4J9HA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph 8
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9hA00
2LQNA 4Z88A 1J3TA 3EG0A 2YUNA 3EGUA 2AZSA 2EYZA 1B07A 1TG0A 4ESRA 1HSQA 2RQVA 3O5ZA 4RTTA 1SSHA 1WXUA 2V1QA 4OMQA 2K2MA 2CT3A 1XOVA 1G2BA 2DVJA 5IHNA 1UECA 2JTEA 1H8KA 1UG1A 3NGPA 2LCSA 1X69A 2KEAA 2JMCA 4LNPA 3TVTA 1AD5A 1SRLA 4HCKA 1E7OA 2ENMA 3THKA 2SEMA 2O9SA 3VS3A 5FWBA 4J9GA 2A36A 2D1XA 4HVWA 2O88A 1NG2A 2JT4A 2DYBA 3NHNA 4ORZA 1KFZA 1I07A 2LJ1A 2FG0A 3C0CA 4JZ4A 2KT1A 2C0TA 4Y92A 1WFWA 2I0NA 1A0NB 2FRYA 3QWXX 2ESWA 4EIKA 1M30A 1YNZA 1VYVA 4OMLA 1WXTA 2F2WA 3U23A 1QKXA 1I0CA 2RQWA 2W0ZA 1X6GA 4OMMA 2DL3A 1M8MA 2EW3A 3PE0A 1RLQC 5ECAA 2GTJA 4J9EA 3VS1A 4J9DA 1GCQA 1WIEA 1WX6A 2L3QA 2RF0A 1WDXA 2J6KA 1GCPA 3UA6A 4AFZC 4A63B 2KT8A 2DRKA 3M0RA 1OV3A 2CT4A 3VRYA 1JO8A 1SHGA 3EHQA 2W10A 1ABQA 3I9QA 4JJCA 1WYXA 3I5SA 1NM7A 3REAB 1E6GA 4CC4B 4AG1C 4CC2A 2HBWA 2DBKA 1CKAA 3FJ5A 1K1ZA 2KYBA 2VKNA 4HVVA 4IIMA 2O2OA 2ECZA 4RTZA 4FSSA 3TSWA 3M0TA 1BK2A 2DILA 4JJDA 1GBQA 1AWWA 1GFCA 2A37A 3ZL7C 3REBB 2H8HA 2AKKA 3PVQA 2JMAA 1AZGB 1S1NA 1GFDA 3UF4A 1UJYA 1UHFA 1MV0B 1QCFA 1KJWA 2KRSA 2FPEA 2DRMA 1M27C 2JM8A 1ARKA 2C0OA 2P4RA 1AWXA 1PKSA 4E6RA 2KRMA 3UATA 2EGCA 1X43A 2G6FX 4QT7A 1CKBA 2KE9A 2KXDA 5IH2A 2EYWA 1BBZA 3VS0A 1UJ0A 2EGEA 2GTOA 4GBQA 3LH5A 2EPDA 1OOTA 3NPFA 2BZ8A 1AOJA 2K3BA 2DMOA 4JPBW 1U5SA 2J06A 3R6NA 2KGTA 2PNIA 1HD3A 2LJ3A 4AFUC 1ZSGA 1OPKA 2D0NA 2JM9A 1TUCA 1V1CA 4HXJA 2L2PA 1SRMA 5FW9A 1N5ZA 2MOXA 4LUEA 1JXMA 2YSQA 4RUGA 2DL4A 3H41A 1GL5A 2A28A 1Z9ZA 2M51A 3EG1A 2EYXA 2ROTA 1X2QA 2AKLA 3H0FA 4GLMA 4RTXA 2MIOA 2J6OA 3SEMA 2DA9A 1UDLA 3VS7A 1AEYA 2EKHA 4F17A 2D8HA 1PHTA 2B86A 2LNHB 2ED1A 1GBRA 4HVUA 1QWEA 4D8KA 2CH4A 4WCIA 4AG2C 2LQWA 1BU1A 1AWOA 4J9BA 3SHWA 1NLPC 2NUZA 3M0QA 1Y0MA 2DE0X 2DJQA 1K0XA 2O31A 1QWFA 2JXBA 2YUQA 1ZUUA 1G83A 1WXBA 2KROA 2JS0A 1ZLMA 2PTKA 2FRWA 1NLOC 2EBPA 2X3WD 1K0SA 2GBQA 4Z8AA 2AK5A 1PNJA 2L3SA 1FMKA 4K11A 2CUBA 5HCKA 3RBBB 2E5KA 3H0IA 2EYYA 3VS5A 1RI9A 1NYFA 1VYTA 2ABLA 1T3LA 2RQRA 2FPDA 3I5RA 2XMFA 2SRCA 5IXFA 5GJWB 2VVKA 4RTUA 2JS2A 1UGVA 1K9AA 1Y57A 2DF6A 2NWMA 2RMOA 1W1FA 2L0AA 4JJBA 1M3AA 1IO6A 2KR3A 4D8DA 1W6XA 2RQUA 1PRMC 4M4ZA 1UE9A 5GJVB 1JEGA 2K9GA 4R0KA 3TSZA 2RPNA 1K4US 1ZBJA 4J9HA 1GRIA 2DX1A 1NEGA 2M0YA 2HSPA 2ROLA 1YCSB 1YWOA 4JZ3A 3VRZA 1M3BA 4LUDA 2FPFA 1PWTA 1ABOA 3EG3A 1FYNA 2EQIA 2CSIA 2RNAA 3GBQA 1QLYA 3VS6A 2GNCA 2FEIA 2GGRA 3M0PA 2EVRA 3IQLA 2J6FA 2HDAA 1B3QA 1ZX6A 1M3CA 5EC7A 3EG2A 2J05A 4LE9A 2DL7A 1SEMA 1WI7A 1JXOA 2DL8A 4AFSC 3PVLA 3QWYA 2CUDA 4F16A 2ED0A 2K79A 4IIOA 2LMJA 3H0HA 2GQIA 1JU5C 2JW4A 4DEYA 2HCKA 5I22A 4OMOA 2OI3A 1VA7A 1SPKA 2X3XD 4X1VA 1VYUA 2HEQA 1JQQA 5IHIA 1PKTA 1CSKA 1PRLC 1MV3A 3JV3A 1UHCA 2PZ1A 2F2XA 1NEBA 1UTIA 1WLPB 2DM1A 2J7IA 1YP5A 3UA7A 2QDLA 2YT6A 4Z89A 1NYGA 1HJDA 1YN8A 4J9FA 1ZUYA 1H92A 5IHKA 2BZYA 2D8JA 2LZ6B 3M0UA 4ZNXA 2K6DA 2F2VA 2K7AA 1ZUKA 1KIKA 2DNUA 2O9VA 2KYMA 2A08A 1BB9A 2VWFA 4RTVA 4OMPA 1YWPA 3ULRB 1Z9QA 5FWCA 2YDLA 1MUZA 1KSWA 2L3PA 4RTYA 1K76A 1H3HA 4RTWA 1TUDA 2BTTA 1X6BA 4LN2A 4J9IA 1LCKA 3VS4A 2CH4W 1OPLA 1E6HA 1T0HA 2MCNA 2KBTA 4AFQC 1T0JA 2KNBB 5IXBA 2KXCA 1AZEA 1SHFA 1I1JA 2KRNA 1UUEA 2BZXA 2CREA 1W70A 1X27A 2DL5A 2V1RA 2C0IA 3M0SA 1EFNA 2OJ2A 3RNJA 3KFVA 2CDTA 1WA7A 2LX7A 1GCQC 4CC3A 2IIMA 1T3SA 1U3OA 2YUOA 4OMNA 2RN8A 1AVZC 3A98A 1RUWA 4DEXA 2AZVA 2RQTA 1QKWA 2CSQA 3NMZC 1OEBA 3VS2A 3I35A 2EGAA 2FO0A 1RLPC 4F14A 2LJ0A 2DLPA 2OAWA 4KRTA 5I11A 2YUPA 1UFFA 4CC7A 5L23A 1AWJA 2LP5A 1X2KA 1U06A 3EHRA 3CQTA 2DBMA 4J9CA
chains in the Genus database with same CATH superfamily
1TOVA 1UGQB 3CXCA 4JLGA 2YUNA 4N4IA 3EGUA 5KYWB 4DBRA 2EYZA 1TG0A 2VV5A 2XHCA 4NL2A 1EX4A 5GAN8 2DXCA 5GAMh 1WXUA 4QKUA 1JB0E 4N0AA 4F04B 3M9QA 2M16A 5IHNA 2CS7A 1IB8A 5GAOm 1D1BA 4MMLA 4KULA 1UG1A 3GIBA 1QVGS 1X69A 1QVGA 1VIEA 2DTHA 2Z0WA 3JRZA 5CIUA 3SDZA 3CPFA 4HCKA 3I56A 4OF1A 3LX7A 2M02A 8AT1B 1JBMA 2PVOB 3NFCA 1VQKT 2FB7A 3N5BB 3L2WA 3JCMV 2QEXQ 1WPYA 5CO7A 2PUOB 4A53A 4ZGJB 2OTLA 1VQPT 4EDUA 3VJPA 4OMLA 2F2WA 1YI2A 4M7AF 2RI3A 1QKXA 1ZSZC 4B9WA 4PJOC 1OX8A 1BIAA 1I0CA 4J6WA 4OMMA 3CCRT 2DL3A 1M8MA 3HHTB 1YITA 1V29B 3DLMA 1MNEA 2GTJA 5GAN2 1VQ7T 2CP2A 3OQ5A 1W2BA 1WX6A 5IN1A 1GCPA 4OP0A 2CGHA 4C5EA 2QTXA 3JSCA 3MPUB 4CRIA 2O4XA 5GANg 3E19A 2LTOA 4M7AD 1YJWQ 5KYNA 3EG9A 3CCLA 3HL8A 1WYXA 3I5SA 1XNIA 1YIJA 2L5QA 2VGNA 2COZA 2DBKA 3FJ5A 1K1ZA 2VKNA 1WJRA 3TQ7P 2O2OA 4RTZA 4FSSA 2AIRB 2XDDA 4PJJA 2DILA 5CKDA 4EPCA 1VQOT 4KGZB 2KSSA 3CD6A 4BE1A 1AZGB 3UF4A 2JJ9A 2K3XA 1UHFA 1QCFA 5GAOl 2QQRA 1YHQA 2P84A 4JS5A 2C0OA 2JNGA 3GOXA 4QVDA 3CD6Q 4E6RA 2KRMA 2MYSA 4PNOA 3UATA 2EGCA 1M90U 1X43A 2G6FX 3M54A 1M2VB 2KE9A 2VXFA 3MCAB 2DIQA 2PU9B 5A0LA 5FROA 1BBZA 5KYXB 2RI2A 4HA8A 5LJ3d 3CC2Q 1VIFA 4ME7A 3RUXA 3CC7A 3H9NA 1ZSZB 1G5VA 4J6XA 4MZPA 3NPFA 2BZ8A 2K3BA 1KD1U 3LH0A 1WHHA 4N4HA 4M7AA 1AHJB 3GLXA 1U5SA 2EQKA 2PNIA 1HD3A 4RG8A 1ZSGA 5KH6A 2D0NA 4ZN3A 3UWNA 4HXJA 4QQDA 5FW9A 2RJCA 4PJOA 1TXQA 4C0GA 1Z9ZA 2M51A 3TU4K 1X2QA 2EJ9A 2RD1A 2YLBA 3VS7A 3GNGA 4M75F 1N9RA 4EMKA 3M56A 2D8HA 1YJNT 2LNHB 1GBRA 3URGA 1QWEA 5AT1B 5LJ5d 4WCIA 4AG2C 2DTIA 2KY9A 4XU2A 4O5VA 3SHWA 1NLPC 3LGFA 1RAHB 4AMCA 1VQMT 2YUQA 4XTYA 2PQWA 1ZLMA 3VUBA 2FRWA 1NLOC 4M77D 3OB9A 5GAMg 2E5QA 4XAXB 5GANe 4K11A 2E6NA 3CCUA 2CUBA 4HCZA 2XU8A 3QJ6A 3VS5A 4DBQA 3OYKA 3CCRA 5KYYB 4C92G 3VKIA 2NUPA 3RKXA 2QGFB 3MEWA 2SRCA 3OS0A 3EGXA 5GJWB 1VQNA 6AT1B 2L8DA 1C1AA 2OTJQ 1UGVA 1W2BS 3BDLA 2RMOA 4C5IA 4J7IA 4BI3A 4RMOA 1EIFA 4M75A 2AT1B 1OYXA 2FZCB 2KR3A 2X35A 4ANJA 4KGXB 2QA4A 4OB0B 5GJVB 4IUQA 3CC4T 2CZ1B 2DX1A 2M0YA 1OZ2A 2ROLA 4M7AC 3G6EQ 2CP3A 4JZ3A 4JUVA 4LUDA 2FPFA 4J6YA 1PWTA 2EQIA 5GAOp 3QYHB 3L2QA 1X6OA 2KVQG 5J39A 3OYDA 2CZ7B 1IZ6A 4L5GA 4M7AB 2OAUA 3M0PA 1K73C 1M1KU 2J6FA 1ZX6A 2NYSA 4BUGA 3MHXA 2DL7A 2YHTA 2DL8A 2WACA 3LYIA 3EH1A 3PVLA 3KBGA 3QWYA 1NBEB 2BKDN 3CMET 2JW4A 2LNVA 4C92B 1YCYA 4DEYA 5LJ3j 2WSCE 1VA7A 2ZPGB 2X3XD 4P5NA 1VYUA 2HEQA 3SB2A 1CSKA 1M2VA 1MV3A 1YI2T 1WJSA 3OS5A 1NEBA 1WLPB 2J7IA 