4J9HA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph 8
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9hA00
5HCKA 2FEIA 1WXTA 1JEGA 1UJYA 2DLPA 2J6OA 4D8KA 1UECA 2RQUA 3M0QA 3PVQA 1WA7A 2W0ZA 3H0HA 4CC3A 2J6FA 2V1RA 4JZ4A 2AKLA 4F17A 1ZSGA 2EBPA 3M0PA 1RLQC 1NLOC 1TG0A 4FSSA 2LJ3A 2DL7A 2GTOA 2RF0A 1HD3A 1YWPA 1TUCA 4LUDA 1B07A 3NPFA 1WX6A 2MCNA 1YP5A 2FPFA 2KYMA 1GRIA 3NGPA 2HDAA 2L3SA 1QKWA 2DL4A 2CUBA 2KROA 4OMOA 3M0UA 5ECAA 2JT4A 2LQNA 4LN2A 1PHTA 3VS6A 4HVUA 1UTIA 2O9SA 2KEAA 4RTWA 2EYYA 4Z88A 2HCKA 3UA7A 2FG0A 2PTKA 2FRYA 1RI9A 3EHRA 2VVKA 3VS1A 1HJDA 1YCSB 5GJVB 1U5SA 1PKTA 2DL8A 3H0FA 1ZBJA 3M0TA 4AFQC 2O9VA 1W1FA 2CSQA 1AD5A 4J9CA 1WLPB 2LMJA 2JW4A 1WDXA 1VYUA 2K7AA 2RQTA 1ABOA 2JMAA 1G2BA 2JMCA 2FPDA 2RNAA 1JQQA 1Y0MA 4CC4B 1WXBA 3H41A 2CH4W 1GCPA 1A0NB 2D1XA 2VWFA 3NMZC 2RQRA 4CC2A 2GGRA 4HVVA 2RQVA 1SHGA 4JJBA 4Z89A 1V1CA 2DL3A 3VS2A 1BK2A 2KRNA 2J05A 1KJWA 2ROLA 1UFFA 2GBQA 3EG0A 1X2KA 2KXCA 2DRMA 1I0CA 2K79A 1H92A 1SEMA 1T0HA 4WCIA 2OJ2A 2W10A 2L2PA 4A63B 1KIKA 3REBB 2LNHB 2KRMA 2A28A 1NM7A 4RTTA 1H3HA 4EIKA 2CREA 1K76A 2O31A 3VRYA 1K1ZA 2RN8A 2YDLA 5IHIA 4DEYA 1NYGA 1ZUKA 2OAWA 2HBWA 3UATA 2EGCA 2EPDA 1RUWA 3VS4A 2D8JA 4HCKA 4RTXA 4AFZC 5IHKA 2F2WA 2AK5A 1ABQA 2ABLA 3RNJA 3R6NA 2EVRA 3CQTA 3H0IA 4J9BA 3ZL7C 2G6FX 1VYVA 1QKXA 2O88A 3VRZA 4QT7A 2KYBA 2DF6A 1PWTA 3EGUA 1UDLA 4M4ZA 1JXOA 1CKBA 2L3QA 1K0XA 4RTUA 2O2OA 2D0NA 2KT8A 5I11A 1KSWA 5L23A 1RLPC 2C0IA 2K3BA 2E5KA 1E6HA 1ZX6A 1MV3A 2DILA 4HVWA 3LH5A 1FMKA 2IIMA 4OMLA 2GTJA 2M0YA 2JM8A 1JXMA 3PVLA 3UA6A 2DA9A 2FPEA 2H8HA 1AWXA 4J9IA 1OPLA 2LZ6B 1SHFA 1AVZC 3JV3A 1PKSA 3EHQA 1B3QA 1TUDA 2V1QA 4AG2C 4J9EA 1AZEA 2ENMA 1PRMC 1JU5C 1CSKA 1GBQA 1WYXA 2K6DA 4JPBW 3I5SA 2YUNA 2RMOA 1WXUA 2HSPA 2J6KA 1T0JA 3A98A 1GBRA 1YNZA 1K4US 3VS7A 4GLMA 1HSQA 2YUQA 1UUEA 3GBQA 4ESRA 2YUOA 5FWBA 5FW9A 1QCFA 1X6GA 4F16A 2LX7A 1EFNA 1ARKA 2JXBA 2KRSA 2MOXA 4J9DA 1QWFA 3VS0A 1GFCA 4AFSC 1UJ0A 2I0NA 1GCQA 2X3XD 2NUZA 4AG1C 2FRWA 5EC7A 1X27A 1W70A 2RPNA 1PNJA 1XOVA 1J3TA 1SRMA 1U3OA 2KR3A 2KXDA 1BU1A 4LNPA 2DRKA 1M30A 2ED0A 2DBMA 1AWJA 2BZYA 2CDTA 1GCQC 1QWEA 1E7OA 2L0AA 3I5RA 1SRLA 2LP5A 2DBKA 2GQIA 2CT4A 1M3BA 2ED1A 1OPKA 4IIOA 4R0KA 3REAB 1M8MA 2LJ0A 1X43A 2K9GA 1SSHA 1Z9QA 2FO0A 2MIOA 2CUDA 2EYXA 1NLPC 1SPKA 3I35A 1I07A 2C0TA 1GFDA 2AZVA 2JS0A 1LCKA 3EG3A 2DMOA 1BBZA 1AWOA 1JO8A 2M51A 1UGVA 2NWMA 1UHFA 1M27C 1T3SA 4RTZA 2QDLA 2JM9A 3SEMA 2X3WD 1X69A 1I1JA 3U23A 4F14A 4IIMA 2LCSA 1S1NA 3EG1A 4LUEA 1N5ZA 1Z9ZA 1Y57A 4AFUC 1MV0B 4J9FA 3KFVA 2KT1A 2SRCA 3M0RA 2KBTA 2DL5A 2ECZA 4KRTA 2D8HA 4J9GA 3QWYA 2L3PA 1X2QA 4RTYA 1AZGB 5IXBA 1M3AA 4RUGA 5I22A 3VS3A 1NG2A 2EYZA 3I9QA 1QLYA 2PNIA 4ORZA 2OI3A 4ZNXA 2HEQA 4K11A 4J9HA 1AEYA 2CSIA 4LE9A 2K2MA 1WIEA 1UHCA 4JZ3A 3M0SA 4DEXA 1W6XA 3TSZA 1YN8A 2YSQA 1WFWA 2DM1A 1T3LA 1OEBA 2EW3A 2F2VA 2CT3A 2YUPA 2DYBA 2CH4A 2DX1A 3NHNA 4JJDA 5FWCA 3QWXX 3RBBB 1OV3A 2SEMA 2BTTA 2KE9A 2EGEA 5IXFA 3IQLA 2A37A 1AOJA 2KNBB 2AZSA 4JJCA 1UE9A 1E6GA 1AWWA 1IO6A 4X1VA 2DVJA 1X6BA 4OMQA 4OMMA 1OOTA 2DJQA 1H8KA 2YT6A 3VS5A 2AKKA 2GNCA 4OMPA 2EKHA 3TSWA 2ROTA 4CC7A 4HXJA 1MUZA 1KFZA 1GL5A 2LQWA 2EGAA 2J7IA 1WI7A 2BZXA 1BB9A 2JTEA 4D8DA 2ESWA 2DNUA 2PZ1A 1CKAA 4OMNA 4Z8AA 1YWOA 3TVTA 1VA7A 2F2XA 3FJ5A 4E6RA 5IH2A 4Y92A 4RTVA 2B86A 2KGTA 3C0CA 1ZUUA 1PRLC 2RQWA 2BZ8A 2JS2A 1K9AA 2XMFA 3UF4A 2P4RA 1UG1A 1K0SA 3EG2A 3THKA 2A36A 1ZUYA 2J06A 1VYTA 2VKNA 1M3CA 2C0OA 3ULRB 2LJ1A 3SHWA 3PE0A 1FYNA 1NYFA 1U06A 1G83A 2DE0X 2A08A 4GBQA 2EYWA 1NEGA 1NEBA 1ZLMA 3O5ZA 2EQIA 5GJWB 5IHNA
chains in the Genus database with same CATH superfamily
1IXDA 1Q82C 1UEBA 3CCJQ 1K9MR 4D8KA 2MMPA 5EG2A 3JCMg 1UECA 2XKOC 3M0QA 5C6SA 1WHGA 4JZ4A 2GFAA 3D7SB 5KYXA 1PCXA 4F17A 3OS0A 1PD1A 2VXEA 1YIJT 4JDSA 1NLOC 4FSSA 3CCET 3RKXA 4PJOD 3JCMX 1XJWB 1RAHB 4A53A 1Q81U 1HD3A 1YWPA 1TUCA 3GLXA 3NPFA 1LVKA 4L59A 1WX6A 3JB9F 2HKQB 1M90R 3E9FA 3S6WA 4PL6A 2FPFA 2KYMA 4IURA 2KDSA 4OMOA 4EMKC 3M0UA 3CCRA 2DTOA 2LC4A 4HCCA 3CCQT 4ZN3A 4RTWA 2XHCA 4C0DC 3E1SA 3META 3EHRA 3VS1A 4WTOB 1WJQA 5GJVB 1U5SA 1BIAA 3OBYA 4C8QA 3OYMA 4FT2A 4FYWB 2JTFA 2IG0A 1K8AC 2HSEB 5FU6B 3CCLA 3CMAT 3CD6A 1WLPB 3QZ5B 3CC4Q 2RK2A 2FZCB 2RQTA 2JMAA 3I55A 2IPOB 1WJRA 4PJOF 2FPDA 3EAEA 3OYFA 1GCPA 5I21A 3MEUA 2D1XA 4BACA 1VQMQ 2OTJT 3NMZC 2RQRA 3MP6A 5DLOA 1YI2Q 2AT1B 1SHGA 3OSSC 3V8JA 1RL2A 2E41A 3VS2A 2KRNA 1VQ4Q 3EG0A 1WHHA 2GBQA 1X2KA 4X9CA 1QW1A 4M77A 2DRMA 5GMKi 1I81A 4M75B 1SEMA 2W10A 2HZYA 2L2PA 3REBB 2RB6A 1RAIB 2C06A 3G1JA 2RHYA 2ZPFB 4EIKA 4HT8A 1W2BA 4ELZC 1K76A 2O31A 3VRYA 1K1ZA 5IHIA 4OB2B 4DEYA 2DKGA 4PJJA 2EGCA 3A1PA 2EPDA 3OYCA 3VS4A 1VQ9T 4HCKA 4RTXA 1Q82U 5IHKA 2LX9A 3QUIA 4XU3A 1I5OB 2LTOA 3MJXA 3KUFA 1JJ2S 4M78E 3ZL7C 1XQHA 1BKBA 3TREA 1QKXA 3VRZA 2E65A 1N9RA 2QGFB 2HKNA 1PWTA 3MPUB 1JJ2P 4M4ZA 1K73U 4LDUA 2XDBA 2L3QA 2RM4A 5CKFA 3E19A 2D0NA 5KYWB 5I11A 1RLPC 2RHUA 5D7UA 4C5EA 2VUBA 2LCCA 2V8JA 1MV3A 4LDVA 5FROA 2DILA 4IUUA 4HVWA 1FMKA 1M2OA 3CCVA 2IIMA 4OMLA 2D9TA 2GTJA 3PVLA 3NTHA 2DA9A 2FPEA 2QASA 2H3JA 3RUXA 3AHUA 3EHQA 2V1QA 4AG2C 4PJNA 2MAMA 2P0PA 2MF2A 4XU1A 2XI9A 3M9QA 2H3EB 1PRMC 1GBQA 4JRPA 2PVOB 2K2VA 5GAMe 2QA4T 1R0CB 1RAGB 2F69A 1T0JA 3M55A 3VUZA 3SWNA 1K8AU 4BI8B 1HSQA 2YUQA 3OYHA 1UUEA 4VUBA 1K9MU 2HL3A 3RMSA 2JN0A 2CP5A 3A8OB 2X4WA 2RJFA 3MEAA 1D0YA 1P92A 1Q95G 1VQOT 2OTLT 1UJ0A 1QVPA 1X27A 2E3HA 2RPNA 4RKUE 1YFNA 2KR3A 2RI5A 1BU1A 4F7UF 4PJOE 4LNPA 2DJZA 1M2VA 1KD1R 2HNIA 5CKEA 3JCMf 2LP5A 1KQSS 2DBKA 2CT4A 5KYYB 4ZGJB 1U8RA 1VQ7Q 2ED1A 1N8RR 4QKUA 1TH7A 5CR2A 1I8FA 2ZZDA 3GPLA 2E1HA 2K9GA 3CBPA 1M1KC 2MIOA 2DERA 1R0BG 2CUDA 2EYXA 1NLPC 1SPKA 3HPWA 2CYZB 3CCEA 2BE9B 2C0TA 1GFDA 4GY5A 4ZTJA 1AWOA 1TS9A 5CKHA 2YWWA 2JM9A 3CC7A 4F14A 1H641 2L89A 3X26B 1Y57A 1JB0E 3OS5A 1MV0B 4J9FA 3FRNA 2KT1A 2L3RA 2SRCA 3M0RA 4J9GA 1SKUB 3QWYA 2L3PA 2VGNA 3A8LB 4ZGDB 1VQLT 1C1AA 1M3AA 3HRTA 5I22A 2NUTB 2EKOA 3VS3A 3PMIA 1NG2A 5CO7A 1QLYA 1FWZA 4LD6A 3VJPA 2FVUA 2PNIA 2P0KA 1YITA 3CMAA 2HEQA 5KCHA 3OYIA 4J9HA 1HK9A 4FW1A 5GAN6 1YHQT 4A4KA 