3A 2R58A 4RKUE 3TSWA 3C94A 2VGNA 1J3TA 3MPUB 4PJMA 4HCKA 1R8OB 3UPUA 3CCQQ 3JCMh 2XU8A 1NM7A 2QA4A 1C6VX 2NWMA 1VIEA 4FU6A 1WHGA 1SSFA 2MI6A 4M7DC 4FSXA 4ZGDB 1EX4A 2J7IA 2NLUA 2QEXQ 3HFNA 1KQSP 4J9HA 3I55Q 1N9RA 1WHLA 1XTDA 4F04B 2LCSA 5GAOr 1NJIR 5M9OA 5GAOn 3S6WA 3SWNC 1JJ2P 3LYIA 1NYFA 4L59A 3MP8A 4A4HA 1M2OA 2GNCA 3GIBA 2L3SA 1ZX6A 5CAIA 3JSCA 2E3IA 2XIDA 1ABOA 1N6AA 3VS5A 2SEMA 4EDUA 1NG2A 2XDDA 1KQ2A 1S72T 1ZLMA 3VYGA 2ZPEB 3CMET 2DZ9A 3UATA 2NUTB 1Q82C 2M02A 1Y71A 2V1RA 4C92D 1S72Q 1TSFA 4AFQC 2KYBA 3JAME 3CMEQ 4C5IA 1IREB 2DE0X 3CD6Q 1D1CA 3DLLA 2DPPB 4NL3A 3CCVA 5AYFA 4FT2A 2QK0A 1Z9QA 5LJ5h 4KH1B 4GBQA 1JXMA 5DLQE 2X4XA 2HAXA 3BE3A 3OYGA 3EGXA 1RAEB 1E7OA 2GBQA 2M0YA 2R57A 1XOVA 2FPFA 2QTVA 5GANe 2RM4A 2BTTA 4IUVA 4Z8AA 4A54A 4RG2A 2IPOB 1MNDA 2QEXA 2QI2A 2HBPA 2KBTA 1WI7A 4N4HA 1WJRA 1IHVA 3HRSA 3CCMA 5HKCA 3CCJQ 3HSBA 3S3MA 4AFUC 3OA6A 3LWIA 2CZ0B 1X6OA 2DXBA 3CCLQ 2GCXA 2DL7A 2VB6A 3M5AA 3QWYA 4M7DA 1ZBJA 3VU3C 4M7AD 1MMNA 2BKDN 2R5MA 2DLPA 3EGDA 2RK2A 2XICA 2MCNA 2NUPB 2GQIA 1WFWA 3CCET 3H0FA 3O8VA 1KK7A 1IRXA 1KQSA 2JXBA 1IGUA 2Z0WA 4NL2A 3QYHB 2M51A 1MUZA 4EMKC 1Y7XA 3MO8A 5CKDA 3JCMb 1YI2A 4RTXA 5GANf 1G83A 2RJEA 4BY6C 1UHCA 4J6YA 3LH5A 3REBB 1X6GA 2RO0A 1ABQA 1S1NA 5D6XA 3D7SB 3FJPA 1YWPA 2RHIA 4F7UB 3PMIA 2JTFA 3QHSA 2K5LA 4N4IA 1JJ2S 2DD4A 3URGA 2HCKA 2KROA 3QDRB 4XU3A 1W70A 2D9TA 2GGRA 2D0QB 1ARKA 4M77G 1KG1A 1LOJA 2LX7A 2LVMA 4CC4B 1YHQT 3OS1A 5CK9A 3VKIA 3H6ZA 1ZUYA 2OX7A 3RESA 3AT1B 2WACA 1JXOA 4M7AB 3ZL7C 2JM8A 2ROTA 5KE3A 1VQ7T 4J9GA 1MMGA 2KNBB 2E6NA 2KT1A 2E10A 3OYJA 4C92B 4II1A 4M77C 5L8RE 5CQXA 4L6V5 3MEAA 3SHWA 1YN8A 1LVKA 4ANJA 4CRIA 1KC8U 1G3SA 3M0TA 5FWCA 4HT8A 2KXDA 5HCKA 4PJOA 1H92A 3I9QA 2F1LA 3CEYA 4EMHA 5CO7A 2GFUA 1AOJA 2EGAA 2EYYA 2M16A 4PJOD 1GFDA 3PVLA 4JZ3A 1I0CA 1VQ7Q 3L1AA 2RHXA 4J6XA 4HCBA 4QQGA 1PRMC 1JB0E 2QEXT 1NLPC 3OY9A 2VASA 4TVRA 2VKNA 3VJPA 1TUDA 3WVEB 6AT1B 1RAHB 3CCUQ 2EFIA 2R5AA 5KYNA 4PJJA 2X4JA 1VYUA 1UE9A 1Q81R 2RNAA 1AT1B 1X43A 1RAGB 2MIOA 1IXDA 1O9SA 1NEBA 2H8HA 1OULA 3QZ5B 1JJ2A 1VQ5A 2I0NA 3ASKA 1K1ZA 1AHJB 4FYVB 1K9MC 2HNIA 1VQ5Q 2WSEE 1BU1A 3CCQT 2F5KA 1GFCA 4HA8A 2JOYA 1UTIA 3M57A 1PRLC 3KBGA 1BBZA 4X9CA 3A1PA 3JCMJ 1I5OB 1YITA 1OEBA 3CMAA 4OB1B 4OMFB 2AKLA 2L5QA 1RAIB 2CZ6B 2JMCA 4KBMB 4OB2B 2RI5A 1WHKA 2J05A 1E6GA 2PU9B 1AD5A 3L2QA 4C8QE 1NPPA 4Z89A 3CC4T 3JB9J 2QYZA 1OPKA 2W0ZA 1GL5A 2KK4A 4AT1B 4M7DG 3TREA 4FYWB 4C0DC 5GAMg 4N0AC 4C92F 2C0OA 4C92C 4Y28E 1UGRB 4Q5WA 3E9FA 1RLPC 2P0QA 2O4XA 3PIPA 2CP6A 3RDVA 1VQOT 3G4SA 3G6EQ 2VGMA 2EJ9A 2QTXA 4M78G 4BY6B 2P4RA 4RG8A 2AKKA 2OAWA 2QDLA 3JCMX 3V8KA 3CCEA 2DEQA 3CD6T 4JLIA 5GAN7 4C8QD 3NFCA 3UA7A 1VQPQ 2EBPA 1VIFA 3I5SA 3OS2A 1M1GA 1ZSZC 4KRTA 3REAB 1UJYA 1K9MR 4IUQA 5KYYB 3G1JA 4PLIA 1H641 3INZA 2JTEA 4EPCA 5IH2A 2X3WD 4JJCA 3HL8A 2IG0A 3HP9A 4HT9A 4OB0B 4OF1A 2AZSA 4FCYA 5ECAA 1KSWA 4JJDA 3UDCA 2XK0A 2RPNA 2L3QA 4RTWA 1M8VA 1YWOA 4M4ZA 1K76A 1GCQC 1WJSA 3UA6A 1KHCA 1M90R 3VS0A 2RN8A 1NLOC 4D8DA 4D8KA 1KJWA 3X24B 4DBQA 4NOYA 1VQKA 1WXBA 1K9MU 2DIGA 3A8GB 2YRDA 2F2VA 1M9SA 3F70A 3OSSC 4C8QC 2KXCA 2H3EB 4LDUA 3SWNA 4BE1A 1YCYA 4IIOA 1WNLA 2RQTA 3L2UA 4KGXB 1B34A 4R56A 2QASA 2AHJB 2M1HA 3HRUA 3OYCA 3EFRA 2GF7A 1K73C 3JRZA 5LL6S 1VQPA 2LT1A 1VQ6A 1GBRA 1HJDA 2EQIA 1I5LA 1QMCA 2RI2A 5FU7B 4OMQA 2COWA 2JT4A 3VRYA 4C5GA 4QQDA 4ESRA 1YIJT 3CXCP 3LW5E 1RABB 3NMZC 1Y57A 4J9EA 3RIRA 1RI0A 5GMKi 4QQ6A 1RACB 3M4YA 3RR6A 1MV0B 1K8AR 1B3QA 1TXQA 4AMCA
chains in the Genus database with same CATH topology
1SRMA 3FJ5A 2VWFA 3UATA 3EG2A 2V1RA 1UFFA 5IHNA 2EYZA 4AFQC 2KYBA 2DBKA 4QT7A 1M3BA 2KT8A 2O31A 1AVZC 1UG1A 3TVTA 2DE0X 1AZGB 2B86A 1ZSGA 2D8HA 3VS1A 3VS2A 1Z9QA 4GBQA 1JXMA 1PNJA 1U3OA 3M0QA 1SEMA 1U06A 2FPDA 4AG1C 1E7OA 2GBQA 2M0YA 2YUPA 1XOVA 2FPFA 2ESWA 2RQWA 2FO0A 2BTTA 4Z8AA 2DA9A 3NHNA 1NYGA 3IQLA 2KBTA 1WI7A 4J9DA 1BK2A 2J6FA 2ED0A 1ZUUA 1CKAA 2K9GA 2SRCA 1JEGA 1OPLA 1JU5C 2CUBA 1I07A 1QKXA 1OV3A 1Y0MA 1X69A 5IHIA 2J06A 4AFUC 1WLPB 2KYMA 2CT3A 2ABLA 1M8MA 2HEQA 2ECZA 2EVRA 4Z88A 2DL7A 3QWYA 3VRZA 2X3XD 2BZ8A 2ED1A 3RNJA 1ZBJA 4LNPA 3O5ZA 3H0HA 1VYVA 2A28A 2LQWA 2KEAA 3M0SA 4F17A 2DLPA 4K11A 2MCNA 1YCSB 4RUGA 2DL5A 1UUEA 2GQIA 3ULRB 1WFWA 4LUDA 3H0FA 2JXBA 1TUCA 2GTJA 2YT6A 2M51A 1MUZA 3I35A 3RBBB 2JM9A 1WYXA 5EC7A 1T3SA 2AZVA 4LUEA 4CC3A 2EW3A 3A98A 5GJWB 1X2KA 2KRNA 3EHRA 2KE9A 4RTXA 4OMLA 2FEIA 1G83A 2CH4W 3EG3A 2FG0A 2ROLA 2DL4A 1UHCA 4OMOA 1GRIA 3LH5A 1WDXA 2BZYA 3REBB 5IXBA 1X6GA 1WA7A 1GCQA 