4JAUA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
232
Chain Sequence
SKELERLKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Histidine kinase
total genus 76
structure length 232
sequence length 241
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jauA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jauA02
2YGAA 3LNUA 4YKQA 2HKJA 1TBWA 3TZ5A 2QF6A 2YECA 4CWOA 2HCHA 3VHAA 4LPBA 2BU8A 1GJVA 2BTZA 1YESA 2CH4A 2YI0A 1I5AA 5FNCA 4O0BA 5D7CA 2C2AA 2XDXA 4E00A 4BIUA 4QPKA 5M4EA 2WI1A 4L8ZA 4KTNA 2WI5A 3ZKBA 3B25A 2XHRA 4LWIA 4XTJA 4XD8A 1YT2A 2AKPA 2WI2A 2O1VA 3ZRXA 3OWBA 1B63A 4CWFA 3G75A 4EM7A 4ASBA 1UY7A 2ZDYA 4HYPA 2QG2A 5IN9A 3B24A 3TZ0A 3K60A 1JOYA 2YE7A 3QDDA 4LWEA 2YE2A 1TH8A 1YETA 3ZKDA 4EGIA 4FCPA 4O09A 5CF0A 4XCLA 1U0ZA 2FXSA 4R3AA 2BZ5A 2ZKJA 2HG1A 3FT5A 1QZRA 2VWCA 4FPPA 5CTWA 3CRKA 3EKRA 2BU5A 2YEDA 1IXMA 3MNRP 1AMWA 2E0AA 1TIDA 2VCJA 1Z59A 4JQLA 5FNFA 4XITA 3TUHA 4BAEA 1Y8OA 2XHXA 1Y4UA 2H55A 4R3MA 3A0RA 2IWSA 3ZXQA 3HZ5A 4BIZA 1NHJA 1YC4A 4CWRA 4YKYA 3H80A 2QM8A 5L3JA 3R4MA 2QFOA 3HHUA 3OWDA 4FCRA 4GT8A 4WUCA 3A0TA 3EHJA 3JZ3A 4YKRA 1TILA 4MPEA 4B7PA 2JKIA 3GIGB 4XIQA 1A4HA 5D7RA 3R92A 5M4NA 2YEJA 4O05A 4L91A 3SL2A 2Q2EB 2YE5A 1JM6A 2YKBA 2WEPA 3HEKA 2P67A 4CWSA 3NXSA 4CWPA 4KSHA 1UYFA 4E02A 3FV5A 3RLPA 1BGQA 1I5DA 2LFSA 4AWPA 1UYLA 1I5BA 4MBCA 4YKXA 1L0OA 1UYCA 1ZXNA 3G7EA 4PL9A 3T0ZA 2XX2A 3DGEA 3LPSA 3PEJA 3R4NA 4HXWA 2Q8FA 1YC3A 1BXDA 5CTXA 4X9LA 4YKWA 1AH8A 4CE1A 3VHCA 3INWA 4MT8A 3ZM7A 4P7AA 4QPJA 2XJJA 2CCTA 3EHGA 1I5CA 1Y8NA 1YC1A 4WUDA 1EA6A 1US7A 3B27A 3ZRWA 2VW5A 4CWQA 3Q5JA 2BRCA 3BMYA 5F5RA 1NHIA 2YEAA 3TTZA 2QM7A 1S14A 2XDUA 4LWFA 1TC0A 4MP2A 2YKIA 1UYMA 1KZNA 1U2OA 3R4OA 1Y4SA 4W7TA 1QY8A 2BU2A 2CCUA 3FT8A 3GIFA 2WI6A 4XC0A 2WI3A 4O07A 3CRLA 3OPDA 2XDSA 3WQ9A 3GIEA 1BYQA 1ZWHA 1S16A 3HZ1A 1YS3A 1UYIA 3O2FA 4BQJA 4K4OA 2PNRA 2IWXA 2UWDA 4GQTA 4Q20A 4L93A 3R4PA 2WERA 4NH7A 2YEHA 4GCZA 5F3KA 4WUBA 2YKJA 4XKAA 1B3QA 2JJCA 4YKTA 2YEEA 1UYHA 2BREA 2EXLA 3INXA 4URMA 4V25A 2YGFA 5GGZA 4EGHA 2WI7A 1EI1A 3A0ZA 2CCSA 4O04A 3TK1A 4CWTA 3TZ4A 1YT1A 4XKOA 5FWKA 4JASA 2ZBKB 3Q5LA 4KP4A 3NMQA 4KFGA 1AJ6A 4R1FA 5B1NA 2XDKA 2VCIA 4GGLA 3EHFA 4AS9A 3HYYA 4DUHA 2QG0A 4HYMA 2BT0A 2XX5A 2O1WA 4AWQA 4MTXA 1UY8A 4U93A 2BU7A 2LFRA 1MU5A 4URNA 2YEIA 3D36A 5D6PA 4P8OA 1UYKA 3U67A 3MD0A 4GT1A 2FYPA 2H8MA 5D7DA 3A0XA 1I59A 4MPNA 3PEHA 4JYBA 2ZDXA 5CPHA 3RLQA 2YEBA 4AWOA 4HZ5A 2YEGA 1QYEA 1Z5CA 3OW6A 1YT0A 3C0EA 4I5SA 2CG9A 2GQPA 3C11A 2YEFA 1AH6A 4V26A 3HYZA 1ID0A 3G7BA 2CGFA 3ZCCA 5M4KA 4ASFA 2Q8GA 3B28A 2K5BA 1KIJA 1UYGA 1THNA 2WI4A 2YKEA 3CGYA 4PU9A 1GKXA 2Q8HA 4PRXA 2YGEA 1Y8PA 4U7OA 1BKNA 1Z5AA 3RLRA 3P32A 4FMTA 3KE6A 3D0BA 2YK2A 5J71A 3IEDA 5D6QA 2FTKA 4JYCA 4H85A 2IORA 2Q8IA 4UROA 4B6CA 5M4HA 3WHAA 3RKZA 2XK2A 2YE4A 4L90A 5BOCA 3EKOA 4GFNA 1MX0A 3D2RA 4EFUA 2XCMA 5CTUA 3U2KA 2YJXA 4HY1A 1Z5BA 4KQVA 3VHDA 4HXZA 1NHHA 3K99A 5M4PA 4XCJA 4XDMA 3O6OA 4I3HA 4XIPA 2GFDA 4MB9A 3ZRWB 2XD6A 4KSGA 2IWUA 4EGKA 4HY6A 5IDJA 4LC1A 3K98A 2YI6A 2BU6A 2WEQA 1B62A 1ZXMA 1UYDA 3TZ2A 3H4LA 1YERA 4NH9A 2XJXA 2YKCA 3OMUA 1YSRA 3BM9A 4H7QA 4XKKA 2BYIA 2YI5A 4MOTA 5CTYA 5B1OA 2YE3A 3GIGA 1UY9A 1UY6A 4NH8A 1GKZA 3T2SA 2XX4A 4CE3A 4ZKIA 3CGZA 1H7UA 1R62A 3R91A 2XJGA 2FWYA 1H7SA 4E01A 4PRVA 4JAUA 4MPCA 4DZYA 1ZW9A 2BYHA 2ESAA 4MP7A 2XDLA 3K97A 2WWWA 3CWVA 4GEEA 3A0WA 3EHHA 5J6AA 4BXIA 4LWGA 4EMVA 3ZRVA 4XE2A 4URLA 4HZ0A 3ZXOA 1AM1A 4BQGA 5C93A 1PVGA 3QTFA 4EFTA 3T10A 2YE9A 4ZVIA 3VADA 1TC6A 4ASGA 2FWZA 4EEHA 2BSMA 4LWHA 1YSZA 4U7NA 2IOPA 2YJWA 3U2DA 4CWNA 2YI7A 3B26A 2O1UA 3Q5KA 5FNDA 2YE6A 3T1KA 1OSFA 2YK9A 5BODA 4JAVA 4LP0A 4L94A 5IDMA 1F51A 4CE2A 3O0IA 4XIRA 5M4MA 2YE8A 4YKZA 1UYEA 4ASAA 2IOQA 2XHTA 4YKUA 3T0HA 3A0YA 4H81A 4FCQA 1I58A 2XABA
chains in the Genus database with same CATH superfamily
1MZEA 2AW9A 1G8MA 5B1AC 4JZ2A 1FXKB 4YHHO 2NR5A 2OYQA 5DM6V 2XDXA 4E00A 1YHQV 3TXQA 4I0XA 4KTNA 2YIBD 4MTOA 1K5QA 1JFFA 4W4KA 1R3IC 2A79B 1P4RA 4XTJA 3RFRA 5EIBC 3H1KH 1YT2A 3K08A 4W4LA 4I4TA 2UXNA 2O1VA 3VQYA 1B63A 1S5LZ 4LFBB 1JMKC 1E79G 1OCCC 3CRCA 1IVSA 3B24A 4HYPA 4N21A 4LWEA 1TH8A 2Y69C 5KLVH 1YETA 2YSUB 3K06A 1I5XA 4O09A 5B5EZ 3QVNA 2FXSA 2NN4A 3QG5A 4R3AA 3OTOB 5FPOA 1N8RW 4G2KA 5AG2A 1QZRA 2HG1A 2VWCA 2C1IA 3OFNG 4U3JB 1MZFA 3CRKA 2YEDA 2F23A 2N74A 3H9VA 3E2EA 2QSAA 4X9QA 4WFGA 2WLMA 1TIDA 5LOVB 1GAXA 2LGWA 4D7TA 2VCJA 2IJHA 3PJSK 2ZDIC 4KHPO 1Z59A 4XITA 3FB6C 1OCCB 3LSUA 3SPIA 2XOKG 4GYCB 2IH3C 2RDCA 4JI8O 2JGUA 3CC4V 2XHXA 1WB8A 1Y74A 1VF6A 2DYSC 1SF9A 2WLLA 5E1AC 5KAIZ 3UT5A 1K8AW 3RYCB 3FAVB 4TWKA 4WUCA 1SQFA 4JTAB 4YKRA 5LA6B 1YJ9V 4ZOLA 1EFRG 1LUWA 2B5UA 4LP8A 3GIGB 3STZC 4GKJB 5D7RA 3SYQA 2YEJA 3CRMA 1OJHA 4O05A 3TXSA 2CGOA 3HEKA 4F6RB 3CRRA 3NXSA 4YJ2B 3UM7A 3WB0A 2ZIOA 1BGQA 4O4JA 2NLJC 1KMIZ 4KFMA 4PA3A 4AWPA 4EB6A 1I5BA 1Y4MA 4MBCA 1HW7A 3U0ZA 1ZXNA 3G7EA 5KHGA 2XX2A 3LPSA 4E72A 4LF4B 4IYHA 2PYLA 4HXWA 1AI7A 3CCSV 2EILC 4X9LA 4YKWA 4MTGA 4QIWF 4YIPA 4CE1A 1F4MA 4MT8A 4JGSA 4JPRA 3D3QA 1WPXA 4QPJA 2Q7GA 3G6BA 1IBMB 5JQGA 3E8FA 4O2AB 3K9AA 1UJWB 4LF6O 1Z5WA 1YF2A 2VW5A 2ZXWC 5LYJB 2YIAA 5LOVA 2KG7A 2UUBB 4AQYB 4JI5B 4YIOA 3H1IH 3TJTA 1IBKO 2YEAA 3G67A 3ZBHA 1WPBA 4MP2A 2W6IG 4W7TA 1QY8A 2BU2A 5L3DA 2CCUA 1VARA 1CP9A 3FT8A 2OIEA 2XAQA 4LFCO 2HLDG 4GX2A 4X1YB 3WQ9A 1BYQA 3LNNA 4KXRA 1KYOF 2C1GA 4JV5O 4BQJA 4DR1O 3OR6C 3N2KA 4LFAB 3E89A 4Q20A 5KHKA 4L93A 4D7SA 1QR9A 5KMGB 2Q68A 3JAMN 1GN3A 4WUBA 1NQTA 2FB5A 5H9CA 2H3OA 3P3NA 3SPHA 2JJCA 1G1XB 3PN1A 5CBGA 2BREA 4URMA 3K59A 1JFFB 4FLVA 2YGFA 3RWRD 5BR8B 2WI7A 1BQ0A 2CCSA 4O04A 4DK0A 2B1IA 3CRAA 4PA4A 3TK1A 5HFMA 1K33A 1W59A 1M56B 1P84F 2VQEB 1K4CC 3TZ4A 1YT1A 2Q73A 5FWKA 1N34O 4YJ3A 1KB9F 3Q5LA 1O9HA 1ZL8B 1S5HC 1TGOA 4WBNA 4AILC 1BS3A 4AS9A 1Q6UA 2A0LA 5KHIA 3ETEA 1NZ6A 2CTRA 4X8AA 3K3WA 3VBBA 2P7TC 2BU7A 1WP8A 4ASUG 4ABMA 4KHPB 4P8OA 2F1MA 1SQPH 1UYKA 2VS0A 4GT1A 5K1XA 