4J9HA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph 8
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
b'DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9hA00
1AWJA 2JM8A 1OPLA 1AEYA 1VYVA 2J05A 2FO0A 2M0YA 4J9EA 1S1NA 4ESRA 3H0IA 5IHKA 2CSIA 1AZEA 2DL5A 2X3XD 3M0TA 5FWBA 4AFSC 2RN8A 4AG1C 4JJBA 1JXMA 1AVZC 1QCFA 3QWYA 3IQLA 2YSQA 4F17A 5IHNA 2GBQA 1UGVA 1BU1A 2LP5A 2KXCA 2EYYA 2FRWA 2VKNA 1B07A 1TUCA 3EHQA 1ZSGA 1NEGA 2AZSA 2C0OA 2MIOA 1ABQA 2LJ0A 2HCKA 5HCKA 3EHRA 1X2QA 1X6GA 1UDLA 4DEXA 1WI7A 3PVQA 2J6FA 3VS6A 2DL3A 1TUDA 4GLMA 3M0SA 2E5KA 2JS0A 4Y92A 2KT1A 4CC7A 2ABLA 2HSPA 1X43A 2ROLA 1PWTA 4AFUC 1X27A 2OI3A 2YDLA 1ABOA 1UFFA 1IO6A 1X2KA 1K76A 2F2WA 2GQIA 2CUDA 2YT6A 4M4ZA 4RTTA 1CKAA 2A36A 2GTJA 1OV3A 2O2OA 1MV3A 1OOTA 2EYZA 1BBZA 2YUPA 2FEIA 4D8DA 2EGCA 2KBTA 4RUGA 1AWWA 1VA7A 2DBMA 2LZ6B 1YNZA 4AG2C 2F2VA 2K2MA 1G2BA 4EIKA 2P4RA 1KIKA 2PZ1A 2RPNA 1VYUA 3UA7A 2BZYA 1UUEA 1U5SA 1UJ0A 4RTVA 2LQWA 4OMPA 1WX6A 1PRMC 3A98A 4J9HA 3UF4A 3VRZA 1E7OA 4LUDA 3QWXX 1YN8A 1YWPA 4JZ4A 3H41A 2CSQA 2X3WD 1K0XA 3PE0A 3NHNA 1ZBJA 5FW9A 4F14A 1TG0A 1WDXA 2O31A 2W0ZA 1JXOA 1ARKA 3NPFA 1ZUKA 3TSZA 1I0CA 4Z88A 1U06A 1AD5A 2GGRA 2RQTA 1NM7A 2O88A 3VS5A 3VRYA 2VWFA 1FYNA 3RBBB 2C0TA 1V1CA 3REAB 1QWFA 2DF6A 2K79A 2KT8A 2KRMA 3I5SA 4J9IA 4HVWA 4Z8AA 4LN2A 4IIOA 2EW3A 2OAWA 2CH4A 1W1FA 4K11A 1UE9A 2VVKA 3NMZC 1E6HA 4OMOA 1MUZA 2HBWA 4OMLA 2EQIA 2RMOA 1Z9QA 2LQNA 2O9VA 2A08A 3VS4A 2J06A 2NUZA 3PVLA 4HCKA 4LE9A 2DRMA 2F2XA 2D0NA 1E6GA 3SEMA 2YUQA 1SEMA 4X1VA 2SEMA 2NWMA 1I07A 2V1RA 2RQRA 2ECZA 3JV3A 2BZ8A 2DNUA 1J3TA 1QKXA 1GRIA 1UHCA 2IIMA 2JM9A 1HJDA 4CC2A 2MOXA 2D8HA 4F16A 3VS2A 1JQQA 3EG2A 2D8JA 5IXFA 1WIEA 2L3QA 1ZX6A 2W10A 1JO8A 3TVTA 1AWOA 4JZ3A 2LCSA 1UECA 1M3CA 2CH4W 2DRKA 2K6DA 1SHGA 2XMFA 2LNHB 4D8KA 3CQTA 2CT4A 4DEYA 1XOVA 3R6NA 1OEBA 1PHTA 2DX1A 1QKWA 1AOJA 2OJ2A 1SSHA 2AKKA 3VS3A 2A28A 2CUBA 1B3QA 1PKSA 2KR3A 3O5ZA 2YUOA 4JJCA 4HVVA 5I11A 2EYXA 2GNCA 3EG1A 2DBKA 2DLPA 2EPDA 3H0HA 1UJYA 2CDTA 4IIMA 1RI9A 2RF0A 2DVJA 1GCQA 1U3OA 5I22A 2EKHA 2RNAA 3VS7A 1NLOC 1RUWA 1WA7A 2DM1A 2JXBA 1A0NB 4OMMA 1T3LA 1JEGA 1GCQC 1Y0MA 3RNJA 3UATA 2BTTA 4LNPA 2O9SA 2ED1A 4OMNA 2PNIA 2L2PA 3EG0A 1GL5A 1M27C 1N5ZA 3KFVA 2DL7A 3EGUA 1WLPB 2MCNA 1NYGA 4GBQA 3ZL7C 2JMAA 4LUEA 1YP5A 2EGEA 2J6OA 1SHFA 2K7AA 1KJWA 3VS0A 2EGAA 4CC4B 2EBPA 1K1ZA 2DA9A 3H0FA 1I1JA 3EG3A 3M0PA 1T3SA 1Y57A 4RTUA 4RTYA 1JU5C 1YWOA 1M8MA 2DMOA 2RQWA 2ENMA 1VYTA 1GCPA 1EFNA 4HXJA 1AWXA 4J9BA 2FPEA 1LCKA 1PKTA 2LJ3A 2DL4A 3I9QA 4JJDA 1SRLA 2LMJA 4WCIA 2DL8A 1SRMA 2ESWA 2RQUA 5IH2A 4QT7A 4R0KA 2KXDA 1OPKA 2FRYA 4HVUA 2L3PA 2KYBA 2KEAA 2PTKA 1CKBA 1UHFA 1W70A 2LX7A 2EVRA 2G6FX 2KROA 2EYWA 4J9GA 2KRSA 1GFDA 2C0IA 2M51A 1X69A 1HD3A 1WXTA 3NGPA 1K9AA 3REBB 2YUNA 1M3AA 2JT4A 3THKA 1ZUYA 5GJVB 2QDLA 1H8KA 1WYXA 1NYFA 2K9GA 4Z89A 2KGTA 1K0SA 2FPFA 1NG2A 3GBQA 1WFWA 2A37A 2AK5A 3M0RA 2D1XA 2K3BA 4RTZA 1PRLC 1RLPC 2H8HA 5GJWB 4RTWA 2JTEA 2RQVA 1UG1A 1H3HA 2JW4A 2DE0X 3LH5A 1ZUUA 4KRTA 3VS1A 1QWEA 2KYMA 2DJQA 5EC7A 2DILA 1Z9ZA 2KE9A 2AKLA 2CREA 1W6XA 2L3SA 2V1QA 1HSQA 1WXBA 5ECAA 1GBQA 3I35A 1NLPC 4ORZA 5L23A 3TSWA 1K4US 1NEBA 1UTIA 2LJ1A 4J9DA 2BZXA 2GTOA 4AFZC 2J7IA 1GFCA 3M0UA 5IXBA 2DYBA 3UA6A 1SPKA 4CC3A 4OMQA 5FWCA 1X6BA 4RTXA 2KRNA 3C0CA 2B86A 2CT3A 1H92A 2FG0A 2JS2A 3SHWA 5IHIA 1QLYA 4JPBW 3U23A 2SRCA 1G83A 1CSKA 3I5RA 1PNJA 2FPDA 2AZVA 2HDAA 3ULRB 4A63B 1WXUA 1ZLMA 1KFZA 2HEQA 1M3BA 2L0AA 2J6KA 2I0NA 1YCSB 4J9CA 4ZNXA 4E6RA 4J9FA 2ROTA 1FMKA 2ED0A 1KSWA 4AFQC 4FSSA 1GBRA 1BK2A 3FJ5A 1T0JA 1AZGB 1BB9A 2JMCA 1RLQC 2KNBB 3M0QA 1T0HA 1MV0B 1M30A
chains in the Genus database with same CATH superfamily
1AWJA 4F7UB 2MF2A 1KD1R 1AEYA 3HFOA 1ZSZA 4PFOA 1KHCA 2JVVA 3G7ZA 3EGDB 4JS5A 4J6XA 2QTVA 4E7HA 1FMWA 1WJSA 3BY7A 3OS5A 4M75A 3CC7T 2PVOB 5IHNA 4MDWA 3G71Q 4C5IA 4M77B 1QVGP 3JCMX 1ZSGA 1ABQA 2LJ0A 1VQ7Q 3J7AF 5HY6A 2HCKA 5FU6C 3ME9A 4OP0A 1X2QA 4ME7A 1WI7A 2XU8A 2CZ7B 3S3OA 2RO0A 5KCHA 1VQ6Q 2H3EB 1UGQB 3MPUB 2JS0A 1GXIE 2ROLA 2K5IA 2YRVA 1KQ1A 5LJ3g 4M7DD 3LLRA 1K76A 2DXUA 4C8QE 4RTTA 1WHGA 3QO3A 3G71A 5CIUA 1UGSB 1TXQA 4XTYA 1BBZA 2DXTA 2YUPA 1YJWT 5GMKh 2LT4A 3CCST 2KBTA 2PQWA 4RUGA 1AWWA 3BE3A 2LZ6B 2XDBA 2ZAEA 1VQ7A 1YIJQ 4PKCC 1G2BA 2KQWA 3CMEA 4C0FA 3NTHA 3TCJA 1KG1A 5HK0A 3L1AA 1P92A 2RPNA 1VYUA 2DIGA 3UA7A 5GAOr 1U5SA 4C92D 3JB9G 3MEWA 3DB3A 3OS2A 3OYNA 1PRMC 3QHSA 1M2OA 2WSCE 3VRZA 5GANh 2RJEA 1YN8A 1X6OA 1YWPA 3G4ST 1N8RU 4BDYA 2X3WD 1YJNA 1NBEB 2LQ8A 1YI2A 2KI7A 4M78E 5GMKi 1JXOA 3V7CA 2I2LA 2E6ZA 4M77D 3HRUA 2GGRA 3P8HA 3P8DA 1JRIA 3VS5A 2NUPB 1OU9A 2WACA 3REAB 2BUDA 4J9IA 3EFRA 2HQEA 3N5BB 2IPOB 3CC4A 1B34A 1QVFS 5LJ5f 1E6HA 4OMOA 5LJ3f 1MUZA 2HBWA 1OX8A 2NUZA 4HCKA 5GMKj 2DRMA 4IUUA 3PGGA 3SEMA 3I55Q 4B6MA 1Q7YU 1SEMA 2SEMA 1RI0A 3MEVA 2RQRA 2QEXQ 3JV3A 1HYOA 3ZEHA 3G71T 2DNUA 1GRIA 1TSFA 1HJDA 2MOXA 5DY9A 5AT1B 4ZGDB 1RL2A 3EG2A 1VQ7T 5GANj 3TVTA 1JO8A 1MHNA 2XK0A 3HRTA 3CMET 4JRPA 3JB9H 3J81E 2DRKA 2K6DA 1SHGA 2XMFA 2LNHB 4NOYA 4M7AG 1PD0A 4QQDA 4DEYA 1XOVA 3R6NA 5LJ5d 3OY9A 4PJOE 5GAOm 5M9OA 4BDZA 4B9XA 3I55A 4C8QA 1SSHA 3VS3A 3A1PA 2CUBA 1G5VA 2L5QA 2KR3A 3JCMd 3O5ZA 1VQNA 3TREA 2QEXA 1YJNT 4JJCA 4HVVA 5LJ3e 5J39A 2QA4A 5KYYA 1YI2T 2EYXA 3DLLA 3LH0A 1NJIU 1VIEA 4QVDA 5FRNA 2V26A 3VYGA 1I5OB 2RF0A 4LDVA 1U3OA 2EKHA 2RNAA 3C12A 2DTHA 4E47A 1K73U 6AT1B 5D6WA 2DM1A 4R55A 2PVGB 3FRNA 2AIRB 3JRZA 4HT9A 3E19A 5FU6B 1G3YA 3QKJA 4KH0B 3OSSC 3OYIA 2HBPA 3RNJA 4LNPA 4VUBA 5GAMg 3CC4T 2HKQB 4RG8A 3V8JA 5GAN2 4ZTJA 3VUZA 3KFVA 3E9FA 4N0AC 1VQ5Q 1WLPB 3MEAA 3OYMA 4XTUA 4M78A 1KD1C 3CCEQ 4OB0B 2EGEA 2D6FA 5GAOn 4DBFA 2L89A 4CC4B 2E10A 2DA9A 2HAXA 5GAN6 4M78F 4MZMA 4QQGA 1T3SA 1EZZB 1WNLA 5DLOA 2RK1A 1JJ2S 5FRMA 1JU5C 2DMOA 2RM4A 4BI3A 1GCPA 3M53A 2F69A 3VYHB 5GAOq 4HXJA 4JJNK 4J9BA 2LJ3A 3Q1JA 3OYEA 4WCIA 3INZA 2XI9A 2RQUA 4KH1B 4M7DC 3TQ7P 4R0KA 3X20B 1OPKA 1VQ5A 4HVUA 1PSFA 1F1BB 2KEAA 2Z0WA 2PTKA 1UHFA 1D3BA 2EVRA 2R5AA 2EYWA 1GFDA 2C0IA 3OYYA 1HD3A 3REBB 2EJ9A 1BKBA 3I55T 1KC8U 3I56Q 1PM3A 3M57A 1H8KA 3VKIA 