4J9HA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph 8
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9hA00
2FG0A 1UJ0A 2LJ3A 2RQUA 2GBQA 4A63B 4J9HA 1K1ZA 1NYGA 1UECA 1X69A 1NM7A 3EG1A 4D8DA 3VS2A 2KYMA 1VYVA 2YUPA 2DJQA 1WXUA 2CDTA 5IHNA 5I22A 2NWMA 4F16A 2EGEA 2CSQA 2DX1A 4HCKA 2YT6A 4AFSC 2KNBB 4X1VA 1K76A 2LMJA 4RUGA 1K0SA 1YP5A 2DRKA 1IO6A 2DBKA 2MIOA 2YUQA 3M0SA 2F2WA 2BZXA 1GFDA 2BZYA 2MOXA 2K6DA 1Z9QA 1HD3A 1W6XA 2O31A 1RLQC 4RTTA 2JS2A 4DEYA 1YWOA 5IXBA 1GBQA 3UA6A 2LCSA 2RQWA 2PTKA 3TSZA 1QLYA 5IH2A 1G2BA 5ECAA 1YNZA 2D0NA 1PKTA 2DL3A 1Z9ZA 2RQRA 1NG2A 3GBQA 1ABQA 1SSHA 2LNHB 2ENMA 2IIMA 2VKNA 4JPBW 3EG2A 1AWJA 2DYBA 2YUNA 1AZGB 1AOJA 1AWWA 2OAWA 1N5ZA 1B3QA 1EFNA 2KYBA 1UJYA 2L2PA 2YSQA 2AZVA 2DLPA 4E6RA 1I0CA 2JXBA 1OPLA 5HCKA 4AFUC 2AZSA 2EGAA 2JTEA 1CSKA 1X43A 1GRIA 1MV3A 2D1XA 1OEBA 1NLPC 1H8KA 2CH4W 3FJ5A 3H0FA 2DE0X 1J3TA 1I1JA 1U5SA 2V1QA 1X6BA 2ED1A 4D8KA 3I35A 2DL7A 3REAB 2GQIA 1M3CA 2CSIA 4DEXA 5GJVB 3VS4A 1M27C 1JEGA 3IQLA 1UTIA 2KGTA 1ZLMA 1I07A 2VWFA 1ZX6A 1XOVA 4IIOA 1QCFA 2CH4A 3UATA 2DNUA 3JV3A 4HVWA 1UHCA 3TVTA 1SHGA 2FRWA 2B86A 1TUDA 1NYFA 2KR3A 2CUBA 1Y0MA 4OMPA 1LCKA 2ECZA 2O2OA 1K0XA 1ZSGA 2HBWA 2EYYA 3NPFA 2HSPA 1RLPC 1SRMA 2FRYA 2LJ1A 1PHTA 1TG0A 2DVJA 2J6KA 2QDLA 2A08A 4AFZC 1X27A 3M0RA 1AWOA 1B07A 2O88A 1PRLC 4J9FA 4LUEA 1CKBA 2C0IA 1H3HA 1X2QA 3H0HA 3EG0A 3SEMA 2KRSA 3ZL7C 2GNCA 2M51A 4JZ4A 4RTUA 2LQNA 3QWYA 3NMZC 2RMOA 1S1NA 2ROLA 4M4ZA 2J6OA 4JJCA 1JXOA 3M0QA 4Z88A 1MUZA 2W10A 1U06A 5IHIA 1ZUUA 1M3BA 2FO0A 2LJ0A 3C0CA 1WXBA 1T0JA 2DBMA 4AG2C 1HJDA 5EC7A 2SEMA 4EIKA 1OOTA 4GLMA 2KT8A 4CC3A 1QWFA 1GCPA 2K79A 1BBZA 1CKAA 1VYUA 1JU5C 1JXMA 1M8MA 2BTTA 2BZ8A 1SEMA 2A37A 4J9DA 1QKWA 2ROTA 3PVLA 2EQIA 4GBQA 1BU1A 1E6HA 3UF4A 4J9EA 2P4RA 4OMOA 1G83A 2EKHA 2HCKA 1KSWA 2DA9A 2DF6A 1W1FA 1A0NB 1ZBJA 2LP5A 1KFZA 3M0TA 1WX6A 4CC2A 4KRTA 2KXCA 3NGPA 2LZ6B 1NLOC 2RNAA 2L0AA 1AVZC 1SRLA 3VS7A 1V1CA 1VYTA 1W70A 2X3XD 1UFFA 5GJWB 2AK5A 2D8JA 2YUOA 4J9BA 4JZ3A 1JO8A 2YDLA 2VVKA 1OV3A 4K11A 4AG1C 3RNJA 1BK2A 2E5KA 1ZUKA 1WYXA 4LNPA 2RPNA 2V1RA 1SHFA 2GTOA 2OJ2A 1UHFA 3PVQA 3VS5A 2ESWA 2H8HA 3QWXX 1WI7A 2ED0A 2KRMA 2FPDA 2JM8A 1YWPA 1WLPB 4RTVA 3H41A 4CC7A 2RQTA 2KT1A 3EHRA 3RBBB 1FMKA 1QWEA 1RUWA 4Z89A 2CUDA 2EVRA 2JW4A 2EYWA 1WFWA 4Y92A 2CREA 4AFQC 2K3BA 2MCNA 4ZNXA 2EYZA 4J9CA 2AKKA 5FW9A 2DM1A 1E6GA 1H92A 4RTXA 1HSQA 2OI3A 1M3AA 2J06A 2M0YA 2FEIA 4OMQA 3SHWA 1WDXA 2J7IA 2PZ1A 1UGVA 2EW3A 2O9SA 3I9QA 2A36A 3R6NA 3H0IA 4HXJA 1Y57A 2A28A 2KRNA 2L3QA 3CQTA 2GTJA 2NUZA 2PNIA 4HVVA 2DILA 4FSSA 4HVUA 1YCSB 2I0NA 2LX7A 1PRMC 1SPKA 1TUCA 3NHNA 1WA7A 2JS0A 3ULRB 2K2MA 2KBTA 2C0TA 1AWXA 2EYXA 2XMFA 3REBB 1OPKA 4ESRA 1ABOA 4F14A 5FWBA 4LN2A 1GCQA 1GFCA 1X6GA 5I11A 1AEYA 2SRCA 2K7AA 2W0ZA 4OMMA 3TSWA 1T3SA 2X3WD 2DMOA 4IIMA 1E7OA 2J6FA 1QKXA 3EHQA 2KE9A 4JJDA 1M30A 3LH5A 1AD5A 1ARKA 4OMLA 2C0OA 2JMAA 2DL8A 2F2VA 2KXDA 1UE9A 4OMNA 1KIKA 3PE0A 1T3LA 2DRMA 3VS1A 2KEAA 1GCQC 3I5RA 2HEQA 2RN8A 2FPFA 1VA7A 2JT4A 4LUDA 2DL4A 2FPEA 3VS3A 2HDAA 2EBPA 2KROA 4QT7A 1UG1A 1JQQA 3UA7A 4WCIA 3VS0A 1UUEA 5L23A 2D8HA 3EG3A 4R0KA 1GBRA 1RI9A 1GL5A 1BB9A 4LE9A 1ZUYA 1U3OA 2RQVA 3I5SA 3EGUA 2ABLA 2EPDA 2DL5A 2F2XA 2JMCA 3M0UA 4CC4B 3M0PA 1UDLA 2AKLA 4RTWA 2JM9A 1FYNA 4RTZA 5FWCA 3KFVA 1PNJA 4JJBA 3VRYA 2J05A 1K9AA 2RF0A 1WIEA 1YN8A 4J9IA 1PWTA 1MV0B 1K4US 4RTYA 1AZEA 1T0HA 3VS6A 2GGRA 4J9GA 2L3SA 1NEGA 3O5ZA 2O9VA 4F17A 2K9GA 3A98A 1X2KA 4Z8AA 3THKA 5IXFA 2CT4A 4ORZA 1KJWA 2LQWA 2EGCA 1NEBA 2L3PA 5IHKA 1PKSA 2G6FX 1WXTA 3U23A 3VRZA 2CT3A
chains in the Genus database with same CATH superfamily
2GCXA 2FG0A 4QVCA 1WHJA 1OULA 2LJ3A 4DOVA 3CCLA 4BACA 2EFIA 1NYGA 1YBYA 1TSFA 1IGQA 4L6V5 2KYMA 3CBPA 2VB6A 4J83A 2NWMA 2BE7D 2EGEA 3ZBDA 2DX1A 2FHDA 5HKCA 4X1VA 3MO8A 1VQ8Q 1YFNA 3RKXA 4M78F 3CCUA 4WF2A 3OYFA 2DKGA 5GANe 2MIOA 1QVFA 2RI3A 2DXBA 3M0SA 1G5VA 1IHWA 5GANj 2XDPA 5GAN7 1QVFS 1NZ9A 2NUTB 1MMGA 4N4IA 1RLQC 2X9HA 2JS2A 1GBQA 3UA6A 2LCSA 4C0FA 1KC8R 3OB9A 3OW2S 2PVDB 1G2BA 3CCJA 2KQWA 2GQVA 1Z9ZA 1M9SA 3PIPA 2LNHB 5FU6B 5HK0A 4EMKB 2ENMA 2ZZDA 3BFMA 2XD0A 4M7AC 2ZGWA 2LQ8A 4JPBW 2E3HA 2DYBA 1KHIA 1KC8U 2YUNA 4N0AA 1AWWA 2OAWA 1B3QA 1EFNA 2KYBA 1VQOQ 1RAHB 1YIJT 4M7DD 3BDUA 2RO0A 4M7AG 1D0XA 2EGAA 1Y07A 1GRIA 1G3YA 1NLPC 3EGDA 3GOXA 2CH4W 3FJ5A 1Q82R 5CIUA 2NYSA 1I1JA 5KCOA 1IHVA 4A53A 4DQ2A 3CCRT 3RR6A 2P4TA 1JEGA 2LT1A 1ZLMA 1I07A 5GMKj 1ZX6A 3BE3A 3JV3A 4HVWA 5GAOm 3TVTA 3P8BB 3CCSQ 3G71A 2B86A 1TUDA 4M78E 3G6EQ 1NYFA 2CP2A 4DBHA 2KR3A 2MAMA 4E7KA 3BY7A 3CMAQ 4FYXB 1PG5B 4E7LA 5GMKm 5J26A 5GAN4 3M5AA 2EYYA 3NPFA 2HSPA 3RDVA 1VQKQ 4D6WA 5GAMh 3CBOA 4BDZA 1JRIA 1R0BG 4F7UG 3SWNC 5GAMe 3HTRA 2QDLA 4M77B 2A08A 3EG9B 3R6OA 4AFZC 1TH7A 8ATCB 1QW1A 5J3BA 1B07A 2KSSA 1M90C 1UB4A 1CKBA 4M77D 2HQXA 3CPFA 2C0IA 4F7UA 1H3HA 2K3YA 1IGUA 5I2SA 3H6ZA 3EG0A 3PMTA 2DYIA 3SEMA 2KRSA 4IURA 1VQ9T 3GNFB 3HFOA 2QA4T 2RMOA 4BUGA 1S1NA 4KGVB 1I8FA 2JOYA 2W10A 3MKDA 4E7ZA 1VQKT 2FO0A 2LJ0A 2QI2A 1BI3A 3VKIA 2K5LA 3MEAA 4AG2C 3OW2A 3RIRA 1HJDA 5EC7A 4OVAA 1BIBA 2MK5A 1D3BB 5A0LA 4C92B 3X24B 2EJGA 2KT8A 4DA4A 2EQMA 3OBYA 2FZGB 5J39A 1BBZA 3AHUA 3MEWA 1VQ8T 4PJMA 3VUZA 4NL3A 2HAXA 1BCOA 4N4HA 3PVLA 3OYDA 1M1KR 1YJNA 4JLIA 3PIOA 2QYZA 2KI7A 1BU1A 3EGXA 2FZKB 1M8VA 2EKHA 4M7AA 2DF6A 1ZBJA 1WX6A 4RKUE 4JUVA 2KXCA 3NGPA 2DERA 1C6VX 4RCBA 2LCCA 1UGPB 1SG5A 4C5IA 1W70A 5CKBA 3I55T 3HFNA 2CGHA 3H9NA 2CS7A 2YDLA 4K11A 4AG1C 4M7AF 3RNJA 1BK2A 4RCCA 2PU9B 2GF7A 1ZUKA 1WYXA 2ZPGB 3EFRA 2RPNA 2IPOB 2LTOA 4FYWB 3VS5A 1YHQQ 4PJOG 1M2VA 1WI7A 3CPWP 1D1CA 1Q7YR 4OB0B 4F7UF 3VYGA 2OTJT 2CUDA 1RAEB 2D6FA 2FZCB 2XIDA 5LL6S 3G4ST 4M77F 1MMDA 2CP3A 4ZNXA 2EYZA 1HK9A 4J9CA 2AKKA 3JCMV 1HSQA 3X25B 1FMVA 3GF5A 4FYYB 1M3AA 5IN1A 4E7SA 4MMKA 3SHWA 1UGVA 3JSCA 2X4YA 3X20B 4HXJA 2L3QA 1FXXA 2GTJA 4HCBA 4TVRA 3V8JA 3OS1A 4HT9A 2EYQA 3OYCA 1H641 1PSFA 4HVVA 1PD0A 3SWNA 2DILA 4PJOA 3CPWA 2I0NA 4MDWA 1WA7A 4XTYA 2X4JA 2LDMA 2K2MA 4M75B 2LC4A 4ESRA 1GCQA 3I55A 3QJ6A 2K7AA 4DOWA 1RI0A 1YHQA 2RHXA 4PJOF 1QKXA 4JJDA 