1AT1B 4FL6A 4KUIA 2QDLA 4Z89A 1YN8A 2YRDA 1Q7YC 4C8QE 4ZNXA 1FMWA 1GXIE 1QVFA 2HNIA 2DNUA 1RADB 5GAMd 1Y7XA 2EYQA 5FRNA 3PIPA 3CEYA 3A1PA 5D6XA 2A7YA 3L1AA 1QVFP 4OMPA 3INZA 3PMTA 2A3LA 1Q81C 1YIJT 3HFOA 4J83A 4M7AG 3FJPA 2RJDA 1M1FA 5CK9A 1WGSA 1X6BA 4J9IA 3VS4A 4C0ZA 2CH4W 2AHJB 1OPLA 4FYVB 2LDMA 4XTUA 2MCNA 4AFQC 2LRQA 2KNBB 5IXBA 4BE2A 3CPWA 5GAN3 1BCMA 1I1JA 4M7AE 2KRNA 2LVMA 1PSFA 1YJWT 3X25B 4C0DB 3F70A 2C0IA 1NPPA 1TSFA 3CXCS 3KFVA 1GCQC 1I8FA 1D0YA 1WJQA 1M5Q1 2OTLQ 2YUOA 1VQOQ 3O8VA 3G1JA 1Q95G 4DEXA 1MGQA 2RQTA 1VQ4A 1OEBA 1S72Q 2CZ6B 3VS2A 5GMKe 1VQLA 2FO0A 3AT1B 2PUKB 4FW1A 2E6ZA 3JCMW 4BACA 5KCHA 3BE3A 5I21A 3EGDB 3L42A 2XD0A 4A54A 2CP6A 2HL5C 4J9CA 2DYIA 4B9XA 4Z88A 3OYEA 4CI0C 1HSQA 3O5ZA 3CMAA 3FDRA 1LVKA 3D7SB 4LDXA 1SSHA 2V8JA 1Y96A 4OMQA 2K2MA 1VQ6Q 1VQOA 2RB6A 3KUFA 2JTEA 1VQ5Q 4WTOB 3C94A 1H8KA 3NGPA 1YJNA 2KEAA 4OB3B 4C0FA 3EAEA 4ZTJA 3EH2A 2ENMA 1WHKA 2SEMA 4E7JA 5FWBA 1Q82U 4J9GA 4PJMA 2A36A 2D1XA 5GAN4 3BFMA 3X26B 2CZ0B 2V8KA 3NHNA 4ORZA 1KFZA 1X75C 2FG0A 4JZ4A 4Y92A 1FWZA 4OB1B 5CQXA 3G4ST 3I55A 3EGDA 4DOVA 2ESWA 4FT2A 4OMFB 4EIKA 3J81E 2E12A 3MEVA 3T9NA 1YJWA 2QDYB 5GAMf 3SD4A 3HRTA 5GMKl 3CC2A 2XK0A 3U23A 3QDRB 2P0KA 2W0ZA 1X6GA 2C06A 3CCSA 1Y96B 4JRKA 4RCBA 3VS1A 3X24B 1UEBA 2K5IA 3PFSA 1B7TA 2CP0A 1H641 3UA6A 4AFZC 2JUFA 3NTKA 1VQ4T 1IGUA 1ZBXA 2ZPHB 1OV3A 3QZ9B 3MP6A 1K8AU 1SHGA 3MEUA 1BI1A 4PJOE 1QP3A 3I9QA 1WHGA 4X34A 2K5FA 3M5AA 1BCOA 5LJ3f 5A0DA 2DZ9A 4Y28E 3OW2S 4PL6A 3CBMA 4CC4B 5DM7R 4HVVA 3CCET 2A0FB 4IIMA 1BK2A 2KAFA 1M90R 4JJDA 1AWWA 1GFCA 5GANj 4QVZA 3REBB 1KQSA 3SFMA 4LDWA 1MMNA 3DB4A 3HFNA 1S1NA 2LC4A 1XQHA 2FVUA 4N0AC 1QQJA 1UJYA 3MP1A 2DPPB 2FPEA 1K8AR 2JM8A 1N8RC 1IHVA 3JB9J 3CCQA 3HSBA 1Y71A 1N9SA 1PD1A 3JCMX 4PFPA 2LX9A 1RAGB 3HPWA 1OULA 1VQKA 3VS0A 8ATCB 2EGEA 3LH5A 2HAXA 2JTFA 4JDSA 3CCMT 3V8KA 1OOTA 2RO0A 4HCBA 1AOJA 1KD1R 1G3SA 5C0MA 4E7LA 1OZ3A 4O6JA 1YITT 2CP7A 1V1CA 5LJ5e 2L2PA 5IT9E 3OYFA 1N5ZA 2HZYA 3SWNB 4RUGA 2DL4A 1MNDA 1B34A 3EG1A 4L59A 3H0FA 4RTXA 1R0BG 2NUTA 3CBOA 1QMCA 1O75A 5L8RE 2FZKB 2VB6A 4Z02A 2QXFA 4A4EA 4PJOG 4BI8B 4HVUA 3P8DA 2DEQA 5CKHA 3GPLA 4PJNA 2LQWA 4J9BA 2DZCA 2RJEA 1V76A 4BY6C 1K0XA 2R5MA 1FXXA 1QWFA 2E10A 1N8RR 5LJ5f 3OMCA 2H3JA 2PTKA 3A5ZB 2EBPA 2X3WD 3EFRA 2KQWA 1K0SA 2M9UA 2GBQA 4R55A 2DAQA 2X4JA 4LDYA 1UGPB 1UGSB 5HCKA 2E5KA 3RERA 2QA4Q 2EYYA 3CXCP 1RI9A 4EMGA 2GQVA 2GFUA 3OYHA 1TS9A 3I5RA 2DVEA 4KGVB 2XMFA 1I5OB 4X9DA 3VYGA 2QEXT 2JS2A 1K9AA 4HCCA 4JJBA 2E4HA 1TU0B 1IO6A 1G8XA 3RMSA 1W6XA 1LNXA 4YTLA 3CCRQ 1WNLA 1K9MC 3QYGB 1PRMC 3OYJA 4M4ZA 3ZBDA 1M90C 2WSFE 4A4HA 1UE9A 1JEGA 4ZGEB 4R0KA 4FCYA 2IPOB 4J9HA 2QQAA 2DJZA 2RHZA 1NPRA 5GAMj 3OMGA 4PJOB 1M3BA 4QVCA 1ABOA 3EG3A 2LT4A 1PM3A 1WHMA 1BI3A 1PCXA 2RNAA 1K9MR 3GBQA 1QLYA 5KE2A 1KQSS 1UGRB 2FEIA 1VQ9Q 3A8OB 3ER0A 4LDVA 2LQ8A 1M1KR 1HXDA 3E9FA 3JCMh 4XQ3A 4EMKC 3G7ZA 3EG2A 3I56T 4OGEA 1SEMA 4PJOF 1WI7A 1JXOA 1C0MA 5LL6S 3LW5E 4TVRA 4F16A 1XJWB 5GMKj 2ED0A 2FL7A 5GMKi 2LMJA 2YRCA 3H0HA 3CCVA 1BI0A 1IGQA 3CCQQ 4BDYA 3CCSQ 1D3BA 4KBMB 3V7SA 2QQSA 1SPKA 5FU7C 5GAOn 3JCMJ 3TCJA 1JQQA 5IHIA 3JB9D 1MMAA 1PRLC 1PSEA 3JV3A 1UHCA 1F1BB 1VQ8Q 4C8QA 3CC7Q 4LDUA 1D0XA 1NYGA 4D6WA 3PNWC 5IHKA 2E70A 2BZYA 2D8JA 3HRSA 3E2UA 2PVGB 3CCVQ 2F2VA 5GANh 4A4KA 1ZUKA 2EKOA 2O9VA 2K5LA 4ELYC 4RKUE 4M75C 2DXBA 2VWFA 1RL2A 3ULRB 5CR2A 3CCJA 1Z9QA 5KYWA 2YDLA 4RTYA 2L3PA 4XU1A 1BI2A 2BTTA 3BDUA 4LN2A 1LCKA 4C8QF 3TREA 1OU9A 1YJ9Q 2FYKA 3M4YA 1RAIB 4M77A 1T0JA 2KXCA 5EG2A 1ACMB 2HQXA 4JJNK 1W70A 4M7DE 1WQ7A 3ME9A 1YHQT 3M0SA 3FB9A 3X28B 2HSEB 3I55Q 2RK2A 1QVPA 1EFNA 3RNJA 2CDTA 1G3YA 3RKYA 3QPHA 4PJOD 1D1AA 2IIMA 1U3OA 1AVZC 1VQPQ 2JN0A 1R77A 2IG0A 1QKWA 2R57A 3NMZC 3I35A 2EGAA 5J26A 2GF7A 4MDXA 4J5YA 2XICA 2LJ0A 2G3RA 2OAWA 4XU3A 4ZN1A 3JCMb 4LD9K 1RAFB 1AWJA 3OBWA 2LP5A 4M75E 1X2KA 5GAN6 4JS4A 1U06A 3EHRA 3OYAA 4NS5A 2EWNA 2E1HA 1TTHB 1WZOA 2OTJT 1D0ZA 2ZAEA 3CCJQ 2AZSA 1B07A 1S72T 2DEUA 2LCLA 4RTTA 3NTIA 3VU3C 1G2BA 1SG5A 2O01E 3MP8A 3EG9B 2DVJA 4M7DD 1UECA 3MKDA 3WXMB 4DBFA 2QG9B 2LCSA 2X51A 2JMCA 4LNPA 2R5AA 1U1TA 3AHUA 1NJIC 2XKOC 3JCMe 2O9SA 3VS3A 1WHJA 3KXTA 4MDWA 3LGLA 3MO8A 2COWA 1VQ6T 2O88A 4HVWA 1NG2A 3V7RA 2ATCB 3X20B 2JT4A 1H3ZA 3C0CA 5KE3A 4RG2A 2DTOA 1WFWA 2I0NA 2VC8A 1A0NB 2FRYA 3GNFB 3QWXX 3EFOB 1PC0A 2FHDA 2ZGWA 3DB3A 1WXTA 4UC4A 4JRPA 5LJ5j 1RAAB 4FM4B 2YLCA 2EQJA 1D3BB 5CCAA 4M77G 3M58A 1JJ2A 5ECAA 4KH1B 1UB4A 1VQNT 1GCQA 1WIEA 3JCMf 2L3QA 2RF0A 2J6KA 1Q82R 3CMAQ 2DRKA 3M0RA 3SWNC 4FSXA 1VQLT 3VRYA 2K57A 5J3BA 4C92C 4E47A 4M7DA 2W10A 2QA4T 4JJCA 4FIBA 3REAB 2HL3A 1E6GA 2MAMA 4CC2A 4C92F 2MI6A 1CKAA 2VYTA 5CKEA 2ECZA 1S72A 1VQ4Q 3TSWA 3M0TA 3FEOA 4FYYB 1GBQA 4EMKB 4C5GA 1RACB 2H8HA 2YRVA 3PVQA 1QW1A 3C12A 1I81A 1MHNA 1N27A 3BY7A 4PFZA 4BD3A 7AT1B 1AWXA 1PKSA 2HKQB 3OYGA 3OYLA 4DBHA 1Y07A 5C6SA 3PGGA 4QT7A 1VQ6A 2QEXA 2KXDA 2XDPA 1RI0A 3WVDB 4F7UF 5IH2A 4XK8E 2R58A 4M77B 2GTOA 2YXYA 4MMKA 2EPDA 1VQPA 1Q82C 2EFIA 5GANf 2DMOA 1KC8C 4JPBW 1I5LA 5HK0A 3R6NA 4C0DC 4C92D 3HKSA 4GLKA 3OS1A 4IUTA 4F7UA 2MOXA 3R6OA 4LUEA 2YSQA 3OW2P 4DQ2A 4PJLA 2RK1A 2EYXA 2EQMA 5IAYA 3SEMA 2JZ2A 3H8ZA 1SKUB 2EKHA 3FLGA 1PHTA 2B86A 3SWNA 4JLIA 3G71Q 2DXUA 4M7DG 3CCLT 2E65A 1C6VX 2CH4A 4GY5A 3JB9I 4M7DC 2NUZA 1RABB 1Y0MA 2DE0X 1VQ5A 2O31A 3OS2A 1K8AC 1O9SA 2JXBA 5CVIA 1ZUUA 3CCVT 3CD6T 1K9MU 1EZZB 2HBPA 1PNJA 4PFOA 4WF2A 2H3EB 3M59A 3H0IA 3LLRA 3M57A 5FLXE 3OYIA 2JOYA 1T3LA 2RQRA 3MEAA 4PK4A 5IXFA 3G4SQ 4E7HA 2VVKA 2E3IA 4RTUA 4E7ZA 2BIVA 1KC8R 2DF6A 2NWMA 1YI2Q 1W1FA 2L0AA 1N8RU 4PKCC 1M3AA 4NOYA 4B6MA 4IKFA 2QI2A 4D8DA 4X9CA 2RQUA 2EAYA 1YHQQ 1N6AA 1M8VA 3TSZA 2M0OA 1IREB 4IUPA 1GRIA 2HSPA 1YCSB 4FYXB 4M7DB 1FYNA 5M9OA 1R8OB 2RI5A 4KUDK 2CSIA 1YIJQ 1M9SA 2GNCA 4M77F 2QTVA 2VXEA 1YBYA 1G3WA 3IQLA 4JRIA 1VQMQ 1B3QA 4R56A 3CCUQ 1M3CA 5LJ5h 4QQGA 4LE9A 5FU7B 4HKEA 1YJ9A 3E1SA 2CUDA 2K79A 4IIOA 1HYOA 1JU5C 5DY9A 2YWWA 2KMTA 3HRUA 2BE9B 2HCKA 2D6FA 5I22A 2P0QA 2QQ9A 2DK3A 3RESA 4AT1B 4X1VA 4QQ6A 3S3OA 1D09B 1TH7A 1IRXA 1NZ9A 3WVEB 2OTLT 1QCNA 4XU0A 5I2MA 2DFUA 