1M1KR 1VQNT 2QEXT 2FPFA 2V8JA 1WJQA 3EFSA 4C92E 4F7UE 3CCJA 1WFWA 2A37A 2LCLA 3BFMA 1KQSS 2E65A 2DIQA 3V8LA 1YITQ 2H8HA 2V8IA 3BDLA 2JTEA 4LDYA 1UG1A 1H3HA 2LTOA 3OBWA 3QZ9B 2YWWA 4PJOA 3V7RA 4X9CA 5EC7A 5GAMf 2DILA 1Z9ZA 1YFNA 2AKLA 2CREA 2V1QA 4ZTFA 2RHUA 3MP8A 1GBQA 4JRKA 4M77E 5L23A 1K4US 1NEBA 2FB7A 1UTIA 2DEUA 4J9DA 4PJOF 2CZ0B 2YHTA 2GTOA 3ASKA 1NPPA 4FIBA 2J7IA 1GFCA 3UA6A 2ZPBB 1SPKA 3CCLA 4OB3B 4X9DA 1BI1A 3UDCA 2KRNA 2B86A 2FG0A 2JS2A 2PVDB 3CPWA 3SHWA 5DM7R 3GNGA 1QLYA 4JPBW 3U23A 4LD9K 2VUBA 5CVIA 4R56A 1CSKA 2BE9B 3I5RA 2KSSA 2LT1A 2CZ1B 2ZPGB 5GAN3 1M3BA 1N27A 5HK3A 3E9GA 4OF1A 4E6RA 4J9FA 3OSVA 1TS9A 4DBRA 5GANd 1WJRA 2HSEB 4FSSA 4AFQC 5CKBA 4DBQA 2VGMA 1VQ5T 1AZGB 2ZPHB 4MMLA 1RLQC 1WHHA 1M4ZA 3CXCS 3CCET 1W2BA 2RK2A 3JCMP 4M7AC 1OPLA 5GAMe 1VYVA 2FO0A 2M0YA 3GNFB 3SFMA 1R8OB 1MNEA 5IHKA 2CSIA 3KBGA 4C0GA 1AZEA 1I5LA 2OAUA 2DL5A 1YCYA 1EIFA 2A3LA 3X28B 2NLUA 2Y4XA 4FT4A 2E64A 1ZSZC 2K2VA 3CCJT 3JB9F 2LP5A 3JSCA 2EYYA 3FIFA 2LDMA 1N6AA 1M2VB 1TUCA 3A8OB 3EGXB 2AZSA 1WHKA 1D1BA 5HCKA 4D6WA 4DEXA 4JRQA 5A0GA 1TUDA 7AT1B 2F1LA 2RI3A 3OYKA 3M0SA 2KT1A 5FU7C 2RJFA 2ABLA 5CCAA 4BI8B 1X43A 2OI3A 2MPXC 1MGQA 2DKGA 2E4HA 4M78G 1IO6A 3QYGB 4C92A 4N4HA 5LJ3h 4F7UA 2CUDA 5GAN8 4OVAA 2OTJQ 3OW2S 2COWA 2A36A 3GPLA 3SB2A 3EGDA 4O5VA 4D8DA 2DBMA 1BYMA 3ER0A 3JCMc 4AG2C 3FB9A 2F2VA 1ZA2B 3OS0A 2KDSA 3QJYA 2KAFA 4M77A 2L3RA 1I8FA 1TUGB 4PL6A 3R6OA 1D0YA 2BZYA 4M7DB 1UUEA 1MMNA 3X25B 2K5FA 2LQWA 4CI0C 1HXDA 4A53A 2DD5A 2P0QA 3A98A 1U1SA 1I81A 4PK4A 3UF4A 3OYGA 2X51A 1UB4A 4AMCA 3A8HB 3H41A 2X9HA 2CSQA 1NZ9A 4FYYB 2OTJA 1LOJA 5FW9A 1RAAB 2R58A 1TG0A 2GQVA 1RAIB 1M8VA 1IHVA 1ZQ1A 1ZUKA 3TSZA 2RHXA 1AD5A 2K5LA 3HTRA 1M1FA 4OB1B 2RQTA 2YLBA 3EFOB 3VRYA 3RBBB 1FYNA 4BY6C 4JUVA 2KT8A 4Z8AA 1VOMA 3P8BB 2X4XA 5LJ3j 4PJOG 3NMZC 4PNOA 1K9MR 4WF2A 1QVFP 1Z9QA 4XTVA 2O9VA 3HFNA 5KE2A 4M75F 1VQPQ 2QQAA 2JTFA 3MJXA 1M1KC 1G3SA 1I07A 2V1RA 5EG2A 2ECZA 2BZ8A 1J3TA 5LJ5g 2JM9A 1Q86R 3TEEA 3JCMb 2QK0A 2VASA 2D8JA 2XHCA 3JCMg 1ZX6A 3CPWP 4X34A 3PFSA 4JZ3A 2NUPA 1AWOA 1UECA 2DK3A 1M3CA 4ELZC 2RJCA 5CO7A 3HPWA 4D8KA 2CT4A 1OEBA 1PHTA 3M4GA 4M7AB 2E3HA 3M54A 1YJ9Q 4KUDK 1PC0A 1B3QA 5D7UA 1VQ6A 2CP6A 2OTJT 4XU3A 3FDRA 5I11A 3OYHA 2QTXA 1VIFA 3JB9J 2DLPA 3QSUA 1UJYA 4IIMA 3OYCA 1W2BP 2E70A 4J6WA 3CC2Q 3SWNC 4QVCA 3VS7A 1NLOC 4J5YA 1G8XA 3X26B 1R0CB 1I4K1 4OMMA 2V8KA 3RUXA 4IKFA 2COZA 2R57A 1O9SA 1S72Q 3RIRA 1KD1U 1Y0MA 4C0DC 1U1TA 1C6VX 1ZBXA 2ED1A 4JDSA 2PNIA 1GL5A 1M27C 1N5ZA 3M4YA 5FU7B 1YIJA 1YJ9A 1MMGA 2JMAA 4EMKC 3OYAA 2J6OA 1KJWA 3KXTA 3CCMQ 3VS0A 2EBPA 2CP2A 2CGHA 2DZ9A 1ZA1B 4HCBA 3CBPA 1N9RA 3H0FA 3CMAQ 1I1JA 2MMPA 4UC4A 2OTLQ 3CC2A 4F7UG 3GOXA 2P0PA 1HK9A 5I2SA 1NE8A 1BCMA 2OX7A 2RQWA 4E7SA 1UEBA 1VYTA 1AWXA 3LYIA 4A4GA 1PKTA 2DL4A 3JCMf 3I9QA 4XU1A 1D1CA 1SRMA 2XKOC 4EMHA 1U8RA 2XDDA 3E2UA 4M77G 1RACB 1OQKA 4JRIA 2KYBA 3HSBA 4M7AD 3AHUA 1CKBA 3CCMA 2E3IA 1BIAA 3PTAA 3E1SA 5GAN4 2GFUA 2KROA 2G6FX 3H8ZA 5GAOp 1VQLQ 1OX9A 3RMQA 1K9AA 2A0FB 2YUNA 2OTLA 1XTDA 3THKA 1ZUYA 3LW5E 5GJVB 2DERA 4GY5A 1NYFA 1H641 3MEUA 1VQ6T 4Z89A 1YHQQ 2DXCA 4BI4A 3GBQA 1N9SA 2EQKA 2VGNA 3PMTA 2AK5A 2LNVA 2DTIA 2DYIA 2K3BA 4E2FB 1G3WA 5CK9A 2MYSA 5GJWB 4BY6B 2E5QA 2QYZA 3OB9A 5LJ5e 2EFIA 3LH5A 1ZUUA 1MMDA 4KRTA 2KYMA 3VS1A 1VQ9Q 3JCMV 3OBYA 4C8QF 5CKDA 2L3SA 4NS5A 4IURA 3JCMe 1NLPC 1B7TA 1BCOA 3TSWA 4M75G 3T9NA 4PLLA 2VB6A 2BZXA 1YIJT 1YJ9T 1OZ3A 4AFZC 4XTXA 5IXBA 4RMOA 1YHQA 5CQXA 1KK7A 1TOVA 2QXFA 2SRCA 3L2VA 3CC2T 4L59A 2HDAA 2AZVA 4A63B 3PMIA 1XNIA 4CRIA 1Q82R 3H9NA 1RAEB 2CKKA 2I0NA 1YCSB 1OYXA 3RESA 1S72T 2ROTA 3CCQQ 1FMKA 2QASA 3TU4K 3A8MB 4RCCA 4NL2A 1KQ2A 2FZGB 3FJ5A 1T0JA 1K9MC 1MMAA 3G6EQ 2JMCA 5KYUB 2KNBB 2K3XA 1K8AR 3EG9B 3EH1A 4FM4B 3CCMT 2JM8A 4J9EA 4M7DE 4FT2A 4ESRA 3CXCP 1SG5A 2MWPA 2OTLT 5GMKl 2RHZA 2M1HA 4AFSC 3M0TA 4JJBA 1TU0B 1IHWA 3QWYA 2YSQA 3CCEA 4F17A 4XU2A 3RMSA 1Q86C 2G3RA 3SWNB 1X01A 5GAOl 2GBQA 2DVEA 3CCQA 2FRWA 2F5TX 1M9SA 3EHQA 3C95A 2C0OA 2CP0A 4EPCA 3G1JA 3EHRA 1X6GA 1UDLA 5KYXB 3PVQA 3VS6A 2AHJB 2DL3A 2GF7A 3CCVQ 4Y92A 2ZZDA 1RAHB 1IRXA 4EMKB 2YDLA 2DAQA 3QXEB 1QVFA 1X2KA 2ATCB 5GANf 2F2WA 4A4HA 3L2UA 2BE7D 1YHQT 4FSXA 2P4TA 2GTJA 1AHJB 1OV3A 2O2OA 3M55A 4ELYC 1O75A 1OOTA 2FEIA 1Y96B 4E7JA 1M5Q1 3I56A 4GLKA 3OW2P 1TWBA 4L6V5 4EIKA 1M2VA 4HKEA 2ZPIB 1D0ZA 3EGXA 3CCVA 4LDUA 2E41A 4RTVA 1SF9A 1YITA 2LX9A 3QUIA 2COYA 4J9HA 5A0DA 2ZGWA 5C6SA 2WSEE 1M90R 3RDVA 4JZ4A 3OA6A 4N0AA 1K0XA 3PE0A 3NHNA 2LVMA 4OGEA 3JCMJ 4F14A 2O31A 2X4JA 3NTIA 1ARKA 3A8LB 3S3NA 1I0CA 4Z88A 1U06A 4M7AE 1R77A 4O6JA 5GANe 1NM7A 2O88A 4E7IA 2R5MA 2VWFA 2C0TA 5IT9E 1V1CA 1UGRB 4OGCA 1RADB 1QWFA 3CCQT 2WSFE 3I5SA 4E7ZA 4C8QG 3OYBA 2NUTB 2O4XB 3RR6A 2OAWA 2PUOB 2CH4A 2LRQA 4K11A 1UE9A 2RD1A 2LC4A 4M7DA 4KGXB 2AT1B 5A0LA 2EQIA 2RMOA 2NYSA 4J6YA 1M1KU 2LQNA 2A08A 4DOVA 3VS4A 2J06A 3OS1A 3PVLA 4LE9A 2F2XA 1D1AA 4MMKA 2HNIA 4M7DF 4LDWA 1E6GA 4IUPA 4M75C 4M78D 2DTOA 1FMVA 1FWZA 4X1VA 4BUGA 1XJWB 3WVDB 2RJDA 2ZCFB 2QQRA 1UHCA 2IIMA 2JZ2A 2P84A 4PJMA 2D8HA 4ZGJB 1JQQA 3I56T 5LJ5h 4KULA 2W10A 3CBMA 3EFOA 3CEYA 2LCSA 1JJ2A 4FW2A 3JCMh 3CCVT 3CQTA 2PU9B 4C92F 1YJWQ 4F7UF 1YITT 3CCSQ 1SKUB 2CP3A 5KCOA 2DO3A 2A7YA 2RH2A 1BI2A 4WTOB 2A28A 2IG0A 2YUOA 2QG9B 1IGQA 4KUIA 2GNCA 2VV5A 2K3YA 3EG1A 2DBKA 2EAYA 1LNXA 2QDYB 3F70A 4XTZA 2XG8D 2FZKB 1RI9A 1QP2A 2FL7A 2DVJA 1GCQA 5I22A 1Q82C 4M77F 2HQXA 3RKYA 3LGFA 1WA7A 4DA4A 2JXBA 3G4SQ 2RB6A 2X35A 4J8OA 2H3JA 5KYWA 3MKDA 1RAFB 1VQ8Q 1JEGA 4KT0E 1KQSA 4PJJA 2BTTA 1WQWA 1QCNA 2O9SA 3LWIA 4PJOD 2L2PA 1K8AC 4HCCA 5GAN7 2DL7A 3EGUA 2MCNA 1NYGA 4FW1A 3GF5A 2K7AA 2LQKA 3OMCA 2EGAA 4RKUE 2HMAA 2EWNA 4B9WA 2EQMA 2X4YA 4M7AA 4E7LA 3PIPA 1PG5B 4V2SA 5LJ5j 3M0PA 1MNDA 4RTUA 1N8RR 1M8MA 5D6YA 2HQHA 3FEOA 3VV0A 4XK8E 1SRLA 2LMJA 1VQ8A 2DL8A 1WHLA 2E12A 2E6NA 2DD4A 2ESWA 3FC3A 2KXDA 3V8KA 3O8VA 4AT1B 3OQ5A 3HKSA 4QW2A 3CCRQ 4Q5WA 4FL6A 3QYHB 1W70A 5J3BA 4J9GA 4MZTA 2KRSA 4PJNA 3MO8A 3X24B 1X69A 5KYWB 2VXFA 4A54A 1M3AA 1JBMA 4BE1A 2HL3A 2KY9A 4FYVB 2QDLA 5KH6A 1WZOA 3CMEQ 4ZN3A 4A4EA 1QVPA 3CXCA 