4XTZA 4C0GA 1UHCA 4WF2A 3LW5E 5CAIA 2DM1A 4TVRA 4JRQA 1T3LA 2DYBA 4QVZA 3KXTA 4J6YA 1OX8A 1JRIA 2OX7A 2OTJA 5FWCA 4FIBA 3QWXX 3PIPA 5I2SA 1XNIA 1MNDA 4L6V5 2SEMA 2BTTA 1ZHIA 2R57A 2O4XA 2AZSA 4J6XA 1E6GA 3MHXA 2MK5A 4XU2A 5GAOm 3LLRA 4X9DA 2K3YA 3CC2Q 6AT1B 3VUBA 1VQ8Q 5GAMh 1M5Q1 1QVGA 1VQ6T 3PTAA 2D0QB 3QBYA 1GL5A 1W4SA 4M7AD 4C8QC 2PZ1A 5GAN7 3HTRA 4Z8AA 1VQ9A 3M4YA 2KGTA 4BY6B 1IHVA 3G6ET 2QDYB 1QP2A 4J5YA 1K9AA 3G4SQ 3UF4A 2P4RA 2KSSA 4IUPA 4CRIA 4YTLA 3BY7A 2PVDB 3RKYA 3PNWC 1M1KU 5KYNA 4F7UE 4FYYB 2DPPB 1NYFA 3GNFB 4ANJA 2I2LA 4M78G 1WQ7A 4E7SA 2CP0A 3TQ7P 4GBQA 5GAMg 2RHZA 1YBYA 2KK4A 5KYXB 5HCKA 4M7AF 1JEGA 1BI3A 4LDYA 2DXUA 4BUGA 3QO3A 2R5MA 1WA7A 1UGSB 2W0ZA 5GAN3 4CC3A 3OBWA 4M77G 1HYOA 3I56T 2KAFA 2EYQA 2ZPEB 4EMHA 4PNOA 3M0PA 2FZGB 1BCOA 1KC8R 2LJ3A 4MZPA 2K5IA 3MO8A 2GTOA 3UT1A 2RF0A 3EFSA 3L1AA 3SDZA 3G71Q 3CMEQ 2RK1A 1B07A 3CPWA 4PJOC 4ATOA 3MP1A 3V8KA 2LDMA 1GRIA 2HDAA 1VQOA 2CUBA 2OTLA 2KROA 2JT4A 4HA8A 2GF7A 4LN2A 1PHTA 1I4K1 2PU9B 4HVUA 3UWNA 2KEAA 1D3BA 3MKDA 5A0GA 2HCKA 2FG0A 2PTKA 4LXCA 3QZ9B 2ZPHB 4XTYA 2DL8A 4KGXB 1ZBJA 1FMWA 4N4IA 3M0TA 4PJMA 4AFQC 1TXQA 3C12A 4C8QD 2LMJA 2JW4A 1WDXA 1YJNT 2K7AA 1YI2T 1D0ZA 2XDDA 1JQQA 2LCLA 3H41A 5GAMj 1G3WA 1VQ4T 2BIVA 1A0NB 3HFNA 4M77B 2DTHA 5KYUB 1V1CA 3E9GA 2DL3A 4KGVB 1BK2A 1KQ2A 2HBPA 5FU6C 2ROLA 1UFFA 1I0CA 2K79A 1G3YA 1UB4A 1TTHB 3CCRQ 2OJ2A 4AMCA 1EX4A 3UPUA 2LNHB 2KRMA 4E7JA 1U1SA 2A28A 3PIOA 5GANe 1H3HA 3DB3A 4AT1B 4C8QF 2RJDA 3OYAA 2RN8A 2YDLA 4MDWA 2JUFA 3JSCA 1NYGA 1ZUKA 2OAWA 3L2WA 4RCCA 4M7DG 3CD6Q 3OYEA 2ZPGB 2EFIA 2MWPA 3JRZA 1ABQA 4BDZA 3CQTA 1YHQA 5GANd 3I55Q 4J9BA 5D6WA 2G6FX 2O88A 4XAXB 4BD3A 4QT7A 1K73C 2QTVA 4M75C 7AT1B 3EGUA 3EG9A 4C92G 1UDLA 3ZFJA 3EFOB 2KT8A 1NBEB 2K3BA 1YJ9Q 5FRMA 4M7AE 1C6VX 1ZX6A 3JCMW 1NPPA 4PJLA 4JS5A 1JXMA 3UA6A 1RAEB 4Z02A 3CC7T 1VQKQ 4FU6A 2LZ6B 1AVZC 1PKSA 5LJ3d 1TUDA 4B9WA 4BB7A 3CCUT 1HXDA 4DOWA 3VKIA 1NPRA 1AZEA 3SWNB 1VQ6A 2CZ0B 1G3TA 4JLGA 1JU5C 4E7HA 3L2RA 2K6DA 4JPBW 1VIFA 2NYSA 1WXUA 1G3SA 2J6KA 1YITT 3LYIA 3LX7A 1YJWT 1GBRA 2QGGA 2M16A 3G6EA 1K4US 1K9MC 4M7DB 5FW9A 4M78A 5KH6A 1X6GA 2CZ6B 4XTVA 4PFOA 4KBMB 3A8HB 1ARKA 5LJ5e 5CCAA 3CCJA 1M2VB 2QTXA 4J9DA 4BDYA 1YCYA 4C92B 3HL8A 2X3XD 1G5VA 2NUZA 2X4YA 1OZ2A 2FRWA 2P4TA 4AG1C 3OW2S 5GAMf 1MMGA 3JB9I 1W70A 2QQSA 1XOVA 2OAUA 1J3TA 1U3OA 2KXDA 2K5FA 3X20B 3FLGA 3OW2P 5LJ5d 1MMDA 2DBMA 1GCQC 1VUBA 4OP0A 1X75C 5KYUA 2L0AA 1M90C 2E6ZA 2GQIA 3I56A 3WXMB 3REAB 1M8MA 2LJ0A 2RO0A 1X43A 5KE2A 3DLMA 3M57A 4JJNK 3J80E 1JJ2A 5GAOp 1PC0A 4M75D 1I07A 2NUPA 2VYTA 1LCKA 1B7TA 1VQPT 2NWMA 5CK9A 1M27C 3BDUA 3SEMA 4C8QE 1W2BS 2QG9B 2XIDA 4Y28E 5GANh 2LCSA 1S1NA 1N5ZA 1ZSZA 3H6ZA 3KFVA 3JCMb 8AT1B 4OVAA 2ECZA 4DBFA 1V76A 4XU0A 1X2QA 4RTYA 3A5ZB 3OYKA 3EFOA 1PD0A 1BI0A 2EYZA 2A0FB 1BYMA 1VQMA 5LL6S 4RG2A 4LE9A 2K2MA 1YJNA 4M75F 4JZ3A 3OB9A 2FYKA 1G8XA 1YI2A 4DEXA 1W6XA 3TSZA 2WSEE 1YN8A 1WFWA 2O4XB 3OA6A 2EW3A 2CH4A 1YIJQ 4FM4B 4DBRA 2YXYA 1VQ4A 1Q7YR 3NHNA 4JJDA 2COZA 5GANg 2MWOA 3JAME 4RG8A 3MEVA 4D6WA 1VQ8T 4A4FA 2EGEA 3DLLA 1TOVA 3IQLA 2DZCA 2KNBB 3LWIA 4JJCA 1UE9A 3JCMc 3VYHB 4DQ2A 1FXXA 5FLXE 2DVJA 5IN1A 3RR6A 1OOTA 2DJQA 2E5QA 3VS5A 4BE0A 2AKKA 2KMTA 2QEXT 4XTWA 3OQ5A 4OMPA 3CCQQ 5GMKm 2DXCA 1UGRB 2D6FA 4M7DA 5DY9A 2EQJA 5A0DA 4J7FA 2QQAA 2EGAA 1WI7A 4N0AA 4DBQA 3GNGA 4NS5A 3JCMV 3CEYA 5GAOl 3CCSQ 5HK0A 2F2XA 3QYHB 1RAAB 4J8OA 5IH2A 4C92A 4RTVA 4M7AC 2B86A 2CP2A 1Q86R 3X28B 2COWA 2JS2A 1S72T 1SG5A 3HP9A 4MDXA 1M90U 1LJOA 1UG1A 1K0SA 1M8VA 1D09B 1KQSP 1VQNQ 3FJPA 1OQKA 3JB9J 3RERA 1M1FA 2VKNA 2OTJQ 1M3CA 3BW1A 4FL6A 4FT4A 3VV0A 1U06A 2DE0X 2A08A 2R58A 2EYWA 3QHSA 2M1HA 4BE2A 2F5KA 1VQ5Q 4QQDA 2DEUA 5GJWB 5IHNA 2A7YA 4II1A 1WXTA 1M4ZA 4X34A 2J6OA 3CCUA 4JS4A 3H0HA 2J6FA 2QAZA 5GANj 4RCBA 1WQWA 3QG1A 5LJ5g 1IREB 4KUDK 2X35A 1VQ9Q 2EBPA 3RDVA 1RLQC 4BI4A 4JUVA 3CCMT 1YJWA 2KVQG 3PFSA 3HRSA 2AIRB 2DL7A 4MMKA 1BI2A 4EMKA 1KD1C 3R6OA 4JRIA 4ME7A 1IGQA 2RA2A 4RMOA 1D3BB 1D1CA 3A8GB 1RADB 2MCNA 2DIQA 3F70A 5KCOA 1N8RC 2DL4A 4HCZA 2CKKA 3M56A 5AT1B 2DETA 2LQNA 3URGA 4C0ZA 2EYYA 4JLIA 4Z88A 2COYA 4M75E 4IKFA 1VQ7A 2FRYA 4LDWA 5CVIA 2Y4YA 1HJDA 3J81E 1YCSB 2CZ7B 2BE7D 4LDXA 3RIRA 4N4HA 2O9VA 4OB3B 1AD5A 3C94A 5GAN5 1N27A 2P84A 1VYUA 2QA4Q 2BUDA 1QMCA 3JB9H 4HKEA 3SFMA 2CH4W 4HT9A 1R77A 3FB9A 4E2FB 5GAOr 5DM7R 4Q5WA 1FX7A 4XTUA 4JJBA 3RMQA 4Z89A 1RI0A 1VQPA 4ZTFA 2DYIA 2J05A 1QVGS 1D1BA 1KJWA 4XQ3A 2PQWA 2KXCA 2DD4A 2XDPA 1Q81R 1VQOQ 1H92A 2OTLQ 5GMKe 3ER0A 1T0HA 2VC8A 3CCJT 1KIKA 5A2QE 1NM7A 4A4HA 3QDRB 4BE1A 2JVVA 3LGLA 2XG8D 5GAN4 3H8ZA 4M77C 3UATA 4J83A 3KBGA 3EG9B 1OU8A 1RUWA 2D8JA 1JBMA 4AFZC 2ZPIB 3C4SA 3L42A 2AK5A 4L5GA 3R6NA 2EVRA 1WGSA 3H0IA 1YJ9T 4EPCA 2RD1A 4E7KA 3NTKA 1PSFA 2KYBA 1NJIR 1TUGB 5GAN2 1JXOA 4N4GA 4RTUA 4FW2A 2O2OA 5L23A 1KSWA 2ZPBB 1VQKT 2C0IA 5FU7C 5GANf 3CC2A 4PLIA 1IHWA 3ASKA 1VQ8A 2VGMA 2FL7A 3LH5A 2NLUA 1MMNA 3PT9A 2QXFA 4KH1B 4ZGEB 1KD1U 2JM8A 4KT0E 2P0QA 3JB9G 1KG1A 4J9IA 1OPLA 1SHFA 2E12A 3OMCA 1SSFA 1XTDA 2KI7A 1N8RU 2QEXA 2VB6A 3L2ZA 2E6NA 4J9EA 3N5BB 1WJSA 1KHCA 1VQLQ 2M0OA 3CC4T 1CSKA 1WYXA 4CI0C 4C5HA 4M78B 1BI1A 3I5SA 3TCJA 5J26A 2HSPA 2JNGA 4V2SA 1IRXA 2ZGWA 3A98A 1M1GA 1VQMT 1YNZA 1S72A 3LGFA 3VS7A 4FYVB 4MMLA 4GLMA 1Q82R 2O01E 3AT1B 3CPFA 4PJOG 1QCFA 3X25B 2DVEA 2LX7A 4B9XA 3MEWA 3GF5A 3FIFA 3QKJA 1EFNA 1TSFA 2JXBA 3SWNC 2YLBA 4JRKA 1WHLA 4FCYA 2FZKB 2G3RA 2GFUA 2MOXA 1QQJA 2QQ9A 2RJEA 3CXCS 4GLKA 3NFCA 1LPLA 1EZZB 1KC8C 1TWBA 3CXCP 1PNJA 2XICA 2EAYA 1RACB 3EFRA 4E7IA 3BDLA 1M30A 2ED0A 1AWJA 1WHMA 2CDTA 2QK0A 1E7OA 3NTIA 4M77D 1VQ6Q 2GQVA 2K4YA 4OMFB 3OYBA 1MMAA 2HL5C 3QIIA 5CQXA 1VOMA 1M3BA 2NUPB 1OPKA 4R0KA 4F04B 3HHTB 1IB8A 1LNXA 4C92C 1QVFS 1DJ7B 1SSHA 1Z9QA 2FO0A 4A4GA 2E10A 3CCLQ 2DXBA 3OY9A 5M9OA 3CCMA 3I35A 3CBMA 1QVFP 1ZSZB 2AZVA 3EG3A 2DMOA 5GMKh 2Z0WA 1BBZA 1K8AR 1MNEA 3ZBDA 4RTZA 1T3SA 2QDLA 3ME9A 2X3WD 1ZA1B 3U23A 4IIMA 2YHTA 2EQUA 3OYDA 2E70A 4AFUC 5LJ3e 2RI2A 4PJOB 2MI6A 2JJ9A 3H9NA 2K57A 2PVGB 1WPYA 2DL5A 2KBTA 2QQBA 4KRTA 4QVCA 4M77F 1AZGB 5IXBA 4RUGA 4C0FA 