2JVVA 2F2XA 1OI1A 2Y90A 4ZTFA 3A8GB 4NL3A 1G3TA 3UA7A 1BYMA 1B34B 2YT6A 3OA6A 5CKFA 1IHWA 4J9FA 2WSEE 3GP8A 1M4ZA 1PD0A 3J80E 1ZUYA 2B8AA 4XTXA 3CCMQ 3M0UA 4IURA 4M78D 2K6DA 3A8LB 2ZPFB 4LD6A 1VQ8A 1LPLA 2KYMA 2K3YA 2A08A 4RTVA 3OYBA 3FRNA 3OYMA 2RA2A 2MPXC 3PMIA 4JRQA 1MUZA 1KSWA 4C8QD 4KH0B 1K76A 4II1A 4HT8A 1X01A 1H3HA 4RTWA 5D6WA 1TUDA 1KQ2A 2V26A 1VQ5T 4LXCA 3PT9A 3RMQA 1OU8A 1VQMA 1QVFS 5D6YA 2I2LA 1VQLQ 1KG1A 2LT1A 1SHFA 4M7DF 2CKKA 1Q86C 2VASA 2BZXA 4PLIA 3EFSA 4M78F 2LCCA 3CC2T 4M78G 4IUUA 2ZZDA 4BI4A 2OJ2A 3V8LA 3UT1A 2LX7A 3RDVA 1KK7A 2QQBA 1YJ9T 3V8JA 4OMNA 2VUBA 2CP5A 2RN8A 4QW2A 1K73R 2MWOA 5HKCA 3FC3A 2DIGA 4RCCA 3QKJA 4F14A 2DLPA 5LJ3e 1NJIU 5I11A 1BKBA 2YUPA 1UFFA 3QSUA 2O4XB 3HTRA 1JJ2P 3QZ5B 3CQTA 2DBMA 1KQ1A 2LQNA 5FU6B 2QASA 1J3TA 2Y4YA 3EG0A 2JTMA 2X4WA 3CCEA 4ESRA 3JCMc 2RQVA 2RM4A 4C8QC 5A2QE 2V1QA 2KK4A 2DKGA 2F5KA 2CT3A 1XOVA 2RHXA 3BW1A 3VYHB 4M75D 4E7KA 3TVTA 2F5TX 3ZEHA 1AD5A 1SRLA 1W2BP 3JAME 1E7OA 1TWBA 3OW2A 5GAN5 3THKA 4DA4A 1VQ9A 1SSFA 2MWPA 4M78B 2DYBA 3CMEA 3QO3A 2LJ1A 3GF5A 2C0TA 2KT1A 5KYUA 2D0QB 2DERA 5GMKh 1HK9A 1M30A 1YNZA 3I56Q 4M77C 3G71T 1VYVA 3CCLQ 3S3MA 2E3HA 4IUVA 4M78E 3QXEB 3QHSA 4A4FA 2RQWA 3PE0A 2EW3A 1RLQC 4DOWA 4J9EA 4Q5WA 4J9DA 4ELZC 2CYZB 3ZFJA 3CC4Q 1WDXA 3J7AF 3JCMQ 4A63B 5CAIA 2KT8A 2RHIA 3G6ET 2CT4A 1YITQ 1JO8A 1ZA2B 3OYCA 3EHQA 2BUDA 4F7UE 2RH2A 1ABQA 2DO3A 4EMHA 1NM7A 2OTJA 2QAZA 1VQNQ 4AG1C 1FMVA 2HBWA 2KYBA 3CMAT 2VGMA 4OVAA 1QCOA 3OYYA 3OY9A 2GCXA 2A37A 3ZL7C 2AKKA 2JMAA 4FU6A 1GFDA 4J7FA 2FZGB 1MV0B 1W4SA 1KJWA 2KRSA 2ZCFB 2DRMA 1M27C 1ARKA 2P4RA 2E64A 2QGGA 5AYFA 1OQKA 3DKMA 5KYYA 2ZPIB 4C92E 3PIOA 2PVDB 1CKBA 4MZTA 1LJOA 3C4SA 3CPWS 4BB7A 2COYA 2EYWA 5CQYA 2P0PA 2KDSA 4M75B 1UJ0A 4GBQA 4E7SA 3I55T 3A8HB 3EFOA 3G71A 3CPWP 2DXTA 4C5HA 5GAOr 3JB9F 1YJNQ 1RAEB 2J06A 4KT0E 2KGTA 3UDCA 2LJ3A 2DD4A 4M77E 4AFUC 3CC4A 1OPKA 1R0CB 1QVGP 2JM9A 1TUCA 2HKNA 3M53A 1SRMA 2HMAA 2XI9A 1VQ7A 1D1CA 1JXMA 3QIIA 3H41A 1GL5A 2A28A 2ROTA 1VQKQ 2AKLA 4BDZA 4GLMA 2HD0A 2MIOA 2J6OA 4M78A 2DA9A 1UDLA 1XTDA 1AEYA 4FT4A 3CCEQ 4F17A 2ED1A 2NUTB 3CCJT 4D8KA 1Q7YR 3PTAA 4C92A 5HK3A 1KD1C 2EIFA 4FW2A 1BU1A 1AWOA 2LQKA 5FRMA 3M0QA 1VQ9T 2DJQA 4F7UG 1U8RA 1VQ7Q 2RHYA 4E7IA 1ZHIA 1G83A 1WXBA 2KROA 2JS0A 2L89A 3CBPA 3OSSC 4Z8AA 4OGCA 2AK5A 1Q7YU 2L3SA 3EGXB 1FMKA 2MF2A 1FX7A 2XG8D 3RBBB 2DETA 3MJXA 4M75G 4XTWA 1NYFA 3CCQT 4V2SA 2OX7A 5KYUB 1VYTA 3CCST 4ATOA 2ABLA 2FPDA 1P92A 5GAN7 3E9GA 4C8QG 3QG1A 1Y57A 3OSVA 1JRIA 2F1LA 2ZPEB 5GANd 1VQ8T 3CC7T 2BE7D 3HP9A 1IXDA 2Y4XA 1ZA1B 2K9GA 2RPNA 1K4US 3Q1JA 1ZBJA 3QDFA 5CKBA 1Q86R 2KI7A 1NEGA 3M4GA 1YWOA 1U1SA 3S3NA 1WHLA 3VV0A 3VRZA 3M55A 3S6WA 3P8HA 1WQWA 5DLQE 2F69A 2K2VA 1PG5B 4OB2B 9ATCB 1TUGB 2MMPA 3VS6A 1KC8U 3P8BB 3L2RA 3CMEQ 2GGRA 3QJYA 5LJ3g 1ZQ1A 3META 4PLLA 4F7UB 2EVRA 1BIBA 4M78C 3JCMP 2HDAA 3UPUA 1NE8A 5EC7A 1M2OA 2J05A 2E41A 4AFSC 3V7CA 5DLOA 1JJ2S 3JCMg 5I2SA 3DLLA 5KCOA 2DD5A 2GFAA 2GQIA 3VUZA 1KHIA 1YFNA 5A0GA 3NTHA 5KYXA 3LWHA 3QUIA 4OMOA 1M1GA 2OI3A 5HY6A 3JB9H 2XIDA 5D7UA 4XTVA 4BY6B 1PKTA 3CCUT 1OX9A 4C8QB 2PZ1A 2QYZA 1UTIA 1QP2A 2DM1A 1K73U 1M1KC 3JCMd 1YP5A 2X9HA 3JB9G 4FYWB 2X4YA 1HJDA 2L3RA 3RR6A 1KQSP 1H92A 2LZ6B 3RKWA 3L2VA 1MMDA 1Q86U 2EJGA 3G6EA 2K7AA 3ASKA 1KIKA 2K4YA 1SF9A 2HQHA 2P4TA 5FU6C 1BB9A 3H6ZA 1YWPA 2X4XA 4J8OA 5FWCA 2IVWA 4XTZA 2V8IA 3QBYA 3RIRA 4L6V5 4Y91A 5GMKm 1I4K1 2ZPBB 5GAOq 4A4GA 2D9TA 3L2ZA 1MMGA 1E6HA 2RJFA 1Q81R 1T0HA 2KBTA 2QK0A 5GAMe 1VUBA 4E2FB 1LOJA 1AZEA 3G4SA 2M1HA 3TEEA 2EJFA 1UUEA 1ZSZA 2CREA 1DJ7B 4N4GA 4VUBA 1VOMA 1X27A 2DL5A 2V1RA 2NLUA 1KHCA 4MZMA 2XDBA 1WA7A 2EQUA 4BE0A 2MK5A 2NUPB 5LJ5g 4CC3A 4HT9A 1Q81U 3LWIA 3A8MB 3OYNA 2HQEA 1T3SA 3A98A 1RUWA 5LJ3h 2AZVA 2CSQA 3L2UA 3FIFA 1RLPC 3CCMA 4KRTA 3OBYA 1NJIR 2RHUA 3C95A 4CC7A 5L23A 1I07A 4ZGDB
chains in the Genus database with same CATH topology
2LQNA 4Z88A 1J3TA 3EG0A 2YUNA 3EGUA 2AZSA 2EYZA 1B07A 1TG0A 4ESRA 1HSQA 2RQVA 3O5ZA 4RTTA 1SSHA 1WXUA 2V1QA 4OMQA 2K2MA 2CT3A 1XOVA 1G2BA 2DVJA 5IHNA 1UECA 2JTEA 1H8KA 1UG1A 3NGPA 2LCSA 1X69A 2KEAA 2JMCA 4LNPA 3TVTA 1AD5A 1SRLA 4HCKA 1E7OA 2ENMA 3THKA 2SEMA 2O9SA 3VS3A 5FWBA 4J9GA 2A36A 2D1XA 4HVWA 2O88A 1NG2A 2JT4A 2DYBA 3NHNA 4ORZA 1KFZA 1I07A 2LJ1A 2FG0A 3C0CA 4JZ4A 2KT1A 2C0TA 4Y92A 1WFWA 2I0NA 1A0NB 2FRYA 3QWXX 2ESWA 4EIKA 1M30A 1YNZA 1VYVA 4OMLA 1WXTA 2F2WA 3U23A 1QKXA 1I0CA 2RQWA 2W0ZA 1X6GA 4OMMA 2DL3A 1M8MA 2EW3A 3PE0A 1RLQC 5ECAA 2GTJA 4J9EA 3VS1A 4J9DA 1GCQA 1WIEA 1WX6A 2L3QA 2RF0A 1WDXA 2J6KA 1GCPA 3UA6A 4AFZC 4A63B 2KT8A 2DRKA 3M0RA 1OV3A 2CT4A 3VRYA 1JO8A 1SHGA 3EHQA 2W10A 1ABQA 3I9QA 4JJCA 1WYXA 3I5SA 1NM7A 3REAB 1E6GA 4CC4B 4AG1C 4CC2A 2HBWA 2DBKA 1CKAA 3FJ5A 1K1ZA 2KYBA 2VKNA 4HVVA 4IIMA 2O2OA 2ECZA 4RTZA 4FSSA 3TSWA 3M0TA 1BK2A 2DILA 4JJDA 1GBQA 1AWWA 1GFCA 2A37A 3ZL7C 3REBB 2H8HA 2AKKA 3PVQA 2JMAA 1AZGB 1S1NA 1GFDA 3UF4A 1UJYA 1UHFA 1MV0B 1QCFA 1KJWA 2KRSA 2FPEA 2DRMA 1M27C 2JM8A 1ARKA 2C0OA 2P4RA 1AWXA 1PKSA 4E6RA 2KRMA 3UATA 2EGCA 1X43A 2G6FX 4QT7A 1CKBA 2KE9A 2KXDA 5IH2A 2EYWA 1BBZA 3VS0A 1UJ0A 2EGEA 2GTOA 4GBQA 3LH5A 2EPDA 1OOTA 3NPFA 2BZ8A 1AOJA 2K3BA 2DMOA 4JPBW 1U5SA 2J06A 3R6NA 2KGTA 2PNIA 1HD3A 2LJ3A 4AFUC 1ZSGA 1OPKA 2D0NA 2JM9A 1TUCA 1V1CA 4HXJA 2L2PA 1SRMA 5FW9A 1N5ZA 2MOXA 4LUEA 1JXMA 2YSQA 4RUGA 2DL4A 3H41A 1GL5A 2A28A 1Z9ZA 2M51A 3EG1A 2EYXA 2ROTA 1X2QA 2AKLA 3H0FA 4GLMA 4RTXA 2MIOA 2J6OA 3SEMA 2DA9A 1UDLA 3VS7A 1AEYA 2EKHA 4F17A 2D8HA 1PHTA 2B86A 2LNHB 2ED1A 1GBRA 4HVUA 1QWEA 4D8KA 2CH4A 4WCIA 4AG2C 2LQWA 1BU1A 1AWOA 4J9BA 3SHWA 1NLPC 2NUZA 3M0QA 1Y0MA 2DE0X 2DJQA 1K0XA 2O31A 1QWFA 2JXBA 2YUQA 1ZUUA 1G83A 1WXBA 2KROA 2JS0A 1ZLMA 2PTKA 2FRWA 1NLOC 2EBPA 2X3WD 1K0SA 2GBQA 4Z8AA 2AK5A 1PNJA 2L3SA 1FMKA 4K11A 2CUBA 5HCKA 3RBBB 2E5KA 3H0IA 2EYYA 3VS5A 1RI9A 1NYFA 1VYTA 2ABLA 1T3LA 2RQRA 2FPDA 3I5RA 2XMFA 2SRCA 5IXFA 5GJWB 2VVKA 4RTUA 2JS2A 1UGVA 1K9AA 1Y57A 2DF6A 2NWMA 2RMOA 1W1FA 2L0AA 4JJBA 1M3AA 1IO6A 2KR3A 4D8DA 1W6XA 2RQUA 1PRMC 4M4ZA 1UE9A 5GJVB 1JEGA 2K9GA 4R0KA 3TSZA 2RPNA 1K4US 1ZBJA 4J9HA 1GRIA 2DX1A 