1K0SA 4XAXB 3JB9D 1RAGB 2FVUA 5I2MA 2XICA 2D1XA 1Q7YR 3RERA 1VQPA 3OYDA 3L2QA 4RTZA 4PFZA 3WXMB 1PRLC 1RLPC 2QQSA 3ZFJA 2RQVA 2O01E 2JW4A 3CCRA 2DJQA 1YJNQ 2DEQA 2QI2A 1W4SA 1YI2Q 2JOYA 1W6XA 2EIFA 4KGZB 1C0MA 4C8QC 5ECAA 3I35A 4ORZA 4N4IA 2EJGA 2LJ1A 1ZSZB 2XIDA 4KBMB 4M7DG 1M90C 4ZGEB 4N4GA 2CS7A 4QVZA 4F04B 2MAMA 2RHIA 3M0UA 3JCMW 4M75B 5FWCA 1X6BA 1Q81R 3FLGA 2CT3A 1H92A 2JJ9A 5I21A 3QPHA 1IB8A 2FYKA 1G83A 3H6ZA 4XU0A 3CC4Q 2E1HA 1PNJA 2ZPEB 2EQJA 2RI5A 2F5KA 1IREB 5FLXE 1WXUA 1ZLMA 1KFZA 1V76A 5GAMh 2J6KA 1NJIR 2MI6A 4NL3A 4ZNXA 3OW2A 4FYXB 1K9MU 2DFUA 3CBOA 4MZPA 1VQ8T 1KSWA 4C92G 1K73R 1QMCA 4M78C 4MDXA 4A4KA 1BB9A 1T0HA 4Z02A 1M30A 3M58A 5L8RE 2K4YA 4J7IA 1BI0A 2J05A 3EAEA 3JB9I 1S72A 1JJ2P 1S1NA 2CP7A 1QQJA 3H0IA 2KK4A 3NTKA 1Q86U 1VQOQ 2X3XD 5FWBA 1IGUA 2RN8A 4AG1C 3JCMQ 1JXMA 1D0XA 3L2RA 1AVZC 3M59A 1C1AA 4KGVB 1QCFA 4OB2B 3IQLA 4JLIA 1EX4A 2DZCA 1QVGS 3M5AA 1Y71A 3FJPA 3GLXA 1IXDA 1UGVA 2GCXA 1BU1A 4ZN1A 2KXCA 2VKNA 3OYFA 1VQPT 1B07A 1NEGA 3CMAA 2MIOA 3BDUA 4FYWB 1VQNQ 1FXXA 4L5GA 2J6FA 3CCRT 2YRDA 1OI1A 2CYZB 4GLMA 2QA4Q 3BW1A 3DLMA 2E5KA 1X75C 2DXBA 4CC7A 3CPWS 1QCOA 2KMTA 2HSPA 4M75D 1PWTA 4AFUC 1X27A 1UGPB 5KYUA 1VQOA 1ABOA 4II1A 1UFFA 3EG9A 1OZ2A 2HD0A 5GMKm 5GAMj 3GP8A 1KQSP 2GQIA 2HKNA 2YT6A 3M56A 4M4ZA 1PD1A 1CKAA 4BB7A 3CCUQ 1WQ7A 1MV3A 1KC8R 2EYZA 1JB0E 1VQLA 1Q81U 2EGCA 1VA7A 5A2QE 5LJ3d 2LCCA 1YNZA 2YLCA 1BI3A 2K2MA 3OMGA 4PJOC 3SWNA 2P4RA 1B34B 1W2BS 1KIKA 2EYQA 2PZ1A 2RA2A 1QW1A 5GANg 4FU6A 1UJ0A 3QIIA 4OMPA 3MP6A 5KYXA 1PSEA 1WX6A 1H3ZA 2IVWA 5KYNA 1E7OA 1D09B 4LUDA 3QWXX 3SDZA 3VUBA 4TVRA 2EJFA 3HL8A 1VQ9A 1ZBJA 3MP1A 4EMKA 3CCUA 9ATCB 2VC8A 1WDXA 2W0ZA 1N8RC 3NPFA 4IUTA 2C06A 2QQBA 3CD6Q 5HKCA 5AYFA 1FX7A 4Y91A 2P0KA 1Y96A 1V29B 1BIBA 2DF6A 2K79A 1RABB 2KRMA 4HVWA 3CMAT 3MHXA 1G3TA 4LN2A 4C5GA 4IIOA 4JS4A 2EW3A 3M9QA 4QQ6A 1W1FA 2VVKA 2B8AA 3PNWC 2QAZA 4C8QB 2RHYA 2D0QB 5CR2A 1VUBA 4OMLA 3CCJQ 2HZYA 1KHIA 4C0ZA 3V7SA 2D0NA 5KYYB 1VQOT 2XDPA 3LGLA 2YUQA 4RCBA 3CD6A 5GAN5 2NWMA 3G6EA 1VQ4Q 4C0DB 2YRCA 2JTMA 4EMGA 1QKXA 1Q7YC 4CC2A 1VQLT 2VXEA 3META 4DQ2A 4ANJA 4F16A 5DLQE 8ATCB 3C4SA 3VS2A 2D9TA 4BE0A 4YTLA 5J26A 5IXFA 1WIEA 2L3QA 4ATOA 2FHDA 8AT1B 3RKWA 1DJ7B 3CCLQ 1LVKA 2CH4W 2QA4T 2QGFB 1R0BG 2NUTA 2O4XA 4M78B 2HL5C 3QDFA 3WVEB 1QP3A 4HT8A 1QKWA 2DX1A 1AOJA 3L2ZA 2OJ2A 4C92C 1VQKQ 2AKKA 3HRSA 4IUQA 1PKSA 3A5ZB 2EKOA 3GIBA 1VQ4A 1QVGA 1Q81C 2BKDN 1VQ9T 1Q82U 4FCYA 4C5EA 3CCUT 2Y4YA 5D6XA 2EPDA 3H0HA 3DB4A 2CDTA 2GFAA 1PCXA 3JAME 2K57A 4Y28E 5GMKe 3ZBDA 4P5NA 4PLIA 1RUWA 4M77C 4DBHA 1NJIC 1TH7A 1A0NB 3QDRB 3UPUA 1K8AU 4DOWA 2JN0A 4C8QD 1OULA 1T3LA 1K73C 3PT9A 1GCQC 3S3MA 3UATA 1D3BB 3LWHA 4OMNA 1VQKA 3EG0A 4QKUA 2CP5A 2JNGA 2BIVA 1AT1B 4LDXA 1VQMQ 4GBQA 3HHTB 3ZL7C 4LUEA 4XQ3A 3NFCA 3A8GB 1YP5A 4BD3A 1SHFA 3UT1A 3VU3C 1K1ZA 2XD0A 3PIOA 1WHJA 4C5HA 3EG3A 3J80E 1M1GA 1Y57A 4EDUA 5GAMd 4RTYA 5CKEA 3CD6T 2M0OA 3G6ET 3CC7Q 1YWOA 3L42A 2ENMA 4BE2A 4RG2A 1EFNA 3OYJA 3D7SB 2FPEA 4M75E 1LCKA 3URGA 3QBYA 4JJDA 4PJOB 3SD4A 3VJPA 5IH2A 4QT7A 2DETA 3S6WA 2YXYA 2FRYA 1Y7XA 1VQMA 2L3PA 4HA8A 3QG1A 2LX7A 4E7KA 2FZCB 4HCZA 1ACMB 2M51A 1WXTA 3NGPA 2JT4A 2RI2A 1WHMA 2M9UA 5CAIA 1WYXA 4A4FA 1VQ4T 3OYLA 2K9GA 5IAYA 3CC7A 3KUFA 2KGTA 5LL6S 1KC8C 1NG2A 4XTWA 1Q95G 3LX7A 1TTHB 1ZHIA 3M0RA 2VYTA 1LPLA 4J83A 5KE3A 5CKHA 3C94A 2Y90A 3QJ6A 4RTWA 2DPPB 1YBYA 2DE0X 4IUVA 2PUKB 3CCLT 1QWEA 2EQUA 2X4WA 2M02A 1M90U 4PFPA 2KE9A 2MWOA 3CPFA 1HSQA 1WXBA 1VQKT 5CKFA 4JLGA 2JUFA 1SSFA 2DYBA 4CC3A 2M16A 2KVQG 2QQ9A 4OMQA 1Y07A 4RTXA 3HP9A 3AT1B 2MK5A 3C0CA 5C0MA 4LD6A 5IHIA 3QZ5B 1YJWA 2ZPFB 3CCSA 2QGGA 3EH2A 1OU8A 1LJOA 5IN1A 2FPDA 5FROA 3ULRB 1XQHA 5CQYA 4J7FA 4BACA 2HEQA 1NPRA 2L0AA 2L8DA 2CZ6B 4OMFB 4J9CA 4PJLA 1IZ6A 1WPYA 2ED0A 4LXCA 3MCAB 3UWNA 1WGSA 3DKMA 1GBRA 1BK2A 2DJZA 3L2WA 1VQMT 3M0QA 4M7AF 3G4SA 1MV0B 3RKXA 4C92B
chains in the Genus database with same CATH topology
1AWJA 2JM8A 1OPLA 1AEYA 1VYVA 2J05A 2FO0A 2M0YA 4J9EA 1S1NA 4ESRA 3H0IA 5IHKA 2CSIA 1AZEA 2DL5A 2X3XD 3M0TA 5FWBA 4AFSC 2RN8A 4AG1C 4JJBA 1JXMA 1AVZC 1QCFA 3QWYA 3IQLA 2YSQA 4F17A 5IHNA 2GBQA 1UGVA 1BU1A 2LP5A 2KXCA 2EYYA 2FRWA 2VKNA 1B07A 1TUCA 3EHQA 1ZSGA 1NEGA 2AZSA 2C0OA 2MIOA 1ABQA 2LJ0A 2HCKA 5HCKA 3EHRA 1X2QA 1X6GA 1UDLA 4DEXA 1WI7A 3PVQA 2J6FA 3VS6A 2DL3A 1TUDA 4GLMA 3M0SA 2E5KA 2JS0A 4Y92A 2KT1A 4CC7A 2ABLA 2HSPA 1X43A 2ROLA 1PWTA 4AFUC 1X27A 2OI3A 2YDLA 1ABOA 1UFFA 1IO6A 1X2KA 1K76A 2F2WA 2GQIA 2CUDA 2YT6A 4M4ZA 4RTTA 1CKAA 2A36A 2GTJA 1OV3A 2O2OA 1MV3A 1OOTA 2EYZA 1BBZA 2YUPA 2FEIA 4D8DA 2EGCA 2KBTA 4RUGA 1AWWA 1VA7A 2DBMA 2LZ6B 1YNZA 4AG2C 2F2VA 2K2MA 1G2BA 4EIKA 2P4RA 1KIKA 2PZ1A 2RPNA 1VYUA 3UA7A 2BZYA 1UUEA 1U5SA 1UJ0A 4RTVA 2LQWA 4OMPA 1WX6A 1PRMC 3A98A 4J9HA 3UF4A 3VRZA 1E7OA 4LUDA 3QWXX 1YN8A 1YWPA 4JZ4A 3H41A 2CSQA 2X3WD 1K0XA 3PE0A 3NHNA 1ZBJA 5FW9A 4F14A 1TG0A 1WDXA 2O31A 2W0ZA 1JXOA 1ARKA 3NPFA 1ZUKA 3TSZA 1I0CA 4Z88A 1U06A 1AD5A 2GGRA 2RQTA 1NM7A 2O88A 3VS5A 3VRYA 2VWFA 1FYNA 3RBBB 2C0TA 1V1CA 3REAB 1QWFA 2DF6A 2K79A 2KT8A 2KRMA 3I5SA 4J9IA 4HVWA 4Z8AA 4LN2A 4IIOA 2EW3A 2OAWA 2CH4A 1W1FA 4K11A 1UE9A 2VVKA 3NMZC 1E6HA 4OMOA 1MUZA 2HBWA 4OMLA 2EQIA 2RMOA 1Z9QA 2LQNA 2O9VA 2A08A 3VS4A 2J06A 2NUZA 3PVLA 4HCKA 4LE9A 2DRMA 2F2XA 2D0NA 1E6GA 3SEMA 2YUQA 1SEMA 4X1VA 2SEMA 2NWMA 1I07A 2V1RA 2RQRA 2ECZA 3JV3A 2BZ8A 2DNUA 1J3TA 1QKXA 1GRIA 1UHCA 2IIMA 2JM9A 1HJDA 4CC2A 2MOXA 2D8HA 4F16A 3VS2A 1JQQA 3EG2A 2D8JA 5IXFA 1WIEA 2L3QA 1ZX6A 2W10A 1JO8A 3TVTA 1AWOA 4JZ3A 2LCSA 1UECA 1M3CA 2CH4W 2DRKA 2K6DA 1SHGA 2XMFA 2LNHB 4D8KA 3CQTA 2CT4A 4DEYA 1XOVA 3R6NA 1OEBA 1PHTA 2DX1A 1QKWA 1AOJA 2OJ2A 1SSHA 2AKKA 3VS3A 2A28A 2CUBA 1B3QA 1PKSA 2KR3A 3O5ZA 2YUOA 4JJCA 4HVVA 5I11A 2EYXA 2GNCA 3EG1A 2DBKA 2DLPA 2EPDA 3H0HA 1UJYA 2CDTA 4IIMA 1RI9A 2RF0A 2DVJA 1GCQA 1U3OA 5I22A 2EKHA 2RNAA 3VS7A 1NLOC 1RUWA 1WA7A 2DM1A 2JXBA 1A0NB 4OMMA 1T3LA 1JEGA 1GCQC 1Y0MA 3RNJA 3UATA 2BTTA 4LNPA 2O9SA 2ED1A 4OMNA 2PNIA 2L2PA 3EG0A 1GL5A 1M27C 1N5ZA 3KFVA 2DL7A 3EGUA 1WLPB 2MCNA 1NYGA 4GBQA 3ZL7C 2JMAA 4LUEA 1YP5A 2EGEA 2J6OA 