4JA1A

Structure of mmp3 complexed with a platinum-based inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
168
structure length
168
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromelysin-1
publication title Structure of matrix metalloproteinase-3 with a platinum-based inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4ja1A00
3DPEA 4FU4A 3L0VA 4ILWD 4PKRA 1IADA 3LILA 2ERPA 2N8RA 5I4OA 4PKVA 1YQYA 5I0LA 1BQQM 1KUKA 3HY9A 1Z3JA 3KRYA 3DSLA 5LABA 3AIGA 2QPJA 2OW2A 3AYKA 3P1VA 4A3WA 1ZS0A 1JK3A 5B5PA 2OXZA 3O2XA 5D2BA 3EHXA 1D5JA 2JSDA 3ZVSA 1JJ9A 1B3DA 2J83A 1BSWA 1KBCA 5D1TA 2A8HA 2USNA 5D1SA 4JA1A 1YOUA 1ZXCA 1JH1A 1ZVXA 1XFYA 3LJTA 3HB2P 4H2EA 3KECA 1IACA 2Y6CA 5D1UA 4XM8A 3F1AA 4DD8A 1IAAA 3SHIA 4WKIA 2AIGP 4H76A 3KEJA 1OS2A 3LKAA 2KRJA 3U1RA 1HFSA 1IABA 2O36A 2SRTA 2WO9A 1XFVA 2YIGA 4GR0A 2XS3A 1PWQA 1Q3AA 2OVZA 1QICA 1O0QA 1MMRA 5D7WA 1BZSA 4G0DA 1PWPA 1Y93A 4JP4A 1KUFA 4I35A 1ASTA 3F15A 5BOYA 4Q1LA 2OI0A 1PWWA 1I76A 2ERQA 1CXVA 1CIZA 1XUCA 1YP1A 1UTTA 3LUNA 1BKCA 3WV2A 4GQLA 1B8YA 1J7NA 1QJIA 1A86A 3ELMA 3LIKA 4J4MA 1PWUA 2JT6A 2POJA 3VTGA 1XFUA 2OW0A 4H49A 1CGLA 1XFXA 3TT4A 3KEKA 2Y6DA 1JAQA 4PKUA 2TCLA 1JAPA 1SRPA 3HDAP 1D8FA 3OHLA 4JQGA 1EAKA 4AUOA 1G9KA 4WKEA 3TVCA 4A7BA 2FV5A 1AKLA 1OM7A 1DTHA 1GE7A 1GKCA 1HOVA 3I7GA 3LUMA 4HMAA 1BM6A 1FBLA 4FVLA 2YB9A 1MMPA 5I12A 1C3IA 2DDFA 2MLRA 5JMYA 1RM8A 1BKCE 5CXAA 3F19A 966CA 3Q2GA 4PKWA 1QUAA 2K2GA 4IJOA 1I73A 2X3AA 1XURA 3EDIA 3EDHA 1CGFA 1GXDA 1DMTA 3TS4A 1JAOA 3RTSA 2OY2A 4JPAA 4H84A 4GR8A 1CAQA 4XM7A 1BUDA 4PKTA 3P24A 1GO7P 456CA 3HBVP 5D3CA 2DW1A 4WK7A 4QKZA 5CUHA 2CLTA 1UMTA 3K7LA 2OZRA 4GR3A 2OW9A 1JIWP 1USNA 2MZIA 2PJTA 1C8TA 1FM1A 3WV1A 3BA0A 3F17A 3LIRA 1G49A 1CGEA 3HYGA 1G4KA 830CA 1C7KA 1UTZA 4AIGA 1UMSA 2WOAA 3ZUKA 3N2VA 1CQRA 3WV3A 1YCMA 2J0TA 4WF6A 3KMEA 1FLSA 2XS4A 1BUVM 1XFWA 2W14A 3F18A 1IAGA 1QIAA 3USNA 1R54A 4H82A 1L6JA 5B5OA 3LMCA 1MMBA 2JNPA 3LGPA 4L6TA 1QJJA 2DW0A 3HBUP 3EDZA 1JIZA 1EB6A 3I7IA 1SLMA 1S4BP 2MZHA 3E8RA 3LJGA 4H1QA 4ON1A 1ZXVA 4GUYA 1AYKA 3KWVC 4FXYP 1GE6A 1SATA 1RMZA 1SMPA 2E2DA 3EDGA 5CZMA 2E3XA 3V96B 2DW2A 1HY7A 2X7MA 1OMJA 1ZTQA 1JANA 1I1IP 2AYKA 4G9LA 4GWNA 2X3CA 2I47A 1IAEA 1Y8JA 3AYUA 3G42A 1GKDA 4H30A 1SLNA 2X3BA 3KHIA 3TSKA 1D8MA 2RJQA 1H71P 1R1JA 1ATLA 1HFCA 1R55A 1R1IA 4AYKA 2OY4A 3OHOA 3KMCA 2JT5A 3MA2A 1HV5A 3HY7A 1KAPP 5I3MA 5L79A 4JIJA 2D1NA 4IN9A 2D1OA 2W12A 1K7IA 5L7FA 1KUIA 2FV9A 1XUDA 4R3VA 1Y0VA 4XCTA 4AXQA 2K9CA 1PWVA 2DDYA 4PKQA 4FXQA 3UVCA 1BQOA 3HDBA 3DWBA 1G05A 1K7GA 1UEAA 3CKIA 3ZXHA 2V4BA 2HU6A 3RTTA 1A85A 2W15A 1MNCA 4GWMA 1OO9A 2CKIA 2W13A 3GBOA 3N2UA 4ZR5A 3NX7A 1JKYA 1ROSA 3EWJA 2RJPA 2JIHA 4DV8A 5I43A 1O0TA 1WNIA 2OVXA 4DPEA 3L0TA 3B92A 1KUGA 1MMQA 