3J7AF 4C0DB 4OMLA 3P8DA 3FEOA 5GAN6 2F2VA 2VXFA 5D6XA 4MDXA 4QKUA 3CD6T 1WPYA 4LD9K 1T3LA 1GCQC 3I5RA 3RUXA 5L8RE 3E19A 2ZPEB 2EQJA 2FPFA 3L2WA 1VQPQ 2X4WA 2MWPA 5A0DA 1YCYA 1UG1A 3G7ZA 3VS0A 3M59A 1Q86C 2K3XA 1GBRA 1RI9A 4M7DA 1ZUYA 2GFAA 3I5SA 3PT9A 4M7DE 4VUBA 8AT1B 3O8VA 2F2XA 4XK8E 4FU6A 3SDZA 3PTAA 1UDLA 2EQKA 2RHUA 2K5FA 4M75E 2JM9A 1FYNA 1BI1A 4RTZA 1WJSA 2MMPA 5GAN3 3PFSA 3X28B 1VQ6A 1TU0B 1YN8A 1D3BA 3OYKA 1YJWQ 1KD1C 4BD3A 1PWTA 1K4US 5GANf 4RTYA 4HA8A 2NUTA 1NEGA 1JBMA 3M54A 3CEYA 4F17A 3THKA 1X2KA 3D7SB 1NJIC 2CT4A 3GIBA 1KJWA 4JRIA 1WXTA 4FW2A 4L5GA 1UJ0A 1OX8A 4LXCA 2P84A 1HYOA 3UDCA 4A63B 1RAFB 1UECA 2YLBA 4D8DA 4C92C 5FU6C 2OAUA 4ZTFA 2YUPA 1WXUA 1Q82C 4A54A 4BE0A 3HP9A 2CSQA 4HCKA 1OI1A 3WVEB 2VYTA 4XTWA 1K0SA 2R5AA 1KD1U 3OSVA 4AT1B 2BUDA 2VUBA 1K8AC 1SKUB 4LD6A 2BIVA 2F2WA 2BZXA 1D09B 2BZYA 3JCMQ 2MYSA 3DKMA 3V7RA 1ZBXA 2EKOA 2OTLA 1HD3A 3LWIA 1W6XA 3EFOA 4PJOC 1YWOA 5IXBA 1LNXA 5A2QE 2DVEA 3OMGA 3NTHA 1WZOA 1QVGA 1VQ9Q 4YTLA 5IH2A 4PL6A 1C0MA 5D6YA 5ECAA 2D0NA 3JCMb 2Y4YA 4B9WA 4M7DF 2DL3A 4C92E 1NG2A 4HT8A 4XTVA 1TXQA 3VU3C 1SSHA 2KDSA 1D0YA 1YJ9T 1K8AR 2E64A 4JS4A 2RK2A 5FU7C 3URGA 1UJYA 2AZVA 2QG9B 2ZAEA 4EMGA 1I0CA 1OPLA 3HL8A 5LJ5j 2X51A 3S6WA 3A1PA 4BY6C 3H0FA 2DXUA 1J3TA 2V1QA 2WACA 3JAME 2DL7A 5FLXE 1M3CA 3ER0A 2X35A 2P0QA 5GJVB 1XQHA 1M27C 5DLOA 4JRKA 1YJNQ 2VWFA 3CMET 1VQLT 4IIOA 1I5OB 1QCFA 2RK1A 2CH4A 3UATA 2DNUA 1SHGA 2FRWA 2YHTA 1WGSA 2K2VA 3GLXA 3TU4K 1LCKA 2PVOB 2O2OA 2HBWA 4EMKC 4OB3B 2RHYA 2EWNA 2QK0A 1QP3A 4IUPA 5KYWB 1VQMA 4WTOB 1OQKA 2F1LA 2F5KA 2HMAA 2DVJA 5GAN5 2D9TA 5GANh 3PNWC 3FRNA 3FIFA 3EGXB 3CC2Q 1PM3A 1N9RA 3SB2A 1VQKA 5GAMg 4FIBA 3ZL7C 2GNCA 2LQKA 2RJEA 3QWYA 2DAQA 5KYYB 4E47A 9ATCB 4PJOD 2DEQA 3CCSA 4JJCA 4M78C 4C8QD 2RJCA 4ELZC 1D0ZA 3C94A 2GFUA 1BIAA 5LJ3d 4M7AE 1D1BA 4P5NA 4J5YA 3C0CA 3JCMP 5LJ5e 2JVVA 3J80E 1VQ5T 4EIKA 2CP0A 4GLMA 3CMEA 2ZPFB 1GCPA 2K79A 3CCEA 3H8ZA 1N9SA 2MPXC 1M8MA 2BTTA 3QDFA 1N8RR 1OU8A 4BE1A 4M78A 3WVDB 1OZ3A 1QKWA 3RKYA 1QVGS 2XG8D 2E4HA 4C92G 5GAMj 4ANJA 1VQNT 3CCVA 1M4ZA 2P4RA 3J81E 4HCCA 4OMOA 1N8RU 3DLMA 3L2UA 3L1AA 3VYHB 3LH0A 3OS0A 1S72A 1A0NB 2JN0A 1KFZA 4CC2A 1NLOC 2L0AA 3CCUT 3V7SA 1VQMQ 2QQAA 1AVZC 1VIEA 2A0FB 1KQSP 3PMIA 1V1CA 5KE3A 5LJ3h 4PFZA 2C06A 1Q7YC 4M7DC 5LJ5d 2D8JA 2NUPA 4XU3A 2VVKA 3CCJQ 1U8RA 1EZZB 1G3WA 2E5KA 3UWNA 2XDDA 4RMOA 3OYGA 3SFMA 1SHFA 2CP6A 2GTOA 2OJ2A 1UHFA 2ESWA 3QWXX 2ED0A 2FVUA 4IKFA 3CD6A 3H41A 2VXEA 2Z0WA 3RBBB 4FT2A 5GAOp 2EVRA 2JW4A 2EYWA 3CD6Q 1WFWA 4M77E 2JJ9A 2K4YA 1KG1A 1ZSZA 3MP8A 2YLCA 1PSEA 1NBEB 3M57A 1YJ9Q 3DB4A 1E6GA 1H92A 4RTXA 1X01A 2OI3A 1C1AA 1O9SA 2QQRA 4OMQA 1VQLQ 1VQ7A 2EW3A 3R6NA 3H0IA 1Y57A 4FCYA 2KRNA 2NUZA 1M2OA 1MNEA 3WXMB 4BE2A 1YHQT 2COZA 3MHXA 3G6ET 5I2MA 4II1A 3CCRA 3HSBA 1OZ2A 1PRMC 3V8KA 4CRIA 3CC7T 2KBTA 2ZPBB 2C0TA 2AHJB 3TREA 1AWXA 2EYXA 3FC3A 4ME7A 1YJNT 4F14A 1M90U 2KK4A 2QEXT 2SRCA 1WQWA 2A3LA 3MJXA 2DMOA 2CP5A 3CCEQ 4N4GA 3LWHA 1M30A 1AD5A 4KUIA 2C0OA 2CKKA 4C5GA 2O01E 3CXCA 3HRUA 4MZMA 1JJ2S 3E9FA 1KIKA 3PE0A 1TWBA 1VQ4A 2DD4A 2DRMA 3JB9D 1RADB 4M7AD 5GMKe 1Q81R 4C5HA 4C8QG 2RN8A 3X26B 3CPWS 1VA7A 2JT4A 4M7DG 2FPEA 4PFPA 1BI2A 3M4YA 2QAZA 4M78G 3M9QA 2HNIA 1JJ2A 4LDVA 4QT7A 3JCMf 3UA7A 1Q81C 4WCIA 3A8GB 3M56A 4R0KA 2FL7A 4ZN1A 1GL5A 3CBMA 1M1GA 1TUGB 2ZPIB 2RQVA 3E9GA 5KYYA 2DL5A 1QCNA 2JMCA 3M0UA 4BB7A 3G4SA 1U1TA 1KQ2A 2AKLA 2PUKB 3JB9H 3JCMc 5FWCA 3KFVA 1N6AA 1PNJA 1MGQA 2DO3A 4JJBA 2QTVA 2RF0A 3CC7A 1KD1R 1MV0B 4BDYA 5KYXB 1T0HA 5CKEA 3KUFA 1D1AA 4HKEA 4KULA 5CK9A 3M58A 4R55A 2LNVA 3CC4Q 3OSSC 2P0KA 1M1FA 2L89A 3EFOB 3KXTA 2O4XA 3BW1A 5IXFA 4ORZA 3CCET 3CCUQ 4XU2A 4N0AC 3QHSA 3U23A 2HQHA 3VRZA 1YIJA 2NLUA 4GY5A 4PNOA 1EX4A 1X69A 4XTXA 5LJ3g 1VYVA 2QTXA 1VQ4T 1K9MU 3LW5E 5IHNA 1OU9A 5I22A 2JTMA 2DETA 1BYMA 2H3EB 1KQSS 5GMKh 2YT6A 4ZGEB 4XTZA 2KNBB 2RH2A 2LMJA 3OY9A 3CCMA 5LJ3e 4C8QF 1LVKA 3OBWA 1RAGB 3OQ5A 1YP5A 2DRKA 1IO6A 2DBKA 2JZ2A 1QVFP 2YUQA 3ME9A 2VC8A 2EQUA 4FT4A 3QG1A 3V8LA 1GFDA 2WSCE 2COYA 3HRTA 5CCAA 1LOJA 2K6DA 2O31A 3PGGA 4MZTA 2CYZB 3V7CA 4DEYA 1TOVA 2PTKA 4C8QA 1Y7XA 1QLYA 1ZA2B 1VQ4Q 3QO3A 2R58A 2RQRA 1ABQA 1YITT 3CC2A 3OW2P 2DXCA 3NFCA 3JCMW 3EG2A 4XU1A 1PD1A 4RG8A 4M75G 1AWJA 4A4HA 1ZHIA 1AZGB 2G3RA 3OYIA 1N5ZA 2K57A 1R77A 1G8XA 2YSQA 4E6RA 1WQ7A 4AFUC 1VQ5A 3CC2T 2JTEA 1X43A 3QJYA 2D1XA 3SD4A 1OEBA 4IUUA 4Q5WA 2PQWA 1H8KA 3CCRQ 2DE0X 3JCMg 1U5SA 1M5Q1 2CZ1B 1X6BA 3C12A 4D8KA 3I35A 3REAB 2GQIA 5HY6A 2CSIA 4DEXA 1LPLA 3OYEA 1M2VB 3VS4A 1W4SA 3IQLA 4ZN3A 1K9MR 1Q81U 4V2SA 1XOVA 2V8IA 4C0GA 4C5EA 3JCMh 1SF9A 3E2UA 3FDRA 1JJ2P 4MZPA 2YRCA 1WHLA 4OF1A 2XHCA 3OS2A 3CCMT 1Y0MA 2CZ0B 4OMPA 3G4SQ 3CCQQ 4GLKA 2ECZA 4FW1A 1ZSGA 1WJRA 3META 1RAAB 1K73U 1RLPC 3A8OB 3INZA 1SRMA 5GAOq 5CKHA 4XU0A 5GAOl 3CXCP 2AIRB 1TG0A 4M78B 2E6NA 2J6KA 2XDBA 1X27A 4QVZA 2OX7A 4BI4A 4IUVA 3VV0A 4E7JA 5A0GA 3Q1JA 4FM4B 4JRQA 2O88A 2DPPB 1WHGA 3CMEQ 5C6SA 4C92F 2OTJA 3I56Q 1X2QA 2RJDA 3H0HA 2X4XA 1KHCA 4F7UB 1YI2Q 2M51A 3JCMe 4M75A 3GP8A 1AT1B 4C0DC 5GANg 2ROLA 4M4ZA 1JXOA 2E12A 3QXEB 3M0QA 4KUDK 3CCVQ 1MUZA 3QUIA 4OMFB 5IHIA 4OB1B 3OYAA 4C92A 1U1SA 1WXBA 2DBMA 4PFOA 3LYIA 5FROA 5GAMd 1VQ9A 3QZ5B 1FX7A 2O4XB 1OOTA 2RB6A 2XKOC 2LT4A 4KGZB 1O75A 2PUOB 2XK0A 3LX7A 5CKFA 1MMAA 1CKAA 1VYUA 1JU5C 2LRQA 2BZ8A 2RHIA 3G71T 4M78D 4C8QC 1VOMA 2QEXQ 3A8LB 3AT1B 4KBMB 3UPUA 2EQIA 3HPWA 5IAYA 4GBQA 2RI2A 4M7AB 4JJNK 2HL3A 3UF4A 4J9EA 1M90R 1VQLA 1G83A 2HCKA 1UEBA 2QGFB 4NL2A 3JCMJ 3JB9I 1X6OA 2LP5A 2LZ6B 2RNAA 3A8HB 5FRNA 2QXFA 4PKCC 5C0MA 1W2BP 1WHMA 2K5IA 1VYTA 2YRVA 2WSEE 1Q7YU 2X3XD 1UFFA 5FRMA 1N27A 2Y90A 2AK5A 2YUOA 3C95A 3EGDB 3JCMX 4J9BA 1RL2A 1KC8C 1Q95G 1VQMT 2DTHA 4M75D 3G71Q 2V1RA 2DK3A 1SSFA 3PVQA 2H8HA 1I81A 2FPDA 4LDUA 3RESA 3FLGA 2JM8A 6AT1B 4RTVA 4LDXA 2KT1A 3MCAB 3RERA 1VQNQ 1FMKA 1RUWA 5IT9E 1XNIA 4Z89A 3LLRA 2RJFA 1KK7A 2V26A 3QSUA 2CP7A 5FW9A 2QA4Q 2YWWA 1P92A 5CVIA 2F69A 5GAN8 2J06A 1WHHA 2JTFA 2FEIA 2OTJQ 2RD1A 1WDXA 2J7IA 2O9SA 3I9QA 5KE2A 2A36A 2LX9A 3CQTA 1VQNA 4PJOB 2V8KA 2ZPHB 5LJ5g 5GANd 4HVUA 1YCSB 