1SHFA 2K7AA 1KJWA 3VS0A 2EGAA 4CC4B 2EBPA 1K1ZA 2DA9A 3H0FA 1I1JA 3EG3A 3M0PA 1T3SA 1Y57A 4RTUA 4RTYA 1JU5C 1YWOA 1M8MA 2DMOA 2RQWA 2ENMA 1VYTA 1GCPA 1EFNA 4HXJA 1AWXA 4J9BA 2FPEA 1LCKA 1PKTA 2LJ3A 2DL4A 3I9QA 4JJDA 1SRLA 2LMJA 4WCIA 2DL8A 1SRMA 2ESWA 2RQUA 5IH2A 4QT7A 4R0KA 2KXDA 1OPKA 2FRYA 4HVUA 2L3PA 2KYBA 2KEAA 2PTKA 1CKBA 1UHFA 1W70A 2LX7A 2EVRA 2G6FX 2KROA 2EYWA 4J9GA 2KRSA 1GFDA 2C0IA 2M51A 1X69A 1HD3A 1WXTA 3NGPA 1K9AA 3REBB 2YUNA 1M3AA 2JT4A 3THKA 1ZUYA 5GJVB 2QDLA 1H8KA 1WYXA 1NYFA 2K9GA 4Z89A 2KGTA 1K0SA 2FPFA 1NG2A 3GBQA 1WFWA 2A37A 2AK5A 3M0RA 2D1XA 2K3BA 4RTZA 1PRLC 1RLPC 2H8HA 5GJWB 4RTWA 2JTEA 2RQVA 1UG1A 1H3HA 2JW4A 2DE0X 3LH5A 1ZUUA 4KRTA 3VS1A 1QWEA 2KYMA 2DJQA 5EC7A 2DILA 1Z9ZA 2KE9A 2AKLA 2CREA 1W6XA 2L3SA 2V1QA 1HSQA 1WXBA 5ECAA 1GBQA 3I35A 1NLPC 4ORZA 5L23A 3TSWA 1K4US 1NEBA 1UTIA 2LJ1A 4J9DA 2BZXA 2GTOA 4AFZC 2J7IA 1GFCA 3M0UA 5IXBA 2DYBA 3UA6A 1SPKA 4CC3A 4OMQA 5FWCA 1X6BA 4RTXA 2KRNA 3C0CA 2B86A 2CT3A 1H92A 2FG0A 2JS2A 3SHWA 5IHIA 1QLYA 4JPBW 3U23A 2SRCA 1G83A 1CSKA 3I5RA 1PNJA 2FPDA 2AZVA 2HDAA 3ULRB 4A63B 1WXUA 1ZLMA 1KFZA 2HEQA 1M3BA 2L0AA 2J6KA 2I0NA 1YCSB 4J9CA 4ZNXA 4E6RA 4J9FA 2ROTA 1FMKA 2ED0A 1KSWA 4AFQC 4FSSA 1GBRA 1BK2A 3FJ5A 1T0JA 1AZGB 1BB9A 2JMCA 1RLQC 2KNBB 3M0QA 1T0HA 1MV0B 1M30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWJ A;  2JM8 A;  1OPL A;  1AEY A;  1VYV A;  2J05 A;  2FO0 A;  2M0Y A;  4J9E A;  1S1N A;  4ESR A;  3H0I A;  5IHK A;  2CSI A;  1AZE A;  2DL5 A;  2X3X D;  3M0T A;  5FWB A;  4AFS C;  2RN8 A;  4AG1 C;  4JJB A;  1JXM A;  1AVZ C;  1QCF A;  3QWY A;  3IQL A;  2YSQ A;  4F17 A;  5IHN A;  2GBQ A;  1UGV A;  1BU1 A;  2LP5 A;  2KXC A;  2EYY A;  2FRW A;  2VKN A;  1B07 A;  1TUC A;  3EHQ A;  1ZSG A;  1NEG A;  2AZS A;  2C0O A;  2MIO A;  1ABQ A;  2LJ0 A;  2HCK A;  5HCK A;  3EHR A;  1X2Q A;  1X6G A;  1UDL A;  4DEX A;  1WI7 A;  3PVQ A;  2J6F A;  3VS6 A;  2DL3 A;  1TUD A;  4GLM A;  3M0S A;  2E5K A;  2JS0 A;  4Y92 A;  2KT1 A;  4CC7 A;  2ABL A;  2HSP A;  1X43 A;  2ROL A;  1PWT A;  4AFU C;  1X27 A;  2OI3 A;  2YDL A;  1ABO A;  1UFF A;  1IO6 A;  1X2K A;  1K76 A;  2F2W A;  2GQI A;  2CUD A;  2YT6 A;  4M4Z A;  4RTT A;  1CKA A;  2A36 A;  2GTJ A;  1OV3 A;  2O2O A;  1MV3 A;  1OOT A;  2EYZ A;  1BBZ A;  2YUP A;  2FEI A;  4D8D A;  2EGC A;  2KBT A;  4RUG A;  1AWW A;  1VA7 A;  2DBM A;  2LZ6 B;  1YNZ A;  4AG2 C;  2F2V A;  2K2M A;  1G2B A;  4EIK A;  2P4R A;  1KIK A;  2PZ1 A;  2RPN A;  1VYU A;  3UA7 A;  2BZY A;  1UUE A;  1U5S A;  1UJ0 A;  4RTV A;  2LQW A;  4OMP A;  1WX6 A;  1PRM C;  3A98 A;  4J9H A;  3UF4 A;  3VRZ A;  1E7O A;  4LUD A;  3QWX X;  1YN8 A;  1YWP A;  4JZ4 A;  3H41 A;  2CSQ A;  2X3W D;  1K0X A;  3PE0 A;  3NHN A;  1ZBJ A;  5FW9 A;  4F14 A;  1TG0 A;  1WDX A;  2O31 A;  2W0Z A;  1JXO A;  1ARK A;  3NPF A;  1ZUK A;  3TSZ A;  1I0C A;  4Z88 A;  1U06 A;  1AD5 A;  2GGR A;  2RQT A;  1NM7 A;  2O88 A;  3VS5 A;  3VRY A;  2VWF A;  1FYN A;  3RBB B;  2C0T A;  1V1C A;  3REA B;  1QWF A;  2DF6 A;  2K79 A;  2KT8 A;  2KRM A;  3I5S A;  4J9I A;  4HVW A;  4Z8A A;  4LN2 A;  4IIO A;  2EW3 A;  2OAW A;  2CH4 A;  1W1F A;  4K11 A;  1UE9 A;  2VVK A;  3NMZ C;  1E6H A;  4OMO A;  1MUZ A;  2HBW A;  4OML A;  2EQI A;  2RMO A;  1Z9Q A;  2LQN A;  2O9V A;  2A08 A;  3VS4 A;  2J06 A;  2NUZ A;  3PVL A;  4HCK A;  4LE9 A;  2DRM A;  2F2X A;  2D0N A;  1E6G A;  3SEM A;  2YUQ A;  1SEM A;  4X1V A;  2SEM A;  2NWM A;  1I07 A;  2V1R A;  2RQR A;  2ECZ A;  3JV3 A;  2BZ8 A;  2DNU A;  1J3T A;  1QKX A;  1GRI A;  1UHC A;  2IIM A;  2JM9 A;  1HJD A;  4CC2 A;  2MOX A;  2D8H A;  4F16 A;  3VS2 A;  1JQQ A;  3EG2 A;  2D8J A;  5IXF A;  1WIE A;  2L3Q A;  1ZX6 A;  2W10 A;  1JO8 A;  3TVT A;  1AWO A;  4JZ3 A;  2LCS A;  1UEC A;  1M3C A;  2CH4 W;  2DRK A;  2K6D A;  1SHG A;  2XMF A;  2LNH B;  4D8K A;  3CQT A;  2CT4 A;  4DEY A;  1XOV A;  3R6N A;  1OEB A;  1PHT A;  2DX1 A;  1QKW A;  1AOJ A;  2OJ2 A;  1SSH A;  2AKK A;  3VS3 A;  2A28 A;  2CUB A;  1B3Q A;  1PKS A;  2KR3 A;  3O5Z A;  2YUO A;  4JJC A;  4HVV A;  5I11 A;  2EYX A;  2GNC A;  3EG1 A;  2DBK A;  2DLP A;  2EPD A;  3H0H A;  1UJY A;  2CDT A;  4IIM A;  1RI9 A;  2RF0 A;  2DVJ A;  1GCQ A;  1U3O A;  5I22 A;  2EKH A;  2RNA A;  3VS7 A;  1NLO C;  1RUW A;  1WA7 A;  2DM1 A;  2JXB A;  1A0N B;  4OMM A;  1T3L A;  1JEG A;  1GCQ C;  1Y0M A;  3RNJ A;  3UAT A;  2BTT A;  4LNP A;  2O9S A;  2ED1 A;  4OMN A;  2PNI A;  2L2P A;  3EG0 A;  1GL5 A;  1M27 C;  1N5Z A;  3KFV A;  2DL7 A;  3EGU A;  1WLP B;  2MCN A;  1NYG A;  4GBQ A;  3ZL7 C;  2JMA A;  4LUE A;  1YP5 A;  2EGE A;  2J6O A;  1SHF A;  2K7A A;  1KJW A;  3VS0 A;  2EGA A;  4CC4 B;  2EBP A;  1K1Z A;  2DA9 A;  3H0F A;  1I1J A;  3EG3 A;  3M0P A;  1T3S A;  1Y57 A;  4RTU A;  4RTY A;  1JU5 C;  1YWO A;  1M8M A;  2DMO A;  2RQW A;  2ENM A;  1VYT A;  1GCP A;  1EFN A;  4HXJ A;  1AWX A;  4J9B A;  2FPE A;  1LCK A;  1PKT A;  2LJ3 A;  2DL4 A;  3I9Q A;  4JJD A;  1SRL A;  2LMJ A;  4WCI A;  2DL8 A;  1SRM A;  2ESW A;  2RQU A;  5IH2 A;  4QT7 A;  4R0K A;  2KXD A;  1OPK A;  2FRY A;  4HVU A;  2L3P A;  2KYB A;  2KEA A;  2PTK A;  1CKB A;  1UHF A;  1W70 A;  2LX7 A;  2EVR A;  2G6F X;  2KRO A;  2EYW A;  4J9G A;  2KRS A;  1GFD A;  2C0I A;  2M51 A;  1X69 A;  1HD3 A;  1WXT A;  3NGP A;  1K9A A;  3REB B;  2YUN A;  1M3A A;  2JT4 A;  3THK A;  1ZUY A;  5GJV B;  2QDL A;  1H8K A;  1WYX A;  1NYF A;  2K9G A;  4Z89 A;  2KGT A;  1K0S A;  2FPF A;  1NG2 A;  3GBQ A;  1WFW A;  2A37 A;  2AK5 A;  3M0R A;  2D1X A;  2K3B A;  4RTZ A;  1PRL C;  1RLP C;  2H8H A;  5GJW B;  4RTW A;  2JTE A;  2RQV A;  1UG1 A;  1H3H A;  2JW4 A;  2DE0 X;  3LH5 A;  1ZUU A;  4KRT A;  3VS1 A;  1QWE A;  2KYM A;  2DJQ A;  5EC7 A;  2DIL A;  1Z9Z A;  2KE9 A;  2AKL A;  2CRE A;  1W6X A;  2L3S A;  2V1Q A;  1HSQ A;  1WXB A;  5ECA A;  1GBQ A;  3I35 A;  1NLP C;  4ORZ A;  5L23 A;  3TSW A;  1K4U S;  1NEB A;  1UTI A;  2LJ1 A;  4J9D A;  2BZX A;  2GTO A;  4AFZ C;  2J7I A;  1GFC A;  3M0U A;  5IXB A;  2DYB A;  3UA6 A;  1SPK A;  4CC3 A;  4OMQ A;  5FWC A;  1X6B A;  4RTX A;  2KRN A;  3C0C A;  2B86 A;  2CT3 A;  1H92 A;  2FG0 A;  2JS2 A;  3SHW A;  5IHI A;  1QLY A;  4JPB W;  3U23 A;  2SRC A;  1G83 A;  1CSK A;  3I5R A;  1PNJ A;  2FPD A;  2AZV A;  2HDA A;  3ULR B;  4A63 B;  1WXU A;  1ZLM A;  1KFZ A;  2HEQ A;  1M3B A;  2L0A A;  2J6K A;  2I0N A;  1YCS B;  4J9C A;  4ZNX A;  4E6R A;  4J9F A;  2ROT A;  1FMK A;  2ED0 A;  1KSW A;  4AFQ C;  4FSS A;  1GBR A;  1BK2 A;  3FJ5 A;  1T0J A;  1AZG B;  1BB9 A;  2JMC A;  1RLQ C;  2KNB B;  3M0Q A;  1T0H A;  1MV0 B;  1M30 A; 