3DPFA 4HX3A 3DNGA 2WO8A 5H8XA 1R1HA 4L63A 3VI1A 4PKSA 3O64A 4XBHA 5BPAA 3LJZA 4GF1A 2OXWA 2OXUA 1OM6A 3LQ0A 1BIWA 4L19A 3Q2HA 1G12A 2MZEA 3LK8A 2O3EA 1GE5A 1GO8P 2Z2DA 1OS9A 3LEAA 1SU3A 5I2ZA 3DL1A 4IUWA 3B2ZA 4DF9A 2OW1A 3LQBA 2MLSA 1XFZA 1ZP5A 1K7QA 1EUBA 3K7NA 3G5CA 4XM6A 1BKCI 4H3XA 4EFSA 2EROA 5BOTA 1HTDA 1KUHA 1ND1A 3B8ZA 3EHYA 4WZVA 4I03A 1D7XA 4CTHA 2W0DA 2L0RA 3LE9A 1CK7A 3F16A 1OM8A 1AF0A 1QIBA
chains in the Genus database with same CATH superfamily
3DPEA 4FU4A 3L0VA 4ILWD 4PKRA 1IADA 3LILA 2ERPA 2N8RA 5I4OA 4PKVA 1YQYA 5I0LA 1BQQM 1KUKA 3HY9A 1Z3JA 3KRYA 3DSLA 5LABA 3AIGA 2QPJA 2OW2A 3AYKA 3P1VA 4A3WA 1ZS0A 1JK3A 5B5PA 2OXZA 3O2XA 5D2BA 3EHXA 1D5JA 2JSDA 3ZVSA 1JJ9A 1B3DA 2J83A 1BSWA 1KBCA 5D1TA 2A8HA 2USNA 5D1SA 4JA1A 1YOUA 1ZXCA 1JH1A 1ZVXA 1XFYA 3LJTA 3HB2P 4H2EA 3KECA 1IACA 2Y6CA 5D1UA 4XM8A 3F1AA 4DD8A 1IAAA 3SHIA 4WKIA 2AIGP 4H76A 3KEJA 1OS2A 3LKAA 2KRJA 3U1RA 1HFSA 1IABA 2O36A 2SRTA 2WO9A 1XFVA 2YIGA 4GR0A 2XS3A 1PWQA 1Q3AA 2OVZA 1QICA 1O0QA 1MMRA 5D7WA 1BZSA 4G0DA 1PWPA 1Y93A 4JP4A 1KUFA 4I35A 1ASTA 3F15A 5BOYA 4Q1LA 2OI0A 1PWWA 1I76A 2ERQA 1CXVA 1CIZA 1XUCA 1YP1A 1UTTA 3LUNA 1BKCA 3WV2A 4GQLA 1B8YA 1J7NA 1QJIA 1A86A 3ELMA 3LIKA 4J4MA 1PWUA 2JT6A 2POJA 3VTGA 1XFUA 2OW0A 4H49A 1CGLA 3DTIA 1XFXA 3TT4A 3KEKA 2Y6DA 1JAQA 4PKUA 2TCLA 1JAPA 1SRPA 3HDAP 1D8FA 3OHLA 4JQGA 1EAKA 4AUOA 1G9KA 4WKEA 3TVCA 4A7BA 1OZ9A 2FV5A 1AKLA 1OM7A 1DTHA 1GE7A 1GKCA 1HOVA 3I7GA 3LUMA 4HMAA 1BM6A 1FBLA 4FVLA 2YB9A 2YUFA 1MMPA 5I12A 1C3IA 2DDFA 2MLRA 5JMYA 1RM8A 1BKCE 5CXAA 3F19A 966CA 3Q2GA 4PKWA 1QUAA 2K2GA 4IJOA 1I73A 2X3AA 1XURA 3EDIA 3EDHA 1CGFA 1GXDA 1DMTA 3TS4A 1JAOA 3RTSA 2OY2A 4JPAA 4H84A 4GR8A 1CAQA 4XM7A 1BUDA 4PKTA 3P24A 1GO7P 456CA 3HBVP 5D3CA 2DW1A 4WK7A 4QKZA 5CUHA 2CLTA 1UMTA 3K7LA 2OZRA 4GR3A 2OW9A 1JIWP 1USNA 2MZIA 2PJTA 1C8TA 1FM1A 3WV1A 3BA0A 3F17A 3LIRA 1G49A 1CGEA 3HYGA 1G4KA 830CA 1C7KA 1UTZA 4AIGA 1UMSA 2WOAA 3ZUKA 3N2VA 1CQRA 3WV3A 1YCMA 2J0TA 4WF6A 3KMEA 1FLSA 2XS4A 1BUVM 1XFWA 2W14A 3F18A 1IAGA 1QIAA 3USNA 1R54A 4H82A 1L6JA 5B5OA 3LMCA 1MMBA 2JNPA 3LGPA 4L6TA 1QJJA 2DW0A 1XAXA 3HBUP 3EDZA 1JIZA 1EB6A 3I7IA 1XM5A 1SLMA 1S4BP 2MZHA 3E8RA 3LJGA 4H1QA 4ON1A 1ZXVA 4GUYA 1AYKA 3KWVC 4FXYP 1GE6A 1SATA 1RMZA 1SMPA 2E2DA 3EDGA 5CZMA 2E3XA 3V96B 2DW2A 1HY7A 2X7MA 1OMJA 1ZTQA 1JANA 1I1IP 2AYKA 4G9LA 4GWNA 2X3CA 2I47A 1IAEA 1Y8JA 3AYUA 3G42A 1GKDA 4H30A 1SLNA 2X3BA 3KHIA 3TSKA 1D8MA 2RJQA 1H71P 1R1JA 1ATLA 1HFCA 1R55A 1R1IA 4AYKA 2OY4A 3OHOA 3KMCA 2JT5A 3MA2A 1HV5A 3DTKA 3HY7A 1KAPP 5I3MA 5L79A 4JIJA 2D1NA 4IN9A 2D1OA 2W12A 1K7IA 5L7FA 1KUIA 2FV9A 1XUDA 4R3VA 1Y0VA 4XCTA 4AXQA 2K9CA 1PWVA 2DDYA 4PKQA 4FXQA 3UVCA 1BQOA 3HDBA 3DWBA 1G05A 1K7GA 1UEAA 3CKIA 3ZXHA 2V4BA 2HU6A 3RTTA 1A85A 