5HK3A 2LX7A 3C4SA 3SWNB 1SPKA 1TUCA 3NHNA 2JS0A 3HKSA 3OYBA 1IB8A 2XMFA 1OPKA 2RI5A 4LN2A 4EDUA 1X6GA 2W0ZA 1AHJB 2R5MA 2EJ9A 1T3SA 4KT0E 4PJOE 3A5ZB 4JDSA 1NPRA 1E7OA 3OYMA 2HZYA 2J6FA 3EHQA 2KE9A 3CCLT 3LH5A 1ARKA 2QQSA 3RKWA 2JMAA 2YRDA 1XJWB 2DL8A 2KXDA 1UE9A 3CXCS 2ATCB 3VS1A 1K73C 2DZ9A 1B34B 3OYNA 2DL4A 2HBPA 4HCZA 4OP0A 2OTLQ 3VS3A 2EBPA 3NTKA 2KROA 2HSEB 4J6XA 4BI8B 1K73R 1YITQ 3DB3A 1UUEA 5L23A 2D8HA 3EG3A 3RMQA 3HHTB 3EH1A 2EIFA 1BB9A 4LE9A 5LJ3j 1BKBA 4DBRA 1YITA 4M7DB 3EGUA 3OYLA 2P0PA 1R8OB 3FJPA 4NOYA 1BI0A 2QQ9A 4LDWA 2VGNA 4RTWA 4J7IA 1K8AU 3LGLA 3NTIA 4M75F 2M16A 2Y4XA 2J05A 2VGMA 1K9AA 3OYJA 1MHNA 2CZ6B 2E10A 1AZEA 4FYVB 4QQ6A 2L3RA 3CMAT 3O5ZA 2O9VA 2K9GA 5LJ3f 2M9UA 2M02A 1Q82U 2JUFA 5KYWA 2EGCA 1MMNA 5IHKA 4C8QB 4AMCA 2G6FX 3ASKA 3QZ9B 3QYGB 2RHZA 2RQUA 4FL6A 1VQPA 2GBQA 4J9HA 5AT1B 1K1ZA 4ZGJB 1NM7A 1YJWA 3KBGA 3EG1A 4R56A 1B7TA 4PJJA 1H3ZA 1VQ6Q 3VS2A 3QPHA 2DJQA 2DTIA 2CDTA 4E2FB 2IG0A 2XICA 3CCMQ 3OA6A 5FU7B 4F16A 1S72T 5D6WA 4AFSC 1G3SA 1K76A 4RUGA 4PJLA 3M4GA 2E70A 4EMHA 4ATOA 1QQJA 3JB9F 1UGSB 5KH6A 1Y96A 2IVWA 1ZQ1A 2FB7A 2KVQG 1VUBA 2V8JA 4XAXB 2MOXA 1QCOA 1Z9QA 4F04B 4RTTA 3TEEA 3TCJA 3CC4A 1FMWA 2RQWA 3TSZA 1NJIR 2MF2A 1YI2T 4C0ZA 1YNZA 1K9MC 3I55Q 1PKTA 3MEVA 3CCQA 1VQOT 1RABB 2YXYA 3GBQA 4BI3A 4LDYA 2IIMA 2VKNA 3QDRB 5LJ5h 1NJIU 1QP2A 3CCST 1AOJA 3GPLA 2E3IA 4A4KA 4X34A 2L2PA 3QIIA 1VQ5Q 2DLPA 2FYKA 2DZCA 2JXBA 4A4GA 5HCKA 3S3OA 2AZSA 4J6WA 3N5BB 1CSKA 1MV3A 4IUQA 5CO7A 3EH2A 1IXDA 3GNGA 1V29B 2ED1A 3G6EA 2PVGB 5CR2A 1QVPA 4J6YA 3JB9G 1UTIA 2KGTA 1XTDA 1UGRB 2E65A 4KGXB 1WNLA 2I2LA 2QEXA 3F70A 3L2VA 4M77C 1UHCA 1Q86U 2DXTA 1HXDA 1ZSZB 5I21A 2CUBA 2DJZA 2QASA 5KCHA 1K0XA 2E6ZA 4PLIA 1V76A 7AT1B 5DM7R 2HQEA 1YI2A 3MP1A 4QQGA 3I56A 3MP6A 4PJNA 2FRYA 1IREB 2LJ1A 1VQOA 1PHTA 1M1KC 2WSFE 3MPUB 2L5QA 2QA4A 4L59A 2OTLT 3M0RA 4B6MA 2KMTA 1AWOA 3L2RA 4M75C 3CC4T 1PC0A 1PRLC 1FWZA 4J9FA 4LUEA 2EAYA 5KYUB 1YIJQ 2QQBA 2COWA 4F7UE 4JZ4A 4RTUA 1KQ1A 2LQNA 4JLGA 4OB2B 3NMZC 1IZ6A 4A4FA 2HD0A 1X75C 2KY9A 4O6JA 5EG2A 2J6OA 2HKQB 5AYFA 3QBYA 2MI6A 2L8DA 5CQYA 3EFSA 4Z88A 1U06A 1ZUUA 1M3BA 1VQ6T 4BY6B 1T0JA 3JB9J 3DLLA 2SEMA 1IRXA 4RG2A 4J7FA 4CC3A 1QWFA 3OYYA 1QVGP 3OMCA 1MNDA 4UC4A 2QGGA 1JXMA 1SEMA 2A37A 4J9DA 4M77A 4OGCA 3EG9A 2ROTA 4PK4A 1YJWT 1DJ7B 4IUTA 1E6HA 4XTUA 4MMLA 2E5QA 1ZA1B 2BE9B 1KSWA 2DA9A 1PCXA 5GAOr 1VQ8A 4KH1B 1W1FA 3M0TA 1WHKA 4KRTA 1LJOA 4QVDA 1WJQA 3ZEHA 1SRLA 3VS7A 3OYHA 5CQXA 1Y96B 2VV5A 3EAEA 2M0OA 5GAN2 4Y28E 5LJ5f 1R0CB 5GJWB 2R57A 2RA2A 4JZ3A 1JO8A 1OV3A 4JS5A 1I4K1 1KQSA 5KYXA 2ZCFB 4LNPA 2B8AA 3QKJA 4Y91A 3VJPA 3S3MA 5DLQE 4ELYC 2KRMA 2XU8A 2DIGA 1YWPA 1WLPB 3JCMd 4CC7A 2RQTA 4QW2A 1I5LA 3EHRA 1QWEA 4EPCA 1Y71A 3FB9A 1VQ7Q 3CCQT 4Y92A 5DY9A 3P8HA 2CREA 1NE8A 2EJFA 4AFQC 2DTOA 2K3BA 2MCNA 1BCMA 4C8QE 4X9DA 4EMKA 3S3NA 5GMKi 2DM1A 1YJ9A 4CI0C 2VASA 3A8MB 1JB0E 5KYNA 2M0YA 1B34A 2PZ1A 2LVMA 4JRPA 3ZFJA 2BKDN 4B9XA 2A28A 4XQ3A 3L2ZA 1EIFA 4DBQA 4NS5A 3RMSA 1TTHB 1RACB 1Q86R 2PNIA 3QYHB 1F1BB 2XI9A 2RM4A 4O5VA 4FSSA 1RAIB 5GAOn 5CAIA 1TS9A 3ULRB 1VQ7T 2E41A 3VUBA 2A7YA 3REBB 3UT1A 3G1JA 1ABOA 2KAFA 5FWBA 1QMCA 1GFCA 4ZGDB 5I11A 3CC7Q 2CZ7B 3CCVT 1AEYA 4OMMA 1W2BS 4FSXA 1OX9A 4DBFA 3TSWA 1M1KU 5D7UA 5CKDA 2X3WD 1ZSZC 4IIMA 4Z02A 1VQPT 4X9CA 3MEUA 2HKNA 2E1HA 3E1SA 4OMNA 5M9OA 2HL5C 2F5TX 2DFUA 3L42A 1UGQB 3I56T 2KEAA 4E7HA 2DD5A 2HEQA 2LCLA 1NPPA 2D0QB 4LUDA 3CCLQ 1OYXA 4M77G 1ACMB 2HDAA 2QDYB 3HRSA 1S72Q 2M1HA 4KH0B 1N8RC 1JQQA 2AT1B 5KYUA 1GXIE 4OGEA 3L2QA 3JRZA 1U3OA 4E7IA 1W2BA 2MWOA 3LGFA 2ABLA 2EPDA 1G3TA 4CC4B 4A4EA 4ZTJA 3M0PA 2H3JA 3CMAA 5GAMf 3CCJT 4QQDA 3T9NA 3VRYA 2DIQA 1WIEA 1VIFA 2NUPB 3M53A 4C92D 3M55A 4J9IA 3VS6A 2GGRA 3OS5A 4J9GA 2DEUA 2L3SA 4PLLA 3BDLA 3A98A 4Z8AA 2JNGA 2LQWA 4J8OA 1NEBA 2L3PA 1PKSA 5GMKl 3TQ7P 2CT3A
chains in the Genus database with same CATH topology
2FG0A 1UJ0A 2LJ3A 2RQUA 2GBQA 4A63B 4J9HA 1K1ZA 1NYGA 1UECA 1X69A 1NM7A 3EG1A 4D8DA 3VS2A 2KYMA 1VYVA 2YUPA 2DJQA 1WXUA 2CDTA 5IHNA 5I22A 2NWMA 4F16A 2EGEA 2CSQA 2DX1A 4HCKA 2YT6A 4AFSC 2KNBB 4X1VA 1K76A 2LMJA 4RUGA 1K0SA 1YP5A 2DRKA 1IO6A 2DBKA 2MIOA 2YUQA 3M0SA 2F2WA 2BZXA 1GFDA 2BZYA 2MOXA 2K6DA 1Z9QA 1HD3A 1W6XA 2O31A 1RLQC 4RTTA 2JS2A 4DEYA 1YWOA 5IXBA 1GBQA 3UA6A 2LCSA 2RQWA 2PTKA 3TSZA 1QLYA 5IH2A 1G2BA 5ECAA 1YNZA 2D0NA 1PKTA 2DL3A 1Z9ZA 2RQRA 1NG2A 3GBQA 1ABQA 1SSHA 2LNHB 2ENMA 2IIMA 2VKNA 4JPBW 3EG2A 1AWJA 2DYBA 2YUNA 1AZGB 1AOJA 1AWWA 2OAWA 1N5ZA 1B3QA 1EFNA 2KYBA 1UJYA 2L2PA 2YSQA 2AZVA 2DLPA 4E6RA 1I0CA 2JXBA 1OPLA 5HCKA 4AFUC 2AZSA 2EGAA 2JTEA 1CSKA 1X43A 1GRIA 1MV3A 2D1XA 1OEBA 1NLPC 1H8KA 2CH4W 3FJ5A 3H0FA 2DE0X 1J3TA 1I1JA 1U5SA 2V1QA 1X6BA 2ED1A 4D8KA 3I35A 2DL7A 3REAB 2GQIA 1M3CA 2CSIA 4DEXA 5GJVB 3VS4A 1M27C 1JEGA 3IQLA 1UTIA 2KGTA 1ZLMA 1I07A 2VWFA 1ZX6A 1XOVA 4IIOA 1QCFA 2CH4A 3UATA 2DNUA 3JV3A 4HVWA 1UHCA 3TVTA 1SHGA 2FRWA 2B86A 1TUDA 1NYFA 2KR3A 2CUBA 1Y0MA 4OMPA 1LCKA 2ECZA 2O2OA 1K0XA 1ZSGA 2HBWA 2EYYA 3NPFA 2HSPA 1RLPC 1SRMA 2FRYA 2LJ1A 1PHTA 1TG0A 2DVJA 2J6KA 2QDLA 2A08A 4AFZC 1X27A 3M0RA 1AWOA 1B07A 2O88A 1PRLC 4J9FA 4LUEA 1CKBA 2C0IA 1H3HA 1X2QA 3H0HA 3EG0A 3SEMA 2KRSA 3ZL7C 2GNCA 2M51A 4JZ4A 4RTUA 2LQNA 3QWYA 3NMZC 2RMOA 1S1NA 2ROLA 4M4ZA 2J6OA 4JJCA 1JXOA 3M0QA 4Z88A 1MUZA 2W10A 1U06A 5IHIA 1ZUUA 1M3BA 2FO0A 2LJ0A 3C0CA 1WXBA 1T0JA 2DBMA 4AG2C 1HJDA 5EC7A 2SEMA 4EIKA 1OOTA 4GLMA 2KT8A 4CC3A 1QWFA 1GCPA 2K79A 1BBZA 1CKAA 1VYUA 1JU5C 1JXMA 1M8MA 2BTTA 2BZ8A 1SEMA 2A37A 4J9DA 1QKWA 2ROTA 3PVLA 2EQIA 4GBQA 1BU1A 1E6HA 3UF4A 4J9EA 2P4RA 4OMOA 1G83A 2EKHA 2HCKA 1KSWA 2DA9A 2DF6A 1W1FA 1A0NB 1ZBJA 2LP5A 1KFZA 3M0TA 1WX6A 4CC2A 4KRTA 2KXCA 3NGPA 2LZ6B 1NLOC 2RNAA 2L0AA 1AVZC 1SRLA 3VS7A 1V1CA 1VYTA 1W70A 2X3XD 1UFFA 5GJWB 2AK5A 2D8JA 2YUOA 4J9BA 4JZ3A 1JO8A 2YDLA 2VVKA 1OV3A 4K11A 4AG1C 3RNJA 1BK2A 2E5KA 1ZUKA 1WYXA 4LNPA 2RPNA 2V1RA 1SHFA 2GTOA 2OJ2A 1UHFA 3PVQA 3VS5A 2ESWA 2H8HA 3QWXX 1WI7A 2ED0A 2KRMA 2FPDA 2JM8A 1YWPA 1WLPB 4RTVA 3H41A 4CC7A 2RQTA 2KT1A 3EHRA 3RBBB 1FMKA 1QWEA 1RUWA 4Z89A 2CUDA 2EVRA 2JW4A 2EYWA 