5L8RE 3M54A 4NL3A 3J7AF 4E7LA 4ZN1A 5D6XA 2WACA 3EGXA 2OI3A 1B34B 3C95A 3O8VA 4K11A 4DA4A 3OSVA 3OMGA 1AEYA 2CSIA 5J3BA 3I56Q 3V7CA 1TU0B 1WZOA 1WIEA 4M75G 1EIFA 2YSQA 3CBOA 2M02A 2CT3A 2YUPA 5HY6A 3E2UA 2DX1A 1Y7XA 4Y91A 1F1BB 3V8LA 3QYGB 2A3LA 1Y07A 2WSCE 1AOJA 1H3ZA 1SF9A 2EJGA 2QYZA 1BCMA 4C5GA 1X6BA 4OMQA 4A4EA 1H8KA 2GNCA 3RKWA 3CCST 3OW2A 1UGQB 2EKHA 1NJIU 3CCVQ 2EIFA 3L2UA 1MUZA 2LNVA 1KFZA 2LQWA 2J7IA 1BB9A 4M7DD 1VQ7T 1KC8U 2KQWA 2DNUA 1CKAA 4O6JA 4OMNA 4F7UG 1VQNT 1YWOA 3TVTA 4PKCC 3HKSA 2KY9A 4LD9K 2DK3A 3C0CA 1YJNQ 1ZUUA 2RQWA 1PM3A 1YJ9A 3Q1JA 5GMKl 4C92D 3WVEB 4E47A 3EG2A 1ZUYA 1VQ5T 2J06A 1WNLA 1N9SA 2DAQA 3WVDB 2C0OA 1VQKA 3ULRB 1OX9A 4QW2A 3PE0A 1C0MA 3M58A 1FYNA 1G83A 1QCNA 2EQMA 1NEGA 1ZLMA 3O5ZA 2E64A 3V7RA 3L2VA 2FEIA 2ATCB 4ELYC 4M7DF 1UJYA 2DLPA 5GMKj 2RQUA 2Y4XA 3OYNA 1W2BP 3PVQA 2V1RA 3CC4A 3MP8A 4EMKB 4C92F 2AKLA 2VV5A 1NZ9A 1ZSGA 2K5LA 4P5NA 5CKDA 4PLLA 4PJOA 4C0DB 1TG0A 4UC4A 2M9UA 3QPHA 3OS2A 5KE3A 1GXIE 2AHJB 4F7UB 2ZCFB 5HK3A 3GP8A 3S3MA 5LJ3h 4IUVA 4LUDA 1KHIA 3M4GA 4M77E 4QVDA 2B8AA 1YP5A 3L2QA 1B34A 3NGPA 2L3SA 1QKWA 3CCEQ 3CC2T 5GAOn 5ECAA 1M1KR 3VS6A 2EJFA 1UTIA 2O9SA 2HD0A 3CC7Q 3UA7A 1R8OB 1RI9A 2VVKA 3T9NA 1ZA2B 1PKTA 3EGDB 3H0FA 4XK8E 4E7ZA 5C0MA 3CCUQ 1W1FA 2CSQA 4J9CA 3M59A 2R5AA 1ABOA 4C5IA 2JOYA 1Y96B 1G2BA 2JMCA 3VYGA 3G4ST 5GAMd 2RNAA 1Y0MA 4MZMA 2LRQA 4CC4B 1WXBA 5LJ3g 1YITQ 3CMAQ 1YJWQ 1KQSA 2VWFA 2YRVA 4CC2A 2GGRA 4HVVA 2LQKA 2RQVA 1RAFB 5LJ5h 4R55A 1BIBA 1V29B 2MPXC 2VXFA 1D1AA 2YRCA 1QP3A 2QI2A 3S3NA 1KK7A 4A54A 3GIBA 1WHJA 4WCIA 3BE3A 4PK4A 1OYXA 4A63B 5FRNA 2HQHA 2DXTA 4RTTA 1Q7YC 2CREA 4BI3A 2FB7A 3OYLA 2ZAEA 2HBWA 4FYXB 4M75A 3LWHA 4BY6C 4M7AG 1MHNA 2X4XA 3LH0A 1YIJA 2F2WA 1N6AA 2ABLA 3RNJA 4DOVA 4DBHA 2Y90A 1VYVA 2RH2A 2DF6A 3G71T 3CMET 4J7IA 4R56A 1CKBA 2RHIA 1K0XA 1KQ1A 2E5KA 1E6HA 4M7DE 2CP3A 1VQPQ 3CCQA 4OF1A 1X6OA 3FC3A 2M0YA 3QSUA 2DD5A 1Y71A 1FMVA 1Q86C 2H8HA 5KYWA 1AWXA 4C92E 3HSBA 3JV3A 4QQGA 1B3QA 3CCSA 3JCMQ 3QDFA 4F7UA 5LJ3j 3OS1A 2ENMA 3QJYA 1IGUA 3INZA 5IT9E 2DTIA 4OGCA 1VIEA 5CQYA 1I5LA 3OYGA 1VQNA 2YUNA 2XK0A 2RMOA 4OB0B 4XTXA 2CGHA 5IAYA 2HQXA 3BFMA 4KGZB 3JCMe 1OZ3A 3GBQA 1U1TA 4M7AB 4ESRA 2YUOA 5FWBA 2LVMA 4PFZA 4EDUA 4F16A 3SB2A 3M5AA 4HCBA 3EGDA 3S3OA 1VQ5A 3HFOA 1LOJA 1PG5B 2KRSA 1QWFA 3VS0A 2JTMA 1GFCA 4AFSC 2I0NA 3CCRT 1GCQA 3JCMd 1Y96A 4M78C 5EC7A 2E4HA 1SRMA 2HAXA 2DRKA 2F1LA 2QEXQ 2BZYA 2VASA 3CCLT 1QVGP 5LJ5j 2EQKA 4KH0B 1QWEA 9ATCB 3CD6T 3I5RA 3UDCA 1SRLA 3OYJA 1M9SA 1ZQ1A 1WHKA 2YLCA 4IIOA 3QXEB 3I55T 4C8QG 1Q7YU 3P8HA 2X4JA 3G7ZA 1O9SA 4NL2A 5CIUA 2DO3A 2CZ1B 1S72Q 3TEEA 4QQ6A 3PMTA 5KYYA 4OB1B 4B6MA 2JS0A 2K3XA 1D0XA 2LT4A 4IUTA 4PFPA 2V8IA 1JO8A 2DIGA 2M51A 1PSEA 1UGVA 3P8BB 5HKCA 1UHFA 2FHDA 2F5TX 1X69A 1I1JA 1RABB 3QJ6A 3EG1A 4LUEA 5DLQE 3JCMP 1Z9ZA 2V8KA 2CS7A 5I2MA 3EGXB 3EH1A 2D8HA 1O75A 3EH2A 2L5QA 2RI3A 5CKBA 4KULA 3M53A 3DB4A 2QA4A 3I9QA 1ZSZC 1Q86U 3PGGA 4ORZA 2DEQA 4ZNXA 3FDRA 2RHXA 2XD0A 2L8DA 5GAOq 2JZ2A 1Q81C 2EJ9A 1OULA 1NE8A 3M0SA 2NUTA 3GOXA 3G4SA 1OEBA 2F2VA 2BKDN 2X51A 3CCMQ 5LJ3f 1UGPB 3A8MB 2RJCA 2YRDA 3CPWS 3DKMA 4C8QB 1YHQQ 4NOYA 2GCXA 3RBBB 1OV3A 2KE9A 5GAN8 3CPWP 5IXFA 3CCVT 3RESA 2A37A 2LQ8A 1AT1B 5D6YA 3FEOA 1AWWA 1IO6A 4IUQA 4X1VA 5AYFA 1MGQA 4J6WA 5J39A 4OMMA 1OU9A 3CXCA 4M78D 3V7SA 3VU3C 3OYYA 2HQEA 2YT6A 4KUIA 1K73R 2CP6A 2QQRA 1NJIC 3TSWA 2ROTA 4M7AA 4CC7A 2PUKB 4HXJA 2E3IA 5A0LA 2CP7A 3ZEHA 3X24B 2DZ9A 2BZXA 2JTEA 4D8DA 2ESWA 3P8DA 2MYSA 3JCMh 1AHJB 1QCOA 1VA7A 3FJ5A 4O5VA 4E6RA 3MCAB 4Y92A 3HRUA 4M7DC 3TU4K 2PUOB 2X9HA 1PRLC 2LT1A 2BZ8A 2EWNA 4N0AC 1ACMB 4EMGA 2XMFA 1QVFA 2XU8A 3G71A 3CMEA 1ZBXA 3THKA 8ATCB 2A36A 1X01A 5LJ5f 3SD4A 3JCMJ 1VYTA 2V26A 4OGEA 2DFUA 2LJ1A 3SHWA 1OI1A 3G6EQ 4M78F 1IZ6A 2IVWA 2HMAA 1NEBA 3JB9D 1VQLA 4MZTA 5FU7B 4FSXA 2EQIA 2WSFE
chains in the Genus database with same CATH topology
5HCKA 2FEIA 1WXTA 1JEGA 1UJYA 2DLPA 2J6OA 4D8KA 1UECA 2RQUA 3M0QA 3PVQA 1WA7A 2W0ZA 3H0HA 4CC3A 2J6FA 2V1RA 4JZ4A 2AKLA 4F17A 1ZSGA 2EBPA 3M0PA 1RLQC 1NLOC 1TG0A 4FSSA 2LJ3A 2DL7A 2GTOA 2RF0A 1HD3A 1YWPA 1TUCA 4LUDA 1B07A 3NPFA 1WX6A 2MCNA 1YP5A 2FPFA 2KYMA 1GRIA 3NGPA 2HDAA 2L3SA 1QKWA 2DL4A 2CUBA 2KROA 4OMOA 3M0UA 5ECAA 2JT4A 2LQNA 4LN2A 1PHTA 3VS6A 4HVUA 1UTIA 2O9SA 2KEAA 4RTWA 2EYYA 4Z88A 2HCKA 3UA7A 2FG0A 2PTKA 2FRYA 1RI9A 3EHRA 2VVKA 3VS1A 1HJDA 1YCSB 5GJVB 1U5SA 1PKTA 2DL8A 3H0FA 1ZBJA 3M0TA 4AFQC 2O9VA 1W1FA 2CSQA 1AD5A 4J9CA 1WLPB 2LMJA 2JW4A 1WDXA 1VYUA 2K7AA 2RQTA 1ABOA 2JMAA 1G2BA 2JMCA 2FPDA 2RNAA 1JQQA 1Y0MA 4CC4B 1WXBA 3H41A 2CH4W 1GCPA 1A0NB 2D1XA 2VWFA 3NMZC 2RQRA 4CC2A 2GGRA 4HVVA 2RQVA 1SHGA 4JJBA 4Z89A 1V1CA 2DL3A 3VS2A 1BK2A 2KRNA 2J05A 1KJWA 2ROLA 1UFFA 2GBQA 3EG0A 1X2KA 2KXCA 2DRMA 1I0CA 2K79A 1H92A 1SEMA 1T0HA 4WCIA 2OJ2A 2W10A 2L2PA 4A63B 1KIKA 3REBB 2LNHB 2KRMA 2A28A 1NM7A 4RTTA 1H3HA 4EIKA 2CREA 1K76A 2O31A 3VRYA 1K1ZA 2RN8A 2YDLA 5IHIA 4DEYA 1NYGA 1ZUKA 2OAWA 2HBWA 3UATA 2EGCA 2EPDA 1RUWA 3VS4A 2D8JA 4HCKA 4RTXA 4AFZC 5IHKA 2F2WA 2AK5A 1ABQA 2ABLA 3RNJA 3R6NA 2EVRA 3CQTA 3H0IA 4J9BA 3ZL7C 2G6FX 1VYVA 1QKXA 2O88A 3VRZA 4QT7A 2KYBA 2DF6A 1PWTA 3EGUA 1UDLA 4M4ZA 1JXOA 1CKBA 2L3QA 1K0XA 4RTUA 2O2OA 2D0NA 2KT8A 5I11A 1KSWA 5L23A 1RLPC 2C0IA 2K3BA 2E5KA 1E6HA 1ZX6A 1MV3A 2DILA 4HVWA 3LH5A 1FMKA 2IIMA 4OMLA 2GTJA 2M0YA 2JM8A 1JXMA 3PVLA 3UA6A 2DA9A 2FPEA 2H8HA 1AWXA 4J9IA 1OPLA 2LZ6B 1SHFA 1AVZC 3JV3A 1PKSA 3EHQA 1B3QA 1TUDA 2V1QA 4AG2C 4J9EA 1AZEA 2ENMA 1PRMC 1JU5C 1CSKA 1GBQA 1WYXA 2K6DA 4JPBW 3I5SA 2YUNA 2RMOA 1WXUA 2HSPA 2J6KA 1T0JA 3A98A 1GBRA 1YNZA 1K4US 3VS7A 4GLMA 1HSQA 2YUQA 1UUEA 3GBQA 4ESRA 2YUOA 5FWBA 5FW9A 1QCFA 1X6GA 4F16A 2LX7A 1EFNA 1ARKA 2JXBA 2KRSA 2MOXA 4J9DA 1QWFA 3VS0A 1GFCA 4AFSC 1UJ0A 2I0NA 1GCQA 2X3XD 2NUZA 4AG1C 2FRWA 5EC7A 1X27A 1W70A 2RPNA 1PNJA 1XOVA 1J3TA 1SRMA 1U3OA 2KR3A 2KXDA 1BU1A 4LNPA 2DRKA 1M30A 2ED0A 2DBMA 1AWJA 2BZYA 2CDTA 1GCQC 1QWEA 1E7OA 2L0AA 3I5RA 1SRLA 2LP5A 2DBKA 2GQIA 2CT4A 1M3BA 2ED1A 1OPKA 4IIOA 4R0KA 3REAB 1M8MA 2LJ0A 1X43A 2K9GA 1SSHA 1Z9QA 2FO0A 2MIOA 2CUDA 2EYXA 1NLPC 