3L73H 5LMNB 3A0XA 2ZNIA 1H2SB 4Z1VA 5LXTA 3F5WC 4JYBA 2ZDXA 5CMUA 1P49A 1YT0A 3FB7C 4RO2A 4I5SA 3CRQA 2YEFA 2PGGA 2L6LA 3HYZA 4NXNO 3SPCA 3ZCCA 3JASB 2DYSB 1VQ6V 4MW8A 1Z2GA 3CCLV 5FNVA 3L74H 1THNA 4J9YB 2PI4A 2YKEA 1GKXA 3BVOA 4AHCA 5D5QA 1M1KW 1FFXA 1YVWA 1AR4A 3DTUB 4U7OA 4RQEA 2FL4A 4K0KB 1JQ0A 1WA8B 1FJGO 2Q8IA 1KECA 5M4HA 3WHAA 3OUSA 4XDLA 1MABG 2DYRB 5JH7B 5BOCA 4R7CA 1MX0A 3D2RA 1WA8A 4P2ZA 4EFUA 3JAWB 1XHZA 2DYRC 4DUYO 4HY1A 3RYIA 5JJEB 3R66A 4QGPA 2N05A 5M4PA 4XDMA 4H13B 3JAKA 4I3HA 3ETGA 1W0KG 1HP8A 2Q67A 1NT2B 3HKEA 3JARB 2IWUA 4EGKA 2Z5UA 3AG3B 5EC1C 1Q7YW 3H01A 4TT3G 3ZS8C 3OUFA 1B62A 1HNWB 2XJXA 3BM9A 3T1YB 4CS2A 3OTFA 3ZEDA 4YHHB 2DW4A 2DWDC 2V1DA 3IGAC 2YI5A 2XT9A 1UY9A 1F23A 4UUJC 4PDRA 1S3JA 2HJDA 2QM4A 2EIKC 4JI7B 1AROP 3W7XA 2XHBA 1L0NH 3D36C 2FWYA 1YI2V 4NTYA 4MPCA 2E75B 5J9PC 1YTFD 1H38A 4MP7A 4GKKO 2UXBB 4E4EA 3AG4C 1K73W 1NTKH 3IC7A 4UV9A 5J6AA 2X7RB 4I55A 3N27A 3ABUA 1N32B 3ZRVA 4XE2A 1AM1A 2QE7G 1XNRB 1X59A 2ZD9A 4BAYA 3QTFA 4EFTA 2YE9A 3VADA 1V54C 1FFTB 4O4IA 3L72H 2QKSA 2WLJA 5IJ9A 4X62O 1H2GA 4LWHA 4F6EA 1ENVA 4MVOA 1PM9A 1WN7A 1DK1A 1TUEB 2O1UA 4DRXB 1PPJH 3CSXA 2XTAA 3X2QB 3K0DA 5BODA 3WG7C 5IDMA 2RJZA 2PYJA 2EIKB 4DV5O 2WA3A 2ZE8A 4TQFA 4NR1A 4EFBA 4XIRA 1Y76B 2EJRA 3F5TA 4X64O 2OTJV 4DV2B 1V54B 2E3CA 2IOQA 2JJ2G 4I0XB 3OT7A 1VF5B 3ZJZA 4JI2O 3HKCA 1TVKA 3ABLC 4YKQA 4LF4O 3TZ5A 2H8PC 3S3XA 2YECA 4CWOA 3JD4A 3KCYA 4DYLA 1I94B 1R6NA 2BU8A 2BTZA 2YI0A 4RUEA 4O0BA 2GUZA 2C2AA 4ZHQA 4UCSA 4BIUA 4TUYB 1XNQB 2Q5ZA 1KKCA 4O2AA 1BL8A 4L8ZA 1EN4A 2IJJA 1JCHA 4XD8A 3WG7B 5LP6C 3ZRXA 3K57A 4UB8Z 1VF7A 4ASBA 2AHZA 3TZ0A 2K9PA 1S5JA 3K60A 1JOYA 4X1YA 5H2FZ 4CH6A 1OCZB 3ZKDA 5IJ9B 4JF3A 3B2EE 4FCPA 1D5NA 5B1AB 5CF0A 3CHXA 3QTCA 1DTOA 3CX5F 4FPPA 5LHGA 1AI6A 5L3GA 5CTWA 3CP1A 4HZ3A 1H2MA 2QKCA 4BW9A 3B8MA 5IJ0B 2PF4E 3CD6V 2CK3G 4LF8O 3TUHA 4DR6B 2QDOA 4LF7B 4BAEA 2UUCO 1GRJA 3I55V 3LDDA 4J7JA 2R70A 4UFZA 3ZXQA 4BIZA 2ZKOA 1YC4A 3K5NA 4YKYA 4I7ZB 5L3JA 5A9GA 3JASA 1XREA 2ETNA 4FCRA 4GT8A 3A0TA 5IYZB 3EHJA 3MHHC 2Y4TA 2JVDA 4HYOA 1TILA 4MPEA 4B7PA 4ICGA 3AG1C 2RMKB 1DF5A 4BWAA 4DR5O 5IE9A 1HNWO 1KUQA 3OAAG 4L91A 3SL2A 2ZDIA 2YKBA 5L3EA 1URFA 1SRYA 1H2LA 4CWSA 2F4VB 4CWPA 4YY3B 1UYFA 3FV5A 5KX5A 4GKKB 4Z2WA 2UXBO 3RLPA 5KHJA 2YICA 1ZLZA 1SERA 5LBQA 3K0GA 4YKXA 1UYCA 1R73A 5D5PA 1NR7A 1WNSA 1TA8A 4UCUA 5LHHA 1XNRO 3R4NA 5JJNB 2Q8FA 5IYCO 5CTXA 3AG4B 4YXWG 4NTXA 4JI6O 3INWA 4KUMA 4GX0A 1SQGA 3ZM7A 5KUKA 2XJJA 1N32O 2Q6AA 3WFVA 4WFAV 4CH3A 4X1KA 1I5CA 4WUDA 4CWQA 5FNVB 3JCUZ 3G4SV 1AJNA 2BRCA 1NHIA 2HR3A 1KD1W 1VQ5V 1NKDA 1NI8A 4IIJA 1UYMA 1S0VA 1XI1A 1Y76A 2P6JA 3ML0A 2ZR3A 1J5EB 2WI6A 4XC0A 2WI3A 5LGUA 5KMGA 3CRLA 4B7KA 1SA0B 2JS3A 2E5LB 2W0XA 3GIEA 1KBHA 2ZNJA 3H1HH 4DR3O 4DV5B 3FB5C 3RN4A 3UQ8A 1UYIA 5JJJB 2HFEC 1I0HA 4OX9O 4WFFA 4FK5C 5JENA 2PI5A 2PNRA 2EZOA 3DC6A 3ZMSA 1AI5A 2UXDB 1MSWD 3R4PA 1PP9H 4CC6A 3N2GB 4G28B 4K0KO 4LH6A 2GUZB 4ZHQB 3VOUA 2FYUH 1EZJA 3ZHUA 3VQXA 2ADPA 2OCHA 2YI8A 5ITZA 1M9NA 1KP3A 2YEEA 1VMGA 1SS3A 4PDVA 1QLEB 1SESA 4V25A 1MMMA 1XUQA 4JYYA 1V55B 2Q69A 5KHHA 1V9PA 2RCVA 4XKOA 3K5MA 4JASA 3UCSC 2ZBKB 1OCOB 3U10A 2ZE6A 5B1NA 4ZIBA 4L87A 3MAQA 2XDKA 1D5AA 1M90W 4FLTA 1EN6A 4LFAO 2VCIA 1TUBA 2XNDG 2BE3A 1US6A 2GV9A 4UVAA 3O9OA 1LUVA 1SZTA 4UVBA 1SQQH 2RNBA 5LA6A 2BT0A 2QA4V 1QLEC 2XX5A 1XMQO 4DUYB 1UY8A 2KSDA 4U93A 4URNA 2EIMB 2GHYA 1WAZA 3LNMB 5IWAB 2FYPA 3A0HZ 4CBCA 5EK0A 4IGGA 3JAWA 1I59A 3GWOA 5CPHA 3RLQA 4TOIA 1YIJV 4HZ5A 4LWSA 2YEGA 2MK3A 1PNLA 3RBZA 1I7FA 2XAFA 2ZINA 3C0EA 4PA7A 2CG9A 3C11A 4LF5O 4DV0B 4UCVA 4V26A 4DR6O 1NTMH 2ZE5A 3FB8C 3SPGA 4EFEA 1I5YA 5M4KA 1GK9A 5IYBO 2Y0IA 2Q8GA 4LWSB 3SYOA 3Q4HA 2WI4A 1NTZH 4PRXA 2YXYA 3M7MX 2N04A 3SJBC 1Y8PA 3MHSC 4I50A 4J7ZA 1Z5AA 3P32A 1Y74B 1UPGA 4X1KB 4MVQA 5J71A 2YK2A 3IEDA 1RSOA 4FVMA 4JYCA 2IORA 4LCUC 4RWUA 1XILA 3RKZA 2XK2A 1YEWA 4TV9B 3ABTA 4DV2O 1M57B 4GFNA 4IIJB 4YY3O 5C8YA 3AK2A 4RUFA 5GTIZ 1IZ3A 3L70H 5CA1A 5JWPA 4UB6Z 4HBNA 5B66Z 2HKOA 2KQXA 3M99B 2YJXA 4JI2B 2EINB 4CZZA 3CCVV 4K35A 1S72V 1YTFB 4MVRA 4KQVA 3IFXA 3CS5A 2Y4UA 3N2KB 1JJOA 3AEIA 4EB6B 4O2BB 3KCXA 3JCZA 2XD6A 5EYPB 2IW5A 5IDJA 3ZRSA 4O4IB 3SYPA 3FYEB 5L3BA 1UYDA 3TZ2A 1YERA 4NH9A 4LNUA 2CTPA 3OMUA 1GM8A 2ARHA 1YSRA 2CTQA 2EZPA 5BXZA 3CC2V 2ZIMA 3E83A 1F4NA 1I94O 2BYIA 1K92A 4DV3B 5B1OA 1UY6A 1OV9A 1GKZA 1OCRB 1O9GA 5LMUB 2IU0A 2ZXWB 5CBHA 5FL7G 3OM3B 3R91A 3BABA 1K9MW 3BA8A 1H7SA 4PRVA 1MNGA 1EM1A 3CCEV 1ZW9A 4B3MB 1GMGA 4RAIA 2XDLA 4JTCB 1FXVA 2JGDB 3J80N 4DR2O 2EILB 3EFFK 4BXIA 3L75H 2Z0AA 1AVMA 4NVPA 3FX7A 4O4HA 4HZ0A 5CB4B 4BQGA 3RGBA 3GWKC 2UXCB 3T10A 1JJ2U 5C8YB 1FKAO 2QWRB 4UCRA 1AP6A 2PTMA 4ASGA 4X65B 2ADQB 3ZHSA 5L3CA 2IOPA 3JD0A 3I56V 2ZCEA 2DN9A 4BR6A 3LUTB 1QVGU 2MW2B 5FNDA 4NXMB 2YXHA 2OCCC 5BZBA 4K8ZA 2YUAA 5KUMA 3AK1A 2UUCB 3K5OA 1KC8W 1VIBA 4CE2A 2YE8A 4JI1B 4YKZA 3B77A 4FJCC 1UYEA 2V7QG 3KG2A 2XHTA 2LQTA 2CGNA 1CEZA 4I9QA 4H81A 4I50B 1I58A 2LO1A 4PDLA 3FYIB 2YGAA 3HKEB 1IDSA 3WB2A 2HKJA 4J9ZB 2PY5A 2F66C 2HVKC 3HB3B 4F6RA 2QWNB 4JI0O 1QU7A 1GM7A 3S5TA 3CJHA 4LPBA 1GJVA 1NR1A 1YESA 5CA3A 5IY5B 3EXAA 5D7CA 1GO3F 4QPKA 2F95B 2JDIG 3CMAV 3G6EV 3KKYA 2F93B 2WI1A 1A32A 5FLXN 2PZSA 1FYJA 2JJ1G 4DR5B 2Y69B 3ZKBA 3B25A 4LWIA 1Q6HA 4JTDB 2HP8A 1Q3EA 2WI2A 1AI4A 2OCCB 1Y6XA 1IX9A 2F4VO 2BSKB 3JARA 4DR4B 1RSOB 1W2BU 4CC5A 4R8CA 3G75A 4EM7A 4LF9B 1NJIW 5IN9A 2QG2A 1PNKA 3T4ZA 4DV6O 5B3SC 2JRIA 2EX3A 2YE2A 4TV9A 2EJ7A 2KKWA 2UUAO 2EULA 1G6UA 4XCLA 1U0ZA 1LNQA 5K1PA 5KX5B 2BZ5A 2ZKJA 5B1BC 1Q8IA 3I5DA 3FT5A 1QQCA 4J41A 2BU5A 3RYHB 2QEXV 3W7WA 3MNRP 2E0AA 2WPDG 3T2MA 2DOSA 1K97A 1DLBA 2Y0PA 3S3WA 2P90A 1M5IA 4ZBMA 3QO7A 1RP3B 3HKBA 1L0LH 1SQBH 4QJFB 4OXSA 3ABKC 3H1LH 2H55A 4R3MA 1W0JG 2BTQA 5EBLC 1L1FA 4IHJA 1NHJA 1PKXA 1SQVH 4TV8B 4OX9B 3HZ5A 4CWRA 1Y66A 3J81N 3IC9A 4I55B 4MVSA 3RW0A 3H80A 4EKWA 4LNUB 3R4MA 2B1GA 3HPLC 3HHUA 4J7KA 3QNEA 4O4HB 4XIQA 1A4HA 2UXXA 4A5UB 