2W15A 1MNCA 4GWMA 1OO9A 2CKIA 2W13A 3GBOA 3N2UA 4ZR5A 3NX7A 1JKYA 1ROSA 3EWJA 2RJPA 2JIHA 4DV8A 5I43A 1O0TA 1WNIA 2OVXA 4DPEA 3DTEA 3L0TA 3B92A 1KUGA 1MMQA 3DPFA 4HX3A 3DNGA 2WO8A 5H8XA 1R1HA 4L63A 3VI1A 4PKSA 3O64A 4XBHA 5BPAA 3LJZA 4GF1A 2OXWA 2OXUA 1OM6A 3LQ0A 1BIWA 4L19A 3Q2HA 4L7AA 1G12A 2MZEA 3LK8A 2O3EA 1GE5A 1GO8P 2Z2DA 1OS9A 3LEAA 1SU3A 5I2ZA 3DL1A 4IUWA 3B2ZA 4DF9A 2OW1A 3LQBA 2MLSA 1XFZA 1ZP5A 1TVIA 1K7QA 1EUBA 3K7NA 3G5CA 4XM6A 1BKCI 4H3XA 4EFSA 2EROA 5BOTA 1HTDA 1KUHA 1ND1A 3B8ZA 3EHYA 4WZVA 4I03A 1D7XA 4CTHA 2W0DA 2L0RA 3LE9A 1CK7A 3F16A 1OM8A 1AF0A 1QIBA
chains in the Genus database with same CATH topology
3DPEA 4FU4A 3L0VA 4ILWD 4PKRA 1IADA 3LILA 2ERPA 2N8RA 5I4OA 4PKVA 1YQYA 5I0LA 1BQQM 1KUKA 3HY9A 1Z3JA 3KRYA 3DSLA 5LABA 3AIGA 2QPJA 2OW2A 3AYKA 3P1VA 4A3WA 1ZS0A 1JK3A 5B5PA 2OXZA 3O2XA 5D2BA 3EHXA 1D5JA 2JSDA 3ZVSA 1JJ9A 1B3DA 2J83A 1BSWA 1KBCA 5D1TA 2A8HA 2USNA 5D1SA 4JA1A 1YOUA 1ZXCA 1JH1A 1ZVXA 1XFYA 3LJTA 3HB2P 4H2EA 3KECA 1IACA 2Y6CA 5D1UA 4XM8A 3F1AA 4DD8A 1IAAA 3SHIA 4WKIA 2AIGP 4H76A 3KEJA 1OS2A 3LKAA 2KRJA 3U1RA 1HFSA 1IABA 2O36A 2SRTA 2WO9A 1XFVA 2YIGA 4GR0A 2XS3A 1PWQA 1Q3AA 2OVZA 1QICA 1O0QA 1MMRA 5D7WA 1BZSA 4G0DA 1PWPA 1Y93A 4JP4A 1KUFA 4I35A 1ASTA 3F15A 5BOYA 4Q1LA 2OI0A 1PWWA 1I76A 2ERQA 1CXVA 1CIZA 1XUCA 1YP1A 1UTTA 3LUNA 1BKCA 3WV2A 4GQLA 1B8YA 1J7NA 1QJIA 1A86A 3ELMA 3LIKA 4J4MA 1PWUA 2JT6A 2POJA 3VTGA 1XFUA 2OW0A 4H49A 1CGLA 3DTIA 1XFXA 3TT4A 3KEKA 2Y6DA 1JAQA 4PKUA 2TCLA 1JAPA 1SRPA 3HDAP 1D8FA 3OHLA 4JQGA 1EAKA 4AUOA 1G9KA 4WKEA 3TVCA 4A7BA 2FV5A 1AKLA 1OM7A 1DTHA 1GE7A 1GKCA 1HOVA 3I7GA 3LUMA 4HMAA 1BM6A 1FBLA 4FVLA 2YB9A 2YUFA 1MMPA 5I12A 1C3IA 2DDFA 2MLRA 5JMYA 1RM8A 1BKCE 5CXAA 3F19A 966CA 3Q2GA 4PKWA 1QUAA 2K2GA 4IJOA 1I73A 2X3AA 1XURA 3EDIA 3EDHA 1CGFA 1GXDA 1DMTA 3TS4A 1JAOA 3RTSA 2OY2A 4JPAA 4H84A 4GR8A 1CAQA 4XM7A 1BUDA 4PKTA 3P24A 1GO7P 456CA 3HBVP 5D3CA 2DW1A 4WK7A 4QKZA 5CUHA 2CLTA 1UMTA 3K7LA 2OZRA 4GR3A 2OW9A 1JIWP 1USNA 2MZIA 2PJTA 1C8TA 1FM1A 3WV1A 3BA0A 3F17A 3LIRA 1G49A 1CGEA 3HYGA 1G4KA 830CA 1C7KA 1UTZA 4AIGA 1UMSA 2WOAA 3ZUKA 3N2VA 1CQRA 3WV3A 1YCMA 2J0TA 4WF6A 3KMEA 1FLSA 2XS4A 1BUVM 1XFWA 2W14A 3F18A 1IAGA 1QIAA 3USNA 1R54A 4H82A 1L6JA 5B5OA 3LMCA 1MMBA 2JNPA 3LGPA 4L6TA 1QJJA 2DW0A 3HBUP 3EDZA 1JIZA 1EB6A 3I7IA 1SLMA 1S4BP 2MZHA 3E8RA 3LJGA 4H1QA 4ON1A 1ZXVA 4GUYA 1AYKA 3KWVC 4FXYP 1GE6A 1SATA 1RMZA 1SMPA 2E2DA 3EDGA 5CZMA 2E3XA 3V96B 2DW2A 1HY7A 2X7MA 1OMJA 1ZTQA 1JANA 1I1IP 2AYKA 4G9LA 4GWNA 2X3CA 2I47A 1IAEA 1Y8JA 3AYUA 3G42A 1GKDA 4H30A 1SLNA 2X3BA 3KHIA 3TSKA 1D8MA 2RJQA 1H71P 1R1JA 1ATLA 1HFCA 1R55A 1R1IA 4AYKA 2OY4A 3OHOA 3KMCA 2JT5A 3MA2A 1HV5A 3DTKA 3HY7A 1KAPP 5I3MA 5L79A 4JIJA 2D1NA 4IN9A 2D1OA 2W12A 1K7IA 5L7FA 