4JAKA

Crystal structure of trna (um34/cm34) methyltransferase trml from escherichia coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
Knots found
sequence length
155
structure length
155
Chain Sequence
b'MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
publication title The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 44
structure length 155
sequence length 155
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2013-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jakA00
5GMBA 4YQ5A 4KGNA 1VHKA 3BBHA 3N4JA 4CNDA 2V3JA 4CNGA 1X7OA 2O3AA 4YQ8A 4YQ1A 1UAMA 2YY8A 4YQAA 1GZ0A 1OY5A 1X7PA 2Z0YA 3L8UA 1VHYA 4MCBA 4PZKA 3IEFA 1ZJRA 4YQ9A 1UAJA 3NK7A 4YQQA 4YQBA 3OINA 4L69A 3DCMX 1P9PA 4YPXA 4YPZA 4H3YA 3QUVA 2V3KA 4YQPA 4YQ7A 5GM8A 4YQIA 2QWVA 4YQCA 4YQ3A 4YVHA 3BBDA 3IC6A 4YPWA 4MCDA 4J3CA 1V6ZA 4YQOA 3E5YA 4CNEA 4YQRA 3AIAA 1IPAA 1VH0A 4YQJA 5D9FA 4YQ2A 3OIIA 3O7BA 1Z85A 3N4KA 1K3RA 4YQTA 5FAIA 3AI9X 1MXIA 3ILKA 5CO4A 3GYQA 4X3LA 4YVKA 3AXZA 4YVJA 4YVGA 2EGWA 3NK6A 4YPYA 3ONPA 4H3ZA 4YQNA 4X3MA 4YQGA 4MCCA 4YQ6A 4YQKA 2I6DA 4CNFA 4E8BA 1NXZA 3KY7A 3OIJA 4XBOA 4JALA 1V2XA 3BBEA 4JAKA 1TO0A 2HA8A 1J85A 1O6DA 4IG6A 1UALA 2QMMA 3KTYA 4YQ4A 4YQLA 4YQSA 1UAKA 1NS5A 2EGVA 3KW2A 4YQ0A 4FAKA 4YVIA 4YQDA 3KNUA 4KDZA 5GMCA 2CX8A 4RG1A
chains in the Genus database with same CATH superfamily
5GMBA 4YQ5A 4KGNA 1VHKA 3BBHA 3N4JA 4CNDA 2V3JA 4CNGA 1X7OA 2O3AA 4YQ8A 4YQ1A 1UAMA 2YY8A 4YQAA 1GZ0A 1OY5A 1X7PA 2Z0YA 3L8UA 1VHYA 4MCBA 4PZKA 3IEFA 1ZJRA 4YQ9A 1UAJA 3NK7A 4YQQA 4YQBA 3OINA 4L69A 3DCMX 1P9PA 4YPXA 4YPZA 4H3YA 3QUVA 2V3KA 4YQPA 4YQ7A 5GM8A 4YQIA 2QWVA 4YQCA 4YQ3A 4YVHA 3BBDA 3IC6A 4YPWA 4MCDA 4J3CA 1V6ZA 4YQOA 3E5YA 4CNEA 4YQRA 3AIAA 1IPAA 1VH0A 4YQJA 5D9FA 4YQ2A 3OIIA 3O7BA 1Z85A 3N4KA 1K3RA 4YQTA 5FAIA 3AI9X 1MXIA 3ILKA 5CO4A 4FMWA 3GYQA 4X3LA 4YVKA 3AXZA 4YVJA 4YVGA 2EGWA 3NK6A 4YPYA 3ONPA 4H3ZA 4YQNA 4X3MA 4JWHA 4YQGA 4MCCA 4YQ6A 4YQKA 2I6DA 4CNFA 4E8BA 4JWGA 1NXZA 3KY7A 3OIJA 4XBOA 4JWJA 4JALA 1V2XA 3BBEA 4JAKA 1TO0A 2HA8A 1J85A 4JWFA 1O6DA 4IG6A 1UALA 2QMMA 3KTYA 4YQ4A 4YQLA 4YQSA 1UAKA 1NS5A 2EGVA 3KW2A 4YQ0A 4FAKA 4YVIA 4YQDA 3KNUA 4KDZA 5GMCA 2CX8A 4RG1A
chains in the Genus database with same CATH topology