1WP7A 4JI3B 2NNUA 2YE5A 4O2BA 1QCEA 1AR1B 4KSHA 2CUGA 4E02A 1JR9A 3LDEA 3P30A 3H1JH 2R72A 4CH5A 1HNZO 3IJ4A 2UU9B 2BSKA 4B3RB 1PV0A 3T0ZA 1L0OA 4PL9A 4I9WA 3HKDB 5JVDB 1Q81W 3DGEA 2AHYA 2GDSA 2QR4A 1R1BA 1GN6A 1FXHA 3A2FA 5CA0A 1YXBA 4B08A 1YC3A 1B06A 1BXDA 2YC0A 4DV1O 2WLIA 5F2VO 4DR2B 4X65O 3VHCA 1HDJA 1Q5OA 4P7AA 3ZN1A 1NH2B 5DECA 3HKDA 2YEVA 4NB5A 4X1IA 1XMQB 2CCTA 3EHGA 4N23A 3SJQC 1JA8A 3B40A 4LFCB 2WLLB 4H0LB 2CH7B 2XAGA 1US7A 3B27A 1JPXA 5HFLA 2WLIB 1XMOO 1VQ9V 1QBZA 4FLYA 5F5RA 1BGYH 1FJGB 3CJHB 3P3PA 5LGTA 3TTZA 1VQOV 2AXTZ 2QM7A 1S14A 4OPHA 2Y48A 2YKIA 1M93A 2CTWA 5LP6B 4GZRB 1N0JA 1Y4SA 1RPRA 2ILMA 2X6CA 3JALB 3GIFA 2CH7A 3OW2U 4LF6B 4UXNA 4JI4B 4MTFA 3QF7A 5E79Z 2OT5A 3SJCC 2DE0X 1OCZC 4JI5O 3HZ1A 1YS3A 1VQ4V 2W6JG 1FPOA 2ZM6B 1BT8A 4LFBO 1S77D 2CDYA 2PUSA 4GQTA 4CH4A 2WERA 3AG3C 4NH7A 1N0NA 4DK1A 4GCZA 4DR7O 4X66O 5DN6G 1CXZB 1Q6IA 2YKJA 4I4TB 1B3QA 1K3EA 4YKTA 2JIZG 2QWOB 2EXLA 1XHXA 2P22C 3BRCA 1QR8A 1WB7A 3E35A 2IJKA 1J5EO 5GONB 3OD4A 4DR4O 4CWTA 4JI8B 1QLNA 4ZI7B 3AG7A 1YITV 1ORQC 1KKDA 1GM9A 3ASOC 3C90A 1QVFU 2UUAB 4R1FA 2WLNA 1YCIA 2YEVB 1ZSPA 4QNHB 1H8HG 2UXDO 4B3SO 4GGLA 2G38A 3T1HB 2ODMA 1N33B 3OEEG 2YI9A 2Q7EA 4HYMA 3N2GA 1DGSA 2O1WA 4BW5A 2EIJB 4IL6Z 2A9HA 3RYFB 1PD3A 3UO2A 2LFRA 5J2UB 4FLUA 1VEWA 3ZHTA 1AJPA 2GSMB 3MD0A 2XAJA 5D7DA 1WJZA 3K79A 1V55C 4MPNA 3HKBB 3SPJA 2QWPB 2AZ2A 1Z5CA 5CB4A 5LMUO 3OW6A 2Q0OC 4C7UA 3F7YC 1Q86W 2VRZA 2P5OA 4TV8A 3THOA 1E1QG 4O4LB 1HNXB 3G7BA 2CGFA 1PNMA 1J95A 5LMNO 4B3MO 4MS2A 2BOBC 1SA0A 1ZWIC 1BHAA 4PU9A 1UYGA 1HWYA 2QTOA 3CGYA 2Q8HA 1KU9A 1GN2A 3ZMZA 2YGEA 1BHBA 3D8CA 1YZBA 1BKNA 2R9AA 4NXMO 4GUNA 3L9DA 3KE6A 4XDJA 5D6QA 2FTKA 2M6YA 2UXCO 1K34A 1SZXA 4B6CA 4PA9A 1AJQA 4X20A 4L8JA 2YE4A 4L90A 1ROPA 2IM9A 1UFIA 3K58A 3RVZA 1GH6A 4DV0O 5KA5A 3ASNC 2XCMA 4JYAB 1XNQO 3U2KA 2ZE7A 2RQ6A 4H33A 4AI8A 3TETA 4P9OA 3BFRA 4FFKA 1Z5BA 3ICXA 3VHDA 4HXZA 1ZL8A 1NHHA 4XCJA 1M4UA 2VQFB 1NS1A 2QGNA 2BCCH 4XIPA 2GFDA 3VQWA 3OR7C 2IU3A 1OCOC 3ETDA 4UCTA 1K5SA 4KSGA 4IHJB 4HY6A 3EVKA 3ZHQA 1TUBB 2HHHO 3K98A 5IYDO 2WEQA 2JK5C 4JI7O 1NBMG 3J7AU 3W7SA 5LL6Y 3H4LA 1R3KC 4LH7A 1Q82W 3E22B 3NR7A 4X89A 3QO5A 4JI4O 3W7TA 2Q4PA 4XKKA 4JI0B 1FFXB 5H5NA 5BR8O 1IBLB 4WCEV 5EZYB 2YIBA 4XBFA 3CCMV 5CA1B 4CE3A 2XX4A 4LF9O 4ZKIA 2VQEO 4PV1B 1BCCH 3CGZA 3SR2C 1H7UA 3SYAA 1EZVH 1R62A 2EBOA 2ATKC 2XJGA 1TAEA 1FD9A 3SDLA 3DXRA 5BMVA 4LF8B 4JAUA 1QHTA 2YIDA 3SGIA 3RYHA 5CBFA 2ESAA 2OIGA 3VQVA 1P7GA 3CWVA 3K97A 2EIMC 3A0WA 1CPYA 3EHHA 3K5LA 5H6RA 4P30A 1P7BA 3ZX6A 2FKXA 5H6QA 5JCOA 3RYIB 3KZIZ 3C3TA 2JS5A 1XDCA 3DXRB 5BMVB 4URLA 3ZXOA 3JSNA 1MA1A 3STLC 1PVGA 2LW7A 5GONA 4X1IB 4DV3O 1MG1A 2FWZA 3ASOB 1H8EG 2Q7HA 1SQXH 4FM0A 1YSZA 4U7NA 2QJ1A 1M56C 4CWNA 2WAMA 1XEQA 4GX1A 2X6BA 1D2DA 3Q5KA 1HR0O 3T1KA 3ABMC 3A0BZ 3JD1A 3QO8A 3UKMA 3CXCU 1YJWV 5M4MA 4X62B 5LGNA 3ZN0A 3R65A 1R3LC 4B3TO 4K3AA 4LR3A 3JAKB 3OEHG 4ASAA 2ZT9B 4J10A 3T1HO 1N33O 1H2KA 1JX9A 2WSSG 3BPZA 1Z5VA 3E86A 2EIJC 2XABA 5J2TA 3K03A 3LNUA 3WU2Z 5CA0B 1R6TA 4UVCA 4YJ2A 1TBWA 2QF6A 5EIBD 1ZX3A 2HCHA 3VHAA 3OTOO 1U96A 4DV7B 4D6TH 2WA4A 1NVPD 2D2CB 1I5AA 2CH4A 5FNCA 2FMLA 3LSQA 1SKVA 1VP7A 2DQ0A 5M4EA 2UU9O 4WFHA 4B3RO 1R6KA 4PJ0Z 2WI5A 4Q6GA 2XHRA 3ABLB 2GTSA 4GX5A 1OCRC 2AKPA 1XMOB 2R9IA 5L3FA 3OWBA 4CWFA 4E2LA 4MVUA 1UY7A 2ZDYA 1Q43A 3M8AA 3JSLA 3OMNB 2YE7A 3QDDA 3A8TA 3HR0A 5LYJA 4O4LA 2IBZH 4EGIA 3BEHA 2LGQA 1VQKV 3AG2C 2VWJA 4HAMA 4OGQB 1NH2D 3BY6A 3EKRA 3B09A 3BCCH 1IXMA 2KB1A 1OHHG 3U11A 4HNAB 1AMWA 4WF9V 1TVKB 4BIOA 2ITCC 5GW7A 4JQLA 4JYAO 5FNFA 4R6ZA 2IJIA 2ITDC 4DRXA 5BY1A 1Y8OA 4DW0A 1M57C 1Y4UA 2BTOA 1S76D 2WLHA 3A0RA 4TUYA 4NTWA 2L35A 2IWSA 2QWQB 3GB7C 2ZM6O 2WLKA 2LJ2A 2QM8A 2QFOA 3OWDA 1IBLO 1QNMA 2DQ3A 3JZ3A 1AP5A 3ETQA 2W0FC 3UO3A 2QTSA 4DR7B 4MSWC 4X66B 2JKIA 1IURA 5TISZ 3R92A 5M4NA 4PDMA 1N36O 5IY5C 1FAFA 2Q2EB 2DWEC 2F43G 1JM6A 3AG2B 2WEPA 2P67A 4MW3A 5IWAO 2E74B 4FFBA 1LR1A 2QKAA 2UUBO 3FKSG 4FZ0A 3CCRV 2YDEA 2ZR2A 4JI6B 4K8XA 3JATB 1VQ7V 1I5DA 3SJAC 1IXBA 2LFSA 1VQ8V 4TQDA 4FZ1A 1UYLA 3CYGA 2A7WA 2O57A 4JZGA 3OGIB 3E22A 1B04A 1YJNV 2BOCC 3CMEV 2EINC 3PEJA 4X64B 1XL4A 5IJ0A 1AH8A 4FM1A 3L71H 2HG5C 5DEDA 1GKFA 4H37A 2HHIA 2P4KA 4F4LA 1E1RG 3CC7V 5B1BB 4XDKA 5J2TB 3UT5B 4JI3O 1RM1B 1KQSU 1Y8NA 1JVMA 1YC1A 5KAFZ 4HNAA 1KP2A 1HR0B 1EA6A 3ZRWA 4FM2A 4DO2A 4DUZO 3Q5JA 4B3SB 2V4DA 3BMYA 3OGCC 1DF4A 3G71V 2XDUA 4LWFA 1TC0A 1VF6C 3CEIA 4QE7A 3CCUV 1KZNA 1U2OA 3R4OA 2IH1C 3CWBH 3E8HA 2GTAA 1FS0G 2Z3YA 2Q8VA 4O07A 2JEUA 1XOUA 3OPDA 1Y67A 2XDSA 4DV1B 1ZWHA 3TGUH 1S16A 4DXWA 2OWOA 3O2FA 5EBWC 1PL0A 4PI2A 4K4OA 2HVJC 2GBOA 3JD2A 4Z1MG 3C3SA 5J2UA 2IWXA 3ABKB 2UWDA 4DV4O 4PI0A 4R50A 4FLXA 2H94A 1B6QA 4B7EA 2P06A 2YEHA 3EHBB 5F3KA 1HNXO 4ZI7A 4DR3B 4FIPC 4WFBV 4XKAA 2X6AA 3JATA 2OTLV 1EBOA 1UYHA 2VQFO 3INXA 4FLZA 4OPAA 5GGZA 4EGHA 4U3FH 1EI1A 3A0ZA 4J11A 3K9SA 3ZMTA 2KG7B 1GTOA 2HHHB 4LF7O 1K7DA 1F7YA 3O65A 4KFGA 4KP4A 3NMQA 1AJ6A 3FFQA 1H2NA 5JVDA 3HKCB 2ZQMA 2LW1A 1SC5B 2LP7A 5IT9N 3EHFA 3HYYA 4DUHA 5EYPA 3WB1A 2QG0A 3ZMVA 3ZHVA 4UCOA 3APOA 4RQFA 1BE3H 4AWQA 4MTXA 1IBMO 5KA6A 3MDSA 3RT3C 2XUMA 4IYIA 3E8GA 1MU5A 4NYKA 2YEIA 3D36A 5D6PA 3U67A 3T4DA 1ZUQA 2H8MA 1IBKB 5A2QN 3PEHA 4PHZA 2YEBA 4AWOA 2K1EA 4H44B 1QYEA 3AG1B 2Q0AA 1EN5A 1Q90D 2GQPA 1AH6A 4NKGB 3T1CA 1ID0A 3APQA 2YS8A 5JQGB 1K4DC 1PL4A 2JGDA 2VWKA 3FAVA 4ASFA 3B28A 5CN0A 4JV5B 1RPOA 2K5BA 4JAAA 1YDXA 4PA6A 4JI1O 1KIJA 2HJFC 1COWG 3LDCA 3G80A 2D3OW 4LF5B 3RLRA 3CE2A 3OMAB 4FMTA 3D0BA 1VQNV 5EBMC 4H85A 4UROA 2R9RB 3B8NA 2A3QA 4DR1B 4B3TB 3GVMA 3ZHRA 1MSDA 3EKOA 5EC2C 1L8DA 1VQPV 4CS3A 2XAHA 5LHIA 4U3JA 3LSSA 1ZAUA 5CTUA 3CXHF 3CCJV 2E5LO 3E8BA 5LXTB 4PELA 3SYCA 2RN9A 1MOFA 1VQMV 4ZOLB 2HEPA 3B4SA 1RM1C 2JEXA 2XASA 1BSMA 3K99A 2M7WA 3O6OA 1OZ0A 1YSCA 4X88A 3FD9A 4KL1A 2B9ZA 4MB9A 1WLEA 3CCQV 1ZTEA 4LBEC 3ZRWB 4MVZA 4LC1A 3K04A 3ZIAG 4O4JB 2YI6A 5B3SB 3DC5A 4UV8A 2BU6A 3ABMB 4DV6B 4CS4A 1ZXMA 4QE9A 3RYCA 3TCUA 2YKCA 1N34B 3RYFA 4H7QA 1R3JC 4X20B 4DUZB 1I08A 2BTQB 4MOTA 1N4CA 2P4VA 5CTYA 2YE3A 3GIGA 5GTHZ 4WBNB 3RVYA 4NH8A 3T2SA 4DW1A 1XBLA 3F7VC 4FFBB 4IT5A 4GKJO 3LMMA 1U97A 1BQZA 2X0LA 4DV4B 5JH7A 3W7UA 2AGAA 1GN4A 3DSQA 3JYCA 3X2QC 4E01A 1G4YB 1SETA 3CPWU 4DZYA 3OE7G 4J80A 4FLWA 4WFEA 2BYHA 5LP6A 4DV7O 3BHPA 2WWWA 4GEEA 4PD4F 3Q4HB 3CB2A 3OMIB 1XL6A 4LWGA 4MVMA 4G27B 3ZMUA 4EMVA 3BAAA 4P9PA 2AZ0A 2YXLA 4EEQA 1T5EA 5C93A 3D3IA 4NXNB 5JCOC 4ZVIA 2DMXA 1TC6A 1NVPB 5EZYA 4EEHA 1AILA 1NU1H 1THZA 3ASNB 2BSMA 1BZKA 3CYOA 2YJWA 3U2DA 2E76B 1VQLV 5FPRA 2YI7A 2Q9LA 3B26A 4YJ3B 1HNZB 2YE6A 1OSFA 2YK9A 3BA9A 4JAVA 4LP0A 4L94A 4AQYO 1RFYA 1FXKC 1F51A 1XQ8A 2CAZC 1N36B 3IAYA 3O0IA 1BMFG 2DJVA 3T1YO 5IYZA 3AK3A 2CE4A 1FXKA 3JD3A 1AB3A 4YKUA 1X4TA 2A06H 5ITZB 4TSFG 3T0HA 3A0YA 1AR5A 4FCQA 4J42A 4GLXA 3JALA