1KUIA 2FV9A 1XUDA 4R3VA 1Y0VA 4XCTA 4AXQA 2K9CA 1PWVA 2DDYA 4PKQA 4FXQA 3UVCA 1BQOA 3HDBA 3DWBA 1G05A 1K7GA 1UEAA 3CKIA 3ZXHA 2V4BA 2HU6A 3RTTA 1A85A 2W15A 1MNCA 4GWMA 1OO9A 2CKIA 2W13A 3GBOA 3N2UA 4ZR5A 3NX7A 1JKYA 1ROSA 3EWJA 2RJPA 2JIHA 4DV8A 5I43A 1O0TA 1WNIA 2OVXA 4DPEA 3DTEA 3L0TA 3B92A 1KUGA 1MMQA 3DPFA 4HX3A 3DNGA 2WO8A 5H8XA 1R1HA 4L63A 3VI1A 4PKSA 3O64A 4XBHA 5BPAA 3LJZA 4GF1A 2OXWA 2OXUA 1OM6A 3LQ0A 1BIWA 4L19A 3Q2HA 4L7AA 1G12A 2MZEA 3LK8A 2O3EA 1GE5A 1GO8P 2Z2DA 1OS9A 3LEAA 1SU3A 5I2ZA 3DL1A 4IUWA 3B2ZA 4DF9A 2OW1A 3LQBA 2MLSA 1XFZA 1ZP5A 1K7QA 1EUBA 3K7NA 3G5CA 4XM6A 1BKCI 4H3XA 4EFSA 2EROA 5BOTA 1HTDA 1KUHA 1ND1A 3B8ZA 3EHYA 4WZVA 4I03A 1D7XA 4CTHA 2W0DA 2L0RA 3LE9A 1CK7A 3F16A 1OM8A 1AF0A 1QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPE A;  4FU4 A;  3L0V A;  4ILW D;  4PKR A;  1IAD A;  3LIL A;  2ERP A;  2N8R A;  5I4O A;  4PKV A;  1YQY A;  5I0L A;  1BQQ M;  1KUK A;  3HY9 A;  1Z3J A;  3KRY A;  3DSL A;  5LAB A;  3AIG A;  2QPJ A;  2OW2 A;  3AYK A;  3P1V A;  4A3W A;  1ZS0 A;  1JK3 A;  5B5P A;  2OXZ A;  3O2X A;  5D2B A;  3EHX A;  1D5J A;  2JSD A;  3ZVS A;  1JJ9 A;  1B3D A;  2J83 A;  1BSW A;  1KBC A;  5D1T A;  2A8H A;  2USN A;  5D1S A;  4JA1 A;  1YOU A;  1ZXC A;  1JH1 A;  1ZVX A;  1XFY A;  3LJT A;  3HB2 P;  4H2E A;  3KEC A;  1IAC A;  2Y6C A;  5D1U A;  4XM8 A;  3F1A A;  4DD8 A;  1IAA A;  3SHI A;  4WKI A;  2AIG P;  4H76 A;  3KEJ A;  1OS2 A;  3LKA A;  2KRJ A;  3U1R A;  1HFS A;  1IAB A;  2O36 A;  2SRT A;  2WO9 A;  1XFV A;  2YIG A;  4GR0 A;  2XS3 A;  1PWQ A;  1Q3A A;  2OVZ A;  1QIC A;  1O0Q A;  1MMR A;  5D7W A;  1BZS A;  4G0D A;  1PWP A;  1Y93 A;  4JP4 A;  1KUF A;  4I35 A;  1AST A;  3F15 A;  5BOY A;  4Q1L A;  2OI0 A;  1PWW A;  1I76 A;  2ERQ A;  1CXV A;  1CIZ A;  1XUC A;  1YP1 A;  1UTT A;  3LUN A;  1BKC A;  3WV2 A;  4GQL A;  1B8Y A;  1J7N A;  1QJI A;  1A86 A;  3ELM A;  3LIK A;  4J4M A;  1PWU A;  2JT6 A;  2POJ A;  3VTG A;  1XFU A;  2OW0 A;  4H49 A;  1CGL A;  1XFX A;  3TT4 A;  3KEK A;  2Y6D A;  1JAQ A;  4PKU A;  2TCL A;  1JAP A;  1SRP A;  3HDA P;  1D8F A;  3OHL A;  4JQG A;  1EAK A;  4AUO A;  1G9K A;  4WKE A;  3TVC A;  4A7B A;  2FV5 A;  1AKL A;  1OM7 A;  1DTH A;  1GE7 A;  1GKC A;  1HOV A;  3I7G A;  3LUM A;  4HMA A;  1BM6 A;  1FBL A;  4FVL A;  2YB9 A;  1MMP A;  5I12 A;  1C3I A;  2DDF A;  2MLR A;  5JMY A;  1RM8 A;  1BKC E;  5CXA A;  3F19 A;  966C A;  3Q2G A;  4PKW A;  1QUA A;  2K2G A;  4IJO A;  1I73 A;  2X3A A;  1XUR A;  3EDI A;  3EDH A;  1CGF A;  1GXD A;  1DMT A;  3TS4 A;  1JAO A;  3RTS A;  2OY2 A;  4JPA A;  4H84 A;  4GR8 A;  1CAQ A;  4XM7 A;  1BUD A;  4PKT A;  3P24 A;  1GO7 P;  456C A;  3HBV P;  5D3C A;  2DW1 A;  4WK7 A;  4QKZ A;  5CUH A;  2CLT A;  1UMT A;  3K7L A;  2OZR A;  4GR3 