1NEGA 2M0YA 2HSPA 2ROLA 1YCSB 1YWOA 4JZ3A 3VRZA 1M3BA 4LUDA 2FPFA 1PWTA 1ABOA 3EG3A 1FYNA 2EQIA 2CSIA 2RNAA 3GBQA 1QLYA 3VS6A 2GNCA 2FEIA 2GGRA 3M0PA 2EVRA 3IQLA 2J6FA 2HDAA 1B3QA 1ZX6A 1M3CA 5EC7A 3EG2A 2J05A 4LE9A 2DL7A 1SEMA 1WI7A 1JXOA 2DL8A 4AFSC 3PVLA 3QWYA 2CUDA 4F16A 2ED0A 2K79A 4IIOA 2LMJA 3H0HA 2GQIA 1JU5C 2JW4A 4DEYA 2HCKA 5I22A 4OMOA 2OI3A 1VA7A 1SPKA 2X3XD 4X1VA 1VYUA 2HEQA 1JQQA 5IHIA 1PKTA 1CSKA 1PRLC 1MV3A 3JV3A 1UHCA 2PZ1A 2F2XA 1NEBA 1UTIA 1WLPB 2DM1A 2J7IA 1YP5A 3UA7A 2QDLA 2YT6A 4Z89A 1NYGA 1HJDA 1YN8A 4J9FA 1ZUYA 1H92A 5IHKA 2BZYA 2D8JA 2LZ6B 3M0UA 4ZNXA 2K6DA 2F2VA 2K7AA 1ZUKA 1KIKA 2DNUA 2O9VA 2KYMA 2A08A 1BB9A 2VWFA 4RTVA 4OMPA 1YWPA 3ULRB 1Z9QA 5FWCA 2YDLA 1MUZA 1KSWA 2L3PA 4RTYA 1K76A 1H3HA 4RTWA 1TUDA 2BTTA 1X6BA 4LN2A 4J9IA 1LCKA 3VS4A 2CH4W 1OPLA 1E6HA 1T0HA 2MCNA 2KBTA 4AFQC 1T0JA 2KNBB 5IXBA 2KXCA 1AZEA 1SHFA 1I1JA 2KRNA 1UUEA 2BZXA 2CREA 1W70A 1X27A 2DL5A 2V1RA 2C0IA 3M0SA 1EFNA 2OJ2A 3RNJA 3KFVA 2CDTA 1WA7A 2LX7A 1GCQC 4CC3A 2IIMA 1T3SA 1U3OA 2YUOA 4OMNA 2RN8A 1AVZC 3A98A 1RUWA 4DEXA 2AZVA 2RQTA 1QKWA 2CSQA 3NMZC 1OEBA 3VS2A 3I35A 2EGAA 2FO0A 1RLPC 4F14A 2LJ0A 2DLPA 2OAWA 4KRTA 5I11A 2YUPA 1UFFA 4CC7A 5L23A 1AWJA 2LP5A 1X2KA 1U06A 3EHRA 3CQTA 2DBMA 4J9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQN A;  4Z88 A;  1J3T A;  3EG0 A;  2YUN A;  3EGU A;  2AZS A;  2EYZ A;  1B07 A;  1TG0 A;  4ESR A;  1HSQ A;  2RQV A;  3O5Z A;  4RTT A;  1SSH A;  1WXU A;  2V1Q A;  4OMQ A;  2K2M A;  2CT3 A;  1XOV A;  1G2B A;  2DVJ A;  5IHN A;  1UEC A;  2JTE A;  1H8K A;  1UG1 A;  3NGP A;  2LCS A;  1X69 A;  2KEA A;  2JMC A;  4LNP A;  3TVT A;  1AD5 A;  1SRL A;  4HCK A;  1E7O A;  2ENM A;  3THK A;  2SEM A;  2O9S A;  3VS3 A;  5FWB A;  4J9G A;  2A36 A;  2D1X A;  4HVW A;  2O88 A;  1NG2 A;  2JT4 A;  2DYB A;  3NHN A;  4ORZ A;  1KFZ A;  1I07 A;  2LJ1 A;  2FG0 A;  3C0C A;  4JZ4 A;  2KT1 A;  2C0T A;  4Y92 A;  1WFW A;  2I0N A;  1A0N B;  2FRY A;  3QWX X;  2ESW A;  4EIK A;  1M30 A;  1YNZ A;  1VYV A;  4OML A;  1WXT A;  2F2W A;  3U23 A;  1QKX A;  1I0C A;  2RQW A;  2W0Z A;  1X6G A;  4OMM A;  2DL3 A;  1M8M A;  2EW3 A;  3PE0 A;  1RLQ C;  5ECA A;  2GTJ A;  4J9E A;  3VS1 A;  4J9D A;  1GCQ A;  1WIE A;  1WX6 A;  2L3Q A;  2RF0 A;  1WDX A;  2J6K A;  1GCP A;  3UA6 A;  4AFZ C;  4A63 B;  2KT8 A;  2DRK A;  3M0R A;  1OV3 A;  2CT4 A;  3VRY A;  1JO8 A;  1SHG A;  3EHQ A;  2W10 A;  1ABQ A;  3I9Q A;  4JJC A;  1WYX A;  3I5S A;  1NM7 A;  3REA B;  1E6G A;  4CC4 B;  4AG1 C;  4CC2 A;  2HBW A;  2DBK A;  1CKA A;  3FJ5 A;  1K1Z A;  2KYB A;  2VKN A;  4HVV A;  4IIM A;  2O2O A;  2ECZ A;  4RTZ A;  4FSS A;  3TSW A;  3M0T A;  1BK2 A;  2DIL A;  4JJD A;  1GBQ A;  1AWW A;  1GFC A;  2A37 A;  3ZL7 C;  3REB B;  2H8H A;  2AKK A;  3PVQ A;  2JMA A;  1AZG B;  1S1N A;  1GFD A;  3UF4 A;  1UJY A;  1UHF A;  1MV0 B;  1QCF A;  1KJW A;  2KRS A;  2FPE A;  2DRM A;  1M27 C;  2JM8 A;  1ARK A;  2C0O A;  2P4R A;  1AWX A;  1PKS A;  4E6R A;  2KRM A;  3UAT A;  2EGC A;  1X43 A;  2G6F X;  4QT7 A;  1CKB A;  2KE9 A;  2KXD A;  5IH2 A;  2EYW A;  1BBZ A;  3VS0 A;  1UJ0 A;  2EGE A;  2GTO A;  4GBQ A;  3LH5 A;  2EPD A;  1OOT A;  3NPF A;  2BZ8 A;  1AOJ A;  2K3B A;  2DMO A;  4JPB W;  1U5S A;  2J06 A;  3R6N A;  2KGT A;  2PNI A;  1HD3 A;  2LJ3 A;  4AFU C;  1ZSG A;  1OPK A;  2D0N A;  2JM9 A;  1TUC A;  1V1C A;  4HXJ A;  2L2P A;  1SRM A;  5FW9 A;  1N5Z A;  2MOX A;  4LUE A;  1JXM A;  2YSQ A;  4RUG A;  2DL4 A;  3H41 A;  1GL5 A;  2A28 A;  1Z9Z A;  2M51 A;  3EG1 A;  2EYX A;  2ROT A;  1X2Q A;  2AKL A;  3H0F A;  4GLM A;  4RTX A;  2MIO A;  2J6O A;  3SEM A;  2DA9 A;  1UDL A;  3VS7 A;  1AEY A;  2EKH A;  4F17 A;  2D8H A;  1PHT A;  2B86 A;  2LNH B;  2ED1 A;  1GBR A;  4HVU A;  1QWE A;  4D8K A;  2CH4 A;  4WCI A;  4AG2 C;  2LQW A;  1BU1 A;  1AWO A;  4J9B A;  3SHW A;  1NLP C;  2NUZ A;  3M0Q A;  1Y0M A;  2DE0 X;  2DJQ A;  1K0X A;  2O31 A;  1QWF A;  2JXB A;  2YUQ A;  1ZUU A;  1G83 A;  1WXB A;  2KRO A;  2JS0 A;  1ZLM A;  2PTK A;  2FRW A;  1NLO C;  2EBP A;  2X3W D;  1K0S A;  2GBQ A;  4Z8A A;  2AK5 A;  1PNJ A;  2L3S A;  1FMK A;  4K11 A;  2CUB A;  5HCK A;  3RBB B;  2E5K A;  3H0I A;  2EYY A;  3VS5 A;  1RI9 A;  1NYF A;  1VYT A;  2ABL A;  1T3L A;  2RQR A;  2FPD A;  3I5R A;  2XMF A;  2SRC A;  5IXF A;  5GJW B;  2VVK A;  4RTU A;  2JS2 A;  1UGV A;  1K9A A;  1Y57 A;  2DF6 A;  2NWM A;  2RMO A;  1W1F A;  2L0A A;  4JJB A;  1M3A A;  1IO6 A;  2KR3 A;  4D8D A;  1W6X A;  2RQU A;  1PRM C;  4M4Z A;  1UE9 A;  5GJV B;  1JEG A;  2K9G A;  4R0K A;  3TSZ A;  2RPN A;  1K4U S;  1ZBJ A;  4J9H A;  1GRI A;  2DX1 A;  1NEG A;  2M0Y A;  2HSP A;  2ROL A;  1YCS B;  1YWO A;  4JZ3 A;  3VRZ A;  1M3B A;  4LUD A;  2FPF A;  1PWT A;  1ABO A;  3EG3 A;  1FYN A;  2EQI A;  2CSI A;  2RNA A;  3GBQ A;  1QLY A;  3VS6 A;  2GNC A;  2FEI A;  2GGR A;  3M0P A;  2EVR A;  3IQL A;  2J6F A;  2HDA A;  1B3Q A;  1ZX6 A;  1M3C A;  5EC7 A;  3EG2 A;  2J05 A;  4LE9 A;  2DL7 A;  1SEM A;  1WI7 A;  1JXO A;  2DL8 A;  4AFS C;  3PVL A;  3QWY A;  2CUD A;  4F16 A;  2ED0 A;  2K79 A;  4IIO A;  2LMJ A;  3H0H A;  2GQI A;  1JU5 C;  2JW4 A;  4DEY A;  2HCK A;  5I22 A;  4OMO A;  2OI3 A;  1VA7 A;  1SPK A;  2X3X D;  4X1V A;  1VYU A;  2HEQ A;  1JQQ A;  5IHI A;  1PKT A;  1CSK A;  1PRL C;  1MV3 A;  3JV3 A;  1UHC A;  2PZ1 A;  2F2X A;  1NEB A;  1UTI A;  1WLP B;  2DM1 A;  2J7I A;  1YP5 A;  3UA7 A;  2QDL A;  2YT6 A;  4Z89 A;  1NYG A;  1HJD A;  1YN8 A;  4J9F A;  1ZUY A;  1H92 A;  5IHK A;  2BZY A;  2D8J A;  2LZ6 B;  3M0U A;  4ZNX A;  2K6D A;  2F2V A;  2K7A A;  1ZUK A;  1KIK A;  2DNU A;  2O9V A;  2KYM A;  2A08 A;  1BB9 A;  2VWF A;  4RTV A;  4OMP A;  1YWP A;  3ULR B;  1Z9Q A;  5FWC A;  2YDL A;  1MUZ A;  1KSW A;  2L3P A;  4RTY A;  1K76 A;  1H3H A;  4RTW A;  1TUD A;  2BTT A;  1X6B A;  4LN2 A;  4J9I A;  1LCK A;  3VS4 A;  2CH4 W;  1OPL A;  1E6H A;  1T0H A;  2MCN A;  2KBT A;  4AFQ C;  1T0J A;  2KNB B;  5IXB A;  2KXC A;  1AZE A;  1SHF A;  1I1J A;  2KRN A;  1UUE A;  2BZX A;  2CRE A;  1W70 A;  1X27 A;  2DL5 A;  2V1R A;  2C0I A;  3M0S A;  1EFN A;  2OJ2 A;  3RNJ A;  3KFV A;  2CDT A;  1WA7 A;  2LX7 A;  1GCQ C;  4CC3 A;  2IIM A;  1T3S A;  1U3O A;  2YUO A;  4OMN A;  2RN8 A;  1AVZ C;  3A98 A;  1RUW A;  4DEX A;  2AZV A;  2RQT A;  1QKW A;  2CSQ A;  3NMZ C;  1OEB A;  3VS2 A;  3I35 A;  2EGA A;  2FO0 A;  1RLP C;  4F14 A;  2LJ0 A;  2DLP A;  2OAW A;  4KRT A;  5I11 A;  2YUP A;  1UFF A;  4CC7 A;  5L23 A;  1AWJ A;  2LP5 A;  1X2K A;  1U06 A;  3EHR A;  3CQT A;  2DBM A;  4J9C A; 