#chains in the Genus database with same CATH topology
 1AWJ A;  4F7U B;  2MF2 A;  1KD1 R;  1AEY A;  3HFO A;  1ZSZ A;  4PFO A;  1KHC A;  2JVV A;  3G7Z A;  3EGD B;  4JS5 A;  4J6X A;  2QTV A;  4E7H A;  1FMW A;  1WJS A;  3BY7 A;  3OS5 A;  4M75 A;  3CC7 T;  2PVO B;  5IHN A;  4MDW A;  3G71 Q;  4C5I A;  4M77 B;  1QVG P;  3JCM X;  1ZSG A;  1ABQ A;  2LJ0 A;  1VQ7 Q;  3J7A F;  5HY6 A;  2HCK A;  5FU6 C;  3ME9 A;  4OP0 A;  1X2Q A;  4ME7 A;  1WI7 A;  2XU8 A;  2CZ7 B;  3S3O A;  2RO0 A;  5KCH A;  1VQ6 Q;  2H3E B;  1UGQ B;  3MPU B;  2JS0 A;  1GXI E;  2ROL A;  2K5I A;  2YRV A;  1KQ1 A;  5LJ3 g;  4M7D D;  3LLR A;  1K76 A;  2DXU A;  4C8Q E;  4RTT A;  1WHG A;  3QO3 A;  3G71 A;  5CIU A;  1UGS B;  1TXQ A;  4XTY A;  1BBZ A;  2DXT A;  2YUP A;  1YJW T;  5GMK h;  2LT4 A;  3CCS T;  2KBT A;  2PQW A;  4RUG A;  1AWW A;  3BE3 A;  2LZ6 B;  2XDB A;  2ZAE A;  1VQ7 A;  1YIJ Q;  4PKC C;  1G2B A;  2KQW A;  3CME A;  4C0F A;  3NTH A;  3TCJ A;  1KG1 A;  5HK0 A;  3L1A A;  1P92 A;  2RPN A;  1VYU A;  2DIG A;  3UA7 A;  5GAO r;  1U5S A;  4C92 D;  3JB9 G;  3MEW A;  3DB3 A;  3OS2 A;  3OYN A;  1PRM C;  3QHS A;  1M2O A;  2WSC E;  3VRZ A;  5GAN h;  2RJE A;  1YN8 A;  1X6O A;  1YWP A;  3G4S T;  1N8R U;  4BDY A;  2X3W D;  1YJN A;  1NBE B;  2LQ8 A;  1YI2 A;  2KI7 A;  4M78 E;  5GMK i;  1JXO A;  3V7C A;  2I2L A;  2E6Z A;  4M77 D;  3HRU A;  2GGR A;  3P8H A;  3P8D A;  1JRI A;  3VS5 A;  2NUP B;  1OU9 A;  2WAC A;  3REA B;  2BUD A;  4J9I A;  3EFR A;  2HQE A;  3N5B B;  2IPO B;  3CC4 A;  1B34 A;  1QVF S;  5LJ5 f;  1E6H A;  4OMO A;  5LJ3 f;  1MUZ A;  2HBW A;  1OX8 A;  2NUZ A;  4HCK A;  5GMK j;  2DRM A;  4IUU A;  3PGG A;  3SEM A;  3I55 Q;  4B6M A;  1Q7Y U;  1SEM A;  2SEM A;  1RI0 A;  3MEV A;  2RQR A;  2QEX Q;  3JV3 A;  1HYO A;  3ZEH A;  3G71 T;  2DNU A;  1GRI A;  1TSF A;  1HJD A;  2MOX A;  5DY9 A;  5AT1 B;  4ZGD B;  1RL2 A;  3EG2 A;  1VQ7 T;  5GAN j;  3TVT A;  1JO8 A;  1MHN A;  2XK0 A;  3HRT A;  3CME T;  4JRP A;  3JB9 H;  3J81 E;  2DRK A;  2K6D A;  1SHG A;  2XMF A;  2LNH B;  4NOY A;  4M7A G;  1PD0 A;  4QQD A;  4DEY A;  1XOV A;  3R6N A;  5LJ5 d;  3OY9 A;  4PJO E;  5GAO m;  5M9O A;  4BDZ A;  4B9X A;  3I55 A;  4C8Q A;  1SSH A;  3VS3 A;  3A1P A;  2CUB A;  1G5V A;  2L5Q A;  2KR3 A;  3JCM d;  3O5Z A;  1VQN A;  3TRE A;  2QEX A;  1YJN T;  4JJC A;  4HVV A;  5LJ3 e;  5J39 A;  2QA4 A;  5KYY A;  1YI2 T;  2EYX A;  3DLL A;  3LH0 A;  1NJI U;  1VIE A;  4QVD A;  5FRN A;  2V26 A;  3VYG A;  1I5O B;  2RF0 A;  4LDV A;  1U3O A;  2EKH A;  2RNA A;  3C12 A;  2DTH A;  4E47 A;  1K73 U;  6AT1 B;  5D6W A;  2DM1 A;  4R55 A;  2PVG B;  3FRN A;  2AIR B;  3JRZ A;  4HT9 A;  3E19 A;  5FU6 B;  1G3Y A;  3QKJ A;  4KH0 B;  3OSS C;  3OYI A;  2HBP A;  3RNJ A;  4LNP A;  4VUB A;  5GAM g;  3CC4 T;  2HKQ B;  4RG8 A;  3V8J A;  5GAN 2;  4ZTJ A;  3VUZ A;  3KFV A;  3E9F A;  4N0A C;  1VQ5 Q;  1WLP B;  3MEA A;  3OYM A;  4XTU A;  4M78 A;  1KD1 C;  3CCE Q;  4OB0 B;  2EGE A;  2D6F A;  5GAO n;  4DBF A;  2L89 A;  4CC4 B;  2E10 A;  2DA9 A;  2HAX A;  5GAN 6;  4M78 F;  4MZM A;  4QQG A;  1T3S A;  1EZZ B;  1WNL A;  5DLO A;  2RK1 A;  1JJ2 S;  5FRM A;  1JU5 C;  2DMO A;  2RM4 A;  4BI3 A;  1GCP A;  3M53 A;  2F69 A;  3VYH B;  5GAO q;  4HXJ A;  4JJN K;  4J9B A;  2LJ3 A;  3Q1J A;  3OYE A;  4WCI A;  3INZ A;  2XI9 A;  2RQU A;  4KH1 B;  4M7D C;  3TQ7 P;  4R0K A;  3X20 B;  1OPK A;  1VQ5 A;  4HVU A;  1PSF A;  1F1B B;  2KEA A;  2Z0W A;  2PTK A;  1UHF A;  1D3B A;  2EVR A;  2R5A A;  2EYW A;  1GFD A;  2C0I A;  3OYY A;  1HD3 A;  3REB B;  2EJ9 A;  1BKB A;  3I55 T;  1KC8 U;  3I56 Q;  1PM3 A;  3M57 A;  1H8K A;  3VKI A;  1M1K R;  1VQN T;  2QEX T;  2FPF A;  2V8J A;  1WJQ A;  3EFS A;  4C92 E;  4F7U E;  3CCJ A;  1WFW A;  2A37 A;  2LCL A;  3BFM A;  1KQS S;  2E65 A;  2DIQ A;  3V8L A;  1YIT Q;  2H8H A;  2V8I A;  3BDL A;  2JTE A;  4LDY A;  1UG1 A;  1H3H A;  2LTO A;  3OBW A;  3QZ9 B;  2YWW A;  4PJO A;  3V7R A;  4X9C A;  5EC7 A;  5GAM f;  2DIL A;  1Z9Z A;  1YFN A;  2AKL A;  2CRE A;  2V1Q A;  4ZTF A;  2RHU A;  3MP8 A;  1GBQ A;  4JRK A;  4M77 E;  5L23 A;  1K4U S;  1NEB A;  2FB7 A;  1UTI A;  2DEU A;  4J9D A;  4PJO F;  2CZ0 B;  2YHT A;  2GTO A;  3ASK A;  1NPP A;  4FIB A;  2J7I A;  1GFC A;  3UA6 A;  2ZPB B;  1SPK A;  3CCL A;  4OB3 B;  4X9D A;  1BI1 A;  3UDC A;  2KRN A;  2B86 A;  2FG0 A;  2JS2 A;  2PVD B;  3CPW A;  3SHW A;  5DM7 R;  3GNG A;  1QLY A;  4JPB W;  3U23 A;  4LD9 K;  2VUB A;  5CVI A;  4R56 A;  1CSK A;  2BE9 B;  3I5R A;  2KSS A;  2LT1 A;  2CZ1 B;  2ZPG B;  5GAN 3;  1M3B A;  1N27 A;  5HK3 A;  3E9G A;  4OF1 A;  4E6R A;  4J9F A;  3OSV A;  1TS9 A;  4DBR A;  5GAN d;  1WJR A;  2HSE B;  4FSS A;  4AFQ C;  5CKB A;  4DBQ A;  2VGM A;  1VQ5 T;  1AZG B;  2ZPH B;  4MML A;  1RLQ C;  1WHH A;  1M4Z A;  3CXC S;  3CCE T;  1W2B A;  2RK2 A;  3JCM P;  4M7A C;  1OPL A;  5GAM e;  1VYV A;  2FO0 A;  2M0Y A;  3GNF B;  3SFM A;  1R8O B;  1MNE A;  5IHK A;  2CSI A;  3KBG A;  4C0G A;  1AZE A;  1I5L A;  2OAU A;  2DL5 A;  1YCY A;  1EIF A;  2A3L A;  3X28 B;  2NLU A;  2Y4X A;  4FT4 A;  2E64 A;  1ZSZ C;  2K2V A;  3CCJ T;  3JB9 F;  2LP5 A;  3JSC A;  2EYY A;  3FIF A;  2LDM A;  1N6A A;  1M2V B;  1TUC A;  3A8O B;  3EGX B;  2AZS A;  1WHK A;  1D1B A;  5HCK A;  4D6W A;  4DEX A;  4JRQ A;  5A0G A;  1TUD A;  7AT1 B;  2F1L A;  2RI3 A;  3OYK A;  3M0S A;  2KT1 A;  5FU7 C;  2RJF A;  2ABL A;  5CCA A;  4BI8 B;  1X43 A;  2OI3 A;  2MPX C;  1MGQ A;  2DKG A;  2E4H A;  4M78 G;  1IO6 A;  3QYG B;  4C92 A;  4N4H A;  5LJ3 h;  4F7U A;  2CUD A;  5GAN 8;  4OVA A;  2OTJ Q;  3OW2 S;  2COW A;  2A36 A;  3GPL A;  3SB2 A;  3EGD A;  4O5V A;  4D8D A;  