1U5SA 1RUWA 1ABQA 1S1NA 2K79A 2K7AA 1YWPA 2JS2A 3QWXX 1AWXA 3I5RA 4J9CA 1JO8A 1T3LA 5FWBA 1AWJA 1GBQA 1SHGA 1UDLA 4HVUA 2CSQA 1AWOA 2HCKA 2KROA 2EKHA 1W70A 2GGRA 1ARKA 2HBWA 3NPFA 2F2WA 2LX7A 1TG0A 2YDLA 2FRWA 4CC4B 2A37A 2PNIA 1ZUYA 1WX6A 4FSSA 1JXOA 1KFZA 4OMMA 2FRYA 3ZL7C 2JM8A 2ROTA 4J9GA 2KNBB 3VS3A 1VYTA 1PKSA 2KT1A 4OMPA 1MV3A 4CC7A 5IHKA 1WIEA 2CT4A 2K6DA 3M0UA 2VVKA 2CREA 3VS6A 3EG1A 4J9FA 3NGPA 1YN8A 3SHWA 4CC2A 2EYXA 2ENMA 3KFVA 1RI9A 3M0TA 5FWCA 1QLYA 2KXDA 5HCKA 1VA7A 3GBQA 4HVVA 1H92A 3I9QA 1UJ0A 3JV3A 1M27C 2DMOA 2K3BA 3U23A 1Z9ZA 1K0XA 2LZ6B 1AOJA 2EGAA 2EYYA 1B07A 1SRLA 2A36A 2LNHB 2YSQA 1BB9A 1GFDA 3PVLA 1K9AA 4JZ3A 1I0CA 1K0SA 2DVJA 2J6OA 2YUNA 2DYBA 1FMKA 1PRMC 1NEGA 2O88A 3PE0A 1UECA 1YP5A 1NLPC 1UGVA 1SSHA 2KR3A 2LJ1A 2W10A 4DEYA 2BZXA 2VKNA 4ZNXA 3UF4A 1TUDA 2L2PA 4J9IA 4ORZA 4RTTA 1AZEA 2V1QA 1V1CA 2GTOA 1AWWA 1QKWA 1VYUA 1UE9A 5I22A 2RNAA 1X43A 2MIOA 1T0JA 3M0PA 1G2BA 1NEBA 2H8HA 2CDTA 2F2XA 3TSZA 2I0NA 3CQTA 1K1ZA 4Y92A 4J9BA 2O9VA 3C0CA 1BU1A 2PTKA 3THKA 1GFCA 5I11A 1CKBA 1UTIA 4E6RA 1PRLC 1OOTA 1QCFA 1SHFA 1X27A 1WXTA 1BBZA 4WCIA 2DL3A 2JW4A 2E5KA 3EHQA 1OEBA 3H41A 3VS4A 2KGTA 2RMOA 4AFSC 2KRSA 2XMFA 2AKLA 1SPKA 2CH4A 2DX1A 1YNZA 2JMCA 3EGUA 1W6XA 2J6KA 4RTZA 2DF6A 2J05A 1EFNA 1E6GA 1X6BA 2FPEA 1AD5A 4HXJA 4HVWA 1T0HA 4Z89A 5IXFA 2O9SA 1IO6A 1OPKA 2W0ZA 1GL5A 3R6NA 1AEYA 2D0NA 2A08A 2KRMA 2EPDA 1LCKA 2C0OA 4RTUA 2IIMA 2RQRA 1H8KA 2DILA 1RLPC 2EGCA 2G6FX 1HD3A 2DJQA 1PHTA 5L23A 2RQUA 2C0IA 2D8JA 3EG0A 3PVQA 4R0KA 2P4RA 4GLMA 1KIKA 2AKKA 2OAWA 2QDLA 2DRMA 3H0IA 1WXUA 5GJVB 4AG2C 1QWEA 2DL8A 2AK5A 3UA7A 2EBPA 2C0TA 3I5SA 1I1JA 1PWTA 4KRTA 3REAB 1UJYA 4F14A 2RF0A 1ZUKA 4RTVA 4F16A 4OMNA 2HDAA 2JTEA 5IH2A 2X3WD 2CSIA 2L0AA 2EGEA 4JJCA 2AZSA 4A63B 5ECAA 1KSWA 4JJDA 4RTYA 2RPNA 1JQQA 1W1FA 2L3QA 4RTWA 1YWOA 2JS0A 4M4ZA 4EIKA 1K76A 1GCQC 2NUZA 1H3HA 3UA6A 4JJBA 2DM1A 3VS0A 1A0NB 1M3AA 2CUDA 1QWFA 2RN8A 1PKTA 4DEXA 2DBMA 1CSKA 2LJ3A 2OI3A 1NLOC 3TSWA 4D8DA 2JMAA 4D8KA 1KJWA 1J3TA 2EYWA 2OJ2A 4HCKA 3VS7A 1E6HA 1N5ZA 1WXBA 1K4US 2O2OA 2F2VA 1X2QA 2KXCA 4JZ4A 1NM7A 1RLQC 1FYNA 2NWMA 4IIOA 2DRKA 2RQTA 1GCPA 2J7IA 2L3PA 2LQNA 1UHFA 2PZ1A 2DNUA 4J9HA 1GBRA 1HJDA 4JPBW 2LCSA 2EQIA 1M3CA 2LMJA 2D1XA 2HSPA 4X1VA 4OMQA 2YUQA 2JT4A 3VRYA 1NYFA 1HSQA 2LJ0A 2YUOA 4LE9A 4ESRA 2GNCA 3NMZC 2L3SA 1Y57A 2LP5A 2RQVA 4IIMA 1ZX6A 4J9EA 2MOXA 3SEMA 2K2MA 4AFZC 1ABOA 3VS5A 2SEMA 1M30A 3M0RA 4LN2A 1NG2A 1MV0B 5FW9A 1ZLMA 1B3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRM A;  3FJ5 A;  2VWF A;  3UAT A;  3EG2 A;  2V1R A;  1UFF A;  5IHN A;  2EYZ A;  4AFQ C;  2KYB A;  2DBK A;  4QT7 A;  1M3B A;  2KT8 A;  2O31 A;  1AVZ C;  1UG1 A;  3TVT A;  2DE0 X;  1AZG B;  2B86 A;  1ZSG A;  2D8H A;  3VS1 A;  3VS2 A;  1Z9Q A;  4GBQ A;  1JXM A;  1PNJ A;  1U3O A;  3M0Q A;  1SEM A;  1U06 A;  2FPD A;  4AG1 C;  1E7O A;  2GBQ A;  2M0Y A;  2YUP A;  1XOV A;  2FPF A;  2ESW A;  2RQW A;  2FO0 A;  2BTT A;  4Z8A A;  2DA9 A;  3NHN A;  1NYG A;  3IQL A;  2KBT A;  1WI7 A;  4J9D A;  1BK2 A;  2J6F A;  2ED0 A;  1ZUU A;  1CKA A;  2K9G A;  2SRC A;  1JEG A;  1OPL A;  1JU5 C;  2CUB A;  1I07 A;  1QKX A;  1OV3 A;  1Y0M A;  1X69 A;  5IHI A;  2J06 A;  4AFU C;  1WLP B;  2KYM A;  2CT3 A;  2ABL A;  1M8M A;  2HEQ A;  2ECZ A;  2EVR A;  4Z88 A;  2DL7 A;  3QWY A;  3VRZ A;  2X3X D;  2BZ8 A;  2ED1 A;  3RNJ A;  1ZBJ A;  4LNP A;  3O5Z A;  3H0H A;  1VYV A;  2A28 A;  2LQW A;  2KEA A;  3M0S A;  4F17 A;  2DLP A;  4K11 A;  2MCN A;  1YCS B;  4RUG A;  2DL5 A;  1UUE A;  2GQI A;  3ULR B;  1WFW A;  4LUD A;  3H0F A;  2JXB A;  1TUC A;  2GTJ A;  2YT6 A;  2M51 A;  1MUZ A;  3I35 A;  3RBB B;  2JM9 A;  1WYX A;  5EC7 A;  1T3S A;  2AZV A;  4LUE A;  4CC3 A;  2EW3 A;  3A98 A;  5GJW B;  1X2K A;  2KRN A;  3EHR A;  2KE9 A;  4RTX A;  4OML A;  2FEI A;  1G83 A;  2CH4 W;  3EG3 A;  2FG0 A;  2ROL A;  2DL4 A;  1UHC A;  4OMO A;  1GRI A;  3LH5 A;  1WDX A;  2BZY A;  3REB B;  5IXB A;  1X6G A;  1WA7 A;  1GCQ A;  1U5S A;  1RUW A;  1ABQ A;  1S1N A;  2K79 A;  2K7A A;  1YWP A;  2JS2 A;  3QWX X;  1AWX A;  3I5R A;  4J9C A;  1JO8 A;  1T3L A;  5FWB A;  1AWJ A;  1GBQ A;  1SHG A;  1UDL A;  4HVU A;  2CSQ A;  1AWO A;  2HCK A;  2KRO A;  2EKH A;  1W70 A;  2GGR A;  1ARK A;  2HBW A;  3NPF A;  2F2W A;  2LX7 A;  1TG0 A;  2YDL A;  2FRW A;  4CC4 B;  2A37 A;  2PNI A;  1ZUY A;  1WX6 A;  4FSS A;  1JXO A;  1KFZ A;  4OMM A;  2FRY A;  3ZL7 C;  2JM8 A;  2ROT A;  4J9G A;  2KNB B;  3VS3 A;  1VYT A;  1PKS A;  2KT1 A;  4OMP