1WFWA 4Y92A 2CREA 4AFQC 2K3BA 2MCNA 4ZNXA 2EYZA 4J9CA 2AKKA 5FW9A 2DM1A 1E6GA 1H92A 4RTXA 1HSQA 2OI3A 1M3AA 2J06A 2M0YA 2FEIA 4OMQA 3SHWA 1WDXA 2J7IA 2PZ1A 1UGVA 2EW3A 2O9SA 3I9QA 2A36A 3R6NA 3H0IA 4HXJA 1Y57A 2A28A 2KRNA 2L3QA 3CQTA 2GTJA 2NUZA 2PNIA 4HVVA 2DILA 4FSSA 4HVUA 1YCSB 2I0NA 2LX7A 1PRMC 1SPKA 1TUCA 3NHNA 1WA7A 2JS0A 3ULRB 2K2MA 2KBTA 2C0TA 1AWXA 2EYXA 2XMFA 3REBB 1OPKA 4ESRA 1ABOA 4F14A 5FWBA 4LN2A 1GCQA 1GFCA 1X6GA 5I11A 1AEYA 2SRCA 2K7AA 2W0ZA 4OMMA 3TSWA 1T3SA 2X3WD 2DMOA 4IIMA 1E7OA 2J6FA 1QKXA 3EHQA 2KE9A 4JJDA 1M30A 3LH5A 1AD5A 1ARKA 4OMLA 2C0OA 2JMAA 2DL8A 2F2VA 2KXDA 1UE9A 4OMNA 1KIKA 3PE0A 1T3LA 2DRMA 3VS1A 2KEAA 1GCQC 3I5RA 2HEQA 2RN8A 2FPFA 1VA7A 2JT4A 4LUDA 2DL4A 2FPEA 3VS3A 2HDAA 2EBPA 2KROA 4QT7A 1UG1A 1JQQA 3UA7A 4WCIA 3VS0A 1UUEA 5L23A 2D8HA 3EG3A 4R0KA 1GBRA 1RI9A 1GL5A 1BB9A 4LE9A 1ZUYA 1U3OA 2RQVA 3I5SA 3EGUA 2ABLA 2EPDA 2DL5A 2F2XA 2JMCA 3M0UA 4CC4B 3M0PA 1UDLA 2AKLA 4RTWA 2JM9A 1FYNA 4RTZA 5FWCA 3KFVA 1PNJA 4JJBA 3VRYA 2J05A 1K9AA 2RF0A 1WIEA 1YN8A 4J9IA 1PWTA 1MV0B 1K4US 4RTYA 1AZEA 1T0HA 3VS6A 2GGRA 4J9GA 2L3SA 1NEGA 3O5ZA 2O9VA 4F17A 2K9GA 3A98A 1X2KA 4Z8AA 3THKA 5IXFA 2CT4A 4ORZA 1KJWA 2LQWA 2EGCA 1NEBA 2L3PA 5IHKA 1PKSA 2G6FX 1WXTA 3U23A 3VRZA 2CT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FG0 A;  1UJ0 A;  2LJ3 A;  2RQU A;  2GBQ A;  4A63 B;  4J9H A;  1K1Z A;  1NYG A;  1UEC A;  1X69 A;  1NM7 A;  3EG1 A;  4D8D A;  3VS2 A;  2KYM A;  1VYV A;  2YUP A;  2DJQ A;  1WXU A;  2CDT A;  5IHN A;  5I22 A;  2NWM A;  4F16 A;  2EGE A;  2CSQ A;  2DX1 A;  4HCK A;  2YT6 A;  4AFS C;  2KNB B;  4X1V A;  1K76 A;  2LMJ A;  4RUG A;  1K0S A;  1YP5 A;  2DRK A;  1IO6 A;  2DBK A;  2MIO A;  2YUQ A;  3M0S A;  2F2W A;  2BZX A;  1GFD A;  2BZY A;  2MOX A;  2K6D A;  1Z9Q A;  1HD3 A;  1W6X A;  2O31 A;  1RLQ C;  4RTT A;  2JS2 A;  4DEY A;  1YWO A;  5IXB A;  1GBQ A;  3UA6 A;  2LCS A;  2RQW A;  2PTK A;  3TSZ A;  1QLY A;  5IH2 A;  1G2B A;  5ECA A;  1YNZ A;  2D0N A;  1PKT A;  2DL3 A;  1Z9Z A;  2RQR A;  1NG2 A;  3GBQ A;  1ABQ A;  1SSH A;  2LNH B;  2ENM A;  2IIM A;  2VKN A;  4JPB W;  3EG2 A;  1AWJ A;  2DYB A;  2YUN A;  1AZG B;  1AOJ A;  1AWW A;  2OAW A;  1N5Z A;  1B3Q A;  1EFN A;  2KYB A;  1UJY A;  2L2P A;  2YSQ A;  2AZV A;  2DLP A;  4E6R A;  1I0C A;  2JXB A;  1OPL A;  5HCK A;  4AFU C;  2AZS A;  2EGA A;  2JTE A;  1CSK A;  1X43 A;  1GRI A;  1MV3 A;  2D1X A;  1OEB A;  1NLP C;  1H8K A;  2CH4 W;  3FJ5 A;  3H0F A;  2DE0 X;  1J3T A;  1I1J A;  1U5S A;  2V1Q A;  1X6B A;  2ED1 A;  4D8K A;  3I35 A;  2DL7 A;  3REA B;  2GQI A;  1M3C A;  2CSI A;  4DEX A;  5GJV B;  3VS4 A;  1M27 C;  1JEG A;  3IQL A;  1UTI A;  2KGT A;  1ZLM A;  1I07 A;  2VWF A;  1ZX6 A;  1XOV A;  4IIO A;  1QCF A;  2CH4 A;  3UAT A;  2DNU A;  3JV3 A;  4HVW A;  1UHC A;  3TVT A;  1SHG A;  2FRW A;  2B86 A;  1TUD A;  1NYF A;  2KR3 A;  2CUB A;  1Y0M A;  4OMP A;  1LCK A;  2ECZ A;  2O2O A;  1K0X A;  1ZSG A;  2HBW A;  2EYY A;  3NPF A;  2HSP A;  1RLP C;  1SRM A;  2FRY A;  2LJ1 A;  1PHT A;  1TG0 A;  2DVJ A;  2J6K A;  2QDL A;  2A08 A;  4AFZ C;  1X27 A;  3M0R A;  1AWO A;  1B07 A;  2O88 A;  1PRL C;  4J9F A;  4LUE A;  1CKB A;  2C0I A;  1H3H A;  1X2Q A;  3H0H A;  3EG0 A;  3SEM A;  2KRS A;  3ZL7 C;  2GNC A;  2M51 A;  4JZ4 A;  4RTU A;  2LQN A;  3QWY A;  3NMZ C;  2RMO A;  1S1N A;  2ROL A;  4M4Z A;  2J6O A;  4JJC A;  1JXO A;  3M0Q A;  4Z88 A;  1MUZ A;  2W10 A;  1U06 A;  5IHI A;  1ZUU A;  1M3B A;  2FO0 A;  2LJ0 A;  3C0C A;  1WXB A;  1T0J A;  2DBM A;  4AG2 C;  1HJD A;  5EC7 A;  2SEM A;  4EIK A;  1OOT A;  4GLM A;  2KT8 A;  4CC3 A;  1QWF A;  1GCP A;  2K79 A;  1BBZ A;  1CKA A;  1VYU A;  1JU5 C;  1JXM A;  1M8M A;  2BTT A;  2BZ8 A;  1SEM A;  2A37 A;  4J9D A;  1QKW A;  2ROT A;  3PVL A;  2EQI A;  4GBQ A;  1BU1 A;  1E6H A;  3UF4 A;  4J9E A;  2P4R A;  4OMO A;  1G83 A;  2EKH A;  2HCK A;  1KSW A;  2DA9 A;  2DF6 A;  1W1F A;  1A0N B;  1ZBJ A;  2LP5 A;  1KFZ A;  3M0T A;  1WX6 A;  4CC2 A;  4KRT A;  2KXC A;  3NGP A;  2LZ6 B;  1NLO C;  2RNA A;  2L0A A;  1AVZ C;  1SRL A;  3VS7 A;  1V1C A;  1VYT A;  1W70 A;  2X3X D;  1UFF A;  5GJW B;  2AK5 A;  2D8J A;  2YUO A;  4J9B A;  4JZ3 A;  1JO8 A;  2YDL A;  2VVK A;  1OV3 A;  4K11 A;  4AG1 C;  3RNJ A;  1BK2 A;  2E5K A;  1ZUK A;  1WYX A;  4LNP A;  2RPN A;  2V1R A;  1SHF A;  2GTO A;  2OJ2 A;  1UHF A;  3PVQ A;  3VS5 A;  2ESW A;  2H8H A;  3QWX X;  1WI7 A;  2ED0 A;  2KRM A;  2FPD A;  2JM8 A;  1YWP A;  1WLP B;  4RTV A;  3H41 A;  4CC7 A;  2RQT A;  2KT1 A;  3EHR A;  3RBB B;  1FMK A;  1QWE A;  1RUW A;  4Z89 A;  2CUD A;  2EVR A;  2JW4 A;  2EYW A;  1WFW A;  4Y92 A;  2CRE A;  4AFQ C;  2K3B A;  2MCN A;  4ZNX A;  2EYZ A;  4J9C A;  2AKK A;  5FW9 A;  2DM1 A;  1E6G A;  1H92 A;  4RTX A;  1HSQ A;  2OI3 A;  1M3A A;  2J06 A;  2M0Y A;  2FEI A;  4OMQ A;  3SHW A;  1WDX A;  2J7I A;  2PZ1 A;  1UGV A;  2EW3 A;  2O9S A;  3I9Q A;  2A36 A;  3R6N A;  3H0I A;  4HXJ A;  1Y57 A;  2A28 A;  2KRN A;  2L3Q A;  3CQT A;  2GTJ A;  2NUZ A;  2PNI A;  4HVV A;  2DIL A;  4FSS A;  4HVU A;  1YCS B;  2I0N A;  2LX7 A;  1PRM C;  1SPK A;  1TUC A;  3NHN A;  1WA7 A;  2JS0 A;  3ULR B;  2K2M A;  2KBT A;  2C0T A;  1AWX A;  2EYX A;  2XMF A;  3REB B;  1OPK A;  4ESR A;  1ABO A;  4F14 A;  5FWB A;  4LN2 A;  1GCQ A;  1GFC A;  1X6G A;  5I11 A;  1AEY A;  2SRC A;  2K7A A;  2W0Z A;  4OMM A;  3TSW A;  1T3S A;  2X3W D;  2DMO A;  4IIM A;  1E7O A;  2J6F A;  1QKX A;  3EHQ A;  2KE9 A;  4JJD A;  1M30 A;  3LH5 A;  1AD5 A;  1ARK A;  4OML A;  2C0O A;  2JMA A;  2DL8 A;  2F2V A;  2KXD A;  1UE9 A;  4OMN A;  1KIK A;  3PE0 A;  1T3L A;  2DRM A;  3VS1 A;  2KEA A;  1GCQ C;  3I5R A;  2HEQ A;  2RN8 A;  2FPF A;  1VA7 A;  2JT4 A;  4LUD A;  2DL4 A;  2FPE A;  3VS3 A;  2HDA A;  2EBP A;  2KRO A;  4QT7 A;  1UG1 A;  1JQQ A;  3UA7 A;  4WCI A;  3VS0 A;  1UUE A;  5L23 A;  2D8H A;  3EG3 A;  4R0K A;  1GBR A;  1RI9 A;  1GL5 A;  1BB9 A;  4LE9 A;  1ZUY A;  1U3O A;  2RQV A;  3I5S A;  3EGU A;  2ABL A;  2EPD A;  2DL5 A;  2F2X A;  2JMC A;  3M0U A;  4CC4 B;  3M0P A;  1UDL A;  2AKL A;  4RTW A;  2JM9 A;  1FYN A;  4RTZ A;  5FWC A;  3KFV A;  1PNJ A;  4JJB A;  3VRY A;  2J05 A;  1K9A A;  2RF0 A;  1WIE A;  1YN8 A;  4J9I A;  1PWT A;  1MV0 B;  1K4U S;  4RTY A;  1AZE A;  1T0H A;  3VS6 A;  2GGR A;  4J9G A;  2L3S A;  1NEG A;  3O5Z A;  2O9V A;  4F17 A;  2K9G A;  3A98 A;  1X2K A;  4Z8A A;  3THK A;  5IXF A;  2CT4 A;  4ORZ A;  1KJW A;  2LQW A;  2EGC A;  1NEB A;  2L3P A;  5IHK A;  1PKS A;  2G6F X;  1WXT A;  3U23 A;  3VRZ A;  2CT3 A; 
