4JAKA

Crystal structure of trna (um34/cm34) methyltransferase trml from escherichia coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
Knots found
sequence length
155
structure length
155
Chain Sequence
MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
publication title The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 44
structure length 155
sequence length 155
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2013-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jakA00
4X3LA 3QUVA 4CNFA 3AXZA 2O3AA 4YQ5A 2V3JA 1MXIA 4YQRA 3GYQA 1V2XA 2QWVA 4YQJA 1IPAA 4MCCA 4YVIA 4L69A 4YVKA 4H3ZA 2V3KA 4RG1A 1GZ0A 1TO0A 5D9FA 3ILKA 4YQ4A 4YPXA 4E8BA 3E5YA 4YQBA 4YQ1A 4YPZA 1ZJRA 3BBEA 2YY8A 4YVGA 4YQ6A 4H3YA 4CNGA 2EGVA 3OIJA 4YQ3A 4CNDA 1OY5A 4KDZA 3NK6A 4YQIA 4YQTA 2QMMA 1O6DA 5FAIA 4CNEA 4YQAA 5GMCA 5CO4A 3DCMX 4MCBA 5GMBA 4JAKA 1NS5A 3BBHA 4YQ8A 3BBDA 4YQ0A 1J85A 1V6ZA 1UAJA 5GM8A 1VH0A 3ONPA 2Z0YA 3N4KA 4J3CA 4MCDA 1K3RA 4YQ2A 3AI9X 3KY7A 3KTYA 1NXZA 4YVJA 4YQ9A 4YQSA 1X7PA 3IC6A 3KW2A 4YQDA 4FAKA 2CX8A 4YPWA 4YQCA 1UALA 1UAKA 4XBOA 3NK7A 3OIIA 1UAMA 4YQKA 4YQQA 3N4JA 2HA8A 1P9PA 1VHYA 4YQPA 2I6DA 3KNUA 1X7OA 4YQ7A 4KGNA 4YQNA 4IG6A 3IEFA 4YPYA 4YQLA 4PZKA 3L8UA 4X3MA 2EGWA 3OINA 1Z85A 4JALA 1VHKA 3AIAA 3O7BA 4YQOA 4YVHA 4YQGA
chains in the Genus database with same CATH superfamily
4X3LA 3QUVA 4CNFA 3AXZA 2O3AA 4YQ5A 2V3JA 1MXIA 4YQRA 3GYQA 4JWJA 1V2XA 2QWVA 4YQJA 1IPAA 4MCCA 4YVIA 4L69A 4YVKA 4H3ZA 2V3KA 4RG1A 1GZ0A 1TO0A 5D9FA 3ILKA 4YQ4A 4YPXA 4JWGA 4E8BA 3E5YA 4YQBA 4YQ1A 4YPZA 1ZJRA 3BBEA 2YY8A 4YVGA 4YQ6A 4H3YA 4CNGA 2EGVA 3OIJA 4YQ3A 4CNDA 1OY5A 4KDZA 3NK6A 4YQIA 4YQTA 2QMMA 1O6DA 5FAIA 4CNEA 4YQAA 5GMCA 5CO4A 3DCMX 4MCBA 4FMWA 5GMBA 4JAKA 1NS5A 3BBHA 4YQ8A 3BBDA 4YQ0A 1J85A 1V6ZA 4JWFA 1UAJA 5GM8A 1VH0A 3ONPA 2Z0YA 3N4KA 4J3CA 4MCDA 1K3RA 4YQ2A 3AI9X 3KY7A 3KTYA 1NXZA 4YVJA 4YQ9A 4YQSA 1X7PA 3IC6A 3KW2A 4YQDA 4FAKA 2CX8A 4YPWA 4YQCA 1UALA 1UAKA 4XBOA 3NK7A 3OIIA 1UAMA 4YQKA 4YQQA 3N4JA 2HA8A 1P9PA 1VHYA 4YQPA 2I6DA 3KNUA 1X7OA 4YQ7A 4KGNA 4YQNA 4IG6A 3IEFA 4YPYA 4YQLA 4PZKA 3L8UA 4X3MA 2EGWA 3OINA 1Z85A 4JALA 1VHKA 3AIAA 3O7BA 4YQOA 4YVHA 4YQGA 4JWHA
chains in the Genus database with same CATH topology