1SPKA 3I35A 1I07A 2C0TA 1GFDA 2AZVA 2JS0A 1LCKA 3EG3A 2DMOA 1BBZA 1AWOA 1JO8A 2M51A 1UGVA 2NWMA 1UHFA 1M27C 1T3SA 4RTZA 2QDLA 2JM9A 3SEMA 2X3WD 1X69A 1I1JA 3U23A 4F14A 4IIMA 2LCSA 1S1NA 3EG1A 4LUEA 1N5ZA 1Z9ZA 1Y57A 4AFUC 1MV0B 4J9FA 3KFVA 2KT1A 2SRCA 3M0RA 2KBTA 2DL5A 2ECZA 4KRTA 2D8HA 4J9GA 3QWYA 2L3PA 1X2QA 4RTYA 1AZGB 5IXBA 1M3AA 4RUGA 5I22A 3VS3A 1NG2A 2EYZA 3I9QA 1QLYA 2PNIA 4ORZA 2OI3A 4ZNXA 2HEQA 4K11A 4J9HA 1AEYA 2CSIA 4LE9A 2K2MA 1WIEA 1UHCA 4JZ3A 3M0SA 4DEXA 1W6XA 3TSZA 1YN8A 2YSQA 1WFWA 2DM1A 1T3LA 1OEBA 2EW3A 2F2VA 2CT3A 2YUPA 2DYBA 2CH4A 2DX1A 3NHNA 4JJDA 5FWCA 3QWXX 3RBBB 1OV3A 2SEMA 2BTTA 2KE9A 2EGEA 5IXFA 3IQLA 2A37A 1AOJA 2KNBB 2AZSA 4JJCA 1UE9A 1E6GA 1AWWA 1IO6A 4X1VA 2DVJA 1X6BA 4OMQA 4OMMA 1OOTA 2DJQA 1H8KA 2YT6A 3VS5A 2AKKA 2GNCA 4OMPA 2EKHA 3TSWA 2ROTA 4CC7A 4HXJA 1MUZA 1KFZA 1GL5A 2LQWA 2EGAA 2J7IA 1WI7A 2BZXA 1BB9A 2JTEA 4D8DA 2ESWA 2DNUA 2PZ1A 1CKAA 4OMNA 4Z8AA 1YWOA 3TVTA 1VA7A 2F2XA 3FJ5A 4E6RA 5IH2A 4Y92A 4RTVA 2B86A 2KGTA 3C0CA 1ZUUA 1PRLC 2RQWA 2BZ8A 2JS2A 1K9AA 2XMFA 3UF4A 2P4RA 1UG1A 1K0SA 3EG2A 3THKA 2A36A 1ZUYA 2J06A 1VYTA 2VKNA 1M3CA 2C0OA 3ULRB 2LJ1A 3SHWA 3PE0A 1FYNA 1NYFA 1U06A 1G83A 2DE0X 2A08A 4GBQA 2EYWA 1NEGA 1NEBA 1ZLMA 3O5ZA 2EQIA 5GJWB 5IHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCK A;  2FEI A;  1WXT A;  1JEG A;  1UJY A;  2DLP A;  2J6O A;  4D8K A;  1UEC A;  2RQU A;  3M0Q A;  3PVQ A;  1WA7 A;  2W0Z A;  3H0H A;  4CC3 A;  2J6F A;  2V1R A;  4JZ4 A;  2AKL A;  4F17 A;  1ZSG A;  2EBP A;  3M0P A;  1RLQ C;  1NLO C;  1TG0 A;  4FSS A;  2LJ3 A;  2DL7 A;  2GTO A;  2RF0 A;  1HD3 A;  1YWP A;  1TUC A;  4LUD A;  1B07 A;  3NPF A;  1WX6 A;  2MCN A;  1YP5 A;  2FPF A;  2KYM A;  1GRI A;  3NGP A;  2HDA A;  2L3S A;  1QKW A;  2DL4 A;  2CUB A;  2KRO A;  4OMO A;  3M0U A;  5ECA A;  2JT4 A;  2LQN A;  4LN2 A;  1PHT A;  3VS6 A;  4HVU A;  1UTI A;  2O9S A;  2KEA A;  4RTW A;  2EYY A;  4Z88 A;  2HCK A;  3UA7 A;  2FG0 A;  2PTK A;  2FRY A;  1RI9 A;  3EHR A;  2VVK A;  3VS1 A;  1HJD A;  1YCS B;  5GJV B;  1U5S A;  1PKT A;  2DL8 A;  3H0F A;  1ZBJ A;  3M0T A;  4AFQ C;  2O9V A;  1W1F A;  2CSQ A;  1AD5 A;  4J9C A;  1WLP B;  2LMJ A;  2JW4 A;  1WDX A;  1VYU A;  2K7A A;  2RQT A;  1ABO A;  2JMA A;  1G2B A;  2JMC A;  2FPD A;  2RNA A;  1JQQ A;  1Y0M A;  4CC4 B;  1WXB A;  3H41 A;  2CH4 W;  1GCP A;  1A0N B;  2D1X A;  2VWF A;  3NMZ C;  2RQR A;  4CC2 A;  2GGR A;  4HVV A;  2RQV A;  1SHG A;  4JJB A;  4Z89 A;  1V1C A;  2DL3 A;  3VS2 A;  1BK2 A;  2KRN A;  2J05 A;  1KJW A;  2ROL A;  1UFF A;  2GBQ A;  3EG0 A;  1X2K A;  2KXC A;  2DRM A;  1I0C A;  2K79 A;  1H92 A;  1SEM A;  1T0H A;  4WCI A;  2OJ2 A;  2W10 A;  2L2P A;  4A63 B;  1KIK A;  3REB B;  2LNH B;  2KRM A;  2A28 A;  1NM7 A;  4RTT A;  1H3H A;  4EIK A;  2CRE A;  1K76 A;  2O31 A;  3VRY A;  1K1Z A;  2RN8 A;  2YDL A;  5IHI A;  4DEY A;  1NYG A;  1ZUK A;  2OAW A;  2HBW A;  3UAT A;  2EGC A;  2EPD A;  1RUW A;  3VS4 A;  2D8J A;  4HCK A;  4RTX A;  4AFZ C;  5IHK A;  2F2W A;  2AK5 A;  1ABQ A;  2ABL A;  3RNJ A;  3R6N A;  2EVR A;  3CQT A;  3H0I A;  4J9B A;  3ZL7 C;  2G6F X;  1VYV A;  1QKX A;  2O88 A;  3VRZ A;  4QT7 A;  2KYB A;  2DF6 A;  1PWT A;  3EGU A;  1UDL A;  4M4Z A;  1JXO A;  1CKB A;  2L3Q A;  1K0X A;  4RTU A;  2O2O A;  2D0N A;  2KT8 A;  5I11 A;  1KSW A;  5L23 A;  1RLP C;  2C0I A;  2K3B A;  2E5K A;  1E6H A;  1ZX6 A;  1MV3 A;  2DIL A;  4HVW A;  3LH5 A;  1FMK A;  2IIM A;  4OML A;  2GTJ A;  2M0Y A;  2JM8 A;  1JXM A;  3PVL A;  3UA6 A;  2DA9 A;  2FPE A;  2H8H A;  1AWX A;  4J9I A;  1OPL A;  2LZ6 B;  1SHF A;  1AVZ C;  3JV3 A;  1PKS A;  3EHQ A;  1B3Q A;  1TUD A;  2V1Q A;  4AG2 C;  4J9E A;  1AZE A;  2ENM A;  1PRM C;  1JU5 C;  1CSK A;  1GBQ A;  1WYX A;  2K6D A;  4JPB W;  3I5S A;  2YUN A;  2RMO A;  1WXU A;  2HSP A;  2J6K A;  1T0J A;  3A98 A;  1GBR A;  1YNZ A;  1K4U S;  3VS7 A;  4GLM A;  1HSQ A;  2YUQ A;  1UUE A;  3GBQ A;  4ESR A;  2YUO A;  5FWB A;  5FW9 A;  1QCF A;  1X6G A;  4F16 A;  2LX7 A;  1EFN A;  1ARK A;  2JXB A;  2KRS A;  2MOX A;  4J9D A;  1QWF A;  3VS0 A;  1GFC A;  4AFS C;  1UJ0 A;  2I0N A;  1GCQ A;  2X3X D;  2NUZ A;  4AG1 C;  2FRW A;  5EC7 A;  1X27 A;  1W70 A;  2RPN A;  1PNJ A;  1XOV A;  1J3T A;  1SRM A;  1U3O A;  2KR3 A;  2KXD A;  1BU1 A;  4LNP A;  2DRK A;  1M30 A;  2ED0 A;  2DBM A;  1AWJ A;  2BZY A;  2CDT A;  1GCQ C;  1QWE A;  1E7O A;  2L0A A;  3I5R A;  1SRL A;  2LP5 A;  2DBK A;  2GQI A;  2CT4 A;  1M3B A;  2ED1 A;  1OPK A;  4IIO A;  4R0K A;  3REA B;  1M8M A;  2LJ0 A;  1X43 A;  2K9G A;  1SSH A;  1Z9Q A;  2FO0 A;  2MIO A;  2CUD A;  2EYX A;  1NLP C;  1SPK A;  3I35 A;  1I07 A;  2C0T A;  1GFD A;  2AZV A;  2JS0 A;  1LCK A;  3EG3 A;  2DMO A;  1BBZ A;  1AWO A;  1JO8 A;  2M51 A;  1UGV A;  2NWM A;  1UHF A;  1M27 C;  1T3S A;  4RTZ A;  2QDL A;  2JM9 A;  3SEM A;  2X3W D;  1X69 A;  1I1J A;  3U23 A;  4F14 A;  4IIM A;  2LCS A;  1S1N A;  3EG1 A;  4LUE A;  1N5Z A;  1Z9Z A;  1Y57 A;  4AFU C;  1MV0 B;  4J9F A;  3KFV A;  2KT1 A;  2SRC A;  3M0R A;  2KBT A;  2DL5 A;  2ECZ A;  4KRT A;  2D8H A;  4J9G A;  3QWY A;  2L3P A;  1X2Q A;  4RTY A;  1AZG B;  5IXB A;  1M3A A;  4RUG A;  5I22 A;  3VS3 A;  1NG2 A;  2EYZ A;  3I9Q A;  1QLY A;  2PNI A;  4ORZ A;  2OI3 A;  4ZNX A;  2HEQ A;  4K11 A;  4J9H A;  1AEY A;  2CSI A;  4LE9 A;  2K2M A;  1WIE A;  1UHC A;  4JZ3 A;  3M0S A;  4DEX A;  1W6X A;  3TSZ A;  1YN8 A;  2YSQ A;  1WFW A;  2DM1 A;  1T3L A;  1OEB A;  2EW3 A;  2F2V A;  2CT3 A;  2YUP A;  2DYB A;  2CH4 A;  2DX1 A;  3NHN A;  4JJD A;  5FWC A;  3QWX X;  3RBB B;  1OV3 A;  2SEM A;  2BTT A;  2KE9 A;  2EGE A;  5IXF A;  3IQL A;  2A37 A;  1AOJ A;  2KNB B;  2AZS A;  4JJC A;  1UE9 A;  1E6G A;  1AWW A;  1IO6 A;  4X1V A;  2DVJ A;  1X6B A;  4OMQ A;  4OMM A;  1OOT A;  2DJQ A;  1H8K A;  2YT6 A;  3VS5 A;  2AKK A;  2GNC A;  4OMP A;  2EKH A;  3TSW A;  2ROT A;  4CC7 A;  4HXJ A;  1MUZ A;  1KFZ A;  1GL5 A;  2LQW A;  2EGA A;  2J7I A;  1WI7 A;  2BZX A;  1BB9 A;  2JTE A;  4D8D A;  2ESW A;  2DNU A;  2PZ1 A;  1CKA A;  4OMN A;  4Z8A A;  1YWO A;  3TVT A;  1VA7 A;  2F2X A;  3FJ5 A;  4E6R A;  5IH2 A;  4Y92 A;  4RTV A;  2B86 A;  2KGT A;  3C0C A;  1ZUU A;  1PRL C;  2RQW A;  2BZ8 A;  2JS2 A;  1K9A A;  2XMF A;  3UF4 A;  2P4R A;  1UG1 A;  1K0S A;  3EG2 A;  3THK A;  2A36 A;  1ZUY A;  2J06 A;  1VYT A;  2VKN A;  1M3C A;  2C0O A;  3ULR B;  2LJ1 A;  3SHW A;  3PE0 A;  1FYN A;  1NYF A;  1U06 A;  1G83 A;  2DE0 X;  2A08 A;  4GBQ A;  2EYW A;  1NEG A;  1NEB A;  1ZLM A;  3O5Z A;  2EQI A;  5GJW B;  5IHN A; 