#chains in the Genus database with same CATH topology
 2GCX A;  2FG0 A;  4QVC A;  1WHJ A;  1OUL A;  2LJ3 A;  4DOV A;  3CCL A;  4BAC A;  2EFI A;  1NYG A;  1YBY A;  1TSF A;  1IGQ A;  4L6V 5;  2KYM A;  3CBP A;  2VB6 A;  4J83 A;  2NWM A;  2BE7 D;  2EGE A;  3ZBD A;  2DX1 A;  2FHD A;  5HKC A;  4X1V A;  3MO8 A;  1VQ8 Q;  1YFN A;  3RKX A;  4M78 F;  3CCU A;  4WF2 A;  3OYF A;  2DKG A;  5GAN e;  2MIO A;  1QVF A;  2RI3 A;  2DXB A;  3M0S A;  1G5V A;  1IHW A;  5GAN j;  2XDP A;  5GAN 7;  1QVF S;  1NZ9 A;  2NUT B;  1MMG A;  4N4I A;  1RLQ C;  2X9H A;  2JS2 A;  1GBQ A;  3UA6 A;  2LCS A;  4C0F A;  1KC8 R;  3OB9 A;  3OW2 S;  2PVD B;  1G2B A;  3CCJ A;  2KQW A;  2GQV A;  1Z9Z A;  1M9S A;  3PIP A;  2LNH B;  5FU6 B;  5HK0 A;  4EMK B;  2ENM A;  2ZZD A;  3BFM A;  2XD0 A;  4M7A C;  2ZGW A;  2LQ8 A;  4JPB W;  2E3H A;  2DYB A;  1KHI A;  1KC8 U;  2YUN A;  4N0A A;  1AWW A;  2OAW A;  1B3Q A;  1EFN A;  2KYB A;  1VQO Q;  1RAH B;  1YIJ T;  4M7D D;  3BDU A;  2RO0 A;  4M7A G;  1D0X A;  2EGA A;  1Y07 A;  1GRI A;  1G3Y A;  1NLP C;  3EGD A;  3GOX A;  2CH4 W;  3FJ5 A;  1Q82 R;  5CIU A;  2NYS A;  1I1J A;  5KCO A;  1IHV A;  4A53 A;  4DQ2 A;  3CCR T;  3RR6 A;  2P4T A;  1JEG A;  2LT1 A;  1ZLM A;  1I07 A;  5GMK j;  1ZX6 A;  3BE3 A;  3JV3 A;  4HVW A;  5GAO m;  3TVT A;  3P8B B;  3CCS Q;  3G71 A;  2B86 A;  1TUD A;  4M78 E;  3G6E Q;  1NYF A;  2CP2 A;  4DBH A;  2KR3 A;  2MAM A;  4E7K A;  3BY7 A;  3CMA Q;  4FYX B;  1PG5 B;  4E7L A;  5GMK m;  5J26 A;  5GAN 4;  3M5A A;  2EYY A;  3NPF A;  2HSP A;  3RDV A;  1VQK Q;  4D6W A;  5GAM h;  3CBO A;  4BDZ A;  1JRI A;  1R0B G;  4F7U G;  3SWN C;  5GAM e;  3HTR A;  2QDL A;  4M77 B;  2A08 A;  3EG9 B;  3R6O A;  4AFZ C;  1TH7 A;  8ATC B;  1QW1 A;  5J3B A;  1B07 A;  2KSS A;  1M90 C;  1UB4 A;  1CKB A;  4M77 D;  2HQX A;  3CPF A;  2C0I A;  4F7U A;  1H3H A;  2K3Y A;  1IGU A;  5I2S A;  3H6Z A;  3EG0 A;  3PMT A;  2DYI A;  3SEM A;  2KRS A;  4IUR A;  1VQ9 T;  3GNF B;  3HFO A;  2QA4 T;  2RMO A;  4BUG A;  1S1N A;  4KGV B;  1I8F A;  2JOY A;  2W10 A;  3MKD A;  4E7Z A;  1VQK T;  2FO0 A;  2LJ0 A;  2QI2 A;  1BI3 A;  3VKI A;  2K5L A;  3MEA A;  4AG2 C;  3OW2 A;  3RIR A;  1HJD A;  5EC7 A;  4OVA A;  1BIB A;  2MK5 A;  1D3B B;  5A0L A;  4C92 B;  3X24 B;  2EJG A;  2KT8 A;  4DA4 A;  2EQM A;  3OBY A;  2FZG B;  5J39 A;  1BBZ A;  3AHU A;  3MEW A;  1VQ8 T;  4PJM A;  3VUZ A;  4NL3 A;  2HAX A;  1BCO A;  4N4H A;  3PVL A;  3OYD A;  1M1K R;  1YJN A;  4JLI A;  3PIO A;  2QYZ A;  2KI7 A;  1BU1 A;  3EGX A;  2FZK B;  1M8V A;  2EKH A;  4M7A A;  2DF6 A;  1ZBJ A;  1WX6 A;  4RKU E;  4JUV A;  2KXC A;  3NGP A;  2DER A;  1C6V X;  4RCB A;  2LCC A;  1UGP B;  1SG5 A;  4C5I A;  1W70 A;  5CKB A;  3I55 T;  3HFN A;  2CGH A;  3H9N A;  2CS7 A;  2YDL A;  4K11 A;  4AG1 C;  4M7A F;  3RNJ A;  1BK2 A;  4RCC A;  2PU9 B;  2GF7 A;  1ZUK A;  1WYX A;  2ZPG B;  3EFR A;  2RPN A;  2IPO B;  2LTO A;  4FYW B;  3VS5 A;  1YHQ Q;  4PJO G;  1M2V A;  1WI7 A;  3CPW P;  1D1C A;  1Q7Y R;  4OB0 B;  4F7U F;  3VYG A;  2OTJ T;  2CUD A;  1RAE B;  2D6F A;  2FZC B;  2XID A;  5LL6 S;  3G4S T;  4M77 F;  1MMD A;  2CP3 A;  4ZNX A;  2EYZ A;  1HK9 A;  4J9C A;  2AKK A;  3JCM V;  1HSQ A;  3X25 B;  1FMV A;  3GF5 A;  4FYY B;  1M3A A;  5IN1 A;  4E7S A;  4MMK A;  3SHW A;  1UGV A;  3JSC A;  2X4Y A;  3X20 B;  4HXJ A;  2L3Q A;  1FXX A;  2GTJ A;  4HCB A;  4TVR A;  3V8J A;  3OS1 A;  4HT9 A;  2EYQ A;  3OYC A;  1H64 1;  1PSF A;  4HVV A;  1PD0 A;  3SWN A;  2DIL A;  4PJO A;  3CPW A;  2I0N A;  4MDW A;  1WA7 A;  4XTY A;  2X4J A;  2LDM A;  2K2M A;  4M75 B;  2LC4 A;  4ESR A;  1GCQ A;  3I55 A;  3QJ6 A;  2K7A A;  4DOW A;  1RI0 A;  1YHQ A;  2RHX A;  4PJO F;  1QKX A;  4JJD A;  3J7A F;  4C0D B;  4OML A;  3P8D A;  3FEO A;  5GAN 6;  2F2V A;  2VXF A;  5D6X A;  4MDX A;  4QKU A;  3CD6 T;  1WPY A;  4LD9 K;  1T3L A;  1GCQ C;  3I5R A;  3RUX A;  5L8R E;  3E19 A;  2ZPE B;  2EQJ A;  2FPF A;  3L2W A;  1VQP Q;  2X4W A;  2MWP A;  5A0D A;  1YCY A;  1UG1 A;  3G7Z A;  3VS0 A;  3M59 A;  1Q86 C;  2K3X A;  1GBR A;  1RI9 A;  4M7D A;  1ZUY A;  2GFA A;  3I5S A;  3PT9 A;  4M7D E;  4VUB A;  8AT1 B;  3O8V A;  2F2X A;  4XK8 E;  4FU6 A;  3SDZ A;  3PTA A;  1UDL A;  2EQK A;  2RHU A;  2K5F A;  4M75 E;  2JM9 A;  1FYN A;  1BI1 A;  4RTZ A;  1WJS A;  2MMP A;  5GAN 3;  3PFS A;  3X28 B;  1VQ6 A;  1TU0 B;  1YN8 A;  1D3B A;  3OYK A;  1YJW Q;  1KD1 C;  4BD3 A;  1PWT A;  1K4U S;  5GAN f;  4RTY A;  4HA8 A;  2NUT A;  1NEG A;  1JBM A;  3M54 A;  3CEY A;  4F17 A;  3THK A;  1X2K A;  3D7S B;  1NJI C;  2CT4 A;  3GIB A;  1KJW A;  4JRI A;  1WXT A;  4FW2 A;  4L5G A;  1UJ0 A;  1OX8 A;  4LXC A;  2P84 A;  1HYO A;  3UDC A;  4A63 B;  1RAF B;  1UEC A;  2YLB A;  4D8D A;  4C92 C;  5FU6 C;  2OAU A;  4ZTF A;  2YUP A;  1WXU A;  1Q82 C;  4A54 A;  4BE0 A;  3HP9 A;  2CSQ A;  4HCK A;  1OI1 A;  3WVE B;  2VYT A;  4XTW A;  1K0S A;  2R5A A;  1KD1 U;  3OSV A;  4AT1 B;  2BUD A;  2VUB A;  1K8A C;  1SKU B;  4LD6 A;  2BIV A;  2F2W A;  2BZX A;  1D09 B;  2BZY A;  3JCM Q;  2MYS A;  3DKM A;  3V7R A;  1ZBX A;  2EKO A;  2OTL A;  1HD3 A;  3LWI A;  1W6X A;  3EFO A;  4PJO C;  1YWO A;  5IXB A;  1LNX A;  5A2Q E;  2DVE A;  3OMG A;  3NTH A;  1WZO A;  1QVG A;  1VQ9 Q;  4YTL A;  5IH2 A;  4PL6 A;  1C0M A;  5D6Y A;  5ECA A;  2D0N A;  3JCM b;  2Y4Y A;  4B9W A;  4M7D F;  2DL3 A;  4C92 E;  1NG2 A;  4HT8 A;  4XTV A;  1TXQ A;  3VU3 C;  1SSH A;  2KDS A;  1D0Y A;  1YJ9 T;  1K8A R;  2E64 A;  4JS4 A;  2RK2 A;  5FU7 C;  3URG A;  1UJY A;  2AZV A;  2QG9 B;  2ZAE A;  4EMG A;  1I0C A;  1OPL A;  3HL8 A;  5LJ5 j;  2X51 A;  3S6W A;  3A1P A;  4BY6 C;  3H0F A;  2DXU A;  1J3T A;  2V1Q A;  2WAC