A;  2OW9 A;  1JIW P;  1USN A;  2MZI A;  2PJT A;  1C8T A;  1FM1 A;  3WV1 A;  3BA0 A;  3F17 A;  3LIR A;  1G49 A;  1CGE A;  3HYG A;  1G4K A;  830C A;  1C7K A;  1UTZ A;  4AIG A;  1UMS A;  2WOA A;  3ZUK A;  3N2V A;  1CQR A;  3WV3 A;  1YCM A;  2J0T A;  4WF6 A;  3KME A;  1FLS A;  2XS4 A;  1BUV M;  1XFW A;  2W14 A;  3F18 A;  1IAG A;  1QIA A;  3USN A;  1R54 A;  4H82 A;  1L6J A;  5B5O A;  3LMC A;  1MMB A;  2JNP A;  3LGP A;  4L6T A;  1QJJ A;  2DW0 A;  3HBU P;  3EDZ A;  1JIZ A;  1EB6 A;  3I7I A;  1SLM A;  1S4B P;  2MZH A;  3E8R A;  3LJG A;  4H1Q A;  4ON1 A;  1ZXV A;  4GUY A;  1AYK A;  3KWV C;  4FXY P;  1GE6 A;  1SAT A;  1RMZ A;  1SMP A;  2E2D A;  3EDG A;  5CZM A;  2E3X A;  3V96 B;  2DW2 A;  1HY7 A;  2X7M A;  1OMJ A;  1ZTQ A;  1JAN A;  1I1I P;  2AYK A;  4G9L A;  4GWN A;  2X3C A;  2I47 A;  1IAE A;  1Y8J A;  3AYU A;  3G42 A;  1GKD A;  4H30 A;  1SLN A;  2X3B A;  3KHI A;  3TSK A;  1D8M A;  2RJQ A;  1H71 P;  1R1J A;  1ATL A;  1HFC A;  1R55 A;  1R1I A;  4AYK A;  2OY4 A;  3OHO A;  3KMC A;  2JT5 A;  3MA2 A;  1HV5 A;  3HY7 A;  1KAP P;  5I3M A;  5L79 A;  4JIJ A;  2D1N A;  4IN9 A;  2D1O A;  2W12 A;  1K7I A;  5L7F A;  1KUI A;  2FV9 A;  1XUD A;  4R3V A;  1Y0V A;  4XCT A;  4AXQ A;  2K9C A;  1PWV A;  2DDY A;  4PKQ A;  4FXQ A;  3UVC A;  1BQO A;  3HDB A;  3DWB A;  1G05 A;  1K7G A;  1UEA A;  3CKI A;  3ZXH A;  2V4B A;  2HU6 A;  3RTT A;  1A85 A;  2W15 A;  1MNC A;  4GWM A;  1OO9 A;  2CKI A;  2W13 A;  3GBO A;  3N2U A;  4ZR5 A;  3NX7 A;  1JKY A;  1ROS A;  3EWJ A;  2RJP A;  2JIH A;  4DV8 A;  5I43 A;  1O0T A;  1WNI A;  2OVX A;  4DPE A;  3L0T A;  3B92 A;  1KUG A;  1MMQ A;  3DPF A;  4HX3 A;  3DNG A;  2WO8 A;  5H8X A;  1R1H A;  4L63 A;  3VI1 A;  4PKS A;  3O64 A;  4XBH A;  5BPA A;  3LJZ A;  4GF1 A;  2OXW A;  2OXU A;  1OM6 A;  3LQ0 A;  1BIW A;  4L19 A;  3Q2H A;  1G12 A;  2MZE A;  3LK8 A;  2O3E A;  1GE5 A;  1GO8 P;  2Z2D A;  1OS9 A;  3LEA A;  1SU3 A;  5I2Z A;  3DL1 A;  4IUW A;  3B2Z A;  4DF9 A;  2OW1 A;  3LQB A;  2MLS A;  1XFZ A;  1ZP5 A;  1K7Q A;  1EUB A;  3K7N A;  3G5C A;  4XM6 A;  1BKC I;  4H3X A;  4EFS A;  2ERO A;  5BOT A;  1HTD A;  1KUH A;  1ND1 A;  3B8Z A;  3EHY A;  4WZV A;  4I03 A;  1D7X A;  4CTH A;  2W0D A;  2L0R A;  3LE9 A;  1CK7 A;  3F16 A;  1OM8 A;  1AF0 A;  1QIB A; 
#chains in the Genus database with same CATH topology
 3DPE A;  4FU4 A;  3L0V A;  4ILW D;  4PKR A;  1IAD A;  3LIL A;  2ERP A;  2N8R A;  5I4O A;  4PKV A;  1YQY A;  5I0L A;  1BQQ M;  1KUK A;  3HY9 A;  1Z3J A;  3KRY A;  3DSL A;  5LAB A;  3AIG A;  2QPJ A;  2OW2 A;  3AYK A;  3P1V A;  4A3W A;  1ZS0 A;  1JK3 A;  5B5P A;  2OXZ A;  3O2X A;  5D2B A;  3EHX A;  1D5J A;  2JSD A;  3ZVS A;  1JJ9 A;  1B3D A;  2J83 A;  1BSW A;  1KBC A;  5D1T A;  2A8H A;  2USN A;  5D1S A;  4JA1 