2DBM A;  1BYM A;  3ER0 A;  3JCM c;  4AG2 C;  3FB9 A;  2F2V A;  1ZA2 B;  3OS0 A;  2KDS A;  3QJY A;  2KAF A;  4M77 A;  2L3R A;  1I8F A;  1TUG B;  4PL6 A;  3R6O A;  1D0Y A;  2BZY A;  4M7D B;  1UUE A;  1MMN A;  3X25 B;  2K5F A;  2LQW A;  4CI0 C;  1HXD A;  4A53 A;  2DD5 A;  2P0Q A;  3A98 A;  1U1S A;  1I81 A;  4PK4 A;  3UF4 A;  3OYG A;  2X51 A;  1UB4 A;  4AMC A;  3A8H B;  3H41 A;  2X9H A;  2CSQ A;  1NZ9 A;  4FYY B;  2OTJ A;  1LOJ A;  5FW9 A;  1RAA B;  2R58 A;  1TG0 A;  2GQV A;  1RAI B;  1M8V A;  1IHV A;  1ZQ1 A;  1ZUK A;  3TSZ A;  2RHX A;  1AD5 A;  2K5L A;  3HTR A;  1M1F A;  4OB1 B;  2RQT A;  2YLB A;  3EFO B;  3VRY A;  3RBB B;  1FYN A;  4BY6 C;  4JUV A;  2KT8 A;  4Z8A A;  1VOM A;  3P8B B;  2X4X A;  5LJ3 j;  4PJO G;  3NMZ C;  4PNO A;  1K9M R;  4WF2 A;  1QVF P;  1Z9Q A;  4XTV A;  2O9V A;  3HFN A;  5KE2 A;  4M75 F;  1VQP Q;  2QQA A;  2JTF A;  3MJX A;  1M1K C;  1G3S A;  1I07 A;  2V1R A;  5EG2 A;  2ECZ A;  2BZ8 A;  1J3T A;  5LJ5 g;  2JM9 A;  1Q86 R;  3TEE A;  3JCM b;  2QK0 A;  2VAS A;  2D8J A;  2XHC A;  3JCM g;  1ZX6 A;  3CPW P;  4X34 A;  3PFS A;  4JZ3 A;  2NUP A;  1AWO A;  1UEC A;  2DK3 A;  1M3C A;  4ELZ C;  2RJC A;  5CO7 A;  3HPW A;  4D8K A;  2CT4 A;  1OEB A;  1PHT A;  3M4G A;  4M7A B;  2E3H A;  3M54 A;  1YJ9 Q;  4KUD K;  1PC0 A;  1B3Q A;  5D7U A;  1VQ6 A;  2CP6 A;  2OTJ T;  4XU3 A;  3FDR A;  5I11 A;  3OYH A;  2QTX A;  1VIF A;  3JB9 J;  2DLP A;  3QSU A;  1UJY A;  4IIM A;  3OYC A;  1W2B P;  2E70 A;  4J6W A;  3CC2 Q;  3SWN C;  4QVC A;  3VS7 A;  1NLO C;  4J5Y A;  1G8X A;  3X26 B;  1R0C B;  1I4K 1;  4OMM A;  2V8K A;  3RUX A;  4IKF A;  2COZ A;  2R57 A;  1O9S A;  1S72 Q;  3RIR A;  1KD1 U;  1Y0M A;  4C0D C;  1U1T A;  1C6V X;  1ZBX A;  2ED1 A;  4JDS A;  2PNI A;  1GL5 A;  1M27 C;  1N5Z A;  3M4Y A;  5FU7 B;  1YIJ A;  1YJ9 A;  1MMG A;  2JMA A;  4EMK C;  3OYA A;  2J6O A;  1KJW A;  3KXT A;  3CCM Q;  3VS0 A;  2EBP A;  2CP2 A;  2CGH A;  2DZ9 A;  1ZA1 B;  4HCB A;  3CBP A;  1N9R A;  3H0F A;  3CMA Q;  1I1J A;  2MMP A;  4UC4 A;  2OTL Q;  3CC2 A;  4F7U G;  3GOX A;  2P0P A;  1HK9 A;  5I2S A;  1NE8 A;  1BCM A;  2OX7 A;  2RQW A;  4E7S A;  1UEB A;  1VYT A;  1AWX A;  3LYI A;  4A4G A;  1PKT A;  2DL4 A;  3JCM f;  3I9Q A;  4XU1 A;  1D1C A;  1SRM A;  2XKO C;  4EMH A;  1U8R A;  2XDD A;  3E2U A;  4M77 G;  1RAC B;  1OQK A;  4JRI A;  2KYB A;  3HSB A;  4M7A D;  3AHU A;  1CKB A;  3CCM A;  2E3I A;  1BIA A;  3PTA A;  3E1S A;  5GAN 4;  2GFU A;  2KRO A;  2G6F X;  3H8Z A;  5GAO p;  1VQL Q;  1OX9 A;  3RMQ A;  1K9A A;  2A0F B;  2YUN A;  2OTL A;  1XTD A;  3THK A;  1ZUY A;  3LW5 E;  5GJV B;  2DER A;  4GY5 A;  1NYF A;  1H64 1;  3MEU A;  1VQ6 T;  4Z89 A;  1YHQ Q;  2DXC A;  4BI4 A;  3GBQ A;  1N9S A;  2EQK A;  2VGN A;  3PMT A;  2AK5 A;  2LNV A;  2DTI A;  2DYI A;  2K3B A;  4E2F B;  1G3W A;  5CK9 A;  2MYS A;  5GJW B;  4BY6 B;  2E5Q A;  2QYZ A;  3OB9 A;  5LJ5 e;  2EFI A;  3LH5 A;  1ZUU A;  1MMD A;  4KRT A;  2KYM A;  3VS1 A;  1VQ9 Q;  3JCM V;  3OBY A;  4C8Q F;  5CKD A;  2L3S A;  4NS5 A;  4IUR A;  3JCM e;  1NLP C;  1B7T A;  1BCO A;  3TSW A;  4M75 G;  3T9N A;  4PLL A;  2VB6 A;  2BZX A;  1YIJ T;  1YJ9 T;  1OZ3 A;  4AFZ C;  4XTX A;  5IXB A;  4RMO A;  1YHQ A;  5CQX A;  1KK7 A;  1TOV A;  2QXF A;  2SRC A;  3L2V A;  3CC2 T;  4L59 A;  2HDA A;  2AZV A;  4A63 B;  3PMI A;  1XNI A;  4CRI A;  1Q82 R;  3H9N A;  1RAE B;  2CKK A;  2I0N A;  1YCS B;  1OYX A;  3RES A;  1S72 T;  2ROT A;  3CCQ Q;  1FMK A;  2QAS A;  3TU4 K;  3A8M B;  4RCC A;  4NL2 A;  1KQ2 A;  2FZG B;  3FJ5 A;  1T0J A;  1K9M C;  1MMA A;  3G6E Q;  2JMC A;  5KYU B;  2KNB B;  2K3X A;  1K8A R;  3EG9 B;  3EH1 A;  4FM4 B;  3CCM T;  2JM8 A;  4J9E A;  4M7D E;  4FT2 A;  4ESR A;  3CXC P;  1SG5 A;  2MWP A;  2OTL T;  5GMK l;  2RHZ A;  2M1H A;  4AFS C;  3M0T A;  4JJB A;  1TU0 B;  1IHW A;  3QWY A;  2YSQ A;  3CCE A;  4F17 A;  4XU2 A;  3RMS A;  1Q86 C;  2G3R A;  3SWN B;  1X01 A;  5GAO l;  2GBQ A;  2DVE A;  3CCQ A;  2FRW A;  2F5T X;  1M9S A;  3EHQ A;  3C95 A;  2C0O A;  2CP0 A;  4EPC A;  3G1J A;  3EHR A;  1X6G A;  1UDL A;  5KYX B;  3PVQ A;  3VS6 A;  2AHJ B;  2DL3 A;  2GF7 A;  3CCV Q;  4Y92 A;  2ZZD A;  1RAH B;  1IRX A;  4EMK B;  2YDL A;  2DAQ A;  3QXE B;  1QVF A;  1X2K A;  2ATC B;  5GAN f;  2F2W A;  4A4H A;  3L2U A;  2BE7 D;  1YHQ T;  4FSX A;  2P4T A;  2GTJ A;  1AHJ B;  1OV3 A;  2O2O A;  3M55 A;  4ELY C;  1O75 A;  1OOT A;  2FEI A;  1Y96 B;  4E7J A;  1M5Q 1;  3I56 A;  4GLK A;  3OW2 P;  1TWB A;  4L6V 5;  4EIK A;  1M2V A;  4HKE A;  2ZPI B;  1D0Z A;  3EGX A;  3CCV A;  4LDU A;  2E41 A;  4RTV A;  1SF9 A;  1YIT A;  2LX9 A;  3QUI A;  2COY A;  4J9H A;  5A0D A;  2ZGW A;  5C6S A;  2WSE E;  1M90 R;  3RDV A;  4JZ4 A;  3OA6 A;  4N0A A;  1K0X A;  3PE0 A;  3NHN A;  2LVM A;  4OGE A;  3JCM J;  4F14 A;  2O31 A;  2X4J A;  3NTI A;  1ARK A;  3A8L B;  3S3N A;  1I0C A;  4Z88 A;  1U06 A;  4M7A E;  1R77 A;  4O6J A;  5GAN e;  1NM7 A;  2O88 A;  4E7I A;  2R5M A;  2VWF A;  2C0T A;  5IT9 E;  1V1C A;  1UGR B;  4OGC A;  1RAD B;  1QWF A;  3CCQ T;  2WSF E;  3I5S A;  4E7Z A;  4C8Q G;  3OYB A;  2NUT B;  2O4X B;  3RR6 A;  2OAW A;  2PUO B;  2CH4 A;  2LRQ A;  4K11 A;  1UE9 A;  2RD1 A;  2LC4 A;  4M7D A;  4KGX B;  2AT1 B;  5A0L A;  2EQI A;  2RMO A;  2NYS A;  4J6Y A;  1M1K U;  2LQN A;  2A08 A;  4DOV A;  3VS4 A;  2J06 A;  3OS1 A;  3PVL A;  4LE9 A;  2F2X A;  1D1A A;  4MMK A;  2HNI A;  4M7D F;  4LDW A;  1E6G A;  4IUP A;  4M75 C;  4M78 D;  2DTO A;  1FMV A;  1FWZ A;  4X1V A;  4BUG A;  1XJW B;  3WVD B;  2RJD A;  2ZCF B;  2QQR A;  1UHC A;  2IIM A;  2JZ2 A;  2P84 A;  4PJM A;  2D8H A;  4ZGJ B;  1JQQ A;  3I56 T;  5LJ5 h;  4KUL A;  2W10 A;  3CBM A;  3EFO A;  3CEY A;  2LCS A;  1JJ2 A;  4FW2 A;  3JCM h;  3CCV T;  3CQT A;  2PU9 B;  4C92 F;  1YJW Q;  4F7U F;  1YIT T;  3CCS Q;  1SKU B;  2CP3 A;  5KCO A;  2DO3 A;  2A7Y A;  2RH2 A;  1BI2 A;  4WTO B;  2A28 A;  2IG0 A;  2YUO A;  2QG9 B;  1IGQ A;  4KUI A;  2GNC A;  2VV5 A;  2K3Y A;  3EG1 A;  2DBK A;  2EAY A;  1LNX A;  2QDY B;  3F70 A;  4XTZ A;  2XG8 D;  2FZK B;  1RI9 A;  1QP2 A;  2FL7 A;  2DVJ A;  1GCQ A;  5I22 