A;  1MV3 A;  4CC7 A;  5IHK A;  1WIE A;  2CT4 A;  2K6D A;  3M0U A;  2VVK A;  2CRE A;  3VS6 A;  3EG1 A;  4J9F A;  3NGP A;  1YN8 A;  3SHW A;  4CC2 A;  2EYX A;  2ENM A;  3KFV A;  1RI9 A;  3M0T A;  5FWC A;  1QLY A;  2KXD A;  5HCK A;  1VA7 A;  3GBQ A;  4HVV A;  1H92 A;  3I9Q A;  1UJ0 A;  3JV3 A;  1M27 C;  2DMO A;  2K3B A;  3U23 A;  1Z9Z A;  1K0X A;  2LZ6 B;  1AOJ A;  2EGA A;  2EYY A;  1B07 A;  1SRL A;  2A36 A;  2LNH B;  2YSQ A;  1BB9 A;  1GFD A;  3PVL A;  1K9A A;  4JZ3 A;  1I0C A;  1K0S A;  2DVJ A;  2J6O A;  2YUN A;  2DYB A;  1FMK A;  1PRM C;  1NEG A;  2O88 A;  3PE0 A;  1UEC A;  1YP5 A;  1NLP C;  1UGV A;  1SSH A;  2KR3 A;  2LJ1 A;  2W10 A;  4DEY A;  2BZX A;  2VKN A;  4ZNX A;  3UF4 A;  1TUD A;  2L2P A;  4J9I A;  4ORZ A;  4RTT A;  1AZE A;  2V1Q A;  1V1C A;  2GTO A;  1AWW A;  1QKW A;  1VYU A;  1UE9 A;  5I22 A;  2RNA A;  1X43 A;  2MIO A;  1T0J A;  3M0P A;  1G2B A;  1NEB A;  2H8H A;  2CDT A;  2F2X A;  3TSZ A;  2I0N A;  3CQT A;  1K1Z A;  4Y92 A;  4J9B A;  2O9V A;  3C0C A;  1BU1 A;  2PTK A;  3THK A;  1GFC A;  5I11 A;  1CKB A;  1UTI A;  4E6R A;  1PRL C;  1OOT A;  1QCF A;  1SHF A;  1X27 A;  1WXT A;  1BBZ A;  4WCI A;  2DL3 A;  2JW4 A;  2E5K A;  3EHQ A;  1OEB A;  3H41 A;  3VS4 A;  2KGT A;  2RMO A;  4AFS C;  2KRS A;  2XMF A;  2AKL A;  1SPK A;  2CH4 A;  2DX1 A;  1YNZ A;  2JMC A;  3EGU A;  1W6X A;  2J6K A;  4RTZ A;  2DF6 A;  2J05 A;  1EFN A;  1E6G A;  1X6B A;  2FPE A;  1AD5 A;  4HXJ A;  4HVW A;  1T0H A;  4Z89 A;  5IXF A;  2O9S A;  1IO6 A;  1OPK A;  2W0Z A;  1GL5 A;  3R6N A;  1AEY A;  2D0N A;  2A08 A;  2KRM A;  2EPD A;  1LCK A;  2C0O A;  4RTU A;  2IIM A;  2RQR A;  1H8K A;  2DIL A;  1RLP C;  2EGC A;  2G6F X;  1HD3 A;  2DJQ A;  1PHT A;  5L23 A;  2RQU A;  2C0I A;  2D8J A;  3EG0 A;  3PVQ A;  4R0K A;  2P4R A;  4GLM A;  1KIK A;  2AKK A;  2OAW A;  2QDL A;  2DRM A;  3H0I A;  1WXU A;  5GJV B;  4AG2 C;  1QWE A;  2DL8 A;  2AK5 A;  3UA7 A;  2EBP A;  2C0T A;  3I5S A;  1I1J A;  1PWT A;  4KRT A;  3REA B;  1UJY A;  4F14 A;  2RF0 A;  1ZUK A;  4RTV A;  4F16 A;  4OMN A;  2HDA A;  2JTE A;  5IH2 A;  2X3W D;  2CSI A;  2L0A A;  2EGE A;  4JJC A;  2AZS A;  4A63 B;  5ECA A;  1KSW A;  4JJD A;  4RTY A;  2RPN A;  1JQQ A;  1W1F A;  2L3Q A;  4RTW A;  1YWO A;  2JS0 A;  4M4Z A;  4EIK A;  1K76 A;  1GCQ C;  2NUZ A;  1H3H A;  3UA6 A;  4JJB A;  2DM1 A;  3VS0 A;  1A0N B;  1M3A A;  2CUD A;  1QWF A;  2RN8 A;  1PKT A;  4DEX A;  2DBM A;  1CSK A;  2LJ3 A;  2OI3 A;  1NLO C;  3TSW A;  4D8D A;  2JMA A;  4D8K A;  1KJW A;  1J3T A;  2EYW A;  2OJ2 A;  4HCK A;  3VS7 A;  1E6H A;  1N5Z A;  1WXB A;  1K4U S;  2O2O A;  2F2V A;  1X2Q A;  2KXC A;  4JZ4 A;  1NM7 A;  1RLQ C;  1FYN A;  2NWM A;  4IIO A;  2DRK A;  2RQT A;  1GCP A;  2J7I A;  2L3P A;  2LQN A;  1UHF A;  2PZ1 A;  2DNU A;  4J9H A;  1GBR A;  1HJD A;  4JPB W;  2LCS A;  2EQI A;  1M3C A;  2LMJ A;  2D1X A;  2HSP A;  4X1V A;  4OMQ A;  2YUQ A;  2JT4 A;  3VRY A;  1NYF A;  1HSQ A;  2LJ0 A;  2YUO A;  4LE9 A;  4ESR A;  2GNC A;  3NMZ C;  2L3S A;  1Y57 A;  2LP5 A;  2RQV A;  4IIM A;  1ZX6 A;  4J9E A;  2MOX A;  3SEM A;  2K2M A;  4AFZ C;  1ABO A;  3VS5 A;  2SEM A;  1M30 A;  3M0R A;  4LN2 A;  1NG2 A;  1MV0 B;  5FW9 A;  1ZLM A;  1B3Q A; 
#chains in the Genus database with same CATH topology
 3FJ5 A;  3CPW A;  3EG2 A;  1B7T A;  1UFF A;  3L2W A;  2EQJ A;  1YFN A;  2DBK A;  2KT8 A;  1AVZ C;  1UG1 A;  1PD1 A;  2B86 A;  4M75 E;  2O01 E;  5I21 A;  4QVZ A;  1M90 C;  5GMK e;  2D8H A;  4O5V A;  2V8J A;  2F5T X;  1U3O A;  2LC4 A;  3BDL A;  1SEM A;  2E6Z A;  1U06 A;  2FPD A;  2MPX C;  3CBP A;  4KT0 E;  2PQW A;  4JDS A;  4OB3 B;  2RQW A;  5IAY A;  3X25 B;  3QUI A;  1HK9 A;  1BI2 A;  1HYO A;  4FL6 A;  3E2U A;  2GFA A;  1BK2 A;  1RL2 A;  1KQ1 A;  1CKA A;  2RB6 A;  5LJ5 g;  3P8B B;  2SRC A;  2XG8 D;  2O4X B;  4M75 G;  1IB8 A;  3DKM A;  3GLX A;  2CUB A;  4QW2 A;  1I07 A;  1QKX A;  4UC4 A;  5GMK h;  4M7A G;  2J06 A;  1S72 A;  1TS9 A;  2XHC A;  3CPW S;  2ECZ A;  4Z88 A;  4HCZ A;  3G71 A;  3VRZ A;  3RKW A;  2BZ8 A;  4EMG A;  3C12 A;  2KAF A;  1QVP A;  2QGF B;  3PMT A;  3EH1 A;  4F17 A;  4K11 A;  3LWH A;  2DJZ A;  4M78 F;  1I81 A;  3OBY A;  1UUE A;  3CCL A;  1BCO A;  4WTO B;  2WSF E;  5J39 A;  4E47 A;  2VXE A;  2FZC B;  1ACM B;  5GAM e;  5D6Y A;  3RBB B;  1W2B P;  1QW1 A;  1NE8 A;  1WYX A;  2JM9 A;  2V8K A;  1T3S A;  5LJ3 g;  1UEB A;  2EW3 A;  1ZSZ B;  1NBE B;  2M9U A;  2KE9 A;  4M7A E;  4OML A;  2CH4 W;  3P8D A;  1ZHI A;  3EFO B;  2E65 A;  2ROL A;  2DL4 A;  2QA4 