A;  1YOU A;  1ZXC A;  1JH1 A;  1ZVX A;  1XFY A;  3LJT A;  3HB2 P;  4H2E A;  3KEC A;  1IAC A;  2Y6C A;  5D1U A;  4XM8 A;  3F1A A;  4DD8 A;  1IAA A;  3SHI A;  4WKI A;  2AIG P;  4H76 A;  3KEJ A;  1OS2 A;  3LKA A;  2KRJ A;  3U1R A;  1HFS A;  1IAB A;  2O36 A;  2SRT A;  2WO9 A;  1XFV A;  2YIG A;  4GR0 A;  2XS3 A;  1PWQ A;  1Q3A A;  2OVZ A;  1QIC A;  1O0Q A;  1MMR A;  5D7W A;  1BZS A;  4G0D A;  1PWP A;  1Y93 A;  4JP4 A;  1KUF A;  4I35 A;  1AST A;  3F15 A;  5BOY A;  4Q1L A;  2OI0 A;  1PWW A;  1I76 A;  2ERQ A;  1CXV A;  1CIZ A;  1XUC A;  1YP1 A;  1UTT A;  3LUN A;  1BKC A;  3WV2 A;  4GQL A;  1B8Y A;  1J7N A;  1QJI A;  1A86 A;  3ELM A;  3LIK A;  4J4M A;  1PWU A;  2JT6 A;  2POJ A;  3VTG A;  1XFU A;  2OW0 A;  4H49 A;  1CGL A;  3DTI A;  1XFX A;  3TT4 A;  3KEK A;  2Y6D A;  1JAQ A;  4PKU A;  2TCL A;  1JAP A;  1SRP A;  3HDA P;  1D8F A;  3OHL A;  4JQG A;  1EAK A;  4AUO A;  1G9K A;  4WKE A;  3TVC A;  4A7B A;  1OZ9 A;  2FV5 A;  1AKL A;  1OM7 A;  1DTH A;  1GE7 A;  1GKC A;  1HOV A;  3I7G A;  3LUM A;  4HMA A;  1BM6 A;  1FBL A;  4FVL A;  2YB9 A;  2YUF A;  1MMP A;  5I12 A;  1C3I A;  2DDF A;  2MLR A;  5JMY A;  1RM8 A;  1BKC E;  5CXA A;  3F19 A;  966C A;  3Q2G A;  4PKW A;  1QUA A;  2K2G A;  4IJO A;  1I73 A;  2X3A A;  1XUR A;  3EDI A;  3EDH A;  1CGF A;  1GXD A;  1DMT A;  3TS4 A;  1JAO A;  3RTS A;  2OY2 A;  4JPA A;  4H84 A;  4GR8 A;  1CAQ A;  4XM7 A;  1BUD A;  4PKT A;  3P24 A;  1GO7 P;  456C A;  3HBV P;  5D3C A;  2DW1 A;  4WK7 A;  4QKZ A;  5CUH A;  2CLT A;  1UMT A;  3K7L A;  2OZR A;  4GR3 A;  2OW9 A;  1JIW P;  1USN A;  2MZI A;  2PJT A;  1C8T A;  1FM1 A;  3WV1 A;  3BA0 A;  3F17 A;  3LIR A;  1G49 A;  1CGE A;  3HYG A;  1G4K A;  830C A;  1C7K A;  1UTZ A;  4AIG A;  1UMS A;  2WOA A;  3ZUK A;  3N2V A;  1CQR A;  3WV3 A;  1YCM A;  2J0T A;  4WF6 A;  3KME A;  1FLS A;  2XS4 A;  1BUV M;  1XFW A;  2W14 A;  3F18 A;  1IAG A;  1QIA A;  3USN A;  1R54 A;  4H82 A;  1L6J A;  5B5O A;  3LMC A;  1MMB A;  2JNP A;  3LGP A;  4L6T A;  1QJJ A;  2DW0 A;  1XAX A;  3HBU P;  3EDZ A;  1JIZ A;  1EB6 A;  3I7I A;  1XM5 A;  1SLM A;  1S4B P;  2MZH A;  3E8R A;  3LJG A;  4H1Q A;  4ON1 A;  1ZXV A;  4GUY A;  1AYK A;  3KWV C;  4FXY P;  1GE6 A;  1SAT A;  1RMZ A;  1SMP A;  2E2D A;  3EDG A;  5CZM A;  2E3X A;  3V96 B;  2DW2 A;  1HY7 A;  2X7M A;  1OMJ A;  1ZTQ A;  1JAN A;  1I1I P;  2AYK A;  4G9L A;  4GWN A;  2X3C A;  2I47 A;  1IAE A;  1Y8J A;  3AYU A;  3G42 A;  1GKD A;  4H30 A;  1SLN A;  2X3B A;  3KHI A;  3TSK A;  1D8M A;  2RJQ A;  1H71 P;  1R1J A;  1ATL A;  1HFC A;  1R55 A;  1R1I A;  4AYK A;  2OY4 A;  3OHO A;  3KMC A;  2JT5 A;  3MA2 A;  1HV5 A;  3DTK A;  3HY7 A;  1KAP P;  5I3M A;  5L79 A;  4JIJ A;  2D1N A;  4IN9 A;  2D1O A;  2W12 A;  1K7I A;  5L7F A;  1KUI A;  