A;  3JAM E;  2DL7 A;  5FLX E;  1M3C A;  3ER0 A;  2X35 A;  2P0Q A;  5GJV B;  1XQH A;  1M27 C;  5DLO A;  4JRK A;  1YJN Q;  2VWF A;  3CME T;  1VQL T;  4IIO A;  1I5O B;  1QCF A;  2RK1 A;  2CH4 A;  3UAT A;  2DNU A;  1SHG A;  2FRW A;  2YHT A;  1WGS A;  2K2V A;  3GLX A;  3TU4 K;  1LCK A;  2PVO B;  2O2O A;  2HBW A;  4EMK C;  4OB3 B;  2RHY A;  2EWN A;  2QK0 A;  1QP3 A;  4IUP A;  5KYW B;  1VQM A;  4WTO B;  1OQK A;  2F1L A;  2F5K A;  2HMA A;  2DVJ A;  5GAN 5;  2D9T A;  5GAN h;  3PNW C;  3FRN A;  3FIF A;  3EGX B;  3CC2 Q;  1PM3 A;  1N9R A;  3SB2 A;  1VQK A;  5GAM g;  4FIB A;  3ZL7 C;  2GNC A;  2LQK A;  2RJE A;  3QWY A;  2DAQ A;  5KYY B;  4E47 A;  9ATC B;  4PJO D;  2DEQ A;  3CCS A;  4JJC A;  4M78 C;  4C8Q D;  2RJC A;  4ELZ C;  1D0Z A;  3C94 A;  2GFU A;  1BIA A;  5LJ3 d;  4M7A E;  1D1B A;  4P5N A;  4J5Y A;  3C0C A;  3JCM P;  5LJ5 e;  2JVV A;  3J80 E;  1VQ5 T;  4EIK A;  2CP0 A;  4GLM A;  3CME A;  2ZPF B;  1GCP A;  2K79 A;  3CCE A;  3H8Z A;  1N9S A;  2MPX C;  1M8M A;  2BTT A;  3QDF A;  1N8R R;  1OU8 A;  4BE1 A;  4M78 A;  3WVD B;  1OZ3 A;  1QKW A;  3RKY A;  1QVG S;  2XG8 D;  2E4H A;  4C92 G;  5GAM j;  4ANJ A;  1VQN T;  3CCV A;  1M4Z A;  2P4R A;  3J81 E;  4HCC A;  4OMO A;  1N8R U;  3DLM A;  3L2U A;  3L1A A;  3VYH B;  3LH0 A;  3OS0 A;  1S72 A;  1A0N B;  2JN0 A;  1KFZ A;  4CC2 A;  1NLO C;  2L0A A;  3CCU T;  3V7S A;  1VQM Q;  2QQA A;  1AVZ C;  1VIE A;  2A0F B;  1KQS P;  3PMI A;  1V1C A;  5KE3 A;  5LJ3 h;  4PFZ A;  2C06 A;  1Q7Y C;  4M7D C;  5LJ5 d;  2D8J A;  2NUP A;  4XU3 A;  2VVK A;  3CCJ Q;  1U8R A;  1EZZ B;  1G3W A;  2E5K A;  3UWN A;  2XDD A;  4RMO A;  3OYG A;  3SFM A;  1SHF A;  2CP6 A;  2GTO A;  2OJ2 A;  1UHF A;  2ESW A;  3QWX X;  2ED0 A;  2FVU A;  4IKF A;  3CD6 A;  3H41 A;  2VXE A;  2Z0W A;  3RBB B;  4FT2 A;  5GAO p;  2EVR A;  2JW4 A;  2EYW A;  3CD6 Q;  1WFW A;  4M77 E;  2JJ9 A;  2K4Y A;  1KG1 A;  1ZSZ A;  3MP8 A;  2YLC A;  1PSE A;  1NBE B;  3M57 A;  1YJ9 Q;  3DB4 A;  1E6G A;  1H92 A;  4RTX A;  1X01 A;  2OI3 A;  1C1A A;  1O9S A;  2QQR A;  4OMQ A;  1VQL Q;  1VQ7 A;  2EW3 A;  3R6N A;  3H0I A;  1Y57 A;  4FCY A;  2KRN A;  2NUZ A;  1M2O A;  1MNE A;  3WXM B;  4BE2 A;  1YHQ T;  2COZ A;  3MHX A;  3G6E T;  5I2M A;  4II1 A;  3CCR A;  3HSB A;  1OZ2 A;  1PRM C;  3V8K A;  4CRI A;  3CC7 T;  2KBT A;  2ZPB B;  2C0T A;  2AHJ B;  3TRE A;  1AWX A;  2EYX A;  3FC3 A;  4ME7 A;  1YJN T;  4F14 A;  1M90 U;  2KK4 A;  2QEX T;  2SRC A;  1WQW A;  2A3L A;  3MJX A;  2DMO A;  2CP5 A;  3CCE Q;  4N4G A;  3LWH A;  1M30 A;  1AD5 A;  4KUI A;  2C0O A;  2CKK A;  4C5G A;  2O01 E;  3CXC A;  3HRU A;  4MZM A;  1JJ2 S;  3E9F A;  1KIK A;  3PE0 A;  1TWB A;  1VQ4 A;  2DD4 A;  2DRM A;  3JB9 D;  1RAD B;  4M7A D;  5GMK e;  1Q81 R;  4C5H A;  4C8Q G;  2RN8 A;  3X26 B;  3CPW S;  1VA7 A;  2JT4 A;  4M7D G;  2FPE A;  4PFP A;  1BI2 A;  3M4Y A;  2QAZ A;  4M78 G;  3M9Q A;  2HNI A;  1JJ2 A;  4LDV A;  4QT7 A;  3JCM f;  3UA7 A;  1Q81 C;  4WCI A;  3A8G B;  3M56 A;  4R0K A;  2FL7 A;  4ZN1 A;  1GL5 A;  3CBM A;  1M1G A;  1TUG B;  2ZPI B;  2RQV A;  3E9G A;  5KYY A;  2DL5 A;  1QCN A;  2JMC A;  3M0U A;  4BB7 A;  3G4S A;  1U1T A;  1KQ2 A;  2AKL A;  2PUK B;  3JB9 H;  3JCM c;  5FWC A;  3KFV A;  1N6A A;  1PNJ A;  1MGQ A;  2DO3 A;  4JJB A;  2QTV A;  2RF0 A;  3CC7 A;  1KD1 R;  1MV0 B;  4BDY A;  5KYX B;  1T0H A;  5CKE A;  3KUF A;  1D1A A;  4HKE A;  4KUL A;  5CK9 A;  3M58 A;  4R55 A;  2LNV A;  3CC4 Q;  3OSS C;  2P0K A;  1M1F A;  2L89 A;  3EFO B;  3KXT A;  2O4X A;  3BW1 A;  5IXF A;  4ORZ A;  3CCE T;  3CCU Q;  4XU2 A;  4N0A C;  3QHS A;  3U23 A;  2HQH A;  3VRZ A;  1YIJ A;  2NLU A;  4GY5 A;  4PNO A;  1EX4 A;  1X69 A;  4XTX A;  5LJ3 g;  1VYV A;  2QTX A;  1VQ4 T;  1K9M U;  3LW5 E;  5IHN A;  1OU9 A;  5I22 A;  2JTM A;  2DET A;  1BYM A;  2H3E B;  1KQS S;  5GMK h;  2YT6 A;  4ZGE B;  4XTZ A;  2KNB B;  2RH2 A;  2LMJ A;  3OY9 A;  3CCM A;  5LJ3 e;  4C8Q F;  1LVK A;  3OBW A;  1RAG B;  3OQ5 A;  1YP5 A;  2DRK A;  1IO6 A;  2DBK A;  2JZ2 A;  1QVF P;  2YUQ A;  3ME9 A;  2VC8 A;  2EQU A;  4FT4 A;  3QG1 A;  3V8L A;  1GFD A;  2WSC E;  2COY A;  3HRT A;  5CCA A;  1LOJ A;  2K6D A;  2O31 A;  3PGG A;  4MZT A;  2CYZ B;  3V7C A;  4DEY A;  1TOV A;  2PTK A;  4C8Q A;  1Y7X A;  1QLY A;  1ZA2 B;  1VQ4 Q;  3QO3 A;  2R58 A;  2RQR A;  1ABQ A;  1YIT T;  3CC2 A;  3OW2 P;  2DXC A;  3NFC A;  3JCM W;  3EG2 A;  4XU1 A;  1PD1 A;  4RG8 A;  4M75 G;  1AWJ A;  4A4H A;  1ZHI A;  1AZG B;  2G3R A;  3OYI A;  1N5Z A;  2K57 A;  1R77 A;  1G8X A;  2YSQ A;  4E6R A;  1WQ7 A;  4AFU C;  1VQ5 A;  3CC2 T;  2JTE A;  1X43 A;  3QJY A;  2D1X A;  3SD4 A;  1OEB A;  4IUU A;  4Q5W A;  2PQW A;  1H8K A;  3CCR Q;  2DE0 X;  3JCM g;  1U5S A;  1M5Q 1;  2CZ1 B;  1X6B A;  3C12 A;  4D8K A;  3I35 A;  3REA B;  2GQI A;  5HY6 A;  2CSI A;  4DEX A;  1LPL A;  3OYE A;  1M2V B;  3VS4 A;  1W4S A;  3IQL A;  4ZN3 A;  1K9M R;  1Q81 U;  4V2S A;  1XOV A;  2V8I A;  4C0G A;  4C5E A;  3JCM h;  1SF9 A;  3E2U A;  3FDR A;  1JJ2 P;  4MZP A;  2YRC A;  1WHL A;  4OF1 A;  2XHC A;  3OS2 A;  3CCM T;  1Y0M A;  2CZ0 B;  4OMP A;  3G4S Q;  3CCQ Q;  4GLK A;  2ECZ A;  4FW1 A;  1ZSG A;  1WJR A;  3MET A;  1RAA B;  1K73 U;  1RLP C;  3A8O B;  3INZ A;  1SRM A;  5GAO q;  5CKH A;  4XU0 A;  5GAO l;  3CXC P;  2AIR B;  1TG0 A;  4M78 B;  2E6N A;  2J6K A;  2XDB A;  1X27 A;  4QVZ A;  2OX7 A;  4BI4 A;  4IUV A;  3VV0 A;  4E7J A;  5A0G A;  3Q1J A;  4FM4 B;  4JRQ A;  2O88 A;  2DPP B;  1WHG A;  3CME Q;  5C6S A;  4C92 F;  2OTJ A;  3I56 Q;  1X2Q A;  2RJD A;  3H0H A;  2X4X A;  1KHC A;  4F7U B;  1YI2 Q;  2M51 A;  3JCM e;  4M75 A;  3GP8 A;  1AT1 B;  4C0D C;  5GAN g;  2ROL A;  4M4Z A;  1JXO A;  2E12 A;  3QXE B;  3M0Q A;  4KUD K;  3CCV Q;  1MUZ A;  3QUI A;  4OMF B;  5IHI A;  4OB1 B;  3OYA A;  4C92 A;  1U1S A;  1WXB A;  2DBM A;  4PFO A;  3LYI A;  5FRO A;  5GAM d;  1VQ9 A;  3QZ5 B;  1FX7 A;  2O4X B;  1OOT A;  2RB6 A;  2XKO C;  2LT4 A;  4KGZ B;  1O75 A;  2PUO B;  2XK0 A;  3LX7 A;  5CKF A;  1MMA A;  1CKA A;  1VYU A;  1JU5 C;  2LRQ A;  2BZ8 A;  2RHI A;  3G71 T;  4M78 D;  4C8Q C;  1VOM A;  