4X3LA 3QUVA 4CNFA 3AXZA 2O3AA 4YQ5A 2V3JA 1MXIA 4YQRA 3GYQA 4JWJA 1V2XA 2QWVA 4YQJA 1IPAA 4MCCA 4YVIA 4L69A 4YVKA 4H3ZA 2V3KA 4RG1A 1GZ0A 1TO0A 5D9FA 3ILKA 4YQ4A 4YPXA 4JWGA 4E8BA 3E5YA 4YQBA 4YQ1A 4YPZA 1ZJRA 3BBEA 2YY8A 4YVGA 4YQ6A 4H3YA 4CNGA 2EGVA 3OIJA 4YQ3A 4CNDA 1OY5A 4KDZA 3NK6A 4YQIA 4YQTA 2QMMA 1O6DA 5FAIA 4CNEA 4YQAA 5GMCA 5CO4A 3DCMX 4MCBA 4FMWA 5GMBA 4JAKA 1NS5A 3BBHA 4YQ8A 3BBDA 4YQ0A 1J85A 1V6ZA 4JWFA 1UAJA 5GM8A 1VH0A 3ONPA 2Z0YA 3N4KA 4J3CA 4MCDA 1K3RA 4YQ2A 3AI9X 3KY7A 3KTYA 1NXZA 4YVJA 4YQ9A 4YQSA 1X7PA 3IC6A 3KW2A 4YQDA 4FAKA 2CX8A 4YPWA 4YQCA 1UALA 1UAKA 4XBOA 3NK7A 3OIIA 1UAMA 4YQKA 4YQQA 3N4JA 2HA8A 1P9PA 1VHYA 4YQPA 2I6DA 3KNUA 1X7OA 4YQ7A 4KGNA 4YQNA 4IG6A 3IEFA 4YPYA 4YQLA 4PZKA 3L8UA 4X3MA 2EGWA 3OINA 1Z85A 4JALA 1VHKA 3AIAA 3O7BA 4YQOA 4YVHA 4YQGA 4JWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3L A;  3QUV A;  4CNF A;  3AXZ A;  2O3A A;  4YQ5 A;  2V3J A;  1MXI A;  4YQR A;  3GYQ A;  1V2X A;  2QWV A;  4YQJ A;  1IPA A;  4MCC A;  4YVI A;  4L69 A;  4YVK A;  4H3Z A;  2V3K A;  4RG1 A;  1GZ0 A;  1TO0 A;  5D9F A;  3ILK A;  4YQ4 A;  4YPX A;  4E8B A;  3E5Y A;  4YQB A;  4YQ1 A;  4YPZ A;  1ZJR A;  3BBE A;  2YY8 A;  4YVG A;  4YQ6 A;  4H3Y A;  4CNG A;  2EGV A;  3OIJ A;  4YQ3 A;  4CND A;  1OY5 A;  4KDZ A;  3NK6 A;  4YQI A;  4YQT A;  2QMM A;  1O6D A;  5FAI A;  4CNE A;  4YQA A;  5GMC A;  5CO4 A;  3DCM X;  4MCB A;  5GMB A;  4JAK A;  1NS5 A;  3BBH A;  4YQ8 A;  3BBD A;  4YQ0 A;  1J85 A;  1V6Z A;  1UAJ A;  5GM8 A;  1VH0 A;  3ONP A;  2Z0Y A;  3N4K A;  4J3C A;  4MCD A;  1K3R A;  4YQ2 A;  3AI9 X;  3KY7 A;  3KTY A;  1NXZ A;  4YVJ A;  4YQ9 A;  4YQS A;  1X7P A;  3IC6 A;  3KW2 A;  4YQD A;  4FAK A;  2CX8 A;  4YPW A;  4YQC A;  1UAL A;  1UAK A;  4XBO A;  3NK7 A;  3OII A;  1UAM A;  4YQK A;  4YQQ A;  3N4J A;  2HA8 A;  1P9P A;  1VHY A;  4YQP A;  2I6D A;  3KNU A;  1X7O A;  4YQ7 A;  4KGN A;  4YQN A;  4IG6 A;  3IEF A;  4YPY A;  4YQL A;  4PZK A;  3L8U A;  4X3M A;  2EGW A;  3OIN A;  1Z85 A;  4JAL A;  1VHK A;  3AIA A;  3O7B A;  4YQO A;  4YVH A;  4YQG A; 
#chains in the Genus database with same CATH topology