2FV9 A;  1XUD A;  4R3V A;  1Y0V A;  4XCT A;  4AXQ A;  2K9C A;  1PWV A;  2DDY A;  4PKQ A;  4FXQ A;  3UVC A;  1BQO A;  3HDB A;  3DWB A;  1G05 A;  1K7G A;  1UEA A;  3CKI A;  3ZXH A;  2V4B A;  2HU6 A;  3RTT A;  1A85 A;  2W15 A;  1MNC A;  4GWM A;  1OO9 A;  2CKI A;  2W13 A;  3GBO A;  3N2U A;  4ZR5 A;  3NX7 A;  1JKY A;  1ROS A;  3EWJ A;  2RJP A;  2JIH A;  4DV8 A;  5I43 A;  1O0T A;  1WNI A;  2OVX A;  4DPE A;  3DTE A;  3L0T A;  3B92 A;  1KUG A;  1MMQ A;  3DPF A;  4HX3 A;  3DNG A;  2WO8 A;  5H8X A;  1R1H A;  4L63 A;  3VI1 A;  4PKS A;  3O64 A;  4XBH A;  5BPA A;  3LJZ A;  4GF1 A;  2OXW A;  2OXU A;  1OM6 A;  3LQ0 A;  1BIW A;  4L19 A;  3Q2H A;  4L7A A;  1G12 A;  2MZE A;  3LK8 A;  2O3E A;  1GE5 A;  1GO8 P;  2Z2D A;  1OS9 A;  3LEA A;  1SU3 A;  5I2Z A;  3DL1 A;  4IUW A;  3B2Z A;  4DF9 A;  2OW1 A;  3LQB A;  2MLS A;  1XFZ A;  1ZP5 A;  1TVI A;  1K7Q A;  1EUB A;  3K7N A;  3G5C A;  4XM6 A;  1BKC I;  4H3X A;  4EFS A;  2ERO A;  5BOT A;  1HTD A;  1KUH A;  1ND1 A;  3B8Z A;  3EHY A;  4WZV A;  4I03 A;  1D7X A;  4CTH A;  2W0D A;  2L0R A;  3LE9 A;  1CK7 A;  3F16 A;  1OM8 A;  1AF0 A;  1QIB A; 
#chains in the Genus database with same CATH homology
 3DPE A;  4FU4 A;  3L0V A;  4ILW D;  4PKR A;  1IAD A;  3LIL A;  2ERP A;  2N8R A;  5I4O A;  4PKV A;  1YQY A;  5I0L A;  1BQQ M;  1KUK A;  3HY9 A;  1Z3J A;  3KRY A;  3DSL A;  5LAB A;  3AIG A;  2QPJ A;  2OW2 A;  3AYK A;  3P1V A;  4A3W A;  1ZS0 A;  1JK3 A;  5B5P A;  2OXZ A;  3O2X A;  5D2B A;  3EHX A;  1D5J A;  2JSD A;  3ZVS A;  1JJ9 A;  1B3D A;  2J83 A;  1BSW A;  1KBC A;  5D1T A;  2A8H A;  2USN A;  5D1S A;  4JA1 A;  1YOU A;  1ZXC A;  1JH1 A;  1ZVX A;  1XFY A;  3LJT A;  3HB2 P;  4H2E A;  3KEC A;  1IAC A;  2Y6C A;  5D1U A;  4XM8 A;  3F1A A;  4DD8 A;  1IAA A;  3SHI A;  4WKI A;  2AIG P;  4H76 A;  3KEJ A;  1OS2 A;  3LKA A;  2KRJ A;  3U1R A;  1HFS A;  1IAB A;  2O36 A;  2SRT A;  2WO9 A;  1XFV A;  2YIG A;  4GR0 A;  2XS3 A;  1PWQ A;  1Q3A A;  2OVZ A;  1QIC A;  1O0Q A;  1MMR A;  5D7W A;  1BZS A;  4G0D A;  1PWP A;  1Y93 A;  4JP4 A;  1KUF A;  4I35 A;  1AST A;  3F15 A;  5BOY A;  4Q1L A;  2OI0 A;  1PWW A;  1I76 A;  2ERQ A;  1CXV A;  1CIZ A;  1XUC A;  1YP1 A;  1UTT A;  3LUN A;  1BKC A;  3WV2 A;  4GQL A;  1B8Y A;  1J7N A;  1QJI A;  1A86 A;  3ELM A;  3LIK A;  4J4M A;  1PWU A;  2JT6 A;  2POJ A;  3VTG A;  1XFU A;  2OW0 A;  4H49 A;  1CGL A;  3DTI A;  1XFX A;  3TT4 A;  3KEK A;  2Y6D A;  1JAQ A;  4PKU A;  2TCL A;  1JAP A;  1SRP A;  3HDA P;  1D8F A;  3OHL A;  4JQG A;  1EAK A;  4AUO A;  1G9K A;  4WKE A;  3TVC A;  4A7B A;  2FV5 A;  1AKL A;  1OM7 A;  1DTH A;  1GE7 A;  1GKC A;  1HOV A;  3I7G A;  3LUM A;  4HMA A;  1BM6 A;  1FBL A;  4FVL A;  2YB9 A;  2YUF A;  1MMP A;  5I12 A;  1C3I A;  2DDF A;  2MLR A;  5JMY