chains in the Genus database with same CATH topology
3FYIB 2YGAA 3K03A 3LNUA 3ABLC 4YKQA 4UVCA 2HKJA 4J9ZB 1G8MA 2HVKC 3HB3B 5B1AC 1TBWA 2H8PC 3TZ5A 2QF6A 2YECA 4CWOA 3JD4A 1FXKB 2HCHA 1GM7A 3VHAA 4LPBA 1R6NA 2BU8A 1GJVA 2BTZA 1NR1A 5DM6V 1YESA 1NVPD 5CA3A 5IY5B 1I5AA 2CH4A 2YI0A 4RUEA 5FNCA 4O0BA 5D7CA 2C2AA 2XDXA 4E00A 1GO3F 1YHQV 3LSQA 4BIUA 4QPKA 2JDIG 3CMAV 3G6EV 2DQ0A 5M4EA 1BL8A 2WI1A 4WFHA 4L8ZA 1R6KA 2JJ1G 2Y69B 2WI5A 4KTNA 3ZKBA 3B25A 4MTOA 2XHRA 4LWIA 1K5QA 2IJJA 4JTDB 3ABLB 1R3IC 1JCHA 1P4RA 2A79B 4GX5A 4XTJA 1OCRC 4XD8A 1YT2A 3K08A 2AKPA 2WI2A 1AI4A 2OCCB 3WG7B 2R9IA 2UXNA 2O1VA 3ZRXA 5L3FA 3OWBA 1B63A 4CWFA 1W2BU 4R8CA 4E2LA 3G75A 4MVUA 4EM7A 4ASBA 1NJIW 1UY7A 2ZDYA 1E79G 1OCCC 2AHZA 1PNKA 2QG2A 3B24A 3T4ZA 4HYPA 3K60A 3TZ0A 3OMNB 5B3SC 1JOYA 2YE7A 4N21A 3QDDA 4LWEA 2YE2A 1TH8A 2Y69C 1OCZB 1YETA 2YSUB 3ZKDA 4JF3A 3K06A 4EGIA 1I5XA 5B1AB 4FCPA 4O09A 5CF0A 3BEHA 1VQKV 1U0ZA 1LNQA 3AG2C 2FXSA 4XCLA 4R3AA 2BZ5A 1DTOA 5B1BC 2ZKJA 1N8RW 4G2KA 1QZRA 2HG1A 4HAMA 4FPPA 5LHGA 1AI6A 3OFNG 5L3GA 3FT5A 5CTWA 3CP1A 4HZ3A 3CRKA 1NH2D 3BY6A 2BU5A 2YEDA 3EKRA 2QEXV 1IXMA 2KB1A 1OHHG 3E2EA 3W7WA 3MNRP 4WFGA 1AMWA 2E0AA 2WPDG 2WLMA 4WF9V 1TIDA 3B8MA 3T2MA 3CD6V 1K97A 1DLBA 2VCJA 4W7TA 2IJHA 3PJSK 2ZDIC 2ITCC 5GW7A 2P90A 1Z59A 2CK3G 4JQLA 5FNFA 4R6ZA 3FB6C 2IJIA 1OCCB 2ITDC 2CCUA 3SPIA 4ZBMA 4XITA 2XOKG 3QO7A 3TUHA 4BAEA 2IH3C 1Y8OA 3CC4V 4QJFB 1M57C 4OXSA 3I55V 3ABKC 2XHXA 1Y4UA 2H55A 3LDDA 1S76D 2WLHA 4R3MA 3A0RA 1W0JG 2DYSC 5EBLC 1L1FA 2IWSA 3ZXQA 4BIZA 1NHJA 1PKXA 3HZ5A 3GB7C 2WLLA 1YC4A 1Y66A 2WLKA 5E1AC 4CWRA 4YKYA 4MVSA 3RW0A 3H80A 4EKWA 2QM8A 1K8AW 5L3JA 3R4MA 2B1GA 2QFOA 4TWKA 3HPLC 3HHUA 3OWDA 4FCRA 4GT8A 4WUCA 3A0TA 3QNEA 3MHHC 4JTAB 3EHJA 2DQ3A 4HYOA 2XABA 3JZ3A 4YKRA 2W0FC 1TILA 4MPEA 4B7PA 1YJ9V 3AG1C 1EFRG 2B5UA 4LP8A 4MSWC 1DF5A 2JKIA 3GIGB 4XIQA 3STZC 1A4HA 5D7RA 3R92A 5M4NA 4PDMA 2UXXA 3SYQA 5IY5C 2YEJA 3OAAG 4L91A 4O05A 2NNUA 2DWEC 2Q2EB 2F43G 3SL2A 2YE5A 2ZDIA 1JM6A 3AG2B 2WEPA 2YKBA 3HEKA 2P67A 1SRYA 4MW3A 5L3EA 4CWSA 1QCEA 3NXSA 1AR1B 4CWPA 4KSHA 1UYFA 4E02A 3FKSG 3FV5A 3CCRV 3LDEA 3UM7A 2ZR2A 3RLPA 3P30A 1BGQA 2NLJC 1VQ7V 1I5DA 2LFSA 1VQ8V 4KFMA 4PA3A 4AWPA 1UYLA 1I5BA 1Y4MA 4MBCA 1SERA 5LBQA 3K0GA 4YKXA 1L0OA 1UYCA 1ZXNA 4I9WA 3G7EA 1R73A 1Q81W 4PL9A 2XX2A 3DGEA 3LPSA 2AHYA 1YJNV 1NR7A 2BOCC 3CMEV 2EINC 5LHHA 1FXHA 3PEJA 1XL4A 3R4NA 4HXWA 5IYCO 2Q8FA 1YC3A 1AI7A 3CCSV 1BXDA 2EILC 5CTXA 4X9LA 4YKWA 3AG4B 4MTGA 4QIWF 1AH8A 4YXWG 2WLIA 4CE1A 2HG5C 3VHCA 1F4MA 3INWA 4KUMA 4GX0A 1GKFA 4H37A 4JGSA 4JPRA 4MT8A 3ZM7A 5KUKA 4P7AA 3ZN1A 1NH2B 1WPXA 4QPJA 2YEVA 4F4LA 1E1RG 2XJJA 3CC7V 5B1BB 2CCTA 2Q6AA 3WFVA 4WFAV 4XDKA 4N23A 3SJQC 3E8FA 3EHGA 1RM1B 1I5CA 1KQSU 1Y8NA 1JVMA 3K9AA 1UJWB 1YC1A 2WLLB 4WUDA 1EA6A 1KP2A 2XAGA 3ZRWA 1US7A 1JPXA 2ZXWC 2WLIB 5HFLA 4DO2A 2VW5A 3B27A 3Q5JA 1VQ9V 3G4SV 1QBZA 1AJNA 2BRCA 3BMYA 3OGCC 5F5RA 1NHIA 2YEAA 5LGTA 1DF4A 2HR3A 3G71V 1VQOV 2QM7A 1KD1W 1VQ5V 1S14A 2XDUA 3TTZA 4LWFA 2Y48A 1TC0A 1NKDA 4MP2A 4QE7A 3CCUV 1UYMA 2YKIA 2W6IG 1S0VA 1KZNA 1U2OA 2IH1C 1Y4SA 3E8HA 1QY8A 1FS0G 2Z3YA 5L3DA 1RPRA 1CP9A 2P6JA 2X6CA 2ZR3A 3ML0A 2BU2A 3FT8A 3GIFA 2WI6A 3OW2U 2WI3A 4XC0A 2XAQA 5LGUA 4O07A 3CRLA 4UXNA 2HLDG 2JEUA 4GX2A 4MTFA 3OPDA 2XDSA 3WQ9A 4CWQA 3GIEA 1BYQA 1ZWHA 2OT5A 1S16A 1OCZC 4DXWA 3FB5C 3HZ1A 1YS3A 1UYIA 1VQ4V 2W6JG 2HFEC 3O2FA 4BQJA 4WFFA 5EBWC 1PL0A 4FK5C 4K4OA 1S77D 2HVJC 3JD2A 2PI5A 2PNRA 4Z1MG 2IWXA 2EZOA 3OR6C 3ZMSA 3ABKB 2UWDA 1AI5A 4GQTA 3E89A 4Q20A 4R50A 1MSWD 4L93A 3R4PA 2H94A 1B6QA 2WERA 3AG3C 4NH7A 1QR9A 2YEHA 4G28B 4GCZA 2Q68A 3EHBB 5F3KA 5DN6G 4WUBA 1NQTA 3VOUA 4FIPC 2YKJA 5H9CA 1EZJA 4WFBV 3SPHA 4XKAA 1B3QA 1K3EA 2JJCA 2X6AA 2OTLV 4YKTA 1M9NA 1KP3A 2JIZG 2YEEA 1EBOA 5CBGA 1UYHA 2BREA 2EXLA 1QR8A 3INXA 4PDVA 4URMA 1QLEB 1SESA 3E35A 2IJKA 4V25A 2YGFA 5GGZA 4EGHA 2WI7A 1EI1A 3A0ZA 2CCSA 1V55B 4O04A 3ZMTA 1GTOA 2B1IA 2Q69A 4PA4A 3TK1A 5HFMA 1K33A 4CWTA 3R4OA 1M56B 1QLNA 1K4CC 3TZ4A 1K7DA 1YT1A 4XKOA 5FWKA 4JASA 1YITV 1ORQC 2ZBKB 1OCOB 1KKDA 1GM9A 3ASOC 3Q5LA 4KP4A 1QVFU 3NMQA 1AJ6A 4KFGA 1S5HC 4R1FA 2WLNA 5B1NA 2YEVB 2XDKA 4L87A 4QNHB 1H8HG 2ZQMA 1M90W 2VCIA 4GGLA 2XNDG 3EHFA 2LP7A 3HYYA 4AS9A 4DUHA 4UVAA 2QG0A 1SZTA 4UVBA 2A0LA 3ZMVA 3OEEG 4HYMA 2BT0A 2QA4V 1QLEC 2XX5A 4RQFA 3ETEA 2O1WA 4AWQA 4MTXA 2EIJB 4X8AA 2A9HA 4BW5A 1PD3A 3K3WA 1UY8A 5KA6A 3VBBA 4U93A 2P7TC 2BU7A 4ASUG 3E8GA 2LFRA 1MU5A 4URNA 2YEIA 2EIMB 3D36A 2GHYA 5D6PA 1AJPA 4P8OA 3LNMB 1UYKA 3T4DA 3U67A 2GSMB 3MD0A 4GT1A 2FYPA 4CBCA 2H8MA 2XAJA 5D7DA 3A0XA 5EK0A 1I59A 3K79A 1V55C 3GWOA 4MPNA 3PEHA 3F5WC 4JYBA 2ZDXA 3SPJA 5CMUA 2YEBA 1YIJV 2K1EA 4HZ5A 5CPHA 3RLQA 4AWOA 2YEGA 1QYEA 1Z5CA 3AG1B 2MK3A 1PNLA 3RBZA 1YT0A 3OW6A 3FB7C 2XAFA 3F7YC 4RO2A 1Q86W 4I5SA 4PA7A 2CG9A 2GQPA 3C0EA 3C11A 2YEFA 1AH6A 4DZYA 4V26A 3T1CA 3HYZA 1ID0A 1E1QG 3G7BA 3FB8C 1K4DC 3SPCA 3SPGA 2CGFA 1I5YA 1J95A 1PNMA 3ZCCA 5M4KA 1GK9A 2DYSB 2BOBC 4MS2A 4MW8A 3SYOA 5IYBO 1VQ6V 3B28A 2Q8GA 4ASFA 1ZWIC 5CN0A 1RPOA 3CCLV 2K5BA 1BHAA 1KIJA 1UYGA 