#chains in the Genus database with same CATH topology
 1TOV A;  1UGQ B;  3CXC A;  4JLG A;  2YUN A;  4N4I A;  3EGU A;  5KYW B;  4DBR A;  2EYZ A;  1TG0 A;  2VV5 A;  2XHC A;  4NL2 A;  1EX4 A;  5GAN 8;  2DXC A;  5GAM h;  1WXU A;  4QKU A;  1JB0 E;  4N0A A;  4F04 B;  3M9Q A;  2M16 A;  5IHN A;  2CS7 A;  1IB8 A;  5GAO m;  1D1B A;  4MML A;  4KUL A;  1UG1 A;  3GIB A;  1QVG S;  1X69 A;  1QVG A;  1VIE A;  2DTH A;  2Z0W A;  3JRZ A;  5CIU A;  3SDZ A;  3CPF A;  4HCK A;  3I56 A;  4OF1 A;  3LX7 A;  2M02 A;  8AT1 B;  1JBM A;  2PVO B;  3NFC A;  1VQK T;  2FB7 A;  3N5B B;  3L2W A;  3JCM V;  2QEX Q;  1WPY A;  5CO7 A;  2PUO B;  4A53 A;  4ZGJ B;  2OTL A;  1VQP T;  4EDU A;  3VJP A;  4OML A;  2F2W A;  1YI2 A;  4M7A F;  2RI3 A;  1QKX A;  1ZSZ C;  4B9W A;  4PJO C;  1OX8 A;  1BIA A;  1I0C A;  4J6W A;  4OMM A;  3CCR T;  2DL3 A;  1M8M A;  3HHT B;  1YIT A;  1V29 B;  3DLM A;  1MNE A;  2GTJ A;  5GAN 2;  1VQ7 T;  2CP2 A;  3OQ5 A;  1W2B A;  1WX6 A;  5IN1 A;  1GCP A;  4OP0 A;  2CGH A;  4C5E A;  2QTX A;  3JSC A;  3MPU B;  4CRI A;  2O4X A;  5GAN g;  3E19 A;  2LTO A;  4M7A D;  1YJW Q;  5KYN A;  3EG9 A;  3CCL A;  3HL8 A;  1WYX A;  3I5S A;  1XNI A;  1YIJ A;  2L5Q A;  2VGN A;  2COZ A;  2DBK A;  3FJ5 A;  1K1Z A;  2VKN A;  1WJR A;  3TQ7 P;  2O2O A;  4RTZ A;  4FSS A;  2AIR B;  2XDD A;  4PJJ A;  2DIL A;  5CKD A;  4EPC A;  1VQO T;  4KGZ B;  2KSS A;  3CD6 A;  4BE1 A;  1AZG B;  3UF4 A;  2JJ9 A;  2K3X A;  1UHF A;  1QCF A;  5GAO l;  2QQR A;  1YHQ A;  2P84 A;  4JS5 A;  2C0O A;  2JNG A;  3GOX A;  4QVD A;  3CD6 Q;  4E6R A;  2KRM A;  2MYS A;  4PNO A;  3UAT A;  2EGC A;  1M90 U;  1X43 A;  2G6F X;  3M54 A;  1M2V B;  2KE9 A;  2VXF A;  3MCA B;  2DIQ A;  2PU9 B;  5A0L A;  5FRO A;  1BBZ A;  5KYX B;  2RI2 A;  4HA8 A;  5LJ3 d;  3CC2 Q;  1VIF A;  4ME7 A;  3RUX A;  3CC7 A;  3H9N A;  1ZSZ B;  1G5V A;  4J6X A;  4MZP A;  3NPF A;  2BZ8 A;  2K3B A;  1KD1 U;  3LH0 A;  1WHH A;  4N4H A;  4M7A A;  1AHJ B;  3GLX A;  1U5S A;  2EQK A;  2PNI A;  1HD3 A;  4RG8 A;  1ZSG A;  5KH6 A;  2D0N A;  4ZN3 A;  3UWN A;  4HXJ A;  4QQD A;  5FW9 A;  2RJC A;  4PJO A;  1TXQ A;  4C0G A;  1Z9Z A;  2M51 A;  3TU4 K;  1X2Q A;  2EJ9 A;  2RD1 A;  2YLB A;  3VS7 A;  3GNG A;  4M75 F;  1N9R A;  4EMK A;  3M56 A;  2D8H A;  1YJN T;  2LNH B;  1GBR A;  3URG A;  1QWE A;  5AT1 B;  5LJ5 d;  4WCI A;  4AG2 C;  2DTI A;  2KY9 A;  4XU2 A;  4O5V A;  3SHW A;  1NLP C;  3LGF A;  1RAH B;  4AMC A;  1VQM T;  2YUQ A;  4XTY A;  2PQW A;  1ZLM A;  3VUB A;  2FRW A;  1NLO C;  4M77 D;  3OB9 A;  5GAM g;  2E5Q A;  4XAX B;  5GAN e;  4K11 A;  2E6N A;  3CCU A;  2CUB A;  4HCZ A;  2XU8 A;  3QJ6 A;  3VS5 A;  4DBQ A;  3OYK A;  3CCR A;  5KYY B;  4C92 G;  3VKI A;  2NUP A;  3RKX A;  2QGF B;  3MEW A;  2SRC A;  3OS0 A;  3EGX A;  5GJW B;  1VQN A;  6AT1 B;  2L8D A;  1C1A A;  2OTJ Q;  1UGV A;  1W2B S;  3BDL A;  2RMO A;  4C5I A;  4J7I A;  4BI3 A;  4RMO A;  1EIF A;  4M75 A;  2AT1 B;  1OYX A;  2FZC B;  2KR3 A;  2X35 A;  4ANJ A;  4KGX B;  2QA4 A;  4OB0 B;  5GJV B;  4IUQ A;  3CC4 T;  2CZ1 B;  2DX1 A;  2M0Y A;  1OZ2 A;  2ROL A;  4M7A C;  3G6E Q;  2CP3 A;  4JZ3 A;  4JUV A;  4LUD A;  2FPF A;  4J6Y A;  1PWT A;  2EQI A;  5GAO p;  3QYH B;  3L2Q A;  1X6O A;  2KVQ G;  5J39 A;  3OYD A;  2CZ7 B;  1IZ6 A;  4L5G A;  4M7A B;  2OAU A;  3M0P A;  1K73 C;  1M1K U;  2J6F A;  1ZX6 A;  2NYS A;  4BUG A;  3MHX A;  2DL7 A;  2YHT A;  2DL8 A;  2WAC A;  3LYI A;  3EH1 A;  3PVL A;  3KBG A;  3QWY A;  1NBE B;  2BKD N;  3CME T;  2JW4 A;  2LNV A;  4C92 B;  1YCY A;  4DEY A;  5LJ3 j;  2WSC E;  1VA7 A;  2ZPG B;  2X3X D;  4P5N A;  1VYU A;  2HEQ A;  3SB2 A;  1CSK A;  1M2V A;  1MV3 A;  1YI2 T;  1WJS A;  3OS5 A;  1NEB A;  1WLP B;  2J7I A;  1AT1 B;  4FL6 A;  4KUI A;  2QDL A;  4Z89 A;  1YN8 A;  2YRD A;  1Q7Y C;  4C8Q E;  4ZNX A;  1FMW A;  1GXI E;  1QVF A;  2HNI A;  2DNU A;  1RAD B;  5GAM d;  1Y7X A;  2EYQ A;  5FRN A;  3PIP A;  3CEY A;  3A1P A;  5D6X A;  2A7Y A;  3L1A A;  1QVF P;  4OMP A;  3INZ A;  3PMT A;  2A3L A;  1Q81 C;  1YIJ T;  3HFO A;  4J83 A;  4M7A G;  3FJP A;  2RJD A;  1M1F A;  5CK9 A;  1WGS A;  1X6B A;  4J9I A;  3VS4 A;  4C0Z A;  2CH4 W;  2AHJ B;  1OPL A;  4FYV B;  2LDM A;  4XTU A;  2MCN A;  4AFQ C;  2LRQ A;  2KNB B;  5IXB A;  4BE2 A;  3CPW A;  5GAN 3;  1BCM A;  1I1J A;  4M7A E;  2KRN A;  2LVM A;  1PSF A;  1YJW T;  3X25 B;  4C0D B;  3F70 A;  2C0I A;  1NPP A;  1TSF A;  3CXC S;  3KFV A;  1GCQ C;  1I8F A;  1D0Y A;  1WJQ A;  1M5Q 1;  2OTL Q;  2YUO A;  1VQO Q;  3O8V A;  3G1J A;  1Q95 G;  4DEX A;  1MGQ A;  2RQT A;  1VQ4 A;  1OEB A;  1S72 Q;  2CZ6 B;  3VS2 A;  5GMK e;  1VQL A;  2FO0 A;  3AT1 B;  2PUK B;  4FW1 A;  2E6Z A;  3JCM W;  4BAC A;  5KCH A;  3BE3 A;  5I21 A;  3EGD B;  3L42 A;  2XD0 A;  4A54 A;  2CP6 A;  2HL5 C;  4J9C A;  2DYI A;  4B9X A;  4Z88 A;  3OYE A;  4CI0 C;  1HSQ A;  3O5Z A;  3CMA A;  3FDR A;  1LVK A;  3D7S B;  4LDX A;  1SSH A;  2V8J A;  1Y96 A;  4OMQ A;  2K2M A;  1VQ6 Q;  1VQO A;  2RB6 A;  3KUF A;  2JTE A;  1VQ5 Q;  4WTO B;  3C94 A;  1H8K A;  3NGP A;  1YJN A;  2KEA A;  4OB3 B;  4C0F A;  3EAE A;  4ZTJ A;  3EH2 A;  2ENM A;  1WHK A;  2SEM A;  4E7J A;  5FWB A;  1Q82 U;  4J9G A;  4PJM A;  2A36 A;  2D1X A;  5GAN 4;  3BFM A;  3X26 B;  2CZ0 B;  2V8K A;  3NHN A;  4ORZ A;  1KFZ A;  1X75 C;  2FG0 A;  4JZ4 A;  4Y92 A;  1FWZ A;  4OB1 B;  5CQX A;  3G4S T;  3I55 A;  3EGD A;  4DOV A;  2ESW A;  4FT2 A;  4OMF B;  4EIK A;  3J81 E;  2E12 A;  3MEV A;  3T9N A;  1YJW A;  2QDY B;  5GAM f;  3SD4 A;  3HRT A;  5GMK l;  3CC2 A;  2XK0 A;  3U23 A;  3QDR B;  2P0K A;  2W0Z A;  1X6G A;  2C06 A;  3CCS A;  1Y96 B;  4JRK A;  4RCB A;  3VS1 A;  3X24 B;  1UEB A;  2K5I