2QEX Q;  3A8L B;  3AT1 B;  4KBM B;  3UPU A;  2EQI A;  3HPW A;  5IAY A;  4GBQ A;  2RI2 A;  4M7A B;  4JJN K;  2HL3 A;  3UF4 A;  4J9E A;  1M90 R;  1VQL A;  1G83 A;  2HCK A;  1UEB A;  2QGF B;  4NL2 A;  3JCM J;  3JB9 I;  1X6O A;  2LP5 A;  2LZ6 B;  2RNA A;  3A8H B;  5FRN A;  2QXF A;  4PKC C;  5C0M A;  1W2B P;  1WHM A;  2K5I A;  1VYT A;  2YRV A;  2WSE E;  1Q7Y U;  2X3X D;  1UFF A;  5FRM A;  1N27 A;  2Y90 A;  2AK5 A;  2YUO A;  3C95 A;  3EGD B;  3JCM X;  4J9B A;  1RL2 A;  1KC8 C;  1Q95 G;  1VQM T;  2DTH A;  4M75 D;  3G71 Q;  2V1R A;  2DK3 A;  1SSF A;  3PVQ A;  2H8H A;  1I81 A;  2FPD A;  4LDU A;  3RES A;  3FLG A;  2JM8 A;  6AT1 B;  4RTV A;  4LDX A;  2KT1 A;  3MCA B;  3RER A;  1VQN Q;  1FMK A;  1RUW A;  5IT9 E;  1XNI A;  4Z89 A;  3LLR A;  2RJF A;  1KK7 A;  2V26 A;  3QSU A;  2CP7 A;  5FW9 A;  2QA4 Q;  2YWW A;  1P92 A;  5CVI A;  2F69 A;  5GAN 8;  2J06 A;  1WHH A;  2JTF A;  2FEI A;  2OTJ Q;  2RD1 A;  1WDX A;  2J7I A;  2O9S A;  3I9Q A;  5KE2 A;  2A36 A;  2LX9 A;  3CQT A;  1VQN A;  4PJO B;  2V8K A;  2ZPH B;  5LJ5 g;  5GAN d;  4HVU A;  1YCS B;  5HK3 A;  2LX7 A;  3C4S A;  3SWN B;  1SPK A;  1TUC A;  3NHN A;  2JS0 A;  3HKS A;  3OYB A;  1IB8 A;  2XMF A;  1OPK A;  2RI5 A;  4LN2 A;  4EDU A;  1X6G A;  2W0Z A;  1AHJ B;  2R5M A;  2EJ9 A;  1T3S A;  4KT0 E;  4PJO E;  3A5Z B;  4JDS A;  1NPR A;  1E7O A;  3OYM A;  2HZY A;  2J6F A;  3EHQ A;  2KE9 A;  3CCL T;  3LH5 A;  1ARK A;  2QQS A;  3RKW A;  2JMA A;  2YRD A;  1XJW B;  2DL8 A;  2KXD A;  1UE9 A;  3CXC S;  2ATC B;  3VS1 A;  1K73 C;  2DZ9 A;  1B34 B;  3OYN A;  2DL4 A;  2HBP A;  4HCZ A;  4OP0 A;  2OTL Q;  3VS3 A;  2EBP A;  3NTK A;  2KRO A;  2HSE B;  4J6X A;  4BI8 B;  1K73 R;  1YIT Q;  3DB3 A;  1UUE A;  5L23 A;  2D8H A;  3EG3 A;  3RMQ A;  3HHT B;  3EH1 A;  2EIF A;  1BB9 A;  4LE9 A;  5LJ3 j;  1BKB A;  4DBR A;  1YIT A;  4M7D B;  3EGU A;  3OYL A;  2P0P A;  1R8O B;  3FJP A;  4NOY A;  1BI0 A;  2QQ9 A;  4LDW A;  2VGN A;  4RTW A;  4J7I A;  1K8A U;  3LGL A;  3NTI A;  4M75 F;  2M16 A;  2Y4X A;  2J05 A;  2VGM A;  1K9A A;  3OYJ A;  1MHN A;  2CZ6 B;  2E10 A;  1AZE A;  4FYV B;  4QQ6 A;  2L3R A;  3CMA T;  3O5Z A;  2O9V A;  2K9G A;  5LJ3 f;  2M9U A;  2M02 A;  1Q82 U;  2JUF A;  5KYW A;  2EGC A;  1MMN A;  5IHK A;  4C8Q B;  4AMC A;  2G6F X;  3ASK A;  3QZ9 B;  3QYG B;  2RHZ A;  2RQU A;  4FL6 A;  1VQP A;  2GBQ A;  4J9H A;  5AT1 B;  1K1Z A;  4ZGJ B;  1NM7 A;  1YJW A;  3KBG A;  3EG1 A;  4R56 A;  1B7T A;  4PJJ A;  1H3Z A;  1VQ6 Q;  3VS2 A;  3QPH A;  2DJQ A;  2DTI A;  2CDT A;  4E2F B;  2IG0 A;  2XIC A;  3CCM Q;  3OA6 A;  5FU7 B;  4F16 A;  1S72 T;  5D6W A;  4AFS C;  1G3S A;  1K76 A;  4RUG A;  4PJL A;  3M4G A;  2E70 A;  4EMH A;  4ATO A;  1QQJ A;  3JB9 F;  1UGS B;  5KH6 A;  1Y96 A;  2IVW A;  1ZQ1 A;  2FB7 A;  2KVQ G;  1VUB A;  2V8J A;  4XAX B;  2MOX A;  1QCO A;  1Z9Q A;  4F04 B;  4RTT A;  3TEE A;  3TCJ A;  3CC4 A;  1FMW A;  2RQW A;  3TSZ A;  1NJI R;  2MF2 A;  1YI2 T;  4C0Z A;  1YNZ A;  1K9M C;  3I55 Q;  1PKT A;  3MEV A;  3CCQ A;  1VQO T;  1RAB B;  2YXY A;  3GBQ A;  4BI3 A;  4LDY A;  2IIM A;  2VKN A;  3QDR B;  5LJ5 h;  1NJI U;  1QP2 A;  3CCS T;  1AOJ A;  3GPL A;  2E3I A;  4A4K A;  4X34 A;  2L2P A;  3QII A;  1VQ5 Q;  2DLP A;  2FYK A;  2DZC A;  2JXB A;  4A4G A;  5HCK A;  3S3O A;  2AZS A;  4J6W A;  3N5B B;  1CSK A;  1MV3 A;  4IUQ A;  5CO7 A;  3EH2 A;  1IXD A;  3GNG A;  1V29 B;  2ED1 A;  3G6E A;  2PVG B;  5CR2 A;  1QVP A;  4J6Y A;  3JB9 G;  1UTI A;  2KGT A;  1XTD A;  1UGR B;  2E65 A;  4KGX B;  1WNL A;  2I2L A;  2QEX A;  3F70 A;  3L2V A;  4M77 C;  1UHC A;  1Q86 U;  2DXT A;  1HXD A;  1ZSZ B;  5I21 A;  2CUB A;  2DJZ A;  2QAS A;  5KCH A;  1K0X A;  2E6Z A;  4PLI A;  1V76 A;  7AT1 B;  5DM7 R;  2HQE A;  1YI2 A;  3MP1 A;  4QQG A;  3I56 A;  3MP6 A;  4PJN A;  2FRY A;  1IRE B;  2LJ1 A;  1VQO A;  1PHT A;  1M1K C;  2WSF E;  3MPU B;  2L5Q A;  2QA4 A;  4L59 A;  2OTL T;  3M0R A;  4B6M A;  2KMT A;  1AWO A;  3L2R A;  4M75 C;  3CC4 T;  1PC0 A;  1PRL C;  1FWZ A;  4J9F A;  4LUE A;  2EAY A;  5KYU B;  1YIJ Q;  2QQB A;  2COW A;  4F7U E;  4JZ4 A;  4RTU A;  1KQ1 A;  2LQN A;  4JLG A;  4OB2 B;  3NMZ C;  1IZ6 A;  4A4F A;  2HD0 A;  1X75 C;  2KY9 A;  4O6J A;  5EG2 A;  2J6O A;  2HKQ B;  5AYF A;  3QBY A;  2MI6 A;  2L8D A;  5CQY A;  3EFS A;  4Z88 A;  1U06 A;  1ZUU A;  1M3B A;  1VQ6 T;  4BY6 B;  1T0J A;  3JB9 J;  3DLL A;  2SEM A;  1IRX A;  4RG2 A;  4J7F A;  4CC3 A;  1QWF A;  3OYY A;  1QVG P;  3OMC A;  1MND A;  4UC4 A;  2QGG A;  1JXM A;  1SEM A;  2A37 A;  4J9D A;  4M77 A;  4OGC A;  3EG9 A;  2ROT A;  4PK4 A;  1YJW T;  1DJ7 B;  4IUT A;  1E6H A;  4XTU A;  4MML A;  2E5Q A;  1ZA1 B;  2BE9 B;  1KSW A;  2DA9 A;  1PCX A;  5GAO r;  1VQ8 A;  4KH1 B;  1W1F A;  3M0T A;  1WHK A;  4KRT A;  1LJO A;  4QVD A;  1WJQ A;  3ZEH A;  1SRL A;  3VS7 A;  3OYH A;  5CQX A;  1Y96 B;  2VV5 A;  3EAE A;  2M0O A;  5GAN 2;  4Y28 E;  5LJ5 f;  1R0C B;  5GJW B;  2R57 A;  2RA2 A;  4JZ3 A;  1JO8 A;  1OV3 A;  4JS5 A;  1I4K 1;  1KQS A;  5KYX A;  2ZCF B;  4LNP A;  2B8A A;  3QKJ A;  4Y91 A;  3VJP A;  3S3M A;  5DLQ E;  4ELY C;  2KRM A;  2XU8 A;  2DIG A;  1YWP A;  1WLP B;  3JCM d;  4CC7 A;  2RQT A;  4QW2 A;  1I5L A;  3EHR A;  1QWE A;  4EPC A;  1Y71 A;  3FB9 A;  1VQ7 Q;  3CCQ T;  4Y92 A;  5DY9 A;  3P8H A;  2CRE A;  1NE8 A;  2EJF A;  4AFQ C;  2DTO A;  2K3B A;  2MCN A;  1BCM A;  4C8Q E;  4X9D A;  4EMK A;  3S3N A;  5GMK i;  2DM1 A;  1YJ9 A;  4CI0 C;  2VAS A;  3A8M B;  1JB0 E;  5KYN A;  2M0Y A;  1B34 A;  2PZ1 A;  2LVM A;  4JRP A;  3ZFJ A;  2BKD N;  4B9X A;  2A28 A;  4XQ3 A;  3L2Z A;  1EIF A;  4DBQ A;  4NS5 A;  3RMS A;  1TTH B;  1RAC B;  1Q86 R;  2PNI A;  3QYH B;  1F1B B;  2XI9 A;  2RM4 A;  4O5V A;  4FSS A;  1RAI B;  5GAO n;  5CAI A;  1TS9 A;  3ULR B;  1VQ7 T;  2E41 A;  3VUB A;  2A7Y A;  3REB B;  3UT1 A;  3G1J A;  1ABO A;  2KAF A;  5FWB A;  1QMC A;  1GFC A;  4ZGD B;  5I11 A;  3CC7 Q;  2CZ7 B;  3CCV T;  1AEY A;  4OMM A;  1W2B S;  4FSX A;  1OX9 A;  4DBF A;  3TSW A;  1M1K U;  5D7U A;  5CKD A;  2X3W D;  1ZSZ C;  4IIM A;  4Z02 A;  1VQP T;  4X9C A;  3MEU A;  2HKN A;  2E1H A;  3E1S A;  4OMN A;  5M9O A;  2HL5 C;  2F5T X;  2DFU A;  3L42 A;  1UGQ B;  3I56 T;  2KEA A;  4E7H A;  2DD5 A;  2HEQ A;  2LCL A;  1NPP A;  2D0Q B;  4LUD A;  3CCL Q;  1OYX A;  4M77 G;  1ACM B;  2HDA A;  2QDY B;  3HRS A;  1S72 Q;  2M1H A;  4KH0 B;  1N8R C;  1JQQ A;  2AT1 B;  5KYU A;  1GXI E;  4OGE A;  3L2Q A;  3JRZ A;  1U3O A;  4E7I A;  1W2B A;  2MWO A;  3LGF A;  2ABL A;  2EPD A;  1G3T A;  4CC4 B;  4A4E A;  4ZTJ A;  3M0P A;  2H3J A;  3CMA A;  5GAM f;  3CCJ T;  4QQD A;  3T9N A;  3VRY A;  2DIQ A;  1WIE A;  1VIF A;  2NUP B;  3M53 A;  4C92 D;  3M55 A;  4J9I A;  3VS6 A;  2GGR A;  3OS5 A;  4J9G A;  2DEU A;  2L3S A;  4PLL A;  3BDL A;  3A98 A;  4Z8A A;  2JNG A;  2LQW A;  4J8O A;  1NEB A;  2L3P A;  1PKS A;  5GMK l;  3TQ7 P;  2CT3 A; 