A;  1Q82 C;  4M77 F;  2HQX A;  3RKY A;  3LGF A;  1WA7 A;  4DA4 A;  2JXB A;  3G4S Q;  2RB6 A;  2X35 A;  4J8O A;  2H3J A;  5KYW A;  3MKD A;  1RAF B;  1VQ8 Q;  1JEG A;  4KT0 E;  1KQS A;  4PJJ A;  2BTT A;  1WQW A;  1QCN A;  2O9S A;  3LWI A;  4PJO D;  2L2P A;  1K8A C;  4HCC A;  5GAN 7;  2DL7 A;  3EGU A;  2MCN A;  1NYG A;  4FW1 A;  3GF5 A;  2K7A A;  2LQK A;  3OMC A;  2EGA A;  4RKU E;  2HMA A;  2EWN A;  4B9W A;  2EQM A;  2X4Y A;  4M7A A;  4E7L A;  3PIP A;  1PG5 B;  4V2S A;  5LJ5 j;  3M0P A;  1MND A;  4RTU A;  1N8R R;  1M8M A;  5D6Y A;  2HQH A;  3FEO A;  3VV0 A;  4XK8 E;  1SRL A;  2LMJ A;  1VQ8 A;  2DL8 A;  1WHL A;  2E12 A;  2E6N A;  2DD4 A;  2ESW A;  3FC3 A;  2KXD A;  3V8K A;  3O8V A;  4AT1 B;  3OQ5 A;  3HKS A;  4QW2 A;  3CCR Q;  4Q5W A;  4FL6 A;  3QYH B;  1W70 A;  5J3B A;  4J9G A;  4MZT A;  2KRS A;  4PJN A;  3MO8 A;  3X24 B;  1X69 A;  5KYW B;  2VXF A;  4A54 A;  1M3A A;  1JBM A;  4BE1 A;  2HL3 A;  2KY9 A;  4FYV B;  2QDL A;  5KH6 A;  1WZO A;  3CME Q;  4ZN3 A;  4A4E A;  1QVP A;  3CXC A;  1K0S A;  4XAX B;  3JB9 D;  1RAG B;  2FVU A;  5I2M A;  2XIC A;  2D1X A;  1Q7Y R;  3RER A;  1VQP A;  3OYD A;  3L2Q A;  4RTZ A;  4PFZ A;  3WXM B;  1PRL C;  1RLP C;  2QQS A;  3ZFJ A;  2RQV A;  2O01 E;  2JW4 A;  3CCR A;  2DJQ A;  1YJN Q;  2DEQ A;  2QI2 A;  1W4S A;  1YI2 Q;  2JOY A;  1W6X A;  2EIF A;  4KGZ B;  1C0M A;  4C8Q C;  5ECA A;  3I35 A;  4ORZ A;  4N4I A;  2EJG A;  2LJ1 A;  1ZSZ B;  2XID A;  4KBM B;  4M7D G;  1M90 C;  4ZGE B;  4N4G A;  2CS7 A;  4QVZ A;  4F04 B;  2MAM A;  2RHI A;  3M0U A;  3JCM W;  4M75 B;  5FWC A;  1X6B A;  1Q81 R;  3FLG A;  2CT3 A;  1H92 A;  2JJ9 A;  5I21 A;  3QPH A;  1IB8 A;  2FYK A;  1G83 A;  3H6Z A;  4XU0 A;  3CC4 Q;  2E1H A;  1PNJ A;  2ZPE B;  2EQJ A;  2RI5 A;  2F5K A;  1IRE B;  5FLX E;  1WXU A;  1ZLM A;  1KFZ A;  1V76 A;  5GAM h;  2J6K A;  1NJI R;  2MI6 A;  4NL3 A;  4ZNX A;  3OW2 A;  4FYX B;  1K9M U;  2DFU A;  3CBO A;  4MZP A;  1VQ8 T;  1KSW A;  4C92 G;  1K73 R;  1QMC A;  4M78 C;  4MDX A;  4A4K A;  1BB9 A;  1T0H A;  4Z02 A;  1M30 A;  3M58 A;  5L8R E;  2K4Y A;  4J7I A;  1BI0 A;  2J05 A;  3EAE A;  3JB9 I;  1S72 A;  1JJ2 P;  1S1N A;  2CP7 A;  1QQJ A;  3H0I A;  2KK4 A;  3NTK A;  1Q86 U;  1VQO Q;  2X3X D;  5FWB A;  1IGU A;  2RN8 A;  4AG1 C;  3JCM Q;  1JXM A;  1D0X A;  3L2R A;  1AVZ C;  3M59 A;  1C1A A;  4KGV B;  1QCF A;  4OB2 B;  3IQL A;  4JLI A;  1EX4 A;  2DZC A;  1QVG S;  3M5A A;  1Y71 A;  3FJP A;  3GLX A;  1IXD A;  1UGV A;  2GCX A;  1BU1 A;  4ZN1 A;  2KXC A;  2VKN A;  3OYF A;  1VQP T;  1B07 A;  1NEG A;  3CMA A;  2MIO A;  3BDU A;  4FYW B;  1VQN Q;  1FXX A;  4L5G A;  2J6F A;  3CCR T;  2YRD A;  1OI1 A;  2CYZ B;  4GLM A;  2QA4 Q;  3BW1 A;  3DLM A;  2E5K A;  1X75 C;  2DXB A;  4CC7 A;  3CPW S;  1QCO A;  2KMT A;  2HSP A;  4M75 D;  1PWT A;  4AFU C;  1X27 A;  1UGP B;  5KYU A;  1VQO A;  1ABO A;  4II1 A;  1UFF A;  3EG9 A;  1OZ2 A;  2HD0 A;  5GMK m;  5GAM j;  3GP8 A;  1KQS P;  2GQI A;  2HKN A;  2YT6 A;  3M56 A;  4M4Z A;  1PD1 A;  1CKA A;  4BB7 A;  3CCU Q;  1WQ7 A;  1MV3 A;  1KC8 R;  2EYZ A;  1JB0 E;  1VQL A;  1Q81 U;  2EGC A;  1VA7 A;  5A2Q E;  5LJ3 d;  2LCC A;  1YNZ A;  2YLC A;  1BI3 A;  2K2M A;  3OMG A;  4PJO C;  3SWN A;  2P4R A;  1B34 B;  1W2B S;  1KIK A;  2EYQ A;  2PZ1 A;  2RA2 A;  1QW1 A;  5GAN g;  4FU6 A;  1UJ0 A;  3QII A;  4OMP A;  3MP6 A;  5KYX A;  1PSE A;  1WX6 A;  1H3Z A;  2IVW A;  5KYN A;  1E7O A;  1D09 B;  4LUD A;  3QWX X;  3SDZ A;  3VUB A;  4TVR A;  2EJF A;  3HL8 A;  1VQ9 A;  1ZBJ A;  3MP1 A;  4EMK A;  3CCU A;  9ATC B;  2VC8 A;  1WDX A;  2W0Z A;  1N8R C;  3NPF A;  4IUT A;  2C06 A;  2QQB A;  3CD6 Q;  5HKC A;  5AYF A;  1FX7 A;  4Y91 A;  2P0K A;  1Y96 A;  1V29 B;  1BIB A;  2DF6 A;  2K79 A;  1RAB B;  2KRM A;  4HVW A;  3CMA T;  3MHX A;  1G3T A;  4LN2 A;  4C5G A;  4IIO A;  4JS4 A;  2EW3 A;  3M9Q A;  4QQ6 A;  1W1F A;  2VVK A;  2B8A A;  3PNW C;  2QAZ A;  4C8Q B;  2RHY A;  2D0Q B;  5CR2 A;  1VUB A;  4OML A;  3CCJ Q;  2HZY A;  1KHI A;  4C0Z A;  3V7S A;  2D0N A;  5KYY B;  1VQO T;  2XDP A;  3LGL A;  2YUQ A;  4RCB A;  3CD6 A;  5GAN 5;  2NWM A;  3G6E A;  1VQ4 Q;  4C0D B;  2YRC A;  2JTM A;  4EMG A;  1QKX A;  1Q7Y C;  4CC2 A;  1VQL T;  2VXE A;  3MET A;  4DQ2 A;  4ANJ A;  4F16 A;  5DLQ E;  8ATC B;  3C4S A;  3VS2 A;  2D9T A;  4BE0 A;  4YTL A;  5J26 A;  5IXF A;  1WIE A;  2L3Q A;  4ATO A;  2FHD A;  8AT1 B;  3RKW A;  1DJ7 B;  3CCL Q;  1LVK A;  2CH4 W;  2QA4 T;  2QGF B;  1R0B G;  2NUT A;  2O4X A;  4M78 B;  2HL5 C;  3QDF A;  3WVE B;  1QP3 A;  4HT8 A;  1QKW A;  2DX1 A;  1AOJ A;  3L2Z A;  2OJ2 A;  4C92 C;  1VQK Q;  2AKK A;  3HRS A;  4IUQ A;  1PKS A;  3A5Z B;  2EKO A;  3GIB A;  1VQ4 A;  1QVG A;  1Q81 C;  2BKD N;  1VQ9 T;  1Q82 U;  4FCY A;  4C5E A;  3CCU T;  2Y4Y A;  5D6X A;  2EPD A;  3H0H A;  3DB4 A;  2CDT A;  2GFA A;  1PCX A;  3JAM E;  2K57 A;  4Y28 E;  5GMK e;  3ZBD A;  4P5N A;  4PLI A;  1RUW A;  4M77 C;  4DBH A;  1NJI C;  1TH7 A;  1A0N B;  3QDR B;  3UPU A;  1K8A U;  4DOW A;  2JN0 A;  4C8Q D;  1OUL A;  1T3L A;  1K73 C;  3PT9 A;  1GCQ C;  3S3M A;  3UAT A;  1D3B B;  3LWH A;  4OMN A;  1VQK A;  3EG0 A;  4QKU A;  2CP5 A;  2JNG A;  2BIV A;  1AT1 B;  4LDX A;  1VQM Q;  4GBQ A;  3HHT B;  3ZL7 C;  4LUE A;  4XQ3 A;  3NFC A;  3A8G B;  1YP5 A;  4BD3 A;  1SHF A;  3UT1 A;  3VU3 C;  1K1Z A;  2XD0 A;  3PIO A;  1WHJ A;  4C5H A;  3EG3 A;  3J80 E;  1M1G A;  1Y57 A;  4EDU A;  5GAM d;  4RTY A;  5CKE A;  3CD6 T;  2M0O A;  3G6E T;  3CC7 Q;  1YWO A;  3L42 A;  2ENM A;  4BE2 A;  4RG2 A;  1EFN A;  3OYJ A;  3D7S B;  2FPE A;  4M75 E;  1LCK A;  3URG A;  3QBY A;  4JJD A;  4PJO B;  3SD4 A;  3VJP A;  5IH2 A;  4QT7 A;  2DET A;  3S6W A;  2YXY A;  2FRY A;  1Y7X A;  1VQM A;  2L3P A;  4HA8 A;  3QG1 A;  2LX7 A;  4E7K A;  2FZC B;  4HCZ A;  1ACM B;  2M51 A;  1WXT A;  3NGP A;  2JT4 A;  2RI2 A;  1WHM A;  2M9U A;  5CAI A;  1WYX A;  4A4F A;  1VQ4 T;  3OYL A;  2K9G A;  5IAY A;  3CC7 A;  3KUF A;  2KGT A;  5LL6 S;  1KC8 C;  1NG2 A;  4XTW A;  1Q95 G;  3LX7 A;  1TTH B;  1ZHI A;  3M0R A;  2VYT A;  1LPL A;  4J83 A;  5KE3 A;  5CKH A;  3C94 A;  2Y90 A;  3QJ6 A;  4RTW A;  2DPP B;  1YBY A;  2DE0 X;  4IUV A;  2PUK B;  3CCL T;  1QWE A;  2EQU A;  2X4W A;  2M02 A;  1M90 U;  4PFP A;  2KE9 A;  2MWO A;  3CPF A;  1HSQ A;  1WXB A;  1VQK T;  5CKF A;  4JLG A;  2JUF A;  1SSF A;  2DYB A;  4CC3 A;  2M16 A;  2KVQ G;  2QQ9 A;  4OMQ A;  1Y07 A;  4RTX A;  3HP9 A;  3AT1 B;  2MK5 A;  3C0C A;  5C0M A;  4LD6 A;  5IHI A;  3QZ5 B;  1YJW A;  2ZPF B;  3CCS A;  2QGG A;  3EH2 A;  1OU8 A;  1LJO A;  5IN1 A;  2FPD A;  5FRO A;  3ULR B;  1XQH A;  5CQY A;  4J7F A;  4BAC A;  2HEQ A;  1NPR A;  2L0A A;  2L8D A;  2CZ6 B;  4OMF B;  4J9C A;  4PJL A;  1IZ6 A;  1WPY A;  2ED0 A;  4LXC A;  3MCA B;  3UWN A;  1WGS A;  3DKM A;  1GBR A;  1BK2 A;  2DJZ A;  3L2W A;  1VQM T;  3M0Q A;  4M7A F;  3G4S A;  1MV0 B;  3RKX A;  4C92 B; 