A;  3PFS A;  1B7T A;  2CP0 A;  1H64 1;  3UA6 A;  4AFZ C;  2JUF A;  3NTK A;  1VQ4 T;  1IGU A;  1ZBX A;  2ZPH B;  1OV3 A;  3QZ9 B;  3MP6 A;  1K8A U;  1SHG A;  3MEU A;  1BI1 A;  4PJO E;  1QP3 A;  3I9Q A;  1WHG A;  4X34 A;  2K5F A;  3M5A A;  1BCO A;  5LJ3 f;  5A0D A;  2DZ9 A;  4Y28 E;  3OW2 S;  4PL6 A;  3CBM A;  4CC4 B;  5DM7 R;  4HVV A;  3CCE T;  2A0F B;  4IIM A;  1BK2 A;  2KAF A;  1M90 R;  4JJD A;  1AWW A;  1GFC A;  5GAN j;  4QVZ A;  3REB B;  1KQS A;  3SFM A;  4LDW A;  1MMN A;  3DB4 A;  3HFN A;  1S1N A;  2LC4 A;  1XQH A;  2FVU A;  4N0A C;  1QQJ A;  1UJY A;  3MP1 A;  2DPP B;  2FPE A;  1K8A R;  2JM8 A;  1N8R C;  1IHV A;  3JB9 J;  3CCQ A;  3HSB A;  1Y71 A;  1N9S A;  1PD1 A;  3JCM X;  4PFP A;  2LX9 A;  1RAG B;  3HPW A;  1OUL A;  1VQK A;  3VS0 A;  8ATC B;  2EGE A;  3LH5 A;  2HAX A;  2JTF A;  4JDS A;  3CCM T;  3V8K A;  1OOT A;  2RO0 A;  4HCB A;  1AOJ A;  1KD1 R;  1G3S A;  5C0M A;  4E7L A;  1OZ3 A;  4O6J A;  1YIT T;  2CP7 A;  1V1C A;  5LJ5 e;  2L2P A;  5IT9 E;  3OYF A;  1N5Z A;  2HZY A;  3SWN B;  4RUG A;  2DL4 A;  1MND A;  1B34 A;  3EG1 A;  4L59 A;  3H0F A;  4RTX A;  1R0B G;  2NUT A;  3CBO A;  1QMC A;  1O75 A;  5L8R E;  2FZK B;  2VB6 A;  4Z02 A;  2QXF A;  4A4E A;  4PJO G;  4BI8 B;  4HVU A;  3P8D A;  2DEQ A;  5CKH A;  3GPL A;  4PJN A;  2LQW A;  4J9B A;  2DZC A;  2RJE A;  1V76 A;  4BY6 C;  1K0X A;  2R5M A;  1FXX A;  1QWF A;  2E10 A;  1N8R R;  5LJ5 f;  3OMC A;  2H3J A;  2PTK A;  3A5Z B;  2EBP A;  2X3W D;  3EFR A;  2KQW A;  1K0S A;  2M9U A;  2GBQ A;  4R55 A;  2DAQ A;  2X4J A;  4LDY A;  1UGP B;  1UGS B;  5HCK A;  2E5K A;  3RER A;  2QA4 Q;  2EYY A;  3CXC P;  1RI9 A;  4EMG A;  2GQV A;  2GFU A;  3OYH A;  1TS9 A;  3I5R A;  2DVE A;  4KGV B;  2XMF A;  1I5O B;  4X9D A;  3VYG A;  2QEX T;  2JS2 A;  1K9A A;  4HCC A;  4JJB A;  2E4H A;  1TU0 B;  1IO6 A;  1G8X A;  3RMS A;  1W6X A;  1LNX A;  4YTL A;  3CCR Q;  1WNL A;  1K9M C;  3QYG B;  1PRM C;  3OYJ A;  4M4Z A;  3ZBD A;  1M90 C;  2WSF E;  4A4H A;  1UE9 A;  1JEG A;  4ZGE B;  4R0K A;  4FCY A;  2IPO B;  4J9H A;  2QQA A;  2DJZ A;  2RHZ A;  1NPR A;  5GAM j;  3OMG A;  4PJO B;  1M3B A;  4QVC A;  1ABO A;  3EG3 A;  2LT4 A;  1PM3 A;  1WHM A;  1BI3 A;  1PCX A;  2RNA A;  1K9M R;  3GBQ A;  1QLY A;  5KE2 A;  1KQS S;  1UGR B;  2FEI A;  1VQ9 Q;  3A8O B;  3ER0 A;  4LDV A;  2LQ8 A;  1M1K R;  1HXD A;  3E9F A;  3JCM h;  4XQ3 A;  4EMK C;  3G7Z A;  3EG2 A;  3I56 T;  4OGE A;  1SEM A;  4PJO F;  1WI7 A;  1JXO A;  1C0M A;  5LL6 S;  3LW5 E;  4TVR A;  4F16 A;  1XJW B;  5GMK j;  2ED0 A;  2FL7 A;  5GMK i;  2LMJ A;  2YRC A;  3H0H A;  3CCV A;  1BI0 A;  1IGQ A;  3CCQ Q;  4BDY A;  3CCS Q;  1D3B A;  4KBM B;  3V7S A;  2QQS A;  1SPK A;  5FU7 C;  5GAO n;  3JCM J;  3TCJ A;  1JQQ A;  5IHI A;  3JB9 D;  1MMA A;  1PRL C;  1PSE A;  3JV3 A;  1UHC A;  1F1B B;  1VQ8 Q;  4C8Q A;  3CC7 Q;  4LDU A;  1D0X A;  1NYG A;  4D6W A;  3PNW C;  5IHK A;  2E70 A;  2BZY A;  2D8J A;  3HRS A;  3E2U A;  2PVG B;  3CCV Q;  2F2V A;  5GAN h;  4A4K A;  1ZUK A;  2EKO A;  2O9V A;  2K5L A;  4ELY C;  4RKU E;  4M75 C;  2DXB A;  2VWF A;  1RL2 A;  3ULR B;  5CR2 A;  3CCJ A;  1Z9Q A;  5KYW A;  2YDL A;  4RTY A;  2L3P A;  4XU1 A;  1BI2 A;  2BTT A;  3BDU A;  4LN2 A;  1LCK A;  4C8Q F;  3TRE A;  1OU9 A;  1YJ9 Q;  2FYK A;  3M4Y A;  1RAI B;  4M77 A;  1T0J A;  2KXC A;  5EG2 A;  1ACM B;  2HQX A;  4JJN K;  1W70 A;  4M7D E;  1WQ7 A;  3ME9 A;  1YHQ T;  3M0S A;  3FB9 A;  3X28 B;  2HSE B;  3I55 Q;  2RK2 A;  1QVP A;  1EFN A;  3RNJ A;  2CDT A;  1G3Y A;  3RKY A;  3QPH A;  4PJO D;  1D1A A;  2IIM A;  1U3O A;  1AVZ C;  1VQP Q;  2JN0 A;  1R77 A;  2IG0 A;  1QKW A;  2R57 A;  3NMZ C;  3I35 A;  2EGA A;  5J26 A;  2GF7 A;  4MDX A;  4J5Y A;  2XIC A;  2LJ0 A;  2G3R A;  2OAW A;  4XU3 A;  4ZN1 A;  3JCM b;  4LD9 K;  1RAF B;  1AWJ A;  3OBW A;  2LP5 A;  4M75 E;  1X2K A;  5GAN 6;  4JS4 A;  1U06 A;  3EHR A;  3OYA A;  4NS5 A;  2EWN A;  2E1H A;  1TTH B;  1WZO A;  2OTJ T;  1D0Z A;  2ZAE A;  3CCJ Q;  2AZS A;  1B07 A;  1S72 T;  2DEU A;  2LCL A;  4RTT A;  3NTI A;  3VU3 C;  1G2B A;  1SG5 A;  2O01 E;  3MP8 A;  3EG9 B;  2DVJ A;  4M7D D;  1UEC A;  3MKD A;  3WXM B;  4DBF A;  2QG9 B;  2LCS A;  2X51 A;  2JMC A;  4LNP A;  2R5A A;  1U1T A;  3AHU A;  1NJI C;  2XKO C;  3JCM e;  2O9S A;  3VS3 A;  1WHJ A;  3KXT A;  4MDW A;  3LGL A;  3MO8 A;  2COW A;  1VQ6 T;  2O88 A;  4HVW A;  1NG2 A;  3V7R A;  2ATC B;  3X20 B;  2JT4 A;  1H3Z A;  3C0C A;  5KE3 A;  4RG2 A;  2DTO A;  1WFW A;  2I0N A;  2VC8 A;  1A0N B;  2FRY A;  3GNF B;  3QWX X;  3EFO B;  1PC0 A;  2FHD A;  2ZGW A;  3DB3 A;  1WXT A;  4UC4 A;  4JRP A;  5LJ5 j;  1RAA B;  4FM4 B;  2YLC A;  2EQJ A;  1D3B B;  5CCA A;  4M77 G;  3M58 A;  1JJ2 A;  5ECA A;  4KH1 B;  1UB4 A;  1VQN T;  1GCQ A;  1WIE A;  3JCM f;  2L3Q A;  2RF0 A;  2J6K A;  1Q82 R;  3CMA Q;  2DRK A;  3M0R A;  3SWN C;  4FSX A;  1VQL T;  3VRY A;  2K57 A;  5J3B A;  4C92 C;  4E47 A;  4M7D A;  2W10 A;  2QA4 T;  4JJC A;  4FIB A;  3REA B;  2HL3 A;  1E6G A;  2MAM A;  4CC2 A;  4C92 F;  2MI6 A;  1CKA A;  2VYT A;  5CKE A;  2ECZ A;  1S72 A;  1VQ4 Q;  3TSW A;  3M0T A;  3FEO A;  4FYY B;  1GBQ A;  4EMK B;  4C5G A;  1RAC B;  2H8H A;  2YRV A;  3PVQ A;  1QW1 A;  3C12 A;  1I81 A;  1MHN A;  1N27 A;  3BY7 A;  4PFZ A;  4BD3 A;  7AT1 B;  1AWX A;  1PKS A;  2HKQ B;  3OYG A;  3OYL A;  4DBH A;  1Y07 A;  5C6S A;  3PGG A;  4QT7 A;  1VQ6 A;  2QEX A;  2KXD A;  2XDP A;  1RI0 A;  3WVD B;  4F7U F;  5IH2 A;  4XK8 E;  2R58 A;  4M77 B;  2GTO A;  2YXY A;  4MMK A;  2EPD A;  1VQP A;  1Q82 C;  2EFI A;  5GAN f;  2DMO A;  1KC8 C;  4JPB W;  1I5L A;  5HK0 A;  3R6N A;  4C0D C;  4C92 D;  3HKS A;  4GLK A;  3OS1 A;  4IUT A;  4F7U A;  2MOX A;  3R6O A;  4LUE A;  2YSQ A;  3OW2 P;  4DQ2 A;  4PJL A;  2RK1 A;  2EYX A;  2EQM A;  5IAY A;  3SEM A;  2JZ2 A;  3H8Z A;  1SKU B;  2EKH A;  3FLG A;  1PHT A;  2B86 A;  3SWN A;  4JLI A;  3G71 Q;  2DXU A;  4M7D G;  3CCL T;  2E65 A;  1C6V X;  2CH4 A;  4GY5 A;  3JB9 I;  4M7D C;  2NUZ A;  1RAB B;  1Y0M A;  2DE0 X;  1VQ5 A;  2O31 A;  3OS2 A;  1K8A C;  1O9S A;  2JXB A;  5CVI A;  1ZUU A;  3CCV