#chains in the Genus database with same CATH homology
 2FG0 A;  1UJ0 A;  2LJ3 A;  2RQU A;  2GBQ A;  4A63 B;  4J9H A;  1K1Z A;  1NYG A;  1UEC A;  1X69 A;  1NM7 A;  3EG1 A;  4D8D A;  3VS2 A;  2KYM A;  1VYV A;  2YUP A;  2DJQ A;  1WXU A;  2CDT A;  5IHN A;  5I22 A;  2NWM A;  4F16 A;  2EGE A;  2CSQ A;  2DX1 A;  4HCK A;  2YT6 A;  4AFS C;  2KNB B;  4X1V A;  1K76 A;  2LMJ A;  4RUG A;  1K0S A;  1YP5 A;  2DRK A;  1IO6 A;  2DBK A;  2MIO A;  2YUQ A;  3M0S A;  2F2W A;  2BZX A;  1GFD A;  2BZY A;  2MOX A;  2K6D A;  1Z9Q A;  1HD3 A;  1W6X A;  2O31 A;  1RLQ C;  4RTT A;  2JS2 A;  4DEY A;  1YWO A;  5IXB A;  1GBQ A;  3UA6 A;  2LCS A;  2RQW A;  2PTK A;  3TSZ A;  1QLY A;  5IH2 A;  1G2B A;  5ECA A;  1YNZ A;  2D0N A;  1PKT A;  2DL3 A;  1Z9Z A;  2RQR A;  1NG2 A;  3GBQ A;  1ABQ A;  1SSH A;  2LNH B;  2ENM A;  2IIM A;  2VKN A;  4JPB W;  3EG2 A;  1AWJ A;  2DYB A;  2YUN A;  1AZG B;  1AOJ A;  1AWW A;  2OAW A;  1N5Z A;  1B3Q A;  1EFN A;  2KYB A;  1UJY A;  2L2P A;  2YSQ A;  2AZV A;  2DLP A;  4E6R A;  1I0C A;  2JXB A;  1OPL A;  5HCK A;  4AFU C;  2AZS A;  2EGA A;  2JTE A;  1CSK A;  1X43 A;  1GRI A;  1MV3 A;  2D1X A;  1OEB A;  1NLP C;  1H8K A;  2CH4 W;  3FJ5 A;  3H0F A;  2DE0 X;  1J3T A;  1I1J A;  1U5S A;  2V1Q A;  1X6B A;  2ED1 A;  4D8K A;  3I35 A;  2DL7 A;  3REA B;  2GQI A;  1M3C A;  2CSI A;  4DEX A;  5GJV B;  3VS4 A;  1M27 C;  1JEG A;  3IQL A;  1UTI A;  2KGT A;  1ZLM A;  1I07 A;  2VWF A;  1ZX6 A;  1XOV A;  4IIO A;  1QCF A;  2CH4 A;  3UAT A;  2DNU A;  3JV3 A;  4HVW A;  1UHC A;  3TVT A;  1SHG A;  2FRW A;  2B86 A;  1TUD A;  1NYF A;  2KR3 A;  2CUB A;  1Y0M A;  4OMP A;  1LCK A;  2ECZ A;  2O2O A;  1K0X A;  1ZSG A;  2HBW A;  2EYY A;  3NPF A;  2HSP A;  1RLP C;  1SRM A;  2FRY A;  2LJ1 A;  1PHT A;  1TG0 A;  2DVJ A;  2J6K A;  2QDL A;  2A08 A;  4AFZ C;  1X27 A;  3M0R A;  1AWO A;  1B07 A;  2O88 A;  1PRL C;  4J9F A;  4LUE A;  1CKB A;  2C0I A;  1H3H A;  1X2Q A;  3H0H A;  3EG0 A;  3SEM A;  2KRS A;  3ZL7 C;  2GNC A;  2M51 A;  4JZ4 A;  4RTU A;  2LQN A;  3QWY A;  3NMZ C;  2RMO A;  1S1N A;  2ROL A;  4M4Z A;  2J6O A;  4JJC A;  1JXO A;  3M0Q A;  4Z88 A;  1MUZ A;  2W10 A;  1U06 A;  5IHI A;  1ZUU A;  1M3B A;  2FO0 A;  2LJ0 A;  3C0C A;  1WXB A;  1T0J A;  2DBM A;  4AG2 C;  1HJD A;  5EC7 A;  2SEM A;  4EIK A;  1OOT A;  4GLM A;  2KT8 A;  4CC3 A;  1QWF A;  1GCP A;  2K79 A;  1BBZ A;  1CKA A;  1VYU A;  1JU5 C;  1JXM A;  1M8M A;  2BTT A;  2BZ8 A;  1SEM A;  2A37 A;  4J9D A;  1QKW A;  2ROT A;  3PVL A;  2EQI A;  4GBQ A;  1BU1 A;  1E6H A;  3UF4 A;  4J9E A;  2P4R A;  4OMO A;  1G83 A;  2EKH A;  2HCK A;  1KSW A;  2DA9 A;  2DF6 A;  1W1F A;  1A0N B;  1ZBJ A;  2LP5 A;  1KFZ A;  3M0T A;  1WX6 A;  4CC2 A;  4KRT A;  2KXC A;  3NGP A;  2LZ6 B;  1NLO C;  2RNA A;  2L0A A;  1AVZ C;  1SRL A;  3VS7 A;  1V1C A;  1VYT A;  1W70 A;  2X3X D;  1UFF A;  5GJW B;  2AK5 A;  2D8J A;  2YUO A;  4J9B A;  4JZ3 A;  1JO8 A;  2YDL A;  2VVK A;  1OV3 A;  4K11 A;  4AG1 C;  3RNJ A;  1BK2 A;  2E5K A;  1ZUK A;  1WYX A;  4LNP A;  2RPN A;  2V1R A;  1SHF A;  2GTO A;  2OJ2 A;  1UHF A;  3PVQ A;  3VS5 A;  2ESW A;  2H8H A;  3QWX X;  1WI7 A;  2ED0 A;  2KRM A;  2FPD A;  2JM8 A;  1YWP A;  1WLP B;  4RTV A;  3H41 A;  4CC7 A;  2RQT A;  2KT1 A;  3EHR A;  3RBB B;  1FMK A;  1QWE A;  1RUW A;  4Z89 A;  2CUD A;  2EVR A;  2JW4 A;  2EYW A;  1WFW A;  4Y92 A;  2CRE A;  4AFQ C;  2K3B A;  2MCN A;  4ZNX A;  2EYZ A;  4J9C A;  2AKK A;  5FW9 A;  2DM1 A;  1E6G A;  1H92 A;  4RTX A;  1HSQ A;  2OI3 A;  1M3A A;  2J06 A;  2M0Y A;  2FEI A;  4OMQ A;  3SHW A;  1WDX A;  2J7I A;  2PZ1 A;  1UGV A;  2EW3 A;  2O9S A;  3I9Q A;  2A36 A;  3R6N A;  3H0I A;  4HXJ A;  1Y57 A;  2A28 A;  2KRN A;  2L3Q A;  3CQT A;  2GTJ A;  2NUZ A;  2PNI A;  4HVV A;  2DIL A;  4FSS A;  4HVU A;  1YCS B;  2I0N A;  2LX7 A;  1PRM C;  1SPK A;  1TUC A;  3NHN A;  1WA7 A;  2JS0 A;  3ULR B;  2K2M A;  2KBT A;  2C0T A;  1AWX A;  2EYX A;  2XMF A;  3REB B;  1OPK A;  4ESR A;  1ABO A;  4F14 A;  5FWB A;  4LN2 A;  1GCQ A;  1GFC A;  1X6G A;  5I11 A;  1AEY A;  2SRC A;  2K7A A;  2W0Z A;  4OMM A;  3TSW A;  1T3S A;  2X3W D;  2DMO A;  4IIM A;  1E7O A;  2J6F A;  1QKX A;  3EHQ A;  2KE9 A;  4JJD A;  1M30 A;  3LH5 A;  1AD5 A;  1ARK A;  4OML A;  2C0O A;  2JMA A;  2DL8 A;  2F2V A;  2KXD A;  1UE9 A;  4OMN A;  1KIK A;  3PE0 A;  1T3L A;  2DRM A;  3VS1 A;  2KEA A;  1GCQ C;  3I5R A;  2HEQ A;  2RN8 A;  2FPF A;  1VA7 A;  2JT4 A;  4LUD A;  2DL4 A;  2FPE A;  3VS3 A;  2HDA A;  2EBP A;  2KRO A;  4QT7 A;  1UG1 A;  1JQQ A;  3UA7 A;  4WCI A;  3VS0 A;  1UUE A;  5L23 A;  2D8H A;  3EG3 A;  4R0K A;  1GBR A;  1RI9 A;  1GL5 A;  1BB9 A;  4LE9 A;  1ZUY A;  1U3O A;  2RQV A;  3I5S A;  3EGU A;  2ABL A;  2EPD A;  2DL5 A;  2F2X A;  2JMC A;  3M0U A;  4CC4 B;  3M0P A;  1UDL A;  2AKL A;  4RTW A;  2JM9 A;  1FYN A;  4RTZ A;  5FWC A;  3KFV A;  1PNJ A;  4JJB A;  3VRY A;  2J05 A;  1K9A A;  2RF0 A;  1WIE A;  1YN8 A;  4J9I A;  1PWT A;  1MV0 B;  1K4U S;  4RTY A;  1AZE A;  1T0H A;  3VS6 A;  2GGR A;  4J9G A;  2L3S A;  1NEG A;  3O5Z A;  2O9V A;  4F17 A;  2K9G A;  3A98 A;  1X2K A;  4Z8A A;  3THK A;  5IXF A;  2CT4 A;  4ORZ A;  1KJW A;  2LQW A;  2EGC A;  1NEB A;  2L3P A;  5IHK A;  1PKS A;  2G6F X;  1WXT A;  3U23 A;  3VRZ A;  2CT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...