#chains in the Genus database with same CATH homology
 1AWJ A;  2JM8 A;  1OPL A;  1AEY A;  1VYV A;  2J05 A;  2FO0 A;  2M0Y A;  4J9E A;  1S1N A;  4ESR A;  3H0I A;  5IHK A;  2CSI A;  1AZE A;  2DL5 A;  2X3X D;  3M0T A;  5FWB A;  4AFS C;  2RN8 A;  4AG1 C;  4JJB A;  1JXM A;  1AVZ C;  1QCF A;  3QWY A;  3IQL A;  2YSQ A;  4F17 A;  5IHN A;  2GBQ A;  1UGV A;  1BU1 A;  2LP5 A;  2KXC A;  2EYY A;  2FRW A;  2VKN A;  1B07 A;  1TUC A;  3EHQ A;  1ZSG A;  1NEG A;  2AZS A;  2C0O A;  2MIO A;  1ABQ A;  2LJ0 A;  2HCK A;  5HCK A;  3EHR A;  1X2Q A;  1X6G A;  1UDL A;  4DEX A;  1WI7 A;  3PVQ A;  2J6F A;  3VS6 A;  2DL3 A;  1TUD A;  4GLM A;  3M0S A;  2E5K A;  2JS0 A;  4Y92 A;  2KT1 A;  4CC7 A;  2ABL A;  2HSP A;  1X43 A;  2ROL A;  1PWT A;  4AFU C;  1X27 A;  2OI3 A;  2YDL A;  1ABO A;  1UFF A;  1IO6 A;  1X2K A;  1K76 A;  2F2W A;  2GQI A;  2CUD A;  2YT6 A;  4M4Z A;  4RTT A;  1CKA A;  2A36 A;  2GTJ A;  1OV3 A;  2O2O A;  1MV3 A;  1OOT A;  2EYZ A;  1BBZ A;  2YUP A;  2FEI A;  4D8D A;  2EGC A;  2KBT A;  4RUG A;  1AWW A;  1VA7 A;  2DBM A;  2LZ6 B;  1YNZ A;  4AG2 C;  2F2V A;  2K2M A;  1G2B A;  4EIK A;  2P4R A;  1KIK A;  2PZ1 A;  2RPN A;  1VYU A;  3UA7 A;  2BZY A;  1UUE A;  1U5S A;  1UJ0 A;  4RTV A;  2LQW A;  4OMP A;  1WX6 A;  1PRM C;  3A98 A;  4J9H A;  3UF4 A;  3VRZ A;  1E7O A;  4LUD A;  3QWX X;  1YN8 A;  1YWP A;  4JZ4 A;  3H41 A;  2CSQ A;  2X3W D;  1K0X A;  3PE0 A;  3NHN A;  1ZBJ A;  5FW9 A;  4F14 A;  1TG0 A;  1WDX A;  2O31 A;  2W0Z A;  1JXO A;  1ARK A;  3NPF A;  1ZUK A;  3TSZ A;  1I0C A;  4Z88 A;  1U06 A;  1AD5 A;  2GGR A;  2RQT A;  1NM7 A;  2O88 A;  3VS5 A;  3VRY A;  2VWF A;  1FYN A;  3RBB B;  2C0T A;  1V1C A;  3REA B;  1QWF A;  2DF6 A;  2K79 A;  2KT8 A;  2KRM A;  3I5S A;  4J9I A;  4HVW A;  4Z8A A;  4LN2 A;  4IIO A;  2EW3 A;  2OAW A;  2CH4 A;  1W1F A;  4K11 A;  1UE9 A;  2VVK A;  3NMZ C;  1E6H A;  4OMO A;  1MUZ A;  2HBW A;  4OML A;  2EQI A;  2RMO A;  1Z9Q A;  2LQN A;  2O9V A;  2A08 A;  3VS4 A;  2J06 A;  2NUZ A;  3PVL A;  4HCK A;  4LE9 A;  2DRM A;  2F2X A;  2D0N A;  1E6G A;  3SEM A;  2YUQ A;  1SEM A;  4X1V A;  2SEM A;  2NWM A;  1I07 A;  2V1R A;  2RQR A;  2ECZ A;  3JV3 A;  2BZ8 A;  2DNU A;  1J3T A;  1QKX A;  1GRI A;  1UHC A;  2IIM A;  2JM9 A;  1HJD A;  4CC2 A;  2MOX A;  2D8H A;  4F16 A;  3VS2 A;  1JQQ A;  3EG2 A;  2D8J A;  5IXF A;  1WIE A;  2L3Q A;  1ZX6 A;  2W10 A;  1JO8 A;  3TVT A;  1AWO A;  4JZ3 A;  2LCS A;  1UEC A;  1M3C A;  2CH4 W;  2DRK A;  2K6D A;  1SHG A;  2XMF A;  2LNH B;  4D8K A;  3CQT A;  2CT4 A;  4DEY A;  1XOV A;  3R6N A;  1OEB A;  1PHT A;  2DX1 A;  1QKW A;  1AOJ A;  2OJ2 A;  1SSH A;  2AKK A;  3VS3 A;  2A28 A;  2CUB A;  1B3Q A;  1PKS A;  2KR3 A;  3O5Z A;  2YUO A;  4JJC A;  4HVV A;  5I11 A;  2EYX A;  2GNC A;  3EG1 A;  2DBK A;  2DLP A;  2EPD A;  3H0H A;  1UJY A;  2CDT A;  4IIM A;  1RI9 A;  2RF0 A;  2DVJ A;  1GCQ A;  1U3O A;  5I22 A;  2EKH A;  2RNA A;  3VS7 A;  1NLO C;  1RUW A;  1WA7 A;  2DM1 A;  2JXB A;  1A0N B;  4OMM A;  1T3L A;  1JEG A;  1GCQ C;  1Y0M A;  3RNJ A;  3UAT A;  2BTT A;  4LNP A;  2O9S A;  2ED1 A;  4OMN A;  2PNI A;  2L2P A;  3EG0 A;  1GL5 A;  1M27 C;  1N5Z A;  3KFV A;  2DL7 A;  3EGU A;  1WLP B;  2MCN A;  1NYG A;  4GBQ A;  3ZL7 C;  2JMA A;  4LUE A;  1YP5 A;  2EGE A;  2J6O A;  1SHF A;  2K7A A;  1KJW A;  3VS0 A;  2EGA A;  4CC4 B;  2EBP A;  1K1Z A;  2DA9 A;  3H0F A;  1I1J A;  3EG3 A;  3M0P A;  1T3S A;  1Y57 A;  4RTU A;  4RTY A;  1JU5 C;  1YWO A;  1M8M A;  2DMO A;  2RQW A;  2ENM A;  1VYT A;  1GCP A;  1EFN A;  4HXJ A;  1AWX A;  4J9B A;  2FPE A;  1LCK A;  1PKT A;  2LJ3 A;  2DL4 A;  3I9Q A;  4JJD A;  1SRL A;  2LMJ A;  4WCI A;  2DL8 A;  1SRM A;  2ESW A;  2RQU A;  5IH2 A;  4QT7 A;  4R0K A;  2KXD A;  1OPK A;  2FRY A;  4HVU A;  2L3P A;  2KYB A;  2KEA A;  2PTK A;  1CKB A;  1UHF A;  1W70 A;  2LX7 A;  2EVR A;  2G6F X;  2KRO A;  2EYW A;  4J9G A;  2KRS A;  1GFD A;  2C0I A;  2M51 A;  1X69 A;  1HD3 A;  1WXT A;  3NGP A;  1K9A A;  3REB B;  2YUN A;  1M3A A;  2JT4 A;  3THK A;  1ZUY A;  5GJV B;  2QDL A;  1H8K A;  1WYX A;  1NYF A;  2K9G A;  4Z89 A;  2KGT A;  1K0S A;  2FPF A;  1NG2 A;  3GBQ A;  1WFW A;  2A37 A;  2AK5 A;  3M0R A;  2D1X A;  2K3B A;  4RTZ A;  1PRL C;  1RLP C;  2H8H A;  5GJW B;  4RTW A;  2JTE A;  2RQV A;  1UG1 A;  1H3H A;  2JW4 A;  2DE0 X;  3LH5 A;  1ZUU A;  4KRT A;  3VS1 A;  1QWE A;  2KYM A;  2DJQ A;  5EC7 A;  2DIL A;  1Z9Z A;  2KE9 A;  2AKL A;  2CRE A;  1W6X A;  2L3S A;  2V1Q A;  1HSQ A;  1WXB A;  5ECA A;  1GBQ A;  3I35 A;  1NLP C;  4ORZ A;  5L23 A;  3TSW A;  1K4U S;  1NEB A;  1UTI A;  2LJ1 A;  4J9D A;  2BZX A;  2GTO A;  4AFZ C;  2J7I A;  1GFC A;  3M0U A;  5IXB A;  2DYB A;  3UA6 A;  1SPK A;  4CC3 A;  4OMQ A;  5FWC A;  1X6B A;  4RTX A;  2KRN A;  3C0C A;  2B86 A;  2CT3 A;  1H92 A;  2FG0 A;  2JS2 A;  3SHW A;  5IHI A;  1QLY A;  4JPB W;  3U23 A;  2SRC A;  1G83 A;  1CSK A;  3I5R A;  1PNJ A;  2FPD A;  2AZV A;  2HDA A;  3ULR B;  4A63 B;  1WXU A;  1ZLM A;  1KFZ A;  2HEQ A;  1M3B A;  2L0A A;  2J6K A;  2I0N A;  1YCS B;  4J9C A;  4ZNX A;  4E6R A;  4J9F A;  2ROT A;  1FMK A;  2ED0 A;  1KSW A;  4AFQ C;  4FSS A;  1GBR A;  1BK2 A;  3FJ5 A;  1T0J A;  1AZG B;  1BB9 A;  2JMC A;  1RLQ C;  2KNB B;  3M0Q A;  1T0H A;  1MV0 B;  1M30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...