T;  3CD6 T;  1K9M U;  1EZZ B;  2HBP A;  1PNJ A;  4PFO A;  4WF2 A;  2H3E B;  3M59 A;  3H0I A;  3LLR A;  3M57 A;  5FLX E;  3OYI A;  2JOY A;  1T3L A;  2RQR A;  3MEA A;  4PK4 A;  5IXF A;  3G4S Q;  4E7H A;  2VVK A;  2E3I A;  4RTU A;  4E7Z A;  2BIV A;  1KC8 R;  2DF6 A;  2NWM A;  1YI2 Q;  1W1F A;  2L0A A;  1N8R U;  4PKC C;  1M3A A;  4NOY A;  4B6M A;  4IKF A;  2QI2 A;  4D8D A;  4X9C A;  2RQU A;  2EAY A;  1YHQ Q;  1N6A A;  1M8V A;  3TSZ A;  2M0O A;  1IRE B;  4IUP A;  1GRI A;  2HSP A;  1YCS B;  4FYX B;  4M7D B;  1FYN A;  5M9O A;  1R8O B;  2RI5 A;  4KUD K;  2CSI A;  1YIJ Q;  1M9S A;  2GNC A;  4M77 F;  2QTV A;  2VXE A;  1YBY A;  1G3W A;  3IQL A;  4JRI A;  1VQM Q;  1B3Q A;  4R56 A;  3CCU Q;  1M3C A;  5LJ5 h;  4QQG A;  4LE9 A;  5FU7 B;  4HKE A;  1YJ9 A;  3E1S A;  2CUD A;  2K79 A;  4IIO A;  1HYO A;  1JU5 C;  5DY9 A;  2YWW A;  2KMT A;  3HRU A;  2BE9 B;  2HCK A;  2D6F A;  5I22 A;  2P0Q A;  2QQ9 A;  2DK3 A;  3RES A;  4AT1 B;  4X1V A;  4QQ6 A;  3S3O A;  1D09 B;  1TH7 A;  1IRX A;  1NZ9 A;  3WVE B;  2OTL T;  1QCN A;  4XU0 A;  5I2M A;  2DFU A;  2JVV A;  2F2X A;  1OI1 A;  2Y90 A;  4ZTF A;  3A8G B;  4NL3 A;  1G3T A;  3UA7 A;  1BYM A;  1B34 B;  2YT6 A;  3OA6 A;  5CKF A;  1IHW A;  4J9F A;  2WSE E;  3GP8 A;  1M4Z A;  1PD0 A;  3J80 E;  1ZUY A;  2B8A A;  4XTX A;  3CCM Q;  3M0U A;  4IUR A;  4M78 D;  2K6D A;  3A8L B;  2ZPF B;  4LD6 A;  1VQ8 A;  1LPL A;  2KYM A;  2K3Y A;  2A08 A;  4RTV A;  3OYB A;  3FRN A;  3OYM A;  2RA2 A;  2MPX C;  3PMI A;  4JRQ A;  1MUZ A;  1KSW A;  4C8Q D;  4KH0 B;  1K76 A;  4II1 A;  4HT8 A;  1X01 A;  1H3H A;  4RTW A;  5D6W A;  1TUD A;  1KQ2 A;  2V26 A;  1VQ5 T;  4LXC A;  3PT9 A;  3RMQ A;  1OU8 A;  1VQM A;  1QVF S;  5D6Y A;  2I2L A;  1VQL Q;  1KG1 A;  2LT1 A;  1SHF A;  4M7D F;  2CKK A;  1Q86 C;  2VAS A;  2BZX A;  4PLI A;  3EFS A;  4M78 F;  2LCC A;  3CC2 T;  4M78 G;  4IUU A;  2ZZD A;  4BI4 A;  2OJ2 A;  3V8L A;  3UT1 A;  2LX7 A;  3RDV A;  1KK7 A;  2QQB A;  1YJ9 T;  3V8J A;  4OMN A;  2VUB A;  2CP5 A;  2RN8 A;  4QW2 A;  1K73 R;  2MWO A;  5HKC A;  3FC3 A;  2DIG A;  4RCC A;  3QKJ A;  4F14 A;  2DLP A;  5LJ3 e;  1NJI U;  5I11 A;  1BKB A;  2YUP A;  1UFF A;  3QSU A;  2O4X B;  3HTR A;  1JJ2 P;  3QZ5 B;  3CQT A;  2DBM A;  1KQ1 A;  2LQN A;  5FU6 B;  2QAS A;  1J3T A;  2Y4Y A;  3EG0 A;  2JTM A;  2X4W A;  3CCE A;  4ESR A;  3JCM c;  2RQV A;  2RM4 A;  4C8Q C;  5A2Q E;  2V1Q A;  2KK4 A;  2DKG A;  2F5K A;  2CT3 A;  1XOV A;  2RHX A;  3BW1 A;  3VYH B;  4M75 D;  4E7K A;  3TVT A;  2F5T X;  3ZEH A;  1AD5 A;  1SRL A;  1W2B P;  3JAM E;  1E7O A;  1TWB A;  3OW2 A;  5GAN 5;  3THK A;  4DA4 A;  1VQ9 A;  1SSF A;  2MWP A;  4M78 B;  2DYB A;  3CME A;  3QO3 A;  2LJ1 A;  3GF5 A;  2C0T A;  2KT1 A;  5KYU A;  2D0Q B;  2DER A;  5GMK h;  1HK9 A;  1M30 A;  1YNZ A;  3I56 Q;  4M77 C;  3G71 T;  1VYV A;  3CCL Q;  3S3M A;  2E3H A;  4IUV A;  4M78 E;  3QXE B;  3QHS A;  4A4F A;  2RQW A;  3PE0 A;  2EW3 A;  1RLQ C;  4DOW A;  4J9E A;  4Q5W A;  4J9D A;  4ELZ C;  2CYZ B;  3ZFJ A;  3CC4 Q;  1WDX A;  3J7A F;  3JCM Q;  4A63 B;  5CAI A;  2KT8 A;  2RHI A;  3G6E T;  2CT4 A;  1YIT Q;  1JO8 A;  1ZA2 B;  3OYC A;  3EHQ A;  2BUD A;  4F7U E;  2RH2 A;  1ABQ A;  2DO3 A;  4EMH A;  1NM7 A;  2OTJ A;  2QAZ A;  1VQN Q;  4AG1 C;  1FMV A;  2HBW A;  2KYB A;  3CMA T;  2VGM A;  4OVA A;  1QCO A;  3OYY A;  3OY9 A;  2GCX A;  2A37 A;  3ZL7 C;  2AKK A;  2JMA A;  4FU6 A;  1GFD A;  4J7F A;  2FZG B;  1MV0 B;  1W4S A;  1KJW A;  2KRS A;  2ZCF B;  2DRM A;  1M27 C;  1ARK A;  2P4R A;  2E64 A;  2QGG A;  5AYF A;  1OQK A;  3DKM A;  5KYY A;  2ZPI B;  4C92 E;  3PIO A;  2PVD B;  1CKB A;  4MZT A;  1LJO A;  3C4S A;  3CPW S;  4BB7 A;  2COY A;  2EYW A;  5CQY A;  2P0P A;  2KDS A;  4M75 B;  1UJ0 A;  4GBQ A;  4E7S A;  3I55 T;  3A8H B;  3EFO A;  3G71 A;  3CPW P;  2DXT A;  4C5H A;  5GAO r;  3JB9 F;  1YJN Q;  1RAE B;  2J06 A;  4KT0 E;  2KGT A;  3UDC A;  2LJ3 A;  2DD4 A;  4M77 E;  4AFU C;  3CC4 A;  1OPK A;  1R0C B;  1QVG P;  2JM9 A;  1TUC A;  2HKN A;  3M53 A;  1SRM A;  2HMA A;  2XI9 A;  1VQ7 A;  1D1C A;  1JXM A;  3QII A;  3H41 A;  1GL5 A;  2A28 A;  2ROT A;  1VQK Q;  2AKL A;  4BDZ A;  4GLM A;  2HD0 A;  2MIO A;  2J6O A;  4M78 A;  2DA9 A;  1UDL A;  1XTD A;  1AEY A;  4FT4 A;  3CCE Q;  4F17 A;  2ED1 A;  2NUT B;  3CCJ T;  4D8K A;  1Q7Y R;  3PTA A;  4C92 A;  5HK3 A;  1KD1 C;  2EIF A;  4FW2 A;  1BU1 A;  1AWO A;  2LQK A;  5FRM A;  3M0Q A;  1VQ9 T;  2DJQ A;  4F7U G;  1U8R A;  1VQ7 Q;  2RHY A;  4E7I A;  1ZHI A;  1G83 A;  1WXB A;  2KRO A;  2JS0 A;  2L89 A;  3CBP A;  3OSS C;  4Z8A A;  4OGC A;  2AK5 A;  1Q7Y U;  2L3S A;  3EGX B;  1FMK A;  2MF2 A;  1FX7 A;  2XG8 D;  3RBB B;  2DET A;  3MJX A;  4M75 G;  4XTW A;  1NYF A;  3CCQ T;  4V2S A;  2OX7 A;  5KYU B;  1VYT A;  3CCS T;  4ATO A;  2ABL A;  2FPD A;  1P92 A;  5GAN 7;  3E9G A;  4C8Q G;  3QG1 A;  1Y57 A;  3OSV A;  1JRI A;  2F1L A;  2ZPE B;  5GAN d;  1VQ8 T;  3CC7 T;  2BE7 D;  3HP9 A;  1IXD A;  2Y4X A;  1ZA1 B;  2K9G A;  2RPN A;  1K4U S;  3Q1J A;  1ZBJ A;  3QDF A;  5CKB A;  1Q86 R;  2KI7 A;  1NEG A;  3M4G A;  1YWO A;  1U1S A;  3S3N A;  1WHL A;  3VV0 A;  3VRZ A;  3M55 A;  3S6W A;  3P8H A;  1WQW A;  5DLQ E;  2F69 A;  2K2V A;  1PG5 B;  4OB2 B;  9ATC B;  1TUG B;  2MMP A;  3VS6 A;  1KC8 U;  3P8B B;  3L2R A;  3CME Q;  2GGR A;  3QJY A;  5LJ3 g;  1ZQ1 A;  3MET A;  4PLL A;  4F7U B;  2EVR A;  1BIB A;  4M78 C;  3JCM P;  2HDA A;  3UPU A;  1NE8 A;  5EC7 A;  1M2O A;  2J05 A;  2E41 A;  4AFS C;  3V7C A;  5DLO A;  1JJ2 S;  3JCM g;  5I2S A;  3DLL A;  5KCO A;  2DD5 A;  2GFA A;  2GQI A;  3VUZ A;  1KHI A;  1YFN A;  5A0G A;  3NTH A;  5KYX A;  3LWH A;  3QUI A;  4OMO A;  1M1G A;  2OI3 A;  5HY6 A;  3JB9 H;  2XID A;  5D7U A;  4XTV A;  4BY6 B;  1PKT A;  3CCU T;  1OX9 A;  4C8Q B;  2PZ1 A;  2QYZ A;  1UTI A;  1QP2 A;  2DM1 A;  1K73 U;  1M1K C;  3JCM d;  1YP5 A;  2X9H A;  3JB9 G;  4FYW B;  2X4Y A;  1HJD A;  2L3R A;  3RR6 A;  1KQS P;  1H92 A;  2LZ6 B;  3RKW A;  3L2V A;  1MMD A;  1Q86 U;  2EJG A;  3G6E A;  2K7A A;  3ASK A;  1KIK A;  2K4Y A;  1SF9 A;  2HQH A;  2P4T A;  5FU6 C;  1BB9 A;  3H6Z A;  1YWP A;  2X4X A;  4J8O A;  5FWC A;  2IVW A;  4XTZ A;  2V8I A;  3QBY A;  3RIR A;  4L6V 5;  4Y91 A;  5GMK m;  1I4K 1;  2ZPB B;  5GAO q;  4A4G A;  2D9T A;  3L2Z A;  1MMG A;  1E6H A;  2RJF A;  1Q81 R;  1T0H A;  2KBT A;  2QK0 A;  5GAM e;  1VUB A;  4E2F B;  1LOJ A;  1AZE A;  3G4S A;  2M1H A;  3TEE A;  2EJF A;  1UUE A;  1ZSZ A;  2CRE A;  1DJ7 B;  4N4G A;  4VUB A;  1VOM A;  1X27 A;  2DL5 A;  2V1R A;  2NLU A;  1KHC A;  4MZM A;  2XDB A;  1WA7 A;  2EQU A;  4BE0 A;  2MK5 A;  2NUP B;  5LJ5 g;  4CC3 A;  4HT9 A;  1Q81 U;  3LWI A;  3A8M B;  3OYN A;  2HQE A;  1T3S A;  3A98 A;  1RUW A;  5LJ3 h;  2AZV A;  2CSQ A;  3L2U A;  3FIF A;  1RLP C;  3CCM A;  4KRT A;  3OBY A;  1NJI R;  2RHU A;  3C95 A;  4CC7 A;  5L23 A;  1I07 A;  4ZGD B; 