4PA6A 1HWYA 2QTOA 4J9YB 2PI4A 1GKXA 1THNA 2WI4A 2YKEA 3CGYA 4PRXA 3ZMZA 2YGEA 1M1KW 1BHBA 2HJFC 1COWG 3LDCA 2D3OW 3DTUB 1Y8PA 3MHSC 4U7OA 1BKNA 1Z5AA 4RQEA 3P32A 3RLRA 4PU9A 3OMAB 4FMTA 4XDJA 1JQ0A 4MVQA 2YK2A 3D0BA 3IEDA 3KE6A 5J71A 1VQNV 5D6QA 5EBMC 2FTKA 4JYCA 4H85A 2IORA 1K34A 4LCUC 2Q8IA 4UROA 2R9RB 3B8NA 1KECA 1AJQA 4PA9A 4B6CA 5M4HA 3WHAA 3RKZA 3OUSA 4XDLA 2XK2A 3ABTA 1MABG 2YE4A 4L90A 1ROPA 2DYRB 5BOCA 1M57B 3EKOA 4GFNA 5EC2C 1VQPV 4R7CA 4RUFA 2XAHA 1MX0A 3RVZA 3D2RA 4P2ZA 4EFUA 5KA5A 3ASNC 5LHIA 2XCMA 3LSSA 2HKOA 3CCJV 3U2KA 5CTUA 3M99B 3E8BA 2DYRC 4PELA 2YJXA 3SYCA 2EINB 4CZZA 4H33A 1MOFA 3CCVV 1VQMV 4HY1A 3TETA 1S72V 4P9OA 1YTFB 1RM1C 2JEXA 2XASA 1Z5BA 4MVRA 4KQVA 3IFXA 3VHDA 4HXZA 1NHHA 3K99A 5M4PA 4XCJA 4XDMA 2M7WA 3O6OA 4I3HA 1OZ0A 4XIPA 3AEIA 1YSCA 3ETGA 2GFDA 1W0KG 4X88A 3OR7C 2IU3A 1OCOC 2Q67A 3ETDA 4MB9A 1WLEA 3CCQV 1K5SA 4LBEC 3JCZA 3ZRWB 2XD6A 2IWUA 4MVZA 4KSGA 4HY6A 4EGKA 2IW5A 5IDJA 2Z5UA 3AG3B 3K04A 4LC1A 5EC1C 3ZIAG 3ZRSA 1Q7YW 3K98A 5IYDO 3SYPA 3H01A 2YI6A 4TT3G 5B3SB 3FYEB 3OUFA 2JK5C 3ABMB 4UV8A 5L3BA 1B62A 2BU6A 1ZXMA 2WEQA 1NBMG 1UYDA 3TZ2A 3W7SA 1YERA 4QE9A 3H4LA 4NH9A 1R3KC 3TCUA 2XJXA 2YKCA 3OMUA 1GM8A 1YSRA 1Q82W 3BM9A 2EZPA 3CC2V 4X89A 1R3JC 3QO5A 3W7TA 4H7QA 4XKKA 3E83A 2DW4A 1F4NA 2DWDC 2V1DA 3IGAC 2BYIA 2YI5A 1K92A 5IN9A 4MOTA 4WCEV 5CTYA 5B1OA 2YE3A 3GIGA 1UY9A 1UY6A 3RVYA 4XBFA 4NH8A 3CCMV 1GKZA 1F23A 4UUJC 1OCRB 3T2SA 2XX4A 4CE3A 4ZKIA 4PDRA 3F7VC 2IU0A 2ZXWB 3CGZA 5CBHA 1S3JA 5FL7G 3OM3B 2EIKC 1H7UA 3SYAA 1R62A 2X0LA 1AROP 2EBOA 3W7XA 3W7UA 3R91A 2ATKC 1K9MW 2XJGA 2FWYA 3JYCA 3X2QC 1YI2V 1H7SA 4E01A 4PRVA 4JAUA 4MPCA 1G4YB 1SETA 3CPWU 3CCEV 1ZW9A 3OE7G 5CBFA 5J9PC 4WFEA 1GMGA 4RAIA 1H38A 1YTFD 2BYHA 2ESAA 3T0ZA 4MP7A 2XDLA 4JTCB 2WWWA 1FXVA 3CWVA 3K97A 2EIMC 3AG4C 1K73W 4GEEA 3A0WA 1CPYA 3IC7A 4UV9A 3EHHA 3OMIB 5J6AA 2EILB 5H6RA 4P30A 1P7BA 2X7RB 1XL6A 3EFFK 5H6QA 4BXIA 4LWGA 4MVMA 4G27B 3ZMUA 3ABUA 4EMVA 3ZRVA 4P9PA 4XE2A 4URLA 2VWCA 4HZ0A 3ZXOA 1AM1A 2QE7G 4BQGA 5C93A 3STLC 3D3IA 2ZD9A 4BAYA 1PVGA 3QTFA 4EFTA 3T10A 1JJ2U 2YE9A 4ZVIA 3VADA 1TC6A 1MG1A 1FFTB 1V54C 2FWZA 4ASGA 3ASOB 1NVPB 1H8EG 2QKSA 2WLJA 1H2GA 4EEHA 3ASNB 2BSMA 1THZA 5L3CA 4LWHA 1YSZA 4U7NA 1ENVA 3CYOA 3JD0A 2IOPA 2YJWA 3U2DA 2Q8HA 4MVOA 1M56C 3I56V 4CWNA 1VQLV 2YI7A 3LUTB 2WAMA 3B26A 4GX1A 1TUEB 2X6BA 1QVGU 2O1UA 3Q5KA 5FNDA 2YE6A 3T1KA 3X2QB 1OSFA 3K0DA 2YK9A 5BODA 2OCCC 4JAVA 3ABMC 3WG7C 5BZBA 4L94A 4LP0A 5IDMA 1FXKC 5KUMA 1F51A 2EIKB 3JD1A 3QO8A 3UKMA 1KC8W 4CE2A 3CXCU 3O0IA 1BMFG 1YJWV 4XIRA 5M4MA 2YE8A 5LGNA 3ZN0A 3R65A 2EJRA 4YKZA 1R3LC 3B77A 2OTJV 4FJCC 1UYEA 1V54B 2V7QG 3KG2A 3OEHG 2IOQA 4ASAA 1FXKA 2XHTA 2JJ2G 3JD3A 4YKUA 1JX9A 2WSSG 1CEZA 4TSFG 3T0HA 3A0YA 4H81A 3E86A 3ZJZA 4FCQA 1I58A 2EIJC 4PDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YGA A;  3LNU A;  4YKQ A;  2HKJ A;  1TBW A;  3TZ5 A;  2QF6 A;  2YEC A;  4CWO A;  2HCH A;  3VHA A;  4LPB A;  2BU8 A;  1GJV A;  2BTZ A;  1YES A;  2CH4 A;  2YI0 A;  1I5A A;  5FNC A;  4O0B A;  5D7C A;  2C2A A;  2XDX A;  4E00 A;  4BIU A;  4QPK A;  5M4E A;  2WI1 A;  4L8Z A;  4KTN A;  2WI5 A;  3ZKB A;  3B25 A;  2XHR A;  4LWI A;  4XTJ A;  4XD8 A;  1YT2 A;  2AKP A;  2WI2 A;  2O1V A;  3ZRX A;  3OWB A;  1B63 A;  4CWF A;  3G75 A;  4EM7 A;  4ASB A;  1UY7 A;  2ZDY A;  4HYP A;  2QG2 A;  5IN9 A;  3B24 A;  3TZ0 A;  3K60 A;  1JOY A;  2YE7 A;  3QDD A;  4LWE A;  2YE2 A;  1TH8 A;  1YET A;  3ZKD A;  4EGI A;  4FCP A;  4O09 A;  5CF0 A;  4XCL A;  1U0Z A;  2FXS A;  4R3A A;  2BZ5 A;  2ZKJ A;  2HG1 A;  3FT5 A;  1QZR A;  2VWC A;  4FPP A;  5CTW A;  3CRK A;  3EKR A;  2BU5 A;  2YED A;  1IXM A;  3MNR P;  1AMW A;  2E0A A;  1TID A;  2VCJ A;  1Z59 A;  4JQL A;  5FNF A;  4XIT A;  3TUH A;  4BAE A;  1Y8O A;  2XHX A;  1Y4U A;  2H55 A;  4R3M A;  3A0R A;  2IWS A;  3ZXQ A;  3HZ5 A;  4BIZ A;  1NHJ A;  1YC4 A;  4CWR A;  4YKY A;  3H80 A;  2QM8 A;  5L3J A;  3R4M A;  2QFO A;  3HHU A;  3OWD A;  4FCR A;  4GT8 A;  4WUC A;  3A0T A;  3EHJ A;  3JZ3 A;  4YKR A;  1TIL A;  4MPE A;  4B7P A;  2JKI A;  3GIG B;  4XIQ A;  1A4H A;  5D7R A;  3R92 A;  5M4N A;  2YEJ A;  4O05 A;  4L91 A;  3SL2 A;  2Q2E B;  2YE5 A;  1JM6 A;  2YKB A;  2WEP A;  3HEK A;  2P67 A;  4CWS A;  3NXS A;  4CWP A;  4KSH A;  1UYF A;  4E02 A;  3FV5 A;  3RLP A;  1BGQ A;  1I5D A;  2LFS A;  4AWP A;  1UYL A;  1I5B A;  4MBC A;  4YKX A;  1L0O A;  1UYC A;  1ZXN A;  3G7E A;  4PL9 A;  3T0Z A;  2XX2 A;  3DGE A;  3LPS A;  3PEJ A;  3R4N A;  4HXW A;  2Q8F A;  1YC3 A;  1BXD A;  5CTX A;  4X9L A;  4YKW A;  1AH8 A;  4CE1 A;  3VHC A;  3INW A;  4MT8 A;  3ZM7 A;  4P7A A;  4QPJ A;  2XJJ A;  2CCT A;  3EHG A;  1I5C A;  1Y8N A;  1YC1 A;  4WUD A;  1EA6 A;  1US7 A;  3B27 A;  3ZRW A;  2VW5 A;  4CWQ A;  3Q5J A;  2BRC A;  3BMY A;  5F5R A;  1NHI A;  2YEA A;  3TTZ A;  2QM7 A;  1S14 A;  2XDU A;  4LWF A;  1TC0 A;  4MP2 A;  2YKI A;  1UYM A;  1KZN A;  1U2O A;  3R4O A;  1Y4S A;  4W7T A;  1QY8 A;  2BU2 A;  2CCU A;  3FT8 A;  3GIF A;  2WI6 A;  4XC0 A;  2WI3 A;  4O07 A;  3CRL A;  3OPD A;  2XDS A;  3WQ9 A;  3GIE A;  1BYQ A;  1ZWH A;  1S16 A;  3HZ1 A;  1YS3 A;  1UYI A;  3O2F A;  4BQJ A;  4K4O A;  2PNR A;  2IWX A;  2UWD A;  4GQT A;  4Q20 A;  4L93 A;  3R4P A;  2WER A;  4NH7 A;  2YEH A;  4GCZ A;  5F3K A;  4WUB A;  2YKJ A;  4XKA A;  1B3Q A;  2JJC A;  4YKT A;  2YEE A;  1UYH A;  2BRE A;  2EXL A;  3INX A;  4URM A;  4V25 A;  2YGF A;  5GGZ A;  4EGH A;  2WI7 A;  1EI1 A;  3A0Z A;  2CCS A;  4O04 A;  3TK1 A;  4CWT A;  3TZ4 A;  1YT1 A;  4XKO A;  5FWK A;  4JAS A;  2ZBK B;  3Q5L A;  4KP4 A;  3NMQ A;  4KFG A;  1AJ6 A;  4R1F A;  5B1N A;  2XDK A;  2VCI A;  4GGL A;  3EHF A;  4AS9 A;  3HYY A;  4DUH A;  2QG0 A;  4HYM A;  2BT0 A;  2XX5 A;  2O1W A;  4AWQ A;  4MTX A;  1UY8 A;  4U93 A;  2BU7 A;  2LFR A;  1MU5 A;  4URN A;  2YEI A;  3D36 A;  5D6P A;  4P8O A;  1UYK A;  3U67 A;  3MD0 A;  4GT1 A;  2FYP A;  2H8M A;  5D7D A;  3A0X A;  1I59 