 4X3L A;  3QUV A;  4CNF A;  3AXZ A;  2O3A A;  4YQ5 A;  2V3J A;  1MXI A;  4YQR A;  3GYQ A;  4JWJ A;  1V2X A;  2QWV A;  4YQJ A;  1IPA A;  4MCC A;  4YVI A;  4L69 A;  4YVK A;  4H3Z A;  2V3K A;  4RG1 A;  1GZ0 A;  1TO0 A;  5D9F A;  3ILK A;  4YQ4 A;  4YPX A;  4JWG A;  4E8B A;  3E5Y A;  4YQB A;  4YQ1 A;  4YPZ A;  1ZJR A;  3BBE A;  2YY8 A;  4YVG A;  4YQ6 A;  4H3Y A;  4CNG A;  2EGV A;  3OIJ A;  4YQ3 A;  4CND A;  1OY5 A;  4KDZ A;  3NK6 A;  4YQI A;  4YQT A;  2QMM A;  1O6D A;  5FAI A;  4CNE A;  4YQA A;  5GMC A;  5CO4 A;  3DCM X;  4MCB A;  4FMW A;  5GMB A;  4JAK A;  1NS5 A;  3BBH A;  4YQ8 A;  3BBD A;  4YQ0 A;  1J85 A;  1V6Z A;  4JWF A;  1UAJ A;  5GM8 A;  1VH0 A;  3ONP A;  2Z0Y A;  3N4K A;  4J3C A;  4MCD A;  1K3R A;  4YQ2 A;  3AI9 X;  3KY7 A;  3KTY A;  1NXZ A;  4YVJ A;  4YQ9 A;  4YQS A;  1X7P A;  3IC6 A;  3KW2 A;  4YQD A;  4FAK A;  2CX8 A;  4YPW A;  4YQC A;  1UAL A;  1UAK A;  4XBO A;  3NK7 A;  3OII A;  1UAM A;  4YQK A;  4YQQ A;  3N4J A;  2HA8 A;  1P9P A;  1VHY A;  4YQP A;  2I6D A;  3KNU A;  1X7O A;  4YQ7 A;  4KGN A;  4YQN A;  4IG6 A;  3IEF A;  4YPY A;  4YQL A;  4PZK A;  3L8U A;  4X3M A;  2EGW A;  3OIN A;  1Z85 A;  4JAL A;  1VHK A;  3AIA A;  3O7B A;  4YQO A;  4YVH A;  4YQG A;  4JWH A; 
#chains in the Genus database with same CATH homology
 4X3L A;  3QUV A;  4CNF A;  3AXZ A;  2O3A A;  4YQ5 A;  2V3J A;  1MXI A;  4YQR A;  3GYQ A;  4JWJ A;  1V2X A;  2QWV A;  4YQJ A;  1IPA A;  4MCC A;  4YVI A;  4L69 A;  4YVK A;  4H3Z A;  2V3K A;  4RG1 A;  1GZ0 A;  1TO0 A;  5D9F A;  3ILK A;  4YQ4 A;  4YPX A;  4JWG A;  4E8B A;  3E5Y A;  4YQB A;  4YQ1 A;  4YPZ A;  1ZJR A;  3BBE A;  2YY8 A;  4YVG A;  4YQ6 A;  4H3Y A;  4CNG A;  2EGV A;  3OIJ A;  4YQ3 A;  4CND A;  1OY5 A;  4KDZ A;  3NK6 A;  4YQI A;  4YQT A;  2QMM A;  1O6D A;  5FAI A;  4CNE A;  4YQA A;  5GMC A;  5CO4 A;  3DCM X;  4MCB A;  4FMW A;  5GMB A;  4JAK A;  1NS5 A;  3BBH A;  4YQ8 A;  3BBD A;  4YQ0 A;  1J85 A;  1V6Z A;  4JWF A;  1UAJ A;  5GM8 A;  1VH0 A;  3ONP A;  2Z0Y A;  3N4K A;  4J3C A;  4MCD A;  1K3R A;  4YQ2 A;  3AI9 X;  3KY7 A;  3KTY A;  1NXZ A;  4YVJ A;  4YQ9 A;  4YQS A;  1X7P A;  3IC6 A;  3KW2 A;  4YQD A;  4FAK A;  2CX8 A;  4YPW A;  4YQC A;  1UAL A;  1UAK A;  4XBO A;  3NK7 A;  3OII A;  1UAM A;  4YQK A;  4YQQ A;  3N4J A;  2HA8 A;  1P9P A;  1VHY A;  4YQP A;  2I6D A;  3KNU A;  1X7O A;  4YQ7 A;  4KGN A;  4YQN A;  4IG6 A;  3IEF A;  4YPY A;  4YQL A;  4PZK A;  3L8U A;  4X3M A;  2EGW A;  3OIN A;  1Z85 A;  4JAL A;  1VHK A;  3AIA A;  3O7B A;  4YQO A;  4YVH A;  4YQG A;  4JWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...