5GMBA 4YQ5A 4KGNA 1VHKA 3BBHA 3N4JA 4CNDA 2V3JA 4CNGA 1X7OA 2O3AA 4YQ8A 4YQ1A 1UAMA 2YY8A 4YQAA 1GZ0A 1OY5A 1X7PA 2Z0YA 3L8UA 1VHYA 4MCBA 4PZKA 3IEFA 1ZJRA 4YQ9A 1UAJA 3NK7A 4YQQA 4YQBA 3OINA 4L69A 3DCMX 1P9PA 4YPXA 4YPZA 4H3YA 3QUVA 2V3KA 4YQPA 4YQ7A 5GM8A 4YQIA 2QWVA 4YQCA 4YQ3A 4YVHA 3BBDA 3IC6A 4YPWA 4MCDA 4J3CA 1V6ZA 4YQOA 3E5YA 4CNEA 4YQRA 3AIAA 1IPAA 1VH0A 4YQJA 5D9FA 4YQ2A 3OIIA 3O7BA 1Z85A 3N4KA 1K3RA 4YQTA 5FAIA 3AI9X 1MXIA 3ILKA 5CO4A 4FMWA 3GYQA 4X3LA 4YVKA 3AXZA 4YVJA 4YVGA 2EGWA 3NK6A 4YPYA 3ONPA 4H3ZA 4YQNA 4X3MA 4JWHA 4YQGA 4MCCA 4YQ6A 4YQKA 2I6DA 4CNFA 4E8BA 4JWGA 1NXZA 3KY7A 3OIJA 4XBOA 4JWJA 4JALA 1V2XA 3BBEA 4JAKA 1TO0A 2HA8A 1J85A 4JWFA 1O6DA 4IG6A 1UALA 2QMMA 3KTYA 4YQ4A 4YQLA 4YQSA 1UAKA 1NS5A 2EGVA 3KW2A 4YQ0A 4FAKA 4YVIA 4YQDA 3KNUA 4KDZA 5GMCA 2CX8A 4RG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMB A;  4YQ5 A;  4KGN A;  1VHK A;  3BBH A;  3N4J A;  4CND A;  2V3J A;  4CNG A;  1X7O A;  2O3A A;  4YQ8 A;  4YQ1 A;  1UAM A;  2YY8 A;  4YQA A;  1GZ0 A;  1OY5 A;  1X7P A;  2Z0Y A;  3L8U A;  1VHY A;  4MCB A;  4PZK A;  3IEF A;  1ZJR A;  4YQ9 A;  1UAJ A;  3NK7 A;  4YQQ A;  4YQB A;  3OIN A;  4L69 A;  3DCM X;  1P9P A;  4YPX A;  4YPZ A;  4H3Y A;  3QUV A;  2V3K A;  4YQP A;  4YQ7 A;  5GM8 A;  4YQI A;  2QWV A;  4YQC A;  4YQ3 A;  4YVH A;  3BBD A;  3IC6 A;  4YPW A;  4MCD A;  4J3C A;  1V6Z A;  4YQO A;  3E5Y A;  4CNE A;  4YQR A;  3AIA A;  1IPA A;  1VH0 A;  4YQJ A;  5D9F A;  4YQ2 A;  3OII A;  3O7B A;  1Z85 A;  3N4K A;  1K3R A;  4YQT A;  5FAI A;  3AI9 X;  1MXI A;  3ILK A;  5CO4 A;  3GYQ A;  4X3L A;  4YVK A;  3AXZ A;  4YVJ A;  4YVG A;  2EGW A;  3NK6 A;  4YPY A;  3ONP A;  4H3Z A;  4YQN A;  4X3M A;  4YQG A;  4MCC A;  4YQ6 A;  4YQK A;  2I6D A;  4CNF A;  4E8B A;  1NXZ A;  3KY7 A;  3OIJ A;  4XBO A;  4JAL A;  1V2X A;  3BBE A;  4JAK A;  1TO0 A;  2HA8 A;  1J85 A;  1O6D A;  4IG6 A;  1UAL A;  2QMM A;  3KTY A;  4YQ4 A;  4YQL A;  4YQS A;  1UAK A;  1NS5 A;  2EGV A;  3KW2 A;  4YQ0 A;  4FAK A;  4YVI A;  4YQD A;  3KNU A;  4KDZ A;  5GMC A;  2CX8 A;  4RG1 A; 
#chains in the Genus database with same CATH topology