A;  4MPN A;  3PEH A;  4JYB A;  2ZDX A;  5CPH A;  3RLQ A;  2YEB A;  4AWO A;  4HZ5 A;  2YEG A;  1QYE A;  1Z5C A;  3OW6 A;  1YT0 A;  3C0E A;  4I5S A;  2CG9 A;  2GQP A;  3C11 A;  2YEF A;  1AH6 A;  4V26 A;  3HYZ A;  1ID0 A;  3G7B A;  2CGF A;  3ZCC A;  5M4K A;  4ASF A;  2Q8G A;  3B28 A;  2K5B A;  1KIJ A;  1UYG A;  1THN A;  2WI4 A;  2YKE A;  3CGY A;  4PU9 A;  1GKX A;  2Q8H A;  4PRX A;  2YGE A;  1Y8P A;  4U7O A;  1BKN A;  1Z5A A;  3RLR A;  3P32 A;  4FMT A;  3KE6 A;  3D0B A;  2YK2 A;  5J71 A;  3IED A;  5D6Q A;  2FTK A;  4JYC A;  4H85 A;  2IOR A;  2Q8I A;  4URO A;  4B6C A;  5M4H A;  3WHA A;  3RKZ A;  2XK2 A;  2YE4 A;  4L90 A;  5BOC A;  3EKO A;  4GFN A;  1MX0 A;  3D2R A;  4EFU A;  2XCM A;  5CTU A;  3U2K A;  2YJX A;  4HY1 A;  1Z5B A;  4KQV A;  3VHD A;  4HXZ A;  1NHH A;  3K99 A;  5M4P A;  4XCJ A;  4XDM A;  3O6O A;  4I3H A;  4XIP A;  2GFD A;  4MB9 A;  3ZRW B;  2XD6 A;  4KSG A;  2IWU A;  4EGK A;  4HY6 A;  5IDJ A;  4LC1 A;  3K98 A;  2YI6 A;  2BU6 A;  2WEQ A;  1B62 A;  1ZXM A;  1UYD A;  3TZ2 A;  3H4L A;  1YER A;  4NH9 A;  2XJX A;  2YKC A;  3OMU A;  1YSR A;  3BM9 A;  4H7Q A;  4XKK A;  2BYI A;  2YI5 A;  4MOT A;  5CTY A;  5B1O A;  2YE3 A;  3GIG A;  1UY9 A;  1UY6 A;  4NH8 A;  1GKZ A;  3T2S A;  2XX4 A;  4CE3 A;  4ZKI A;  3CGZ A;  1H7U A;  1R62 A;  3R91 A;  2XJG A;  2FWY A;  1H7S A;  4E01 A;  4PRV A;  4JAU A;  4MPC A;  4DZY A;  1ZW9 A;  2BYH A;  2ESA A;  4MP7 A;  2XDL A;  3K97 A;  2WWW A;  3CWV A;  4GEE A;  3A0W A;  3EHH A;  5J6A A;  4BXI A;  4LWG A;  4EMV A;  3ZRV A;  4XE2 A;  4URL A;  4HZ0 A;  3ZXO A;  1AM1 A;  4BQG A;  5C93 A;  1PVG A;  3QTF A;  4EFT A;  3T10 A;  2YE9 A;  4ZVI A;  3VAD A;  1TC6 A;  4ASG A;  2FWZ A;  4EEH A;  2BSM A;  4LWH A;  1YSZ A;  4U7N A;  2IOP A;  2YJW A;  3U2D A;  4CWN A;  2YI7 A;  3B26 A;  2O1U A;  3Q5K A;  5FND A;  2YE6 A;  3T1K A;  1OSF A;  2YK9 A;  5BOD A;  4JAV A;  4LP0 A;  4L94 A;  5IDM A;  1F51 A;  4CE2 A;  3O0I A;  4XIR A;  5M4M A;  2YE8 A;  4YKZ A;  1UYE A;  4ASA A;  2IOQ A;  2XHT A;  4YKU A;  3T0H A;  3A0Y A;  4H81 A;  4FCQ A;  1I58 A;  2XAB A; 
#chains in the Genus database with same CATH topology
 1MZE A;  2AW9 A;  1G8M A;  5B1A C;  4JZ2 A;  1FXK B;  4YHH O;  2NR5 A;  2OYQ A;  5DM6 V;  2XDX A;  4E00 A;  1YHQ V;  3TXQ A;  4I0X A;  4KTN A;  2YIB D;  4MTO A;  1K5Q A;  1JFF A;  4W4K A;  1R3I C;  2A79 B;  1P4R A;  4XTJ A;  3RFR A;  5EIB C;  3H1K H;  1YT2 A;  3K08 A;  4W4L A;  4I4T A;  2UXN A;  2O1V A;  3VQY A;  1B63 A;  1S5L Z;  4LFB B;  1JMK C;  1E79 G;  1OCC C;  3CRC A;  1IVS A;  3B24 A;  4HYP A;  4N21 A;  4LWE A;  1TH8 A;  2Y69 C;  5KLV H;  1YET A;  2YSU B;  3K06 A;  1I5X A;  4O09 A;  5B5E Z;  3QVN A;  2FXS A;  2NN4 A;  3QG5 A;  4R3A A;  3OTO B;  5FPO A;  1N8R W;  4G2K A;  5AG2 A;  1QZR A;  2HG1 A;  2VWC A;  2C1I A;  3OFN G;  4U3J B;  1MZF A;  3CRK A;  2YED A;  2F23 A;  2N74 A;  3H9V A;  3E2E A;  2QSA A;  4X9Q A;  4WFG A;  2WLM A;  1TID A;  5LOV B;  1GAX A;  2LGW A;  4D7T A;  2VCJ A;  2IJH A;  3PJS K;  2ZDI C;  4KHP O;  1Z59 A;  4XIT A;  3FB6 C;  1OCC B;  3LSU A;  3SPI A;  2XOK G;  4GYC B;  2IH3 C;  2RDC A;  4JI8 O;  2JGU A;  3CC4 V;  2XHX A;  1WB8 A;  1Y74 A;  1VF6 A;  2DYS C;  1SF9 A;  2WLL A;  5E1A C;  5KAI Z;  3UT5 A;  1K8A W;  3RYC B;  3FAV B;  4TWK A;  4WUC A;  1SQF A;  4JTA B;  4YKR A;  5LA6 B;  1YJ9 V;  4ZOL A;  1EFR G;  1LUW A;  2B5U A;  4LP8 A;  3GIG B;  3STZ C;  4GKJ B;  5D7R A;  3SYQ A;  2YEJ A;  3CRM A;  1OJH A;  4O05 A;  3TXS A;  2CGO A;  3HEK A;  4F6R B;  3CRR A;  3NXS A;  4YJ2 B;  3UM7 A;  3WB0 A;  2ZIO A;  1BGQ A;  4O4J A;  2NLJ C;  1KMI Z;  4KFM A;  4PA3 A;  4AWP A;  4EB6 A;  1I5B A;  1Y4M A;  4MBC A;  1HW7 A;  3U0Z A;  1ZXN A;  3G7E A;  5KHG A;  2XX2 A;  3LPS A;  4E72 A;  4LF4 B;  4IYH A;  2PYL A;  4HXW A;  1AI7 A;  3CCS V;  2EIL C;  4X9L A;  4YKW A;  4MTG A;  4QIW F;  4YIP A;  4CE1 A;  1F4M A;  4MT8 A;  4JGS A;  4JPR A;  3D3Q A;  1WPX A;  4QPJ A;  2Q7G A;  3G6B A;  1IBM B;  5JQG A;  3E8F A;  4O2A B;  3K9A A;  1UJW B;  4LF6 O;  1Z5W A;  1YF2 A;  2VW5 A;  2ZXW C;  5LYJ B;  2YIA A;  5LOV A;  2KG7 A;  2UUB B;  4AQY B;  4JI5 B;  4YIO A;  3H1I H;  3TJT A;  1IBK O;  2YEA A;  3G67 A;  3ZBH A;  1WPB A;  4MP2 A;  2W6I G;  4W7T A;  1QY8 A;  2BU2 A;  5L3D A;  2CCU A;  1VAR A;  1CP9 A;  3FT8 A;  2OIE A;  2XAQ A;  4LFC O;  2HLD G;  4GX2 A;  4X1Y B;  3WQ9 A;  1BYQ A;  3LNN A;  4KXR A;  1KYO F;  2C1G A;  4JV5 O;  4BQJ A;  4DR1 O;  3OR6 C;  3N2K A;  4LFA B;  3E89 A;  4Q20 A;  5KHK A;  4L93 A;  4D7S A;  1QR9 A;  5KMG B;  2Q68 A;  3JAM N;  1GN3 A;  4WUB A;  1NQT A;  2FB5 A;  5H9C A;  2H3O A;  3P3N A;  3SPH A;  2JJC A;  1G1X B;  3PN1 A;  5CBG A;  2BRE A;  4URM A;  3K59 A;  1JFF B;  4FLV A;  2YGF A;  3RWR D;  5BR8 B;  2WI7 A;  1BQ0 A;  2CCS A;  4O04 A;  4DK0 A;  2B1I A;  3CRA A;  4PA4 A;  3TK1 A;  5HFM A;  1K33 A;  1W59 A;  1M56 B;  1P84 F;  2VQE B;  1K4C C;  3TZ4 A;  1YT1 A;  2Q73 A;  5FWK A;  1N34 O;  4YJ3 A;  1KB9 F;  3Q5L A;  1O9H A;  1ZL8 B;  1S5H C;  1TGO A;  4WBN A;  4AIL C;  1BS3 A;  4AS9 A;  1Q6U A;  2A0L A;  5KHI A;  3ETE A;  1NZ6 A;  2CTR A;  4X8A A;  3K3W A;  3VBB A;  2P7T C;  2BU7 A;  1WP8 A;  4ASU G;  4ABM A;  4KHP B;  4P8O A;  2F1M A;  1SQP H;  1UYK A;  2VS0 A;  4GT1 A;  5K1X A;  3L73 H;  5LMN B;  3A0X A;  2ZNI A;  1H2S B;  4Z1V A;  5LXT A;  3F5W C;  4JYB A;  2ZDX A;  5CMU A;  1P49 A;  1YT0 A;  3FB7 C;  4RO2 A;  4I5S A;  3CRQ A;  2YEF A;  2PGG A;  2L6L A;  3HYZ A;  4NXN O;  3SPC A;  3ZCC A;  3JAS B;  2DYS B;  1VQ6 V;  4MW8 A;  1Z2G A;  3CCL V;  5FNV A;  3L74 H;  1THN A;  4J9Y B;  2PI4 A;  2YKE A;  1GKX A;  3BVO A;  4AHC A;  5D5Q A;  1M1K W;  1FFX A;  1YVW A;  1AR4 A;  3DTU B;  4U7O A;  4RQE A;  2FL4 A;  4K0K B;  1JQ0 A;  1WA8 B;  1FJG O;  2Q8I A;  1KEC A;  5M4H A;  3WHA A;  3OUS A;  4XDL A;  1MAB G;  2DYR B;  5JH7 B;  5BOC A;  4R7C A;  1MX0 A;  3D2R A;  1WA8 A;  4P2Z A;  4EFU A;  3JAW B;  1XHZ A;  2DYR C;  4DUY O;  4HY1 A;  3RYI A;  5JJE B;  3R66 A;  4QGP A;  2N05 A;  5M4P A;  4XDM A;  4H13 B;  3JAK A;  4I3H A;  3ETG A;  1W0K G;  1HP8 A;  2Q67 A;  1NT2 B;  3HKE A;  3JAR B;  2IWU A;  4EGK A;  2Z5U A;  3AG3 B;  5EC1 C;  1Q7Y W;  3H01 A;  4TT3 G;  3ZS8 C;  3OUF A;  1B62 A;  1HNW B;  2XJX A;  3BM9 A;  3T1Y B;  4CS2 A;  3OTF A;  3ZED A;  4YHH B;  2DW4 A;  2DWD C;  2V1D A;  3IGA C;  2YI5 A;  2XT9 A;  1UY9 A;  1F23 A;  4UUJ C;  4PDR A;  1S3J A;  2HJD A;  2QM4 A;  2EIK C;  4JI7 B;  1ARO P;  3W7X A;  2XHB A;  1L0N H;  3D36 C;  2FWY A;  1YI2 V;  4NTY A;  4MPC A;  2E75 B;  5J9P C;  1YTF D;  1H38 A;  4MP7 A;  4GKK O;  2UXB B;  4E4E A;  3AG4 C;  1K73 W;  1NTK H;  3IC7 A;  4UV9 A;  5J6A A;  2X7R B;  4I55 A;  3N27 A;  3ABU A;  1N32 B;  3ZRV A;  4XE2 A;  1AM1 A;  2QE7 G;  1XNR B;  1X59 A;  2ZD9 A;  4BAY A;  3QTF A;  4EFT A;  2YE9 A;  3VAD A;  1V54 C;  1FFT B;  4O4I A;  3L72 H;  2QKS A;  2WLJ A;  5IJ9 A;  4X62 O;  1H2G A;  4LWH A;  4F6E A;  1ENV A;  4MVO A;  1PM9 A;  1WN7 A;  1DK1 A;  1TUE B;  2O1U A;  4DRX B;  1PPJ H;  3CSX A;  2XTA A;  3X2Q B;  3K0D A;  5BOD A;  3WG7 C;  5IDM A;  2RJZ A;  2PYJ A;  2EIK B;  4DV5 O;  2WA3 A;  2ZE8 A;  4TQF A;  4NR1 A;  4EFB A;  4XIR A;  1Y76 B;  2EJR A;  3F5T A;  4X64 O;  2OTJ V;  4DV2 B;  1V54 B;  2E3C A;  2IOQ A;  2JJ2 G;  4I0X B;  3OT7 A;  1VF5 B;  3ZJZ A;  4JI2 O;  3HKC A;  1TVK A;  3ABL C;  4YKQ A;  4LF4 O;  3TZ5 A;  2H8P C;  3S3X A;  2YEC A;  4CWO A;  3JD4 A;  3KCY A;  4DYL A;  1I94 B;  1R6N A;  2BU8 A;  2BTZ A;  2YI0 A;  4RUE A;  4O0B A;  2GUZ A;  2C2A A;  4ZHQ A;  4UCS A;  4BIU A;  4TUY B;  1XNQ B;  2Q5Z A;  1KKC A;  4O2A A;  1BL8 A;  4L8Z A;  1EN4 A;  2IJJ A;  1JCH A;  4XD8 A;  3WG7 B;  5LP6 C;  3ZRX A;  3K57 A;  4UB8 Z;  1VF7 A;  4ASB A;  2AHZ A;  3TZ0 A;  2K9P A;  1S5J A;  3K60 A;  1JOY A;  4X1Y A;  5H2F Z;  4CH6 A;  1OCZ B;  3ZKD A;  5IJ9 B;  4JF3 A;  3B2E E;  4FCP A;  1D5N A;  5B1A B;  5CF0 A;  3CHX A;  3QTC A;  1DTO A;  3CX5 F;  4FPP A;  5LHG A;  1AI6 A;  5L3G A;  5CTW A;  3CP1 A;  4HZ3 A;  1H2M A;  2QKC A;  4BW9 A;  3B8M A;  5IJ0 B;  2PF4 E;  3CD6 V;  2CK3 G;  4LF8 O;  3TUH A;  4DR6 B;  2QDO A;  4LF7 B;  4BAE A;  2UUC O;  1GRJ A;  3I55 V;  3LDD A;  4J7J A;  2R70 A;  4UFZ A;  3ZXQ A;  4BIZ A;  2ZKO A;  1YC4 A;  3K5N A;  4YKY A;  4I7Z B;  5L3J A;  5A9G A;  3JAS A;  1XRE A;  2ETN A;  4FCR A;  4GT8 A;  3A0T A;  5IYZ B;  3EHJ A;  3MHH C;  2Y4T A;  2JVD A;  4HYO A;  1TIL A;  4MPE A;  4B7P A;  4ICG A;  3AG1 C;  2RMK B;  1DF5 A;  4BWA A;  4DR5 O;  5IE9 A;  1HNW O;  1KUQ A;  3OAA G;  4L91 A;  3SL2 A;  2ZDI A;  2YKB A;  5L3E A;  1URF A;  1SRY A;  1H2L A;  4CWS A;  2F4V B;  4CWP A;  4YY3 B;  1UYF A;  3FV5 A;  5KX5 A;  4GKK B;  4Z2W A;  2UXB O;  3RLP A;  5KHJ A;  2YIC A;  1ZLZ A;  1SER A;  5LBQ A;  3K0G A;  4YKX A;  1UYC A;  1R73 A;  5D5P A;  1NR7 A;  1WNS A;  1TA8 A;  4UCU A;  5LHH A;  1XNR O;  3R4N A;  5JJN B;  2Q8F A;  5IYC O;  5CTX A;  3AG4 B;  4YXW G;  4NTX A;  4JI6 O;  3INW A;  4KUM A;  4GX0 A;  1SQG A;  3ZM7 A;  5KUK A;  2XJJ A;  1N32 O;  2Q6A A;  3WFV A;  4WFA V;  4CH3 A;  4X1K A;  1I5C A;  4WUD A;  4CWQ A;  5FNV B;  3JCU Z;  3G4S V;  1AJN A;  2BRC A;  1NHI A;  2HR3 A;  1KD1 W;  1VQ5 V;  1NKD A;  1NI8 A;  4IIJ A;  1UYM A;  1S0V A;  1XI1 A;  1Y76 A;  2P6J A;  3ML0 A;  2ZR3 A;  1J5E B;  2WI6 A;  4XC0 A;  2WI3 A;  5LGU A;  5KMG A;  3CRL A;  4B7K A;  1SA0 B;  2JS3 A;  2E5L B;  2W0X A;  3GIE A;  1KBH A;  2ZNJ A;  3H1H H;  4DR3 O;  4DV5 B;  3FB5 C;  3RN4 A;  3UQ8 A;  1UYI A;  5JJJ B;  2HFE C;  1I0H A;  4OX9 O;  4WFF A;  4FK5 C;  5JEN A;  2PI5 A;  2PNR A;  2EZO A;  3DC6 A;  3ZMS A;  1AI5 A;  2UXD B;  1MSW D;  3R4P A;  1PP9 H;  4CC6 A;  3N2G B;  4G28 B;  4K0K O;  4LH6 A;  2GUZ B;  4ZHQ B;  3VOU A;  2FYU H;  1EZJ A;  3ZHU A;  3VQX A;  2ADP A;  2OCH A;  2YI8 A;  5ITZ A;  1M9N A;  1KP3 A;  2YEE A;  1VMG A;  1SS3 A;  4PDV A;  1QLE B;  1SES A;  4V25 A;  1MMM A;  1XUQ A;  4JYY A;  1V55 B;  2Q69 A;  5KHH A;  1V9P A;  2RCV A;  4XKO A;  3K5M A;  4JAS A;  3UCS C;  2ZBK B;  1OCO B;  3U10 A;  2ZE6 A;  5B1N A;  4ZIB A;  4L87 A;  3MAQ A;  2XDK A;  1D5A A;  1M90 W;  4FLT A;  1EN6 A;  4LFA O;  2VCI A;  1TUB A;  2XND G;  2BE3 A;  1US6 A;  2GV9 A;  4UVA A;  3O9O A;  1LUV A;  1SZT A;  4UVB A;  1SQQ H;  2RNB A;  5LA6 A;  2BT0 A;  2QA4 V;  1QLE C;  2XX5 A;  1XMQ O;  4DUY B;  1UY8 A;  2KSD A;  4U93 A;  4URN A;  2EIM B;  2GHY A;  1WAZ A;  3LNM B;  5IWA B;  2FYP A;  3A0H Z;  4CBC A;  5EK0 A;  4IGG A;  3JAW A;  1I59 A;  3GWO A;  5CPH A;  3RLQ A;  4TOI A;  1YIJ V;  4HZ5 A;  4LWS A;  2YEG A;  2MK3 A;  1PNL A;  3RBZ A;  1I7F A;  2XAF A;  2ZIN A;  3C0E A;  4PA7 A;  2CG9 A;  3C11 A;  4LF5 O;  4DV0 B;  4UCV A;  4V26 A;  4DR6 O;  1NTM H;  2ZE5 A;  3FB8 C;  3SPG A;  4EFE A;  1I5Y A;  5M4K A;  1GK9 A;  5IYB O;  2Y0I A;  2Q8G A;  4LWS B;  3SYO A;  3Q4H A;  2WI4 A;  1NTZ H;  4PRX A;  2YXY A;  3M7M X;  2N04 A;  3SJB C;  1Y8P A;  3MHS C;  4I50 A;  4J7Z A;  1Z5A A;  3P32 A;  1Y74 B;  1UPG A;  4X1K B;  4MVQ A;  5J71 A;  2YK2 A;  3IED A;  1RSO A;  4FVM A;  4JYC A;  2IOR A;  4LCU C;  4RWU A;  1XIL A;  3RKZ A;  2XK2 A;  1YEW A;  4TV9 B;  3ABT A;  4DV2 O;  1M57 B;  4GFN A;  4IIJ B;  4YY3 O;  5C8Y A;  3AK2 A;  4RUF A;  5GTI Z;  1IZ3 A;  3L70 H;  5CA1 A;  5JWP A;  4UB6 Z;  4HBN A;  5B66 Z;  2HKO A;  2KQX A;  3M99 B;  2YJX A;  4JI2 B;  2EIN B;  4CZZ A;  3CCV V;  4K35 A;  1S72 V;  1YTF B;  4MVR A;  4KQV A;  3IFX A;  3CS5 A;  2Y4U A;  3N2K B;  1JJO A;  3AEI A;  4EB6 B;  4O2B B;  3KCX A;  3JCZ A;  2XD6 A;  5EYP B;  2IW5 A;  5IDJ A;  3ZRS A;  4O4I B;  3SYP A;  3FYE B;  5L3B A;  1UYD A;  3TZ2 A;  1YER A;  4NH9 A;  4LNU A;  2CTP A;  3OMU A;  1GM8 A;  2ARH A;  1YSR A;  2CTQ A;  2EZP A;  5BXZ A;  3CC2 V;  2ZIM A;  3E83 A;  1F4N A;  1I94 O;  2BYI A;  1K92 A;  4DV3 B;  5B1O A;  1UY6 A;  1OV9 A;  1GKZ A;  1OCR B;  1O9G A;  5LMU B;  2IU0 A;  2ZXW B;  5CBH