#chains in the Genus database with same CATH topology
 1IXD A;  1Q82 C;  1UEB A;  3CCJ Q;  1K9M R;  4D8K A;  2MMP A;  5EG2 A;  3JCM g;  1UEC A;  2XKO C;  3M0Q A;  5C6S A;  1WHG A;  4JZ4 A;  2GFA A;  3D7S B;  5KYX A;  1PCX A;  4F17 A;  3OS0 A;  1PD1 A;  2VXE A;  1YIJ T;  4JDS A;  1NLO C;  4FSS A;  3CCE T;  3RKX A;  4PJO D;  3JCM X;  1XJW B;  1RAH B;  4A53 A;  1Q81 U;  1HD3 A;  1YWP A;  1TUC A;  3GLX A;  3NPF A;  1LVK A;  4L59 A;  1WX6 A;  3JB9 F;  2HKQ B;  1M90 R;  3E9F A;  3S6W A;  4PL6 A;  2FPF A;  2KYM A;  4IUR A;  2KDS A;  4OMO A;  4EMK C;  3M0U A;  3CCR A;  2DTO A;  2LC4 A;  4HCC A;  3CCQ T;  4ZN3 A;  4RTW A;  2XHC A;  4C0D C;  3E1S A;  3MET A;  3EHR A;  3VS1 A;  4WTO B;  1WJQ A;  5GJV B;  1U5S A;  1BIA A;  3OBY A;  4C8Q A;  3OYM A;  4FT2 A;  4FYW B;  2JTF A;  2IG0 A;  1K8A C;  2HSE B;  5FU6 B;  3CCL A;  3CMA T;  3CD6 A;  1WLP B;  3QZ5 B;  3CC4 Q;  2RK2 A;  2FZC B;  2RQT A;  2JMA A;  3I55 A;  2IPO B;  1WJR A;  4PJO F;  2FPD A;  3EAE A;  3OYF A;  1GCP A;  5I21 A;  3MEU A;  2D1X A;  4BAC A;  1VQM Q;  2OTJ T;  3NMZ C;  2RQR A;  3MP6 A;  5DLO A;  1YI2 Q;  2AT1 B;  1SHG A;  3OSS C;  3V8J A;  1RL2 A;  2E41 A;  3VS2 A;  2KRN A;  1VQ4 Q;  3EG0 A;  1WHH A;  2GBQ A;  1X2K A;  4X9C A;  1QW1 A;  4M77 A;  2DRM A;  5GMK i;  1I81 A;  4M75 B;  1SEM A;  2W10 A;  2HZY A;  2L2P A;  3REB B;  2RB6 A;  1RAI B;  2C06 A;  3G1J A;  2RHY A;  2ZPF B;  4EIK A;  4HT8 A;  1W2B A;  4ELZ C;  1K76 A;  2O31 A;  3VRY A;  1K1Z A;  5IHI A;  4OB2 B;  4DEY A;  2DKG A;  4PJJ A;  2EGC A;  3A1P A;  2EPD A;  3OYC A;  3VS4 A;  1VQ9 T;  4HCK A;  4RTX A;  1Q82 U;  5IHK A;  2LX9 A;  3QUI A;  4XU3 A;  1I5O B;  2LTO A;  3MJX A;  3KUF A;  1JJ2 S;  4M78 E;  3ZL7 C;  1XQH A;  1BKB A;  3TRE A;  1QKX A;  3VRZ A;  2E65 A;  1N9R A;  2QGF B;  2HKN A;  1PWT A;  3MPU B;  1JJ2 P;  4M4Z A;  1K73 U;  4LDU A;  2XDB A;  2L3Q A;  2RM4 A;  5CKF A;  3E19 A;  2D0N A;  5KYW B;  5I11 A;  1RLP C;  2RHU A;  5D7U A;  4C5E A;  2VUB A;  2LCC A;  2V8J A;  1MV3 A;  4LDV A;  5FRO A;  2DIL A;  4IUU A;  4HVW A;  1FMK A;  1M2O A;  3CCV A;  2IIM A;  4OML A;  2D9T A;  2GTJ A;  3PVL A;  3NTH A;  2DA9 A;  2FPE A;  2QAS A;  2H3J A;  3RUX A;  3AHU A;  3EHQ A;  2V1Q A;  4AG2 C;  4PJN A;  2MAM A;  2P0P A;  2MF2 A;  4XU1 A;  2XI9 A;  3M9Q A;  2H3E B;  1PRM C;  1GBQ A;  4JRP A;  2PVO B;  2K2V A;  5GAM e;  2QA4 T;  1R0C B;  1RAG B;  2F69 A;  1T0J A;  3M55 A;  3VUZ A;  3SWN A;  1K8A U;  4BI8 B;  1HSQ A;  2YUQ A;  3OYH A;  1UUE A;  4VUB A;  1K9M U;  2HL3 A;  3RMS A;  2JN0 A;  2CP5 A;  3A8O B;  2X4W A;  2RJF A;  3MEA A;  1D0Y A;  1P92 A;  1Q95 G;  1VQO T;  2OTL T;  1UJ0 A;  1QVP A;  1X27 A;  2E3H A;  2RPN A;  4RKU E;  1YFN A;  2KR3 A;  2RI5 A;  1BU1 A;  4F7U F;  4PJO E;  4LNP A;  2DJZ A;  1M2V A;  1KD1 R;  2HNI A;  5CKE A;  3JCM f;  2LP5 A;  1KQS S;  2DBK A;  2CT4 A;  5KYY B;  4ZGJ B;  1U8R A;  1VQ7 Q;  2ED1 A;  1N8R R;  4QKU A;  1TH7 A;  5CR2 A;  1I8F A;  2ZZD A;  3GPL A;  2E1H A;  2K9G A;  3CBP A;  1M1K C;  2MIO A;  2DER A;  1R0B G;  2CUD A;  2EYX A;  1NLP C;  1SPK A;  3HPW A;  2CYZ B;  3CCE A;  2BE9 B;  2C0T A;  1GFD A;  4GY5 A;  4ZTJ A;  1AWO A;  1TS9 A;  5CKH A;  2YWW A;  2JM9 A;  3CC7 A;  4F14 A;  1H64 1;  2L89 A;  3X26 B;  1Y57 A;  1JB0 E;  3OS5 A;  1MV0 B;  4J9F A;  3FRN A;  2KT1 A;  2L3R A;  2SRC A;  3M0R A;  4J9G A;  1SKU B;  3QWY A;  2L3P A;  2VGN A;  3A8L B;  4ZGD B;  1VQL T;  1C1A A;  1M3A A;  3HRT A;  5I22 A;  2NUT B;  2EKO A;  3VS3 A;  3PMI A;  1NG2 A;  5CO7 A;  1QLY A;  1FWZ A;  4LD6 A;  3VJP A;  2FVU A;  2PNI A;  2P0K A;  1YIT A;  3CMA A;  2HEQ A;  5KCH A;  3OYI A;  4J9H A;  1HK9 A;  4FW1 A;  5GAN 6;  1YHQ T;  4A4K A;  4XTZ A;  4C0G A;  1UHC A;  4WF2 A;  3LW5 E;  5CAI A;  2DM1 A;  4TVR A;  4JRQ A;  1T3L A;  2DYB A;  4QVZ A;  3KXT A;  4J6Y A;  1OX8 A;  1JRI A;  2OX7 A;  2OTJ A;  5FWC A;  4FIB A;  3QWX X;  3PIP A;  5I2S A;  1XNI A;  1MND A;  4L6V 5;  2SEM A;  2BTT A;  1ZHI A;  2R57 A;  2O4X A;  2AZS A;  4J6X A;  1E6G A;  3MHX A;  2MK5 A;  4XU2 A;  5GAO m;  3LLR A;  4X9D A;  2K3Y A;  3CC2 Q;  6AT1 B;  3VUB A;  1VQ8 Q;  5GAM h;  1M5Q 1;  1QVG A;  1VQ6 T;  3PTA A;  2D0Q B;  3QBY A;  1GL5 A;  1W4S A;  4M7A D;  4C8Q C;  2PZ1 A;  5GAN 7;  3HTR A;  4Z8A A;  1VQ9 A;  3M4Y A;  2KGT A;  4BY6 B;  1IHV A;  3G6E T;  2QDY B;  1QP2 A;  4J5Y A;  1K9A A;  3G4S Q;  3UF4 A;  2P4R A;  2KSS A;  4IUP A;  4CRI A;  4YTL A;  3BY7 A;  2PVD B;  3RKY A;  3PNW C;  1M1K U;  5KYN A;  4F7U E;  4FYY B;  2DPP B;  1NYF A;  3GNF B;  4ANJ A;  2I2L A;  4M78 G;  1WQ7 A;  4E7S A;  2CP0 A;  3TQ7 P;  4GBQ A;  5GAM g;  2RHZ A;  1YBY A;  2KK4 A;  5KYX B;  5HCK A;  4M7A F;  1JEG A;  1BI3 A;  4LDY A;  2DXU A;  4BUG A;  3QO3 A;  2R5M A;  1WA7 A;  1UGS B;  2W0Z A;  5GAN 3;  4CC3 A;  3OBW A;  4M77 G;  1HYO A;  3I56 T;  2KAF A;  2EYQ A;  2ZPE B;  4EMH A;  4PNO A;  3M0P A;  2FZG B;  1BCO A;  1KC8 R;  2LJ3 A;  4MZP A;  2K5I A;  3MO8 A;  2GTO A;  3UT1 A;  2RF0 A;  3EFS A;  3L1A A;  3SDZ A;  3G71 Q;  3CME Q;  2RK1 A;  1B07 A;  3CPW A;  4PJO C;  4ATO A;  3MP1 A;  3V8K A;  2LDM A;  1GRI A;  2HDA A;  1VQO A;  2CUB A;  2OTL A;  2KRO A;  2JT4 A;  4HA8 A;  2GF7 A;  4LN2 A;  1PHT A;  1I4K 1;  2PU9 B;  4HVU A;  3UWN A;  2KEA A;  1D3B A;  3MKD A;  5A0G A;  2HCK A;  2FG0 A;  2PTK A;  4LXC A;  3QZ9 B;  2ZPH B;  4XTY A;  2DL8 A;  4KGX B;  1ZBJ A;  1FMW A;  4N4I A;  3M0T A;  4PJM A;  4AFQ C;  1TXQ A;  3C12 A;  4C8Q D;  2LMJ A;  2JW4 A;  1WDX A;  1YJN T;  2K7A A;  1YI2 T;  1D0Z A;  2XDD A;  1JQQ A;  2LCL A;  3H41 A;  5GAM j;  1G3W A;  1VQ4 T;  2BIV A;  1A0N B;  3HFN A;  4M77 B;  2DTH A;  5KYU