Q;  1WDX A;  3CCQ A;  4YTL A;  5IXB A;  1WA7 A;  1Q82 U;  2JUF A;  3MJX A;  2JS2 A;  3TU4 K;  4ZTF A;  1PCX A;  4KUD K;  3QWX X;  4IUT A;  3M56 A;  2D6F A;  3I5R A;  5GAN 3;  1JO8 A;  1T3L A;  2KMT A;  1SF9 A;  1GBQ A;  3MET A;  1SHG A;  1UDL A;  2CSQ A;  3L2R A;  4HCC A;  2EKH A;  3RUX A;  1M2V B;  4BDY A;  4C5E A;  3QG1 A;  4EMK A;  1QCN A;  2F2W A;  1TG0 A;  2FRW A;  2K3Y A;  2DTO A;  2A37 A;  4FSS A;  3C95 A;  9ATC B;  3OYI A;  2HMA A;  2K2V A;  3CBO A;  3QII A;  1R77 A;  3A5Z B;  4Y91 A;  5IHK A;  1X01 A;  3VV0 A;  1JRI A;  3V7S A;  2VVK A;  3VS6 A;  3G4S T;  4J9F A;  3PFS A;  3JB9 I;  1RI9 A;  1QLY A;  2A7Y A;  1PD0 A;  1EZZ B;  3MCA B;  1BYM A;  3GP8 A;  4C0Z A;  4M78 E;  3S3N A;  4M7A C;  4OVA A;  2CZ1 B;  1Z9Z A;  1QVG A;  1G3T A;  4C92 E;  1VQ6 T;  3UT1 A;  2A36 A;  2LNH B;  3EH2 A;  1BB9 A;  4DBH A;  2K57 A;  3LH0 A;  2DYI A;  3FIF A;  1K9A A;  3LX7 A;  2J6O A;  2YUN A;  2CZ7 B;  2RA2 A;  3X28 B;  1NEG A;  2LQK A;  2X9H A;  3EG9 A;  1YP5 A;  1Q81 C;  2KR3 A;  2LJ1 A;  2DET A;  5CR2 A;  4ZNX A;  2L2P A;  2XKO C;  1Q95 G;  1WQ7 A;  1AZE A;  2V1Q A;  3GNG A;  4IUP A;  1V1C A;  1AWW A;  1QKW A;  3JCM e;  5HK0 A;  5GAN 6;  1T0J A;  4J7I A;  5GAN 2;  4VUB A;  1G2B A;  1N27 A;  2CDT A;  2F2X A;  2DER A;  4PJO E;  1KD1 C;  3ZBD A;  2XDB A;  4HKE A;  2OTL A;  1ZA2 B;  4J9B A;  3E9G A;  2O9V A;  2G3R A;  1MGQ A;  2PTK A;  1BI0 A;  4PJO F;  5GMK l;  5C6S A;  1CKB A;  4E6R A;  1WZO A;  2YHT A;  1QCF A;  4L5G A;  4XQ3 A;  4F7U F;  2EYQ A;  3KXT A;  3C4S A;  4KGZ B;  1W2B A;  4RCC A;  2LCL A;  2JW4 A;  3H41 A;  2QGG A;  1SPK A;  2CH4 A;  3OYY A;  1MMD A;  1W6X A;  2EWN A;  3CCV Q;  2J6K A;  4C5H A;  2DF6 A;  1ZQ1 A;  3KUF A;  2B8A A;  5HY6 A;  3OBW A;  1YHQ A;  5IXF A;  4ME7 A;  2AT1 B;  1GXI E;  1YJN T;  3HKS A;  4E7K A;  2DXC A;  3G71 Q;  1AEY A;  3CPW P;  3A8L B;  2HKN A;  1QP3 A;  2MAM A;  1MMA A;  3HPW A;  2RQR A;  4C8Q G;  1H8K A;  1OX9 A;  1DJ7 B;  3DLM A;  2DKG A;  3QZ9 B;  3M53 A;  5FLX E;  5FU6 C;  1PHT A;  2EAY A;  2C0I A;  3EG0 A;  1MNE A;  4M7D D;  2RJC A;  3CCE Q;  4GLM A;  4WF2 A;  4XTY A;  3WVD B;  4AG2 C;  5FRM A;  3G4S Q;  2FB7 A;  1W2B S;  3CMA T;  3I55 T;  2BUD A;  1KD1 R;  5LJ5 d;  4PFZ A;  2OAU A;  2RF0 A;  2CP7 A;  4OMN A;  2KY9 A;  4B9W A;  3EGX B;  4C8Q A;  4E7S A;  4R55 A;  2MWP A;  3CC4 A;  3OYH A;  4RTY A;  2LQ8 A;  3G6E T;  1W1F A;  4FT4 A;  3A8M B;  2JS0 A;  4EIK A;  3PTA A;  4ZN1 A;  2FZK B;  3P8H A;  4JJB A;  1IZ6 A;  1M3A A;  4V2S A;  1D09 B;  1IGQ A;  1KD1 U;  1X75 C;  2EYW A;  2E5Q A;  3VS7 A;  4BI4 A;  1N5Z A;  1M1F A;  1K4U S;  1K73 R;  4JZ4 A;  4PLL A;  3SWN B;  1FYN A;  3OMG A;  3OMC A;  4M7A F;  1GCP A;  2A0F B;  1VQM Q;  1UB4 A;  1FMV A;  2X4W A;  2PZ1 A;  1P92 A;  2DNU A;  3M4G A;  4F7U A;  4ZN3 A;  1RAD B;  4M75 A;  4JPB W;  5IT9 E;  1M3C A;  2K4Y A;  2D1X A;  1NPR A;  1K8A C;  4X1V A;  2YUQ A;  1YJN Q;  1WGS A;  1LPL A;  4LE9 A;  3X26 B;  4M75 D;  3CCU A;  2RQV A;  3FRN A;  4IIM A;  1OU9 A;  2MOX A;  3SD4 A;  3SEM A;  2K2M A;  5GMK m;  3QYG B;  2ZGW A;  1M30 A;  4LN2 A;  3V7R A;  3CCV T;  3G7Z A;  1SRM A;  3E1S A;  4F7U G;  2VWF A;  3OYN A;  3CCU T;  2NUP A;  4DA4 A;  3HFO A;  1VQ7 A;  2V8I A;  2EYZ A;  1QP2 A;  3JCM P;  2DXU A;  4QT7 A;  3R6O A;  1YJ9 T;  2DEU A;  2DK3 A;  1AZG B;  4XTX A;  1YJN A;  4Z02 A;  3VS2 A;  1VQK T;  3BY7 A;  1PNJ A;  3MEW A;  3GNF B;  4OP0 A;  4AG1 C;  2YUP A;  5HK3 A;  3NTI A;  4C92 G;  1VQO Q;  4FYY B;  3CC2 T;  3M54 A;  2DA9 A;  5KCH A;  2OTJ A;  2E12 A;  4FYX B;  1N8R U;  2ZZD A;  2ED0 A;  2JVV A;  4M77 B;  2OTJ Q;  5GAO m;  1VQP T;  2L89 A;  1JEG A;  1OPL A;  2YXY A;  1VQN T;  5A0D A;  3PIO A;  2ZPG B;  1Y0M A;  1X69 A;  4PJN A;  3CXC S;  2OTJ T;  4JRI A;  2CT3 A;  2RHY A;  2ABL A;  2E4H A;  5GAN 4;  1M8M A;  5CKH A;  2HEQ A;  3J80 E;  4QVD A;  2I2L A;  4E7Z A;  5CKE A;  1RAA B;  4JRQ A;  2X3X D;  2ED1 A;  3MKD A;  2V26 A;  3O5Z A;  3OQ5 A;  4PJL A;  2A28 A;  2LQW A;  3QDF A;  5GAN d;  2FVU A;  1FXX A;  1WHM A;  4PNO A;  1YCS B;  4RUG A;  2DL5 A;  2P0P A;  2VYT A;  2NUT A;  3ULR B;  4LUD A;  5LJ5 j;  4JRP A;  1YIT Q;  3JB9 D;  2GTJ A;  4XU1 A;  5DM7 R;  3I35 A;  3L2V A;  3GPL A;  3J81 E;  3I56 A;  3BW1 A;  5EC7 A;  1BI1 A;  3CC7 Q;  1YI2 Q;  3A98 A;  5GJW B;  2KRN A;  2MK5 A;  3EHR A;  1NJI U;  4BAC A;  4E7J A;  2FEI A;  4MMK A;  2CP3 A;  1VQ4 Q;  3CXC A;  3NTK A;  2FG0 A;  1VQ8 T;  1GRI A;  3V8L A;  5FU6 B;  8ATC B;  2BZY A;  1Q86 