A;  1RM8 A;  1BKC E;  5CXA A;  3F19 A;  966C A;  3Q2G A;  4PKW A;  1QUA A;  2K2G A;  4IJO A;  1I73 A;  2X3A A;  1XUR A;  3EDI A;  3EDH A;  1CGF A;  1GXD A;  1DMT A;  3TS4 A;  1JAO A;  3RTS A;  2OY2 A;  4JPA A;  4H84 A;  4GR8 A;  1CAQ A;  4XM7 A;  1BUD A;  4PKT A;  3P24 A;  1GO7 P;  456C A;  3HBV P;  5D3C A;  2DW1 A;  4WK7 A;  4QKZ A;  5CUH A;  2CLT A;  1UMT A;  3K7L A;  2OZR A;  4GR3 A;  2OW9 A;  1JIW P;  1USN A;  2MZI A;  2PJT A;  1C8T A;  1FM1 A;  3WV1 A;  3BA0 A;  3F17 A;  3LIR A;  1G49 A;  1CGE A;  3HYG A;  1G4K A;  830C A;  1C7K A;  1UTZ A;  4AIG A;  1UMS A;  2WOA A;  3ZUK A;  3N2V A;  1CQR A;  3WV3 A;  1YCM A;  2J0T A;  4WF6 A;  3KME A;  1FLS A;  2XS4 A;  1BUV M;  1XFW A;  2W14 A;  3F18 A;  1IAG A;  1QIA A;  3USN A;  1R54 A;  4H82 A;  1L6J A;  5B5O A;  3LMC A;  1MMB A;  2JNP A;  3LGP A;  4L6T A;  1QJJ A;  2DW0 A;  3HBU P;  3EDZ A;  1JIZ A;  1EB6 A;  3I7I A;  1SLM A;  1S4B P;  2MZH A;  3E8R A;  3LJG A;  4H1Q A;  4ON1 A;  1ZXV A;  4GUY A;  1AYK A;  3KWV C;  4FXY P;  1GE6 A;  1SAT A;  1RMZ A;  1SMP A;  2E2D A;  3EDG A;  5CZM A;  2E3X A;  3V96 B;  2DW2 A;  1HY7 A;  2X7M A;  1OMJ A;  1ZTQ A;  1JAN A;  1I1I P;  2AYK A;  4G9L A;  4GWN A;  2X3C A;  2I47 A;  1IAE A;  1Y8J A;  3AYU A;  3G42 A;  1GKD A;  4H30 A;  1SLN A;  2X3B A;  3KHI A;  3TSK A;  1D8M A;  2RJQ A;  1H71 P;  1R1J A;  1ATL A;  1HFC A;  1R55 A;  1R1I A;  4AYK A;  2OY4 A;  3OHO A;  3KMC A;  2JT5 A;  3MA2 A;  1HV5 A;  3DTK A;  3HY7 A;  1KAP P;  5I3M A;  5L79 A;  4JIJ A;  2D1N A;  4IN9 A;  2D1O A;  2W12 A;  1K7I A;  5L7F A;  1KUI A;  2FV9 A;  1XUD A;  4R3V A;  1Y0V A;  4XCT A;  4AXQ A;  2K9C A;  1PWV A;  2DDY A;  4PKQ A;  4FXQ A;  3UVC A;  1BQO A;  3HDB A;  3DWB A;  1G05 A;  1K7G A;  1UEA A;  3CKI A;  3ZXH A;  2V4B A;  2HU6 A;  3RTT A;  1A85 A;  2W15 A;  1MNC A;  4GWM A;  1OO9 A;  2CKI A;  2W13 A;  3GBO A;  3N2U A;  4ZR5 A;  3NX7 A;  1JKY A;  1ROS A;  3EWJ A;  2RJP A;  2JIH A;  4DV8 A;  5I43 A;  1O0T A;  1WNI A;  2OVX A;  4DPE A;  3DTE A;  3L0T A;  3B92 A;  1KUG A;  1MMQ A;  3DPF A;  4HX3 A;  3DNG A;  2WO8 A;  5H8X A;  1R1H A;  4L63 A;  3VI1 A;  4PKS A;  3O64 A;  4XBH A;  5BPA A;  3LJZ A;  4GF1 A;  2OXW A;  2OXU A;  1OM6 A;  3LQ0 A;  1BIW A;  4L19 A;  3Q2H A;  4L7A A;  1G12 A;  2MZE A;  3LK8 A;  2O3E A;  1GE5 A;  1GO8 P;  2Z2D A;  1OS9 A;  3LEA A;  1SU3 A;  5I2Z A;  3DL1 A;  4IUW A;  3B2Z A;  4DF9 A;  2OW1 A;  3LQB A;  2MLS A;  1XFZ A;  1ZP5 A;  1K7Q A;  1EUB A;  3K7N A;  3G5C A;  4XM6 A;  1BKC I;  4H3X A;  4EFS A;  2ERO A;  5BOT A;  1HTD A;  1KUH A;  1ND1 A;  3B8Z A;  3EHY A;  4WZV A;  4I03 A;  1D7X A;  4CTH A;  2W0D A;  2L0R A;  3LE9 A;  1CK7 A;  3F16 A;  1OM8 A;  1AF0 A;  1QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...