#chains in the Genus database with same CATH homology
 2LQN A;  4Z88 A;  1J3T A;  3EG0 A;  2YUN A;  3EGU A;  2AZS A;  2EYZ A;  1B07 A;  1TG0 A;  4ESR A;  1HSQ A;  2RQV A;  3O5Z A;  4RTT A;  1SSH A;  1WXU A;  2V1Q A;  4OMQ A;  2K2M A;  2CT3 A;  1XOV A;  1G2B A;  2DVJ A;  5IHN A;  1UEC A;  2JTE A;  1H8K A;  1UG1 A;  3NGP A;  2LCS A;  1X69 A;  2KEA A;  2JMC A;  4LNP A;  3TVT A;  1AD5 A;  1SRL A;  4HCK A;  1E7O A;  2ENM A;  3THK A;  2SEM A;  2O9S A;  3VS3 A;  5FWB A;  4J9G A;  2A36 A;  2D1X A;  4HVW A;  2O88 A;  1NG2 A;  2JT4 A;  2DYB A;  3NHN A;  4ORZ A;  1KFZ A;  1I07 A;  2LJ1 A;  2FG0 A;  3C0C A;  4JZ4 A;  2KT1 A;  2C0T A;  4Y92 A;  1WFW A;  2I0N A;  1A0N B;  2FRY A;  3QWX X;  2ESW A;  4EIK A;  1M30 A;  1YNZ A;  1VYV A;  4OML A;  1WXT A;  2F2W A;  3U23 A;  1QKX A;  1I0C A;  2RQW A;  2W0Z A;  1X6G A;  4OMM A;  2DL3 A;  1M8M A;  2EW3 A;  3PE0 A;  1RLQ C;  5ECA A;  2GTJ A;  4J9E A;  3VS1 A;  4J9D A;  1GCQ A;  1WIE A;  1WX6 A;  2L3Q A;  2RF0 A;  1WDX A;  2J6K A;  1GCP A;  3UA6 A;  4AFZ C;  4A63 B;  2KT8 A;  2DRK A;  3M0R A;  1OV3 A;  2CT4 A;  3VRY A;  1JO8 A;  1SHG A;  3EHQ A;  2W10 A;  1ABQ A;  3I9Q A;  4JJC A;  1WYX A;  3I5S A;  1NM7 A;  3REA B;  1E6G A;  4CC4 B;  4AG1 C;  4CC2 A;  2HBW A;  2DBK A;  1CKA A;  3FJ5 A;  1K1Z A;  2KYB A;  2VKN A;  4HVV A;  4IIM A;  2O2O A;  2ECZ A;  4RTZ A;  4FSS A;  3TSW A;  3M0T A;  1BK2 A;  2DIL A;  4JJD A;  1GBQ A;  1AWW A;  1GFC A;  2A37 A;  3ZL7 C;  3REB B;  2H8H A;  2AKK A;  3PVQ A;  2JMA A;  1AZG B;  1S1N A;  1GFD A;  3UF4 A;  1UJY A;  1UHF A;  1MV0 B;  1QCF A;  1KJW A;  2KRS A;  2FPE A;  2DRM A;  1M27 C;  2JM8 A;  1ARK A;  2C0O A;  2P4R A;  1AWX A;  1PKS A;  4E6R A;  2KRM A;  3UAT A;  2EGC A;  1X43 A;  2G6F X;  4QT7 A;  1CKB A;  2KE9 A;  2KXD A;  5IH2 A;  2EYW A;  1BBZ A;  3VS0 A;  1UJ0 A;  2EGE A;  2GTO A;  4GBQ A;  3LH5 A;  2EPD A;  1OOT A;  3NPF A;  2BZ8 A;  1AOJ A;  2K3B A;  2DMO A;  4JPB W;  1U5S A;  2J06 A;  3R6N A;  2KGT A;  2PNI A;  1HD3 A;  2LJ3 A;  4AFU C;  1ZSG A;  1OPK A;  2D0N A;  2JM9 A;  1TUC A;  1V1C A;  4HXJ A;  2L2P A;  1SRM A;  5FW9 A;  1N5Z A;  2MOX A;  4LUE A;  1JXM A;  2YSQ A;  4RUG A;  2DL4 A;  3H41 A;  1GL5 A;  2A28 A;  1Z9Z A;  2M51 A;  3EG1 A;  2EYX A;  2ROT A;  1X2Q A;  2AKL A;  3H0F A;  4GLM A;  4RTX A;  2MIO A;  2J6O A;  3SEM A;  2DA9 A;  1UDL A;  3VS7 A;  1AEY A;  2EKH A;  4F17 A;  2D8H A;  1PHT A;  2B86 A;  2LNH B;  2ED1 A;  1GBR A;  4HVU A;  1QWE A;  4D8K A;  2CH4 A;  4WCI A;  4AG2 C;  2LQW A;  1BU1 A;  1AWO A;  4J9B A;  3SHW A;  1NLP C;  2NUZ A;  3M0Q A;  1Y0M A;  2DE0 X;  2DJQ A;  1K0X A;  2O31 A;  1QWF A;  2JXB A;  2YUQ A;  1ZUU A;  1G83 A;  1WXB A;  2KRO A;  2JS0 A;  1ZLM A;  2PTK A;  2FRW A;  1NLO C;  2EBP A;  2X3W D;  1K0S A;  2GBQ A;  4Z8A A;  2AK5 A;  1PNJ A;  2L3S A;  1FMK A;  4K11 A;  2CUB A;  5HCK A;  3RBB B;  2E5K A;  3H0I A;  2EYY A;  3VS5 A;  1RI9 A;  1NYF A;  1VYT A;  2ABL A;  1T3L A;  2RQR A;  2FPD A;  3I5R A;  2XMF A;  2SRC A;  5IXF A;  5GJW B;  2VVK A;  4RTU A;  2JS2 A;  1UGV A;  1K9A A;  1Y57 A;  2DF6 A;  2NWM A;  2RMO A;  1W1F A;  2L0A A;  4JJB A;  1M3A A;  1IO6 A;  2KR3 A;  4D8D A;  1W6X A;  2RQU A;  1PRM C;  4M4Z A;  1UE9 A;  5GJV B;  1JEG A;  2K9G A;  4R0K A;  3TSZ A;  2RPN A;  1K4U S;  1ZBJ A;  4J9H A;  1GRI A;  2DX1 A;  1NEG A;  2M0Y A;  2HSP A;  2ROL A;  1YCS B;  1YWO A;  4JZ3 A;  3VRZ A;  1M3B A;  4LUD A;  2FPF A;  1PWT A;  1ABO A;  3EG3 A;  1FYN A;  2EQI A;  2CSI A;  2RNA A;  3GBQ A;  1QLY A;  3VS6 A;  2GNC A;  2FEI A;  2GGR A;  3M0P A;  2EVR A;  3IQL A;  2J6F A;  2HDA A;  1B3Q A;  1ZX6 A;  1M3C A;  5EC7 A;  3EG2 A;  2J05 A;  4LE9 A;  2DL7 A;  1SEM A;  1WI7 A;  1JXO A;  2DL8 A;  4AFS C;  3PVL A;  3QWY A;  2CUD A;  4F16 A;  2ED0 A;  2K79 A;  4IIO A;  2LMJ A;  3H0H A;  2GQI A;  1JU5 C;  2JW4 A;  4DEY A;  2HCK A;  5I22 A;  4OMO A;  2OI3 A;  1VA7 A;  1SPK A;  2X3X D;  4X1V A;  1VYU A;  2HEQ A;  1JQQ A;  5IHI A;  1PKT A;  1CSK A;  1PRL C;  1MV3 A;  3JV3 A;  1UHC A;  2PZ1 A;  2F2X A;  1NEB A;  1UTI A;  1WLP B;  2DM1 A;  2J7I A;  1YP5 A;  3UA7 A;  2QDL A;  2YT6 A;  4Z89 A;  1NYG A;  1HJD A;  1YN8 A;  4J9F A;  1ZUY A;  1H92 A;  5IHK A;  2BZY A;  2D8J A;  2LZ6 B;  3M0U A;  4ZNX A;  2K6D A;  2F2V A;  2K7A A;  1ZUK A;  1KIK A;  2DNU A;  2O9V A;  2KYM A;  2A08 A;  1BB9 A;  2VWF A;  4RTV A;  4OMP A;  1YWP A;  3ULR B;  1Z9Q A;  5FWC A;  2YDL A;  1MUZ A;  1KSW A;  2L3P A;  4RTY A;  1K76 A;  1H3H A;  4RTW A;  1TUD A;  2BTT A;  1X6B A;  4LN2 A;  4J9I A;  1LCK A;  3VS4 A;  2CH4 W;  1OPL A;  1E6H A;  1T0H A;  2MCN A;  2KBT A;  4AFQ C;  1T0J A;  2KNB B;  5IXB A;  2KXC A;  1AZE A;  1SHF A;  1I1J A;  2KRN A;  1UUE A;  2BZX A;  2CRE A;  1W70 A;  1X27 A;  2DL5 A;  2V1R A;  2C0I A;  3M0S A;  1EFN A;  2OJ2 A;  3RNJ A;  3KFV A;  2CDT A;  1WA7 A;  2LX7 A;  1GCQ C;  4CC3 A;  2IIM A;  1T3S A;  1U3O A;  2YUO A;  4OMN A;  2RN8 A;  1AVZ C;  3A98 A;  1RUW A;  4DEX A;  2AZV A;  2RQT A;  1QKW A;  2CSQ A;  3NMZ C;  1OEB A;  3VS2 A;  3I35 A;  2EGA A;  2FO0 A;  1RLP C;  4F14 A;  2LJ0 A;  2DLP A;  2OAW A;  4KRT A;  5I11 A;  2YUP A;  1UFF A;  4CC7 A;  5L23 A;  1AWJ A;  2LP5 A;  1X2K A;  1U06 A;  3EHR A;  3CQT A;  2DBM A;  4J9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...