U;  1GCQ A;  4FW2 A;  1VQM A;  3M55 A;  5FRN A;  2K79 A;  4M77 D;  3X20 B;  2HZY A;  5CKB A;  1YJ9 Q;  1AWX A;  2K5F A;  2QAZ A;  5CVI A;  1QCO A;  5GAM d;  2DAQ A;  2WSC E;  3FB9 A;  3BDU A;  2HBW A;  2CGH A;  4M78 C;  5I2M A;  3JB9 F;  5A0G A;  4M75 B;  2EQU A;  1KQS S;  1VQ8 A;  2PNI A;  2NYS A;  3JB9 G;  4BUG A;  1TUG B;  2Y4Y A;  4KUL A;  2EQM A;  3DB3 A;  1D1A A;  1KFZ A;  2C06 A;  4OMM A;  2FRY A;  2FZG B;  2KVQ G;  3MP1 A;  2VXF A;  4XTU A;  4M78 D;  3VS3 A;  1VYT A;  2HD0 A;  1ZA1 B;  1PKS A;  4OMP A;  4CC7 A;  5A0L A;  4LD9 K;  4JS4 A;  2QQA A;  3OS5 A;  4XTW A;  4XTV A;  3M0U A;  2BIV A;  2EJG A;  4MDW A;  5LJ3 f;  4MDX A;  2CRE A;  3EG1 A;  3L42 A;  2F69 A;  3NGP A;  3KFV A;  4LDV A;  2CP2 A;  1VA7 A;  4J5Y A;  4HVV A;  2E1H A;  2E41 A;  2DMO A;  2MWO A;  3U23 A;  2KDS A;  1QVG P;  1D0Y A;  4J6W A;  1TWB A;  1SRL A;  4KUI A;  2YLB A;  2YSQ A;  2CP5 A;  4FW1 A;  1IHW A;  2DVJ A;  2QQR A;  2DYB A;  4A4F A;  2O88 A;  1PSF A;  1UEC A;  4IUU A;  1OX8 A;  5DY9 A;  1M1K R;  1UGP B;  4DEY A;  3OYE A;  3UF4 A;  4KGV B;  2FL7 A;  4GLK A;  4J9I A;  4J8O A;  1YHQ Q;  4ORZ A;  1VQN A;  4RTT A;  5LJ3 e;  5CQY A;  1HXD A;  2VC8 A;  2PVD B;  4EMK B;  2LRQ A;  1BCM A;  1D0Z A;  4B9X A;  1R0C B;  3OYK A;  3TSZ A;  1PG5 B;  3CQT A;  2HQX A;  3EGD B;  4M7D B;  1TH7 A;  4Y92 A;  5GAN g;  4XTZ A;  1D0X A;  4BE2 A;  4N0A A;  5LJ5 e;  4FM4 B;  2RK1 A;  2HL5 C;  4C92 A;  1LJO A;  2RHU A;  1QVG S;  4QKU A;  5LJ3 j;  5GAN 8;  4MZT A;  1SHF A;  3QJ6 A;  1X27 A;  2VUB A;  3VYH B;  5GAM j;  1WXT A;  2BE9 B;  4WCI A;  4C0D B;  4XU0 A;  4JRK A;  3SFM A;  3EHQ A;  3S3O A;  1K73 U;  2RMO A;  4XAX B;  2XMF A;  4LXC A;  1BI3 A;  1YNZ A;  3H8Z A;  2L8D A;  4RTZ A;  3CBM A;  3OYA A;  1YJW Q;  2JTM A;  2LX9 A;  1ZSZ A;  2FPE A;  3NTH A;  5IN1 A;  3L2Z A;  3CCJ T;  1T0H A;  1YIJ Q;  2K5I A;  3BFM A;  3ZFJ A;  1IO6 A;  1WHJ A;  3FEO A;  1YJW A;  1KC8 C;  3AHU A;  2QG9 B;  2VV5 A;  4A4G A;  2A08 A;  2RHZ A;  2KRM A;  2EPD A;  5KYY A;  1W4S A;  4RTU A;  3CCJ A;  2IIM A;  3OYM A;  3A8O B;  4B6M A;  2DIL A;  2EGC A;  4BD3 A;  5GAO q;  1Y96 B;  1HD3 A;  2MF2 A;  3TCJ A;  5L23 A;  2RQU A;  4R0K A;  4RCB A;  1M1K U;  2AIR B;  3A8H B;  1WXU A;  2ATC B;  3M59 A;  1M90 U;  2XDP A;  4M75 F;  4M7A A;  5CIU A;  2AK5 A;  3N5B B;  4D6W A;  1PWT A;  1QQJ A;  4MML A;  4F14 A;  4RTV A;  2HQE A;  3GF5 A;  4F16 A;  3OW2 S;  3CC2 Q;  2HDA A;  3G71 T;  3PGG A;  4DBF A;  1LNX A;  2CSI A;  2L0A A;  2PVO B;  4ELZ C;  2RH2 A;  4A63 B;  3CD6 A;  2P0K A;  3CCM T;  3GOX A;  3CME A;  3OYF A;  4ATO A;  4M77 F;  4E7L A;  1VQN Q;  4X34 A;  1XNI A;  1V29 B;  2RI3 A;  2NUZ A;  1VQ9 Q;  2DM1 A;  1YJ9 A;  2YWW A;  4DEX A;  1PKT A;  2LJ3 A;  4C8Q F;  2E64 A;  2JMA A;  2OJ2 A;  2Y4X A;  1E6H A;  1OQK A;  1WQW A;  1Y07 A;  2O2O A;  1X2Q A;  1WPY A;  1XQH A;  5KYW A;  4DQ2 A;  3QJY A;  2QQ9 A;  3CCS Q;  1RLQ C;  2ZAE A;  1VQ4 A;  1KC8 R;  2EKO A;  2DRK A;  3JB9 H;  2L3P A;  4JLG A;  3JCM c;  1BKB A;  2P84 A;  2PUO B;  4PKC C;  4RMO A;  3RMQ A;  1C1A A;  2LQN A;  2LCC A;  1UHF A;  4IUR A;  5KYX B;  3VUZ A;  2RJF A;  4BB7 A;  5KYU A;  4ZGJ B;  2GQV A;  5GAO p;  3M9Q A;  5KCO A;  4NS5 A;  2LMJ A;  2HSP A;  2FYK A;  5CCA A;  2E70 A;  4C0F A;  5LJ3 h;  4J7F A;  1HSQ A;  2LJ0 A;  3QKJ A;  2E3H A;  5KYW B;  3HRT A;  2YUO A;  1I8F A;  4M78 A;  1TTH B;  2DXT A;  2LP5 A;  2DO3 A;  5GMK j;  5CKF A;  1G5V A;  2Y90 A;  3PNW C;  3RKX A;  1VQ4 T;  1B34 B;  4AFZ C;  2ZPB B;  1VQ8 Q;  4KH0 B;  3M0R A;  3PT9 A;  5FRO A;  2COY A;  1G8X A;  1NJI C;  3FLG A;  5C0M A;  5FW9 A;  1JBM A;  2CS7 A;  2PUK B;  2RD1 A;  1Q81 U;  3JCM W;  5IHN A;  1NZ9 A;  5D7U A;  3QBY A;  1M3B A;  4ZGE B;  4M7D F;  2O31 A;  3TVT A;  2M0O A;  3CCR Q;  1ZSG A;  3VS1 A;  3M0Q A;  4DOV A;  1Q82 R;  2QA4 T;  2KQW A;  1R0B G;  1RAF B;  2ESW A;  2HQH A;  4OGC A;  1VQ6 Q;  2FO0 A;  3LGL A;  2MMP A;  5EG2 A;  3UWN A;  1VQL A;  3SB2 A;  3NHN A;  3QXE B;  1TOV A;  1NYG A;  3IQL A;  1ZBX A;  4DOW A;  4J9D A;  2J6F A;  1ZUU A;  1Q7Y C;  5KE2 A;  2K9G A;  5GAN 5;  1VQ5 T;  1JU5 C;  1M5Q 1;  2MYS A;  2PVG B;  5GAN h;  3OYD A;  1VQ9 T;  5GAO l;  1OV3 A;  4DBR A;  1I4K 1;  1F1B B;  1YBY A;  5IHI A;  2BE7 D;  4N4G A;  1WLP B;  1VQK Q;  2KYM A;  1C0M A;  4PJO C;  4MZP A;  2EVR A;  3Q1J A;  3RNJ A;  4LNP A;  3ZEH A;  3TEE A;  3H0H A;  2OTL T;  1YIT T;  1VYV A;  3CPF A;  2KEA A;  3M0S A;  5DLO A;  2HKQ B;  3EG9 B;  3OYB A;  1WJQ A;  4LDY