B;  1V1C A;  3E9G A;  2DL3 A;  4KGV B;  1BK2 A;  1KQ2 A;  2HBP A;  5FU6 C;  2ROL A;  1UFF A;  1I0C A;  2K79 A;  1G3Y A;  1UB4 A;  1TTH B;  3CCR Q;  2OJ2 A;  4AMC A;  1EX4 A;  3UPU A;  2LNH B;  2KRM A;  4E7J A;  1U1S A;  2A28 A;  3PIO A;  5GAN e;  1H3H A;  3DB3 A;  4AT1 B;  4C8Q F;  2RJD A;  3OYA A;  2RN8 A;  2YDL A;  4MDW A;  2JUF A;  3JSC A;  1NYG A;  1ZUK A;  2OAW A;  3L2W A;  4RCC A;  4M7D G;  3CD6 Q;  3OYE A;  2ZPG B;  2EFI A;  2MWP A;  3JRZ A;  1ABQ A;  4BDZ A;  3CQT A;  1YHQ A;  5GAN d;  3I55 Q;  4J9B A;  5D6W A;  2G6F X;  2O88 A;  4XAX B;  4BD3 A;  4QT7 A;  1K73 C;  2QTV A;  4M75 C;  7AT1 B;  3EGU A;  3EG9 A;  4C92 G;  1UDL A;  3ZFJ A;  3EFO B;  2KT8 A;  1NBE B;  2K3B A;  1YJ9 Q;  5FRM A;  4M7A E;  1C6V X;  1ZX6 A;  3JCM W;  1NPP A;  4PJL A;  4JS5 A;  1JXM A;  3UA6 A;  1RAE B;  4Z02 A;  3CC7 T;  1VQK Q;  4FU6 A;  2LZ6 B;  1AVZ C;  1PKS A;  5LJ3 d;  1TUD A;  4B9W A;  4BB7 A;  3CCU T;  1HXD A;  4DOW A;  3VKI A;  1NPR A;  1AZE A;  3SWN B;  1VQ6 A;  2CZ0 B;  1G3T A;  4JLG A;  1JU5 C;  4E7H A;  3L2R A;  2K6D A;  4JPB W;  1VIF A;  2NYS A;  1WXU A;  1G3S A;  2J6K A;  1YIT T;  3LYI A;  3LX7 A;  1YJW T;  1GBR A;  2QGG A;  2M16 A;  3G6E A;  1K4U S;  1K9M C;  4M7D B;  5FW9 A;  4M78 A;  5KH6 A;  1X6G A;  2CZ6 B;  4XTV A;  4PFO A;  4KBM B;  3A8H B;  1ARK A;  5LJ5 e;  5CCA A;  3CCJ A;  1M2V B;  2QTX A;  4J9D A;  4BDY A;  1YCY A;  4C92 B;  3HL8 A;  2X3X D;  1G5V A;  2NUZ A;  2X4Y A;  1OZ2 A;  2FRW A;  2P4T A;  4AG1 C;  3OW2 S;  5GAM f;  1MMG A;  3JB9 I;  1W70 A;  2QQS A;  1XOV A;  2OAU A;  1J3T A;  1U3O A;  2KXD A;  2K5F A;  3X20 B;  3FLG A;  3OW2 P;  5LJ5 d;  1MMD A;  2DBM A;  1GCQ C;  1VUB A;  4OP0 A;  1X75 C;  5KYU A;  2L0A A;  1M90 C;  2E6Z A;  2GQI A;  3I56 A;  3WXM B;  3REA B;  1M8M A;  2LJ0 A;  2RO0 A;  1X43 A;  5KE2 A;  3DLM A;  3M57 A;  4JJN K;  3J80 E;  1JJ2 A;  5GAO p;  1PC0 A;  4M75 D;  1I07 A;  2NUP A;  2VYT A;  1LCK A;  1B7T A;  1VQP T;  2NWM A;  5CK9 A;  1M27 C;  3BDU A;  3SEM A;  4C8Q E;  1W2B S;  2QG9 B;  2XID A;  4Y28 E;  5GAN h;  2LCS A;  1S1N A;  1N5Z A;  1ZSZ A;  3H6Z A;  3KFV A;  3JCM b;  8AT1 B;  4OVA A;  2ECZ A;  4DBF A;  1V76 A;  4XU0 A;  1X2Q A;  4RTY A;  3A5Z B;  3OYK A;  3EFO A;  1PD0 A;  1BI0 A;  2EYZ A;  2A0F B;  1BYM A;  1VQM A;  5LL6 S;  4RG2 A;  4LE9 A;  2K2M A;  1YJN A;  4M75 F;  4JZ3 A;  3OB9 A;  2FYK A;  1G8X A;  1YI2 A;  4DEX A;  1W6X A;  3TSZ A;  2WSE E;  1YN8 A;  1WFW A;  2O4X B;  3OA6 A;  2EW3 A;  2CH4 A;  1YIJ Q;  4FM4 B;  4DBR A;  2YXY A;  1VQ4 A;  1Q7Y R;  3NHN A;  4JJD A;  2COZ A;  5GAN g;  2MWO A;  3JAM E;  4RG8 A;  3MEV A;  4D6W A;  1VQ8 T;  4A4F A;  2EGE A;  3DLL A;  1TOV A;  3IQL A;  2DZC A;  2KNB B;  3LWI A;  4JJC A;  1UE9 A;  3JCM c;  3VYH B;  4DQ2 A;  1FXX A;  5FLX E;  2DVJ A;  5IN1 A;  3RR6 A;  1OOT A;  2DJQ A;  2E5Q A;  3VS5 A;  4BE0 A;  2AKK A;  2KMT A;  2QEX T;  4XTW A;  3OQ5 A;  4OMP A;  3CCQ Q;  5GMK m;  2DXC A;  1UGR B;  2D6F A;  4M7D A;  5DY9 A;  2EQJ A;  5A0D A;  4J7F A;  2QQA A;  2EGA A;  1WI7 A;  4N0A A;  4DBQ A;  3GNG A;  4NS5 A;  3JCM V;  3CEY A;  5GAO l;  3CCS Q;  5HK0 A;  2F2X A;  3QYH B;  1RAA B;  4J8O A;  5IH2 A;  4C92 A;  4RTV A;  4M7A C;  2B86 A;  2CP2 A;  1Q86 R;  3X28 B;  2COW A;  2JS2 A;  1S72 T;  1SG5 A;  3HP9 A;  4MDX A;  1M90 U;  1LJO A;  1UG1 A;  1K0S A;  1M8V A;  1D09 B;  1KQS P;  1VQN Q;  3FJP A;  1OQK A;  3JB9 J;  3RER A;  1M1F A;  2VKN A;  2OTJ Q;  1M3C A;  3BW1 A;  4FL6 A;  4FT4 A;  3VV0 A;  1U06 A;  2DE0 X;  2A08 A;  2R58 A;  2EYW A;  3QHS A;  2M1H A;  4BE2 A;  2F5K A;  1VQ5 Q;  4QQD A;  2DEU A;  5GJW B;  5IHN A;  2A7Y A;  4II1 A;  1WXT A;  1M4Z A;  4X34 A;  2J6O A;  3CCU A;  4JS4 A;  3H0H A;  2J6F A;  2QAZ A;  5GAN j;  4RCB A;  1WQW A;  3QG1 A;  5LJ5 g;  1IRE B;  4KUD K;  2X35 A;  1VQ9 Q;  2EBP A;  3RDV A;  1RLQ C;  4BI4 A;  4JUV A;  3CCM T;  1YJW A;  2KVQ G;  3PFS A;  3HRS A;  2AIR B;  2DL7 A;  4MMK A;  1BI2 A;  4EMK A;  1KD1 C;  3R6O A;  4JRI A;  4ME7 A;  1IGQ A;  2RA2 A;  4RMO A;  1D3B B;  1D1C A;  3A8G B;  1RAD B;  2MCN A;  2DIQ A;  3F70 A;  5KCO A;  1N8R C;  2DL4 A;  4HCZ A;  2CKK A;  3M56 A;  5AT1 B;  2DET A;  2LQN A;  3URG A;  4C0Z A;  2EYY A;  4JLI A;  4Z88 A;  2COY A;  4M75 E;  4IKF A;  1VQ7 A;  2FRY A;  4LDW A;  5CVI A;  2Y4Y A;  1HJD A;  3J81 E;  1YCS B;  2CZ7 B;  2BE7 D;  4LDX A;  3RIR A;  4N4H A;  2O9V A;  4OB3 B;  1AD5 A;  3C94 A;  5GAN 5;  1N27 A;  2P84 A;  1VYU A;  2QA4 Q;  2BUD A;  1QMC A;  3JB9 H;  4HKE A;  3SFM A;  2CH4 W;  4HT9 A;  1R77 A;  3FB9 A;  4E2F B;  5GAO r;  5DM7 R;  4Q5W A;  1FX7 A;  4XTU A;  4JJB A;  3RMQ A;  4Z89 A;  1RI0 A;  1VQP A;  4ZTF A;  2DYI A;  2J05 A;  1QVG S;  1D1B A;  1KJW A;  4XQ3 A;  2PQW A;  2KXC A;  2DD4 A;  2XDP A;  1Q81 R;  1VQO Q;  1H92 A;  2OTL Q;  5GMK e;  3ER0 A;  1T0H A;  2VC8 A;  3CCJ T;  1KIK A;  5A2Q E;  1NM7 A;  4A4H A;  3QDR B;  4BE1 A;  2JVV A;  3LGL A;  2XG8 D;  5GAN 4;  3H8Z A;  4M77 C;  3UAT A;  4J83 A;  3KBG A;  3EG9 B;  1OU8 A;  1RUW A;  2D8J A;  1JBM A;  4AFZ C;  2ZPI B;  3C4S A;  3L42 A;  2AK5 A;  4L5G A;  3R6N A;  2EVR A;  1WGS A;  3H0I A;  1YJ9 T;  4EPC A;  2RD1 A;  4E7K A;  3NTK A;  1PSF A;  2KYB A;  1NJI R;  1TUG B;  5GAN 2;  1JXO A;  4N4G A;  4RTU A;  4FW2 A;  2O2O A;  5L23 A;  1KSW A;  2ZPB B;  1VQK T;  2C0I A;  5FU7 C;  5GAN f;  3CC2 A;  4PLI A;  1IHW A;  3ASK A;  1VQ8 A;  2VGM A;  2FL7 A;  3LH5 A;  2NLU A;  1MMN A;  3PT9 A;  2QXF A;  4KH1 B;  4ZGE B;  1KD1 U;  2JM8 A;  4KT0 E;  2P0Q A;  3JB9 G;  1KG1 A;  4J9I A;  1OPL A;  1SHF A;  2E12 A;  3OMC A;  1SSF A;  1XTD A;  2KI7 A;  1N8R U;  2QEX A;  2VB6 A;  3L2Z A;  2E6N A;  4J9E A;  3N5B B;  1WJS A;  1KHC A;  1VQL Q;  2M0O A;  3CC4 T;  1CSK A;  1WYX A;  4CI0 C;  4C5H A;  4M78 B;  1BI1 A;  3I5S A;  3TCJ A;  5J26 A;  2HSP A;  2JNG A;  4V2S A;  1IRX A;  2ZGW A;  3A98 A;  1M1G A;  1VQM T;  1YNZ A;  1S72 A;  3LGF A;  3VS7 A;  4FYV B;  4MML A;  4GLM A;  1Q82 R;  2O01 E;  3AT1 B;  3CPF A;  4PJO G;  1QCF A;  3X25 B;  2DVE A;  2LX7 A;  4B9X A;  3MEW A;  3GF5 A;  3FIF A;  3QKJ A;  1EFN A;  1TSF A;  2JXB A;  3SWN C;  2YLB A;  4JRK A;  1WHL A;  4FCY A;  2FZK B;  2G3R A;  2GFU A;  2MOX A;  1QQJ A;  2QQ9 A;  2RJE A;  3CXC S;  4GLK A;  3NFC A;  1LPL A;  1EZZ B;  1KC8 C;  1TWB A;  3CXC P;  1PNJ A;  2XIC A;  2EAY A;  1RAC B;  3EFR A;  4E7I A;  3BDL A;  1M30 A;  2ED0 A;  1AWJ A;  1WHM A;  2CDT A;  2QK0 A;  1E7O A;  3NTI A;  4M77 D;  1VQ6 Q;  2GQV A;  2K4Y A;  4OMF B;  3OYB A;  1MMA A;  2HL5 C;  3QII A;  5CQX A;  1VOM A;  1M3B A;  2NUP B;  1OPK A;  4R0K A;  4F04 B;  3HHT B;  1IB8 A;  1LNX A;  4C92 C;  1QVF S;  1DJ7 B;  1SSH A;  1Z9Q A;  2FO0 A;  4A4G A;  2E10 A;  3CCL Q;  2DXB A;  3OY9 A;  5M9O A;  3CCM A;  3I35 A;  3CBM A;  1QVF P;  1ZSZ B;  2AZV A;  3EG3 A;  2DMO A;  5GMK h;  2Z0W A;  1BBZ A;  1K8A R;  1MNE A;  3ZBD A;  4RTZ A;  1T3S A;  2QDL A;  3ME9 A;  2X3W D;  1ZA1 B;  3U23 A;  4IIM A;  2YHT A;  2EQU A;  3OYD A;  2E70 A;  4AFU C;  5LJ3 e;  2RI2 A;  4PJO B;  2MI6 A;  2JJ9 A;  3H9N A;  2K57 A;  2PVG B;  1WPY A;  2DL5 A;  2KBT A;  2QQB A;  4KRT A;  4QVC A;  4M77 F;  1AZG B;  5IXB A;  4RUG A;  4C0F A;  5L8R E;  3M54 A;  4NL3 A;  3J7A F;  4E7L A;  4ZN1 A;  5D6X A;  2WAC A;  3EGX A;  2OI3 A;  1B34 B;  3C95 A;  3O8V A;  4K11 A;  4DA4 A;  3OSV A;  3OMG A;  1AEY A;  2CSI A;  5J3B A;  3I56 Q;  3V7C A;  1TU0 B;  1WZO A;  1WIE A;  4M75 G;  1EIF A;  2YSQ A;  3CBO A;  2M02 A;  2CT3 A;  2YUP A;  5HY6 A;  3E2U A;  2DX1 A;  1Y7X A;  4Y91 A;  1F1B B;  3V8L A;  3QYG B;  2A3L A;  1Y07 A;  2WSC E;  1AOJ A;  1H3Z A;  1SF9 A;  2EJG A;  2QYZ A;  1BCM A;  4C5G A;  1X6B A;  4OMQ A;  4A4E A;  1H8K A;  2GNC A;  3RKW A;  3CCS T;  3OW2 A;  1UGQ B;  2EKH A;  1NJI U;  3CCV Q;  2EIF A;  3L2U A;  1MUZ A;  2LNV A;  1KFZ A;  2LQW A;  2J7I A;  1BB9 A;  4M7D D;  1VQ7 T;  1KC8 U;  2KQW A;  2DNU A;  1CKA A;  4O6J A;  4OMN A;  4F7U G;  1VQN T;  1YWO A;  3TVT A;  4PKC C;  3HKS A;  2KY9 A;  4LD9 K;  2DK3 A;  3C0C A;  1YJN Q;  1ZUU A;  2RQW A;  1PM3 A;  1YJ9 A;  3Q1J A;  5GMK l;  4C92 D;  3WVE B;  4E47 A;  3EG2 A;  1ZUY A;  1VQ5 T;  2J06 A;  1WNL A;  1N9S A;  2DAQ A;  3WVD B;  2C0O A;  1VQK A;  3ULR B;  1OX9 A;  4QW2 A;  3PE0 A;  1C0M A;  3M58 A;  1FYN A;  1G83 A;  1QCN A;  2EQM A;  1NEG A;  1ZLM A;  3O5Z A;  2E64 A;  3V7R A;  3L2V A;  2FEI A;  2ATC B;  4ELY C;  4M7D F;  1UJY A;  2DLP A;  5GMK j;  2RQU A;  2Y4X A;  3OYN A;  1W2B P;  3PVQ A;  2V1R A;  3CC4 A;  3MP8 A;  4EMK B;  4C92 F;  2AKL A;  2VV5 A;  1NZ9 A;  1ZSG A;  2K5L A;  4P5N A;  5CKD A;  4PLL A;  4PJO A;  4C0D B;  1TG0 A;  4UC4 A;  2M9U A;  3QPH A;  3OS2 A;  5KE3 A;  1GXI E;  2AHJ B;  4F7U B;  2ZCF B;  5HK3 A;  3GP8 A;  3S3M A;  5LJ3 h;  4IUV A;  4LUD A;  1KHI A;  3M4G A;  4M77 E;  4QVD A;  2B8A A;  1YP5 A;  3L2Q A;  1B34 A;  3NGP A;  2L3S A;  1QKW A;  3CCE Q;  3CC2 T;  5GAO n;  5ECA A;  1M1K R;  3VS6 A;  2EJF A;  1UTI A;  2O9S A;  2HD0 A;  3CC7 Q;  3UA7 A;  1R8O B;  1RI9 A;  2VVK A;  3T9N A;  1ZA2 B;  1PKT A;  3EGD B;  3H0F A;  4XK8 E;  4E7Z A;  5C0M A;  3CCU Q;  1W1F A;  2CSQ A;  4J9C A;  3M59 A;  2R5A A;  1ABO A;  4C5I A;  2JOY A;  1Y96 B;  1G2B A;  2JMC A;  3VYG A;  3G4S T;  5GAM d;  2RNA A;  1Y0M A;  4MZM A;  2LRQ A;  4CC4 B;  1WXB A;  5LJ3 g;  1YIT Q;  3CMA Q;  1YJW Q;  1KQS A;  2VWF A;  2YRV A;  4CC2 A;  2GGR A;  4HVV A;  2LQK A;  2RQV A;  1RAF B;  5LJ5 h;  4R55 A;  1BIB A;  1V29 B;  2MPX C;  2VXF A;  1D1A A;  2YRC A;  1QP3 A;  2QI2 A;  3S3N A;  1KK7 A;  4A54 A;  3GIB A;  1WHJ A;  4WCI A;  3BE3 A;  4PK4 A;  1OYX A;  4A63 B;  5FRN A;  2HQH A;  2DXT A;  4RTT A;  1Q7Y C;  2CRE A;  4BI3 A;  2FB7 A;  3OYL A;  2ZAE A;  2HBW A;  4FYX B;  4M75 A;  3LWH A;  4BY6 C;  4M7A G;  1MHN A;  2X4X A;  3LH0 A;  1YIJ A;  2F2W A;  1N6A A;  2ABL A;  3RNJ A;  4DOV A;  4DBH A;  2Y90 A;  1VYV A;  2RH2 A;  2DF6 A;  3G71 T;  3CME T;  4J7I A;  4R56 A;  1CKB A;  2RHI A;  1K0X A;  1KQ1 A;  2E5K A;  1E6H A;  4M7D E;  2CP3 A;  1VQP Q;  3CCQ A;  4OF1 A;  1X6O A;  3FC3 A;  2M0Y A;  3QSU A;  2DD5 A;  1Y71 A;  1FMV A;  1Q86 C;  2H8H A;  5KYW A;  1AWX A;  4C92 E;  3HSB A;  3JV3 A;  4QQG A;  1B3Q A;  3CCS A;  3JCM Q;  3QDF A;  4F7U A;  5LJ3 j;  3OS1 A;  2ENM A;  3QJY A;  1IGU A;  3INZ A;  5IT9 E;  2DTI A;  4OGC A;  1VIE A;  5CQY A;  1I5L A;  3OYG A;  1VQN A;  2YUN A;  2XK0 A;  2RMO A;  4OB0 B;  4XTX A;  2CGH A;  5IAY A;  2HQX A;  3BFM A;  4KGZ B;  3JCM e;  1OZ3 A;  3GBQ A;  1U1T A;  4M7A B;  4ESR A;  2YUO A;  5FWB A;  2LVM A;  4PFZ A;  4EDU A;  4F16 A;  3SB2 A;  3M5A A;  4HCB A;  3EGD A;  3S3O A;  1VQ5 A;  3HFO A;  1LOJ A;  1PG5 B;  2KRS A;  1QWF A;  3VS0 A;  2JTM A;  1GFC A;  4AFS C;  2I0N A;  3CCR T;  1GCQ A;  3JCM d;  1Y96 A;  4M78 C;  5EC7 A;  2E4H A;  1SRM A;  2HAX A;  2DRK A;  2F1L A;  2QEX Q;  2BZY A;  2VAS A;  3CCL T;  1QVG P;  5LJ5 j;  2EQK A;  4KH0 B;  1QWE A;  9ATC B;  3CD6 T;  3I5R A;  3UDC A;  1SRL A;  3OYJ A;  1M9S A;  1ZQ1 A;  1WHK A;  2YLC A;  4IIO A;  3QXE B;  3I55 T;  4C8Q G;  1Q7Y U;  3P8H A;  2X4J A;  3G7Z A;  1O9S A;  4NL2 A;  5CIU A;  2DO3 A;  2CZ1 B;  1S72 Q;  3TEE A;  4QQ6 A;  3PMT A;  5KYY A;  4OB1 B;  4B6M A;  2JS0 A;  2K3X A;  1D0X A;  2LT4 A;  4IUT A;  4PFP A;  2V8I A;  1JO8 A;  2DIG A;  2M51 A;  1PSE A;  1UGV A;  3P8B B;  5HKC A;  1UHF A;  2FHD A;  2F5T X;  1X69 A;  1I1J A;  1RAB B;  3QJ6 A;  3EG1 A;  4LUE A;  5DLQ E;  3JCM P;  1Z9Z A;  2V8K A;  2CS7 A;  5I2M A;  3EGX B;  3EH1 A;  2D8H A;  1O75 A;  3EH2 A;  2L5Q A;  2RI3 A;  5CKB A;  4KUL A;  3M53 A;  3DB4 A;  2QA4 A;  3I9Q A;  1ZSZ C;  1Q86 U;  3PGG A;  4ORZ A;  2DEQ A;  4ZNX A;  3FDR A;  2RHX A;  2XD0 A;  2L8D A;  5GAO q;  2JZ2 A;  1Q81 C;  2EJ9 A;  1OUL A;  1NE8 A;  3M0S A;  2NUT A;  3GOX A;  3G4S A;  1OEB A;  2F2V A;  2BKD N;  2X51 A;  3CCM Q;  5LJ3 f;  1UGP B;  3A8M B;  2RJC A;  2YRD A;  3CPW S;  3DKM A;  4C8Q B;  1YHQ Q;  4NOY A;  2GCX A;  3RBB B;  1OV3 A;  2KE9 A;  5GAN 8;  3CPW P;  5IXF A;  3CCV T;  3RES A;  2A37 A;  2LQ8 A;  1AT1 B;  5D6Y A;  3FEO A;  1AWW A;  1IO6 A;  4IUQ A;  4X1V A;  5AYF A;  1MGQ A;  4J6W A;  5J39 A;  4OMM A;  1OU9 A;  3CXC A;  4M78 D;  3V7S A;  3VU3 C;  3OYY A;  2HQE A;  2YT6 A;  4KUI A;  1K73 R;  2CP6 A;  2QQR A;  1NJI C;  3TSW A;  2ROT A;  4M7A A;  4CC7 A;  2PUK B;  4HXJ A;  2E3I A;  5A0L A;  2CP7 A;  3ZEH A;  3X24 B;  2DZ9 A;  2BZX A;  2JTE A;  4D8D A;  2ESW A;  3P8D A;  2MYS A;  3JCM h;  1AHJ B;  1QCO A;  1VA7 A;  3FJ5 A;  4O5V A;  4E6R A;  3MCA B;  4Y92 A;  3HRU A;  4M7D C;  3TU4 K;  2PUO B;  2X9H A;  1PRL C;  2LT1 A;  2BZ8 A;  2EWN A;  4N0A C;  1ACM B;  4EMG A;  2XMF A;  1QVF A;  2XU8 A;  3G71 A;  3CME A;  1ZBX A;  3THK A;  8ATC B;  2A36 A;  1X01 A;  5LJ5 f;  3SD4 A;  3JCM J;  1VYT A;  2V26 A;  4OGE A;  2DFU A;  2LJ1 A;  3SHW A;  1OI1 A;  3G6E Q;  4M78 F;  1IZ6 A;  2IVW A;  2HMA A;  1NEB A;  3JB9 D;  1VQL A;  4MZT A;  5FU7 B;  4FSX A;  2EQI A;  2WSF E; 