 5GMB A;  4YQ5 A;  4KGN A;  1VHK A;  3BBH A;  3N4J A;  4CND A;  2V3J A;  4CNG A;  1X7O A;  2O3A A;  4YQ8 A;  4YQ1 A;  1UAM A;  2YY8 A;  4YQA A;  1GZ0 A;  1OY5 A;  1X7P A;  2Z0Y A;  3L8U A;  1VHY A;  4MCB A;  4PZK A;  3IEF A;  1ZJR A;  4YQ9 A;  1UAJ A;  3NK7 A;  4YQQ A;  4YQB A;  3OIN A;  4L69 A;  3DCM X;  1P9P A;  4YPX A;  4YPZ A;  4H3Y A;  3QUV A;  2V3K A;  4YQP A;  4YQ7 A;  5GM8 A;  4YQI A;  2QWV A;  4YQC A;  4YQ3 A;  4YVH A;  3BBD A;  3IC6 A;  4YPW A;  4MCD A;  4J3C A;  1V6Z A;  4YQO A;  3E5Y A;  4CNE A;  4YQR A;  3AIA A;  1IPA A;  1VH0 A;  4YQJ A;  5D9F A;  4YQ2 A;  3OII A;  3O7B A;  1Z85 A;  3N4K A;  1K3R A;  4YQT A;  5FAI A;  3AI9 X;  1MXI A;  3ILK A;  5CO4 A;  4FMW A;  3GYQ A;  4X3L A;  4YVK A;  3AXZ A;  4YVJ A;  4YVG A;  2EGW A;  3NK6 A;  4YPY A;  3ONP A;  4H3Z A;  4YQN A;  4X3M A;  4JWH A;  4YQG A;  4MCC A;  4YQ6 A;  4YQK A;  2I6D A;  4CNF A;  4E8B A;  4JWG A;  1NXZ A;  3KY7 A;  3OIJ A;  4XBO A;  4JWJ A;  4JAL A;  1V2X A;  3BBE A;  4JAK A;  1TO0 A;  2HA8 A;  1J85 A;  4JWF A;  1O6D A;  4IG6 A;  1UAL A;  2QMM A;  3KTY A;  4YQ4 A;  4YQL A;  4YQS A;  1UAK A;  1NS5 A;  2EGV A;  3KW2 A;  4YQ0 A;  4FAK A;  4YVI A;  4YQD A;  3KNU A;  4KDZ A;  5GMC A;  2CX8 A;  4RG1 A; 
#chains in the Genus database with same CATH homology
 5GMB A;  4YQ5 A;  4KGN A;  1VHK A;  3BBH A;  3N4J A;  4CND A;  2V3J A;  4CNG A;  1X7O A;  2O3A A;  4YQ8 A;  4YQ1 A;  1UAM A;  2YY8 A;  4YQA A;  1GZ0 A;  1OY5 A;  1X7P A;  2Z0Y A;  3L8U A;  1VHY A;  4MCB A;  4PZK A;  3IEF A;  1ZJR A;  4YQ9 A;  1UAJ A;  3NK7 A;  4YQQ A;  4YQB A;  3OIN A;  4L69 A;  3DCM X;  1P9P A;  4YPX A;  4YPZ A;  4H3Y A;  3QUV A;  2V3K A;  4YQP A;  4YQ7 A;  5GM8 A;  4YQI A;  2QWV A;  4YQC A;  4YQ3 A;  4YVH A;  3BBD A;  3IC6 A;  4YPW A;  4MCD A;  4J3C A;  1V6Z A;  4YQO A;  3E5Y A;  4CNE A;  4YQR A;  3AIA A;  1IPA A;  1VH0 A;  4YQJ A;  5D9F A;  4YQ2 A;  3OII A;  3O7B A;  1Z85 A;  3N4K A;  1K3R A;  4YQT A;  5FAI A;  3AI9 X;  1MXI A;  3ILK A;  5CO4 A;  4FMW A;  3GYQ A;  4X3L A;  4YVK A;  3AXZ A;  4YVJ A;  4YVG A;  2EGW A;  3NK6 A;  4YPY A;  3ONP A;  4H3Z A;  4YQN A;  4X3M A;  4JWH A;  4YQG A;  4MCC A;  4YQ6 A;  4YQK A;  2I6D A;  4CNF A;  4E8B A;  4JWG A;  1NXZ A;  3KY7 A;  3OIJ A;  4XBO A;  4JWJ A;  4JAL A;  1V2X A;  3BBE A;  4JAK A;  1TO0 A;  2HA8 A;  1J85 A;  4JWF A;  1O6D A;  4IG6 A;  1UAL A;  2QMM A;  3KTY A;  4YQ4 A;  4YQL A;  4YQS A;  1UAK A;  1NS5 A;  2EGV A;  3KW2 A;  4YQ0 A;  4FAK A;  4YVI A;  4YQD A;  3KNU A;  4KDZ A;  5GMC A;  2CX8 A;  4RG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...