A;  1UGS B;  2A3L A;  3RKY A;  3T9N A;  1TUC A;  2ZCF B;  2YT6 A;  3MHX A;  2HSE B;  1N9S A;  1K8A U;  1PSE A;  1D1B A;  3HTR A;  2AZV A;  2CP0 A;  2JZ2 A;  4LUE A;  4CC3 A;  1X2K A;  2DTH A;  2H3J A;  2DD5 A;  3OS0 A;  4BE0 A;  4M78 B;  2JJ9 A;  3EG3 A;  4ZTJ A;  4M7D E;  4OMO A;  2X35 A;  1XJW B;  1VQO A;  2L3R A;  3LGF A;  1U5S A;  1RUW A;  2DFU A;  2K7A A;  3MEV A;  7AT1 B;  1Q7Y R;  3MP6 A;  4J9C A;  5FWB A;  1WHH A;  1AWJ A;  3ER0 A;  3V7C A;  4LDW A;  4BI8 B;  4HVU A;  4M77 A;  1AWO A;  2XD0 A;  2LNV A;  3CC4 Q;  2YLC A;  4P5N A;  5LJ3 d;  3H9N A;  3NPF A;  4XK8 E;  2X51 A;  1QVF A;  2QQB A;  3JCM f;  1QVF P;  2YDL A;  1SKU B;  5J3B A;  1WX6 A;  1D3B A;  3ME9 A;  1FMW A;  4A53 A;  4QVC A;  3FDR A;  1MV3 A;  1WIE A;  1M4Z A;  2JNG A;  2CT4 A;  3CC7 T;  2K6D A;  1N8R R;  3E19 A;  2CYZ B;  4C8Q B;  5KYX A;  4JJN K;  1VQL Q;  4C0G A;  4CC2 A;  5GAM f;  2EYX A;  2ENM A;  4PJO G;  1G3Y A;  8AT1 B;  3GBQ A;  1VQL T;  4PJO B;  1UJ0 A;  1U1S A;  2JN0 A;  1PC0 A;  3CC7 A;  5GAN j;  1TU0 B;  3JV3 A;  3I56 Q;  1M27 C;  2K3B A;  2EJF A;  1OZ3 A;  3G6E A;  1M1K C;  1K0X A;  1OI1 A;  2LZ6 B;  1B07 A;  5A2Q E;  2LT4 A;  3JCM Q;  4LDX A;  1K0S A;  1QVF S;  1FMK A;  5GAM h;  3PE0 A;  2COZ A;  1UGV A;  1SSH A;  1YJW T;  3DB4 A;  2W10 A;  4BDZ A;  2BZX A;  2DTI A;  2XI9 A;  3JCM V;  4J83 A;  3CCM Q;  2IVW A;  2K3X A;  3OB9 A;  5KH6 A;  3CCS T;  4BI3 A;  3J7A F;  4MZM A;  4E7I A;  1VUB A;  2GTO A;  3QPH A;  4CI0 C;  4LD6 A;  5I22 A;  1FWZ A;  1OZ2 A;  3JCM d;  3M0P A;  3I56 T;  3RER A;  1H3Z A;  5D6W A;  3CMA Q;  3HHT B;  3CCL T;  2ZPH B;  1O75 A;  4PFP A;  5AT1 B;  4A4E A;  1G3W A;  3OSV A;  1VOM A;  2RJD A;  3C0C A;  3THK A;  1Q86 R;  2HL3 A;  5I11 A;  1FX7 A;  1N8R C;  1OOT A;  4GY5 A;  3LLR A;  3CCS A;  2DL3 A;  1EIF A;  3QO3 A;  2X4Y A;  5FU7 C;  4PFO A;  3RMS A;  5LJ5 f;  2E5K A;  5I2S A;  3VS4 A;  2KGT A;  4AFS C;  2KRS A;  4PK4 A;  1UGQ B;  4IKF A;  2DX1 A;  1Y96 A;  2QDY B;  3OW2 A;  3EGU A;  1EFN A;  1VQ9 A;  4FIB A;  1X6B A;  4JUV A;  4HXJ A;  2YRV A;  2KI7 A;  1BIB A;  4HVW A;  4M75 C;  2FHD A;  2O9S A;  3TQ7 P;  3V8J A;  3FC3 A;  3R6N A;  2LDM A;  1KHI A;  4JS5 A;  2D0N A;  4O6J A;  1SG5 A;  1LCK A;  2ZPI B;  1YI2 T;  3CC2 A;  2EIF A;  1M2V A;  2G6F X;  4A4K A;  3EFS A;  3QSU A;  4XU2 A;  3I55 A;  2DJQ A;  3PVQ A;  2D8J A;  4ELY C;  1KIK A;  1PM3 A;  1VQM T;  4OGE A;  2DZC A;  3H0I A;  1OYX A;  2DRM A;  1U1T A;  2EQK A;  5GJV B;  1D3B B;  1QWE A;  3SDZ A;  3WXM B;  2DIQ A;  2OTL Q;  3CCR T;  4X9D A;  2DL8 A;  1MHN A;  4E7H A;  2KSS A;  3EFO A;  2C0T A;  5J26 A;  1I1J A;  3VUB A;  1U8R A;  3JCM g;  1V76 A;  1ZUK A;  2LTO A;  2EGE A;  1Q86 C;  4E2F B;  3EAE A;  4F7U E;  3OW2 P;  2QQS A;  3CCR A;  2QXF A;  2DVE A;  5KYU B;  2CKK A;  1BIA A;  3MEU A;  2P4T A;  1JQQ A;  1YIJ A;  2ZPF B;  2YRC A;  1OU8 A;  1H3H A;  1Q7Y U;  1A0N B;  3OYL A;  2CUD A;  3M58 A;  4M77 E;  1QWF A;  4PL6 A;  2DBM A;  1CSK A;  2OI3 A;  2R58 A;  4RKU E;  3TSW A;  3C94 A;  2VGN A;  1J3T A;  3MPU B;  4PJM A;  4HCK A;  1R8O B;  3UPU A;  3CCQ Q;  3JCM h;  2XU8 A;  1NM7 A;  2QA4 A;  1C6V X;  2NWM A;  1VIE A;  4FU6 A;  1WHG A;  1SSF A;  2MI6 A;  4M7D C;  4FSX A;  4ZGD B;  1EX4 A;  2J7I A;  2NLU A;  2QEX Q;  3HFN A;  1KQS P;  4J9H A;  3I55 Q;  1N9R A;  1WHL A;  1XTD A;  4F04 B;  2LCS A;  5GAO r;  1NJI R;  5M9O A;  5GAO n;  3S6W A;  3SWN C;  1JJ2 P;  3LYI A;  1NYF A;  4L59 A;  3MP8 A;  4A4H A;  1M2O A;  2GNC A;  3GIB A;  2L3S A;  1ZX6 A;  5CAI A;  3JSC A;  2E3I A;  2XID A;  1ABO A;  1N6A A;  3VS5 A;  2SEM A;  4EDU A;  1NG2 A;  2XDD A;  1KQ2 A;  1S72 T;  1ZLM A;  3VYG A;  2ZPE B;  3CME T;  2DZ9 A;  3UAT A;  2NUT B;  1Q82 C;  2M02 A;  1Y71 A;  2V1R A;  4C92 D;  1S72 Q;  1TSF A;  4AFQ C;  2KYB A;  3JAM E;  3CME Q;  4C5I A;  1IRE B;  2DE0 X;  3CD6 Q;  1D1C A;  3DLL A;  2DPP B;  4NL3 A;  3CCV A;  5AYF A;  4FT2 A;  2QK0 A;  1Z9Q A;  5LJ5 h;  4KH1 B;  4GBQ A;  1JXM A;  5DLQ E;  2X4X A;  2HAX A;  3BE3 A;  3OYG A;  3EGX A;  1RAE B;  1E7O A;  2GBQ A;  2M0Y A;  2R57 A;  1XOV A;  2FPF A;  2QTV A;  5GAN e;  2RM4 A;  2BTT A;  4IUV A;  4Z8A A;  4A54 A;  4RG2 A;  2IPO B;  1MND A;  2QEX A;  2QI2 A;  2HBP A;  2KBT A;  1WI7 A;  4N4H A;  1WJR A;  1IHV A;  3HRS A;  3CCM A;  5HKC A;  3CCJ Q;  3HSB A;  3S3M A;  4AFU C;  3OA6 A;  3LWI A;  2CZ0 B;  1X6O A;  2DXB A;  3CCL Q;  2GCX A;  2DL7 A;  2VB6 A;  3M5A A;  3QWY A;  4M7D A;  1ZBJ A;  3VU3 C;  4M7A D;  1MMN A;  2BKD