#chains in the Genus database with same CATH homology
 5HCK A;  2FEI A;  1WXT A;  1JEG A;  1UJY A;  2DLP A;  2J6O A;  4D8K A;  1UEC A;  2RQU A;  3M0Q A;  3PVQ A;  1WA7 A;  2W0Z A;  3H0H A;  4CC3 A;  2J6F A;  2V1R A;  4JZ4 A;  2AKL A;  4F17 A;  1ZSG A;  2EBP A;  3M0P A;  1RLQ C;  1NLO C;  1TG0 A;  4FSS A;  2LJ3 A;  2DL7 A;  2GTO A;  2RF0 A;  1HD3 A;  1YWP A;  1TUC A;  4LUD A;  1B07 A;  3NPF A;  1WX6 A;  2MCN A;  1YP5 A;  2FPF A;  2KYM A;  1GRI A;  3NGP A;  2HDA A;  2L3S A;  1QKW A;  2DL4 A;  2CUB A;  2KRO A;  4OMO A;  3M0U A;  5ECA A;  2JT4 A;  2LQN A;  4LN2 A;  1PHT A;  3VS6 A;  4HVU A;  1UTI A;  2O9S A;  2KEA A;  4RTW A;  2EYY A;  4Z88 A;  2HCK A;  3UA7 A;  2FG0 A;  2PTK A;  2FRY A;  1RI9 A;  3EHR A;  2VVK A;  3VS1 A;  1HJD A;  1YCS B;  5GJV B;  1U5S A;  1PKT A;  2DL8 A;  3H0F A;  1ZBJ A;  3M0T A;  4AFQ C;  2O9V A;  1W1F A;  2CSQ A;  1AD5 A;  4J9C A;  1WLP B;  2LMJ A;  2JW4 A;  1WDX A;  1VYU A;  2K7A A;  2RQT A;  1ABO A;  2JMA A;  1G2B A;  2JMC A;  2FPD A;  2RNA A;  1JQQ A;  1Y0M A;  4CC4 B;  1WXB A;  3H41 A;  2CH4 W;  1GCP A;  1A0N B;  2D1X A;  2VWF A;  3NMZ C;  2RQR A;  4CC2 A;  2GGR A;  4HVV A;  2RQV A;  1SHG A;  4JJB A;  4Z89 A;  1V1C A;  2DL3 A;  3VS2 A;  1BK2 A;  2KRN A;  2J05 A;  1KJW A;  2ROL A;  1UFF A;  2GBQ A;  3EG0 A;  1X2K A;  2KXC A;  2DRM A;  1I0C A;  2K79 A;  1H92 A;  1SEM A;  1T0H A;  4WCI A;  2OJ2 A;  2W10 A;  2L2P A;  4A63 B;  1KIK A;  3REB B;  2LNH B;  2KRM A;  2A28 A;  1NM7 A;  4RTT A;  1H3H A;  4EIK A;  2CRE A;  1K76 A;  2O31 A;  3VRY A;  1K1Z A;  2RN8 A;  2YDL A;  5IHI A;  4DEY A;  1NYG A;  1ZUK A;  2OAW A;  2HBW A;  3UAT A;  2EGC A;  2EPD A;  1RUW A;  3VS4 A;  2D8J A;  4HCK A;  4RTX A;  4AFZ C;  5IHK A;  2F2W A;  2AK5 A;  1ABQ A;  2ABL A;  3RNJ A;  3R6N A;  2EVR A;  3CQT A;  3H0I A;  4J9B A;  3ZL7 C;  2G6F X;  1VYV A;  1QKX A;  2O88 A;  3VRZ A;  4QT7 A;  2KYB A;  2DF6 A;  1PWT A;  3EGU A;  1UDL A;  4M4Z A;  1JXO A;  1CKB A;  2L3Q A;  1K0X A;  4RTU A;  2O2O A;  2D0N A;  2KT8 A;  5I11 A;  1KSW A;  5L23 A;  1RLP C;  2C0I A;  2K3B A;  2E5K A;  1E6H A;  1ZX6 A;  1MV3 A;  2DIL A;  4HVW A;  3LH5 A;  1FMK A;  2IIM A;  4OML A;  2GTJ A;  2M0Y A;  2JM8 A;  1JXM A;  3PVL A;  3UA6 A;  2DA9 A;  2FPE A;  2H8H A;  1AWX A;  4J9I A;  1OPL A;  2LZ6 B;  1SHF A;  1AVZ C;  3JV3 A;  1PKS A;  3EHQ A;  1B3Q A;  1TUD A;  2V1Q A;  4AG2 C;  4J9E A;  1AZE A;  2ENM A;  1PRM C;  1JU5 C;  1CSK A;  1GBQ A;  1WYX A;  2K6D A;  4JPB W;  3I5S A;  2YUN A;  2RMO A;  1WXU A;  2HSP A;  2J6K A;  1T0J A;  3A98 A;  1GBR A;  1YNZ A;  1K4U S;  3VS7 A;  4GLM A;  1HSQ A;  2YUQ A;  1UUE A;  3GBQ A;  4ESR A;  2YUO A;  5FWB A;  5FW9 A;  1QCF A;  1X6G A;  4F16 A;  2LX7 A;  1EFN A;  1ARK A;  2JXB A;  2KRS A;  2MOX A;  4J9D A;  1QWF A;  3VS0 A;  1GFC A;  4AFS C;  1UJ0 A;  2I0N A;  1GCQ A;  2X3X D;  2NUZ A;  4AG1 C;  2FRW A;  5EC7 A;  1X27 A;  1W70 A;  2RPN A;  1PNJ A;  1XOV A;  1J3T A;  1SRM A;  1U3O A;  2KR3 A;  2KXD A;  1BU1 A;  4LNP A;  2DRK A;  1M30 A;  2ED0 A;  2DBM A;  1AWJ A;  2BZY A;  2CDT A;  1GCQ C;  1QWE A;  1E7O A;  2L0A A;  3I5R A;  1SRL A;  2LP5 A;  2DBK A;  2GQI A;  2CT4 A;  1M3B A;  2ED1 A;  1OPK A;  4IIO A;  4R0K A;  3REA B;  1M8M A;  2LJ0 A;  1X43 A;  2K9G A;  1SSH A;  1Z9Q A;  2FO0 A;  2MIO A;  2CUD A;  2EYX A;  1NLP C;  1SPK A;  3I35 A;  1I07 A;  2C0T A;  1GFD A;  2AZV A;  2JS0 A;  1LCK A;  3EG3 A;  2DMO A;  1BBZ A;  1AWO A;  1JO8 A;  2M51 A;  1UGV A;  2NWM A;  1UHF A;  1M27 C;  1T3S A;  4RTZ A;  2QDL A;  2JM9 A;  3SEM A;  2X3W D;  1X69 A;  1I1J A;  3U23 A;  4F14 A;  4IIM A;  2LCS A;  1S1N A;  3EG1 A;  4LUE A;  1N5Z A;  1Z9Z A;  1Y57 A;  4AFU C;  1MV0 B;  4J9F A;  3KFV A;  2KT1 A;  2SRC A;  3M0R A;  2KBT A;  2DL5 A;  2ECZ A;  4KRT A;  2D8H A;  4J9G A;  3QWY A;  2L3P A;  1X2Q A;  4RTY A;  1AZG B;  5IXB A;  1M3A A;  4RUG A;  5I22 A;  3VS3 A;  1NG2 A;  2EYZ A;  3I9Q A;  1QLY A;  2PNI A;  4ORZ A;  2OI3 A;  4ZNX A;  2HEQ A;  4K11 A;  4J9H A;  1AEY A;  2CSI A;  4LE9 A;  2K2M A;  1WIE A;  1UHC A;  4JZ3 A;  3M0S A;  4DEX A;  1W6X A;  3TSZ A;  1YN8 A;  2YSQ A;  1WFW A;  2DM1 A;  1T3L A;  1OEB A;  2EW3 A;  2F2V A;  2CT3 A;  2YUP A;  2DYB A;  2CH4 A;  2DX1 A;  3NHN A;  4JJD A;  5FWC A;  3QWX X;  3RBB B;  1OV3 A;  2SEM A;  2BTT A;  2KE9 A;  2EGE A;  5IXF A;  3IQL A;  2A37 A;  1AOJ A;  2KNB B;  2AZS A;  4JJC A;  1UE9 A;  1E6G A;  1AWW A;  1IO6 A;  4X1V A;  2DVJ A;  1X6B A;  4OMQ A;  4OMM A;  1OOT A;  2DJQ A;  1H8K A;  2YT6 A;  3VS5 A;  2AKK A;  2GNC A;  4OMP A;  2EKH A;  3TSW A;  2ROT A;  4CC7 A;  4HXJ A;  1MUZ A;  1KFZ A;  1GL5 A;  2LQW A;  2EGA A;  2J7I A;  1WI7 A;  2BZX A;  1BB9 A;  2JTE A;  4D8D A;  2ESW A;  2DNU A;  2PZ1 A;  1CKA A;  4OMN A;  4Z8A A;  1YWO A;  3TVT A;  1VA7 A;  2F2X A;  3FJ5 A;  4E6R A;  5IH2 A;  4Y92 A;  4RTV A;  2B86 A;  2KGT A;  3C0C A;  1ZUU A;  1PRL C;  2RQW A;  2BZ8 A;  2JS2 A;  1K9A A;  2XMF A;  3UF4 A;  2P4R A;  1UG1 A;  1K0S A;  3EG2 A;  3THK A;  2A36 A;  1ZUY A;  2J06 A;  1VYT A;  2VKN A;  1M3C A;  2C0O A;  3ULR B;  2LJ1 A;  3SHW A;  3PE0 A;  1FYN A;  1NYF A;  1U06 A;  1G83 A;  2DE0 X;  2A08 A;  4GBQ A;  2EYW A;  1NEG A;  1NEB A;  1ZLM A;  3O5Z A;  2EQI A;  5GJW B;  5IHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...