N;  2R5M A;  2DLP A;  3EGD A;  2RK2 A;  2XIC A;  2MCN A;  2NUP B;  2GQI A;  1WFW A;  3CCE T;  3H0F A;  3O8V A;  1KK7 A;  1IRX A;  1KQS A;  2JXB A;  1IGU A;  2Z0W A;  4NL2 A;  3QYH B;  2M51 A;  1MUZ A;  4EMK C;  1Y7X A;  3MO8 A;  5CKD A;  3JCM b;  1YI2 A;  4RTX A;  5GAN f;  1G83 A;  2RJE A;  4BY6 C;  1UHC A;  4J6Y A;  3LH5 A;  3REB B;  1X6G A;  2RO0 A;  1ABQ A;  1S1N A;  5D6X A;  3D7S B;  3FJP A;  1YWP A;  2RHI A;  4F7U B;  3PMI A;  2JTF A;  3QHS A;  2K5L A;  4N4I A;  1JJ2 S;  2DD4 A;  3URG A;  2HCK A;  2KRO A;  3QDR B;  4XU3 A;  1W70 A;  2D9T A;  2GGR A;  2D0Q B;  1ARK A;  4M77 G;  1KG1 A;  1LOJ A;  2LX7 A;  2LVM A;  4CC4 B;  1YHQ T;  3OS1 A;  5CK9 A;  3VKI A;  3H6Z A;  1ZUY A;  2OX7 A;  3RES A;  3AT1 B;  2WAC A;  1JXO A;  4M7A B;  3ZL7 C;  2JM8 A;  2ROT A;  5KE3 A;  1VQ7 T;  4J9G A;  1MMG A;  2KNB B;  2E6N A;  2KT1 A;  2E10 A;  3OYJ A;  4C92 B;  4II1 A;  4M77 C;  5L8R E;  5CQX A;  4L6V 5;  3MEA A;  3SHW A;  1YN8 A;  1LVK A;  4ANJ A;  4CRI A;  1KC8 U;  1G3S A;  3M0T A;  5FWC A;  4HT8 A;  2KXD A;  5HCK A;  4PJO A;  1H92 A;  3I9Q A;  2F1L A;  3CEY A;  4EMH A;  5CO7 A;  2GFU A;  1AOJ A;  2EGA A;  2EYY A;  2M16 A;  4PJO D;  1GFD A;  3PVL A;  4JZ3 A;  1I0C A;  1VQ7 Q;  3L1A A;  2RHX A;  4J6X A;  4HCB A;  4QQG A;  1PRM C;  1JB0 E;  2QEX T;  1NLP C;  3OY9 A;  2VAS A;  4TVR A;  2VKN A;  3VJP A;  1TUD A;  3WVE B;  6AT1 B;  1RAH B;  3CCU Q;  2EFI A;  2R5A A;  5KYN A;  4PJJ A;  2X4J A;  1VYU A;  1UE9 A;  1Q81 R;  2RNA A;  1AT1 B;  1X43 A;  1RAG B;  2MIO A;  1IXD A;  1O9S A;  1NEB A;  2H8H A;  1OUL A;  3QZ5 B;  1JJ2 A;  1VQ5 A;  2I0N A;  3ASK A;  1K1Z A;  1AHJ B;  4FYV B;  1K9M C;  2HNI A;  1VQ5 Q;  2WSE E;  1BU1 A;  3CCQ T;  2F5K A;  1GFC A;  4HA8 A;  2JOY A;  1UTI A;  3M57 A;  1PRL C;  3KBG A;  1BBZ A;  4X9C A;  3A1P A;  3JCM J;  1I5O B;  1YIT A;  1OEB A;  3CMA A;  4OB1 B;  4OMF B;  2AKL A;  2L5Q A;  1RAI B;  2CZ6 B;  2JMC A;  4KBM B;  4OB2 B;  2RI5 A;  1WHK A;  2J05 A;  1E6G A;  2PU9 B;  1AD5 A;  3L2Q A;  4C8Q E;  1NPP A;  4Z89 A;  3CC4 T;  3JB9 J;  2QYZ A;  1OPK A;  2W0Z A;  1GL5 A;  2KK4 A;  4AT1 B;  4M7D G;  3TRE A;  4FYW B;  4C0D C;  5GAM g;  4N0A C;  4C92 F;  2C0O A;  4C92 C;  4Y28 E;  1UGR B;  4Q5W A;  3E9F A;  1RLP C;  2P0Q A;  2O4X A;  3PIP A;  2CP6 A;  3RDV A;  1VQO T;  3G4S A;  3G6E Q;  2VGM A;  2EJ9 A;  2QTX A;  4M78 G;  4BY6 B;  2P4R A;  4RG8 A;  2AKK A;  2OAW A;  2QDL A;  3JCM X;  3V8K A;  3CCE A;  2DEQ A;  3CD6 T;  4JLI A;  5GAN 7;  4C8Q D;  3NFC A;  3UA7 A;  1VQP Q;  2EBP A;  1VIF A;  3I5S A;  3OS2 A;  1M1G A;  1ZSZ C;  4KRT A;  3REA B;  1UJY A;  1K9M R;  4IUQ A;  5KYY B;  3G1J A;  4PLI A;  1H64 1;  3INZ A;  2JTE A;  4EPC A;  5IH2 A;  2X3W D;  4JJC A;  3HL8 A;  2IG0 A;  3HP9 A;  4HT9 A;  4OB0 B;  4OF1 A;  2AZS A;  4FCY A;  5ECA A;  1KSW A;  4JJD A;  3UDC A;  2XK0 A;  2RPN A;  2L3Q A;  4RTW A;  1M8V A;  1YWO A;  4M4Z A;  1K76 A;  1GCQ C;  1WJS A;  3UA6 A;  1KHC A;  1M90 R;  3VS0 A;  2RN8 A;  1NLO C;  4D8D A;  4D8K A;  1KJW A;  3X24 B;  4DBQ A;  4NOY A;  1VQK A;  1WXB A;  1K9M U;  2DIG A;  3A8G B;  2YRD A;  2F2V A;  1M9S A;  3F70 A;  3OSS C;  4C8Q C;  2KXC A;  2H3E B;  4LDU A;  3SWN A;  4BE1 A;  1YCY A;  4IIO A;  1WNL A;  2RQT A;  3L2U A;  4KGX B;  1B34 A;  4R56 A;  2QAS A;  2AHJ B;  2M1H A;  3HRU A;  3OYC A;  3EFR A;  2GF7 A;  1K73 C;  3JRZ A;  5LL6 S;  1VQP A;  2LT1 A;  1VQ6 A;  1GBR A;  1HJD A;  2EQI A;  1I5L A;  1QMC A;  2RI2 A;  5FU7 B;  4OMQ A;  2COW A;  2JT4 A;  3VRY A;  4C5G A;  4QQD A;  4ESR A;  1YIJ T;  3CXC P;  3LW5 E;  1RAB B;  3NMZ C;  1Y57 A;  4J9E A;  3RIR A;  1RI0 A;  5GMK i;  4QQ6 A;  1RAC B;  3M4Y A;  3RR6 A;  1MV0 B;  1K8A R;  1B3Q A;  1TXQ A;  4AMC A; 
#chains in the Genus database with same CATH homology
 1SRM A;  3FJ5 A;  2VWF A;  3UAT A;  3EG2 A;  2V1R A;  1UFF A;  5IHN A;  2EYZ A;  4AFQ C;  2KYB A;  2DBK A;  4QT7 A;  1M3B A;  2KT8 A;  2O31 A;  1AVZ C;  1UG1 A;  3TVT A;  2DE0 X;  1AZG B;  2B86 A;  1ZSG A;  2D8H A;  3VS1 A;  3VS2 A;  1Z9Q A;  4GBQ A;  1JXM A;  1PNJ A;  1U3O A;  3M0Q A;  1SEM A;  1U06 A;  2FPD A;  4AG1 C;  1E7O A;  2GBQ A;  2M0Y A;  2YUP A;  1XOV A;  2FPF A;  2ESW A;  2RQW A;  2FO0 A;  2BTT A;  4Z8A A;  2DA9 A;  3NHN A;  1NYG A;  3IQL A;  2KBT A;  1WI7 A;  4J9D A;  1BK2 A;  2J6F A;  2ED0 A;  1ZUU A;  1CKA A;  2K9G A;  2SRC A;  1JEG A;  1OPL A;  1JU5 C;  2CUB A;  1I07 A;  1QKX A;  1OV3 A;  1Y0M A;  1X69 A;  5IHI A;  2J06 A;  4AFU C;  1WLP B;  2KYM A;  2CT3 A;  2ABL A;  1M8M A;  2HEQ A;  2ECZ A;  2EVR A;  4Z88 A;  2DL7 A;  3QWY A;  3VRZ A;  2X3X D;  2BZ8 A;  2ED1 A;  3RNJ A;  1ZBJ A;  4LNP A;  3O5Z A;  3H0H A;  1VYV A;  2A28 A;  2LQW A;  2KEA A;  3M0S A;  4F17 A;  2DLP A;  4K11 A;  2MCN A;  1YCS B;  4RUG A;  2DL5 A;  1UUE A;  2GQI A;  3ULR B;  1WFW A;  4LUD A;  3H0F A;  2JXB A;  1TUC A;  2GTJ A;  2YT6 A;  2M51 A;  1MUZ A;  3I35 A;  3RBB B;  2JM9 A;  1WYX A;  5EC7 A;  1T3S A;  2AZV A;  4LUE A;  4CC3 A;  2EW3 A;  3A98 A;  5GJW B;  1X2K A;  2KRN A;  3EHR A;  2KE9 A;  4RTX A;  4OML A;  2FEI A;  1G83 A;  2CH4 W;  3EG3 A;  2FG0 A;  2ROL A;  2DL4 A;  1UHC A;  4OMO A;  1GRI A;  3LH5 A;  1WDX A;  2BZY A;  3REB B;  5IXB A;  1X6G A;  1WA7 A;  1GCQ A;  1U5S A;  1RUW A;  1ABQ A;  1S1N A;  2K79 A;  2K7A A;  1YWP A;  2JS2 A;  3QWX X;  1AWX A;  3I5R A;  4J9C A;  1JO8 A;  1T3L A;  5FWB A;  1AWJ A;  1GBQ A;  1SHG A;  1UDL A;  4HVU A;  2CSQ A;  1AWO A;  2HCK A;  2KRO A;  2EKH A;  1W70 A;  2GGR A;  1ARK A;  2HBW A;  3NPF A;  2F2W A;  2LX7 A;  1TG0 A;  2YDL A;  2FRW A;  4CC4 B;  2A37 A;  2PNI A;  1ZUY A;  1WX6 A;  4FSS A;  1JXO A;  1KFZ A;  4OMM A;  2FRY A;  3ZL7 C;  2JM8 A;  2ROT A;  4J9G A;  2KNB B;  3VS3 A;  1VYT A;  1PKS A;  2KT1 A;  4OMP A;  1MV3 A;  4CC7 A;  5IHK A;  1WIE A;  2CT4 A;  2K6D A;  3M0U A;  2VVK A;  2CRE A;  3VS6 A;  3EG1 A;  4J9F A;  3NGP A;  1YN8 A;  3SHW A;  4CC2 A;  2EYX A;  2ENM A;  3KFV A;  1RI9 A;  3M0T A;  5FWC A;  1QLY A;  2KXD A;  5HCK A;  1VA7 A;  3GBQ A;  4HVV A;  1H92 A;  3I9Q A;  1UJ0 A;  3JV3 A;  1M27 C;  2DMO A;  2K3B A;  3U23 A;  1Z9Z A;  1K0X A;  2LZ6 B;  1AOJ A;  2EGA A;  2EYY A;  1B07 A;  1SRL A;  2A36 A;  2LNH B;  2YSQ A;  1BB9 A;  1GFD A;  3PVL A;  1K9A A;  4JZ3 A;  1I0C A;  1K0S A;  2DVJ A;  2J6O A;  2YUN A;  2DYB A;  1FMK A;  1PRM C;  1NEG A;  2O88 A;  3PE0 A;  1UEC A;  1YP5 A;  1NLP C;  1UGV A;  1SSH A;  2KR3 A;  2LJ1 A;  2W10 A;  4DEY A;  2BZX A;  2VKN A;  4ZNX A;  3UF4 A;  1TUD A;  2L2P A;  4J9I A;  4ORZ A;  4RTT A;  1AZE A;  2V1Q A;  1V1C A;  2GTO A;  1AWW A;  1QKW A;  1VYU A;  1UE9 A;  5I22 A;  2RNA A;  1X43 A;  2MIO A;  1T0J A;  3M0P A;  1G2B A;  1NEB A;  2H8H A;  2CDT A;  2F2X A;  3TSZ A;  2I0N A;  3CQT A;  1K1Z A;  4Y92 A;  4J9B A;  2O9V A;  3C0C A;  1BU1 A;  2PTK A;  3THK A;  1GFC A;  5I11 A;  1CKB A;  1UTI A;  4E6R A;  1PRL C;  1OOT A;  1QCF A;  1SHF A;  1X27 A;  1WXT A;  1BBZ A;  4WCI A;  2DL3 A;  2JW4 A;  2E5K A;  3EHQ A;  1OEB A;  3H41 A;  3VS4 A;  2KGT A;  2RMO A;  4AFS C;  2KRS A;  2XMF A;  2AKL A;  1SPK A;  2CH4 A;  2DX1 A;  1YNZ A;  2JMC A;  3EGU A;  1W6X A;  2J6K A;  4RTZ A;  2DF6 A;  2J05 A;  1EFN A;  1E6G A;  1X6B A;  2FPE A;  1AD5 A;  4HXJ A;  4HVW A;  1T0H A;  4Z89 A;  5IXF A;  2O9S A;  1IO6 A;  1OPK A;  2W0Z A;  1GL5 A;  3R6N A;  1AEY A;  2D0N A;  2A08 A;  2KRM A;  2EPD A;  1LCK A;  2C0O A;  4RTU A;  2IIM A;  2RQR A;  1H8K A;  2DIL A;  1RLP C;  2EGC A;  2G6F X;  1HD3 A;  2DJQ A;  1PHT A;  5L23 A;  2RQU A;  2C0I A;  2D8J A;  3EG0 A;  3PVQ A;  4R0K A;  2P4R A;  4GLM A;  1KIK A;  2AKK A;  2OAW A;  2QDL A;  2DRM A;  3H0I A;  1WXU A;  5GJV B;  4AG2 C;  1QWE A;  2DL8 A;  2AK5 A;  3UA7 A;  2EBP A;  2C0T A;  3I5S A;  1I1J A;  1PWT A;  4KRT A;  3REA B;  1UJY A;  4F14 A;  2RF0 A;  1ZUK A;  4RTV A;  4F16 A;  4OMN A;  2HDA A;  2JTE A;  5IH2 A;  2X3W D;  2CSI A;  2L0A A;  2EGE A;  4JJC A;  2AZS A;  4A63 B;  5ECA A;  1KSW A;  4JJD A;  4RTY A;  2RPN A;  1JQQ A;  1W1F A;  2L3Q A;  4RTW A;  1YWO A;  2JS0 A;  4M4Z A;  4EIK A;  1K76 A;  1GCQ C;  2NUZ A;  1H3H A;  3UA6 A;  4JJB A;  2DM1 A;  3VS0 A;  1A0N B;  1M3A A;  2CUD A;  1QWF A;  2RN8 A;  1PKT A;  4DEX A;  2DBM A;  1CSK A;  2LJ3 A;  2OI3 A;  1NLO C;  3TSW A;  4D8D A;  2JMA A;  4D8K A;  1KJW A;  1J3T A;  2EYW A;  2OJ2 A;  4HCK A;  3VS7 A;  1E6H A;  1N5Z A;  1WXB A;  1K4U S;  2O2O A;  2F2V A;  1X2Q A;  2KXC A;  4JZ4 A;  1NM7 A;  1RLQ C;  1FYN A;  2NWM A;  4IIO A;  2DRK A;  2RQT A;  1GCP A;  2J7I A;  2L3P A;  2LQN A;  1UHF A;  2PZ1 A;  2DNU A;  4J9H A;  1GBR A;  1HJD A;  4JPB W;  2LCS A;  2EQI A;  1M3C A;  2LMJ A;  2D1X A;  2HSP A;  4X1V A;  4OMQ A;  2YUQ A;  2JT4 A;  3VRY A;  1NYF A;  1HSQ A;  2LJ0 A;  2YUO A;  4LE9 A;  4ESR A;  2GNC A;  3NMZ C;  2L3S A;  1Y57 A;  2LP5 A;  2RQV A;  4IIM A;  1ZX6 A;  4J9E A;  2MOX A;  3SEM A;  2K2M A;  4AFZ C;  1ABO A;  3VS5 A;  2SEM A;  1M30 A;  3M0R A;  4LN2 A;  1NG2 A;  1MV0 B;  5FW9 A;  1ZLM A;  1B3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...