A;  5FL7 G;  3OM3 B;  3R91 A;  3BAB A;  1K9M W;  3BA8 A;  1H7S A;  4PRV A;  1MNG A;  1EM1 A;  3CCE V;  1ZW9 A;  4B3M B;  1GMG A;  4RAI A;  2XDL A;  4JTC B;  1FXV A;  2JGD B;  3J80 N;  4DR2 O;  2EIL B;  3EFF K;  4BXI A;  3L75 H;  2Z0A A;  1AVM A;  4NVP A;  3FX7 A;  4O4H A;  4HZ0 A;  5CB4 B;  4BQG A;  3RGB A;  3GWK C;  2UXC B;  3T10 A;  1JJ2 U;  5C8Y B;  1FKA O;  2QWR B;  4UCR A;  1AP6 A;  2PTM A;  4ASG A;  4X65 B;  2ADQ B;  3ZHS A;  5L3C A;  2IOP A;  3JD0 A;  3I56 V;  2ZCE A;  2DN9 A;  4BR6 A;  3LUT B;  1QVG U;  2MW2 B;  5FND A;  4NXM B;  2YXH A;  2OCC C;  5BZB A;  4K8Z A;  2YUA A;  5KUM A;  3AK1 A;  2UUC B;  3K5O A;  1KC8 W;  1VIB A;  4CE2 A;  2YE8 A;  4JI1 B;  4YKZ A;  3B77 A;  4FJC C;  1UYE A;  2V7Q G;  3KG2 A;  2XHT A;  2LQT A;  2CGN A;  1CEZ A;  4I9Q A;  4H81 A;  4I50 B;  1I58 A;  2LO1 A;  4PDL A;  3FYI B;  2YGA A;  3HKE B;  1IDS A;  3WB2 A;  2HKJ A;  4J9Z B;  2PY5 A;  2F66 C;  2HVK C;  3HB3 B;  4F6R A;  2QWN B;  4JI0 O;  1QU7 A;  1GM7 A;  3S5T A;  3CJH A;  4LPB A;  1GJV A;  1NR1 A;  1YES A;  5CA3 A;  5IY5 B;  3EXA A;  5D7C A;  1GO3 F;  4QPK A;  2F95 B;  2JDI G;  3CMA V;  3G6E V;  3KKY A;  2F93 B;  2WI1 A;  1A32 A;  5FLX N;  2PZS A;  1FYJ A;  2JJ1 G;  4DR5 B;  2Y69 B;  3ZKB A;  3B25 A;  4LWI A;  1Q6H A;  4JTD B;  2HP8 A;  1Q3E A;  2WI2 A;  1AI4 A;  2OCC B;  1Y6X A;  1IX9 A;  2F4V O;  2BSK B;  3JAR A;  4DR4 B;  1RSO B;  1W2B U;  4CC5 A;  4R8C A;  3G75 A;  4EM7 A;  4LF9 B;  1NJI W;  5IN9 A;  2QG2 A;  1PNK A;  3T4Z A;  4DV6 O;  5B3S C;  2JRI A;  2EX3 A;  2YE2 A;  4TV9 A;  2EJ7 A;  2KKW A;  2UUA O;  2EUL A;  1G6U A;  4XCL A;  1U0Z A;  1LNQ A;  5K1P A;  5KX5 B;  2BZ5 A;  2ZKJ A;  5B1B C;  1Q8I A;  3I5D A;  3FT5 A;  1QQC A;  4J41 A;  2BU5 A;  3RYH B;  2QEX V;  3W7W A;  3MNR P;  2E0A A;  2WPD G;  3T2M A;  2DOS A;  1K97 A;  1DLB A;  2Y0P A;  3S3W A;  2P90 A;  1M5I A;  4ZBM A;  3QO7 A;  1RP3 B;  3HKB A;  1L0L H;  1SQB H;  4QJF B;  4OXS A;  3ABK C;  3H1L H;  2H55 A;  4R3M A;  1W0J G;  2BTQ A;  5EBL C;  1L1F A;  4IHJ A;  1NHJ A;  1PKX A;  1SQV H;  4TV8 B;  4OX9 B;  3HZ5 A;  4CWR A;  1Y66 A;  3J81 N;  3IC9 A;  4I55 B;  4MVS A;  3RW0 A;  3H80 A;  4EKW A;  4LNU B;  3R4M A;  2B1G A;  3HPL C;  3HHU A;  4J7K A;  3QNE A;  4O4H B;  4XIQ A;  1A4H A;  2UXX A;  4A5U B;  1WP7 A;  4JI3 B;  2NNU A;  2YE5 A;  4O2B A;  1QCE A;  1AR1 B;  4KSH A;  2CUG A;  4E02 A;  1JR9 A;  3LDE A;  3P30 A;  3H1J H;  2R72 A;  4CH5 A;  1HNZ O;  3IJ4 A;  2UU9 B;  2BSK A;  4B3R B;  1PV0 A;  3T0Z A;  1L0O A;  4PL9 A;  4I9W A;  3HKD B;  5JVD B;  1Q81 W;  3DGE A;  2AHY A;  2GDS A;  2QR4 A;  1R1B A;  1GN6 A;  1FXH A;  3A2F A;  5CA0 A;  1YXB A;  4B08 A;  1YC3 A;  1B06 A;  1BXD A;  2YC0 A;  4DV1 O;  2WLI A;  5F2V O;  4DR2 B;  4X65 O;  3VHC A;  1HDJ A;  1Q5O A;  4P7A A;  3ZN1 A;  1NH2 B;  5DEC A;  3HKD A;  2YEV A;  4NB5 A;  4X1I A;  1XMQ B;  2CCT A;  3EHG A;  4N23 A;  3SJQ C;  1JA8 A;  3B40 A;  4LFC B;  2WLL B;  4H0L B;  2CH7 B;  2XAG A;  1US7 A;  3B27 A;  1JPX A;  5HFL A;  2WLI B;  1XMO O;  1VQ9 V;  1QBZ A;  4FLY A;  5F5R A;  1BGY H;  1FJG B;  3CJH B;  3P3P A;  5LGT A;  3TTZ A;  1VQO V;  2AXT Z;  2QM7 A;  1S14 A;  4OPH A;  2Y48 A;  2YKI A;  1M93 A;  2CTW A;  5LP6 B;  4GZR B;  1N0J A;  1Y4S A;  1RPR A;  2ILM A;  2X6C A;  3JAL B;  3GIF A;  2CH7 A;  3OW2 U;  4LF6 B;  4UXN A;  4JI4 B;  4MTF A;  3QF7 A;  5E79 Z;  2OT5 A;  3SJC C;  2DE0 X;  1OCZ C;  4JI5 O;  3HZ1 A;  1YS3 A;  1VQ4 V;  2W6J G;  1FPO A;  2ZM6 B;  1BT8 A;  4LFB O;  1S77 D;  2CDY A;  2PUS A;  4GQT A;  4CH4 A;  2WER A;  3AG3 C;  4NH7 A;  1N0N A;  4DK1 A;  4GCZ A;  4DR7 O;  4X66 O;  5DN6 G;  1CXZ B;  1Q6I A;  2YKJ A;  4I4T B;  1B3Q A;  1K3E A;  4YKT A;  2JIZ G;  2QWO B;  2EXL A;  1XHX A;  2P22 C;  3BRC A;  1QR8 A;  1WB7 A;  3E35 A;  2IJK A;  1J5E O;  5GON B;  3OD4 A;  4DR4 O;  4CWT A;  4JI8 B;  1QLN A;  4ZI7 B;  3AG7 A;  1YIT V;  1ORQ C;  1KKD A;  1GM9 A;  3ASO C;  3C90 A;  1QVF U;  2UUA B;  4R1F A;  2WLN A;  1YCI A;  2YEV B;  1ZSP A;  4QNH B;  1H8H G;  2UXD O;  4B3S O;  4GGL A;  2G38 A;  3T1H B;  2ODM A;  1N33 B;  3OEE G;  2YI9 A;  2Q7E A;  4HYM A;  3N2G A;  1DGS A;  2O1W A;  4BW5 A;  2EIJ B;  4IL6 Z;  2A9H A;  3RYF B;  1PD3 A;  3UO2 A;  2LFR A;  5J2U B;  4FLU A;  1VEW A;  3ZHT A;  1AJP A;  2GSM B;  3MD0 A;  2XAJ A;  5D7D A;  1WJZ A;  3K79 A;  1V55 C;  4MPN A;  3HKB B;  3SPJ A;  2QWP B;  2AZ2 A;  1Z5C A;  5CB4 A;  5LMU O;  3OW6 A;  2Q0O C;  4C7U A;  3F7Y C;  1Q86 W;  2VRZ A;  2P5O A;  4TV8 A;  3THO A;  1E1Q G;  4O4L B;  1HNX B;  3G7B A;  2CGF A;  1PNM A;  1J95 A;  5LMN O;  4B3M O;  4MS2 A;  2BOB C;  1SA0 A;  1ZWI C;  1BHA A;  4PU9 A;  1UYG A;  1HWY A;  2QTO A;  3CGY A;  2Q8H A;  1KU9 A;  1GN2 A;  3ZMZ A;  2YGE A;  1BHB A;  3D8C A;  1YZB A;  1BKN A;  2R9A A;  4NXM O;  4GUN A;  3L9D A;  3KE6 A;  4XDJ A;  5D6Q A;  2FTK A;  2M6Y A;  2UXC O;  1K34 A;  1SZX A;  4B6C A;  4PA9 A;  1AJQ A;  4X20 A;  4L8J A;  2YE4 A;  4L90 A;  1ROP A;  2IM9 A;  1UFI A;  3K58 A;  3RVZ A;  1GH6 A;  4DV0 O;  5KA5 A;  3ASN C;  2XCM A;  4JYA B;  1XNQ O;  3U2K A;  2ZE7 A;  2RQ6 A;  4H33 A;  4AI8 A;  3TET A;  4P9O A;  3BFR A;  4FFK A;  1Z5B A;  3ICX A;  3VHD A;  4HXZ A;  1ZL8 A;  1NHH A;  4XCJ A;  1M4U A;  2VQF B;  1NS1 A;  2QGN A;  2BCC H;  4XIP A;  2GFD A;  3VQW A;  3OR7 C;  2IU3 A;  1OCO C;  3ETD A;  4UCT A;  1K5S A;  4KSG A;  4IHJ B;  4HY6 A;  3EVK A;  3ZHQ A;  1TUB B;  2HHH O;  3K98 A;  5IYD O;  2WEQ A;  2JK5 C;  4JI7 O;  1NBM G;  3J7A U;  3W7S A;  5LL6 Y;  3H4L A;  1R3K C;  4LH7 A;  1Q82 W;  3E22 B;  3NR7 A;  4X89 A;  3QO5 A;  4JI4 O;  3W7T A;  2Q4P A;  4XKK A;  4JI0 B;  1FFX B;  5H5N A;  5BR8 O;  1IBL B;  4WCE V;  5EZY B;  2YIB A;  4XBF A;  3CCM V;  5CA1 B;  4CE3 A;  2XX4 A;  4LF9 O;  4ZKI A;  2VQE O;  4PV1 B;  1BCC H;  3CGZ A;  3SR2 C;  1H7U A;  3SYA A;  1EZV H;  1R62 A;  2EBO A;  2ATK C;  2XJG A;  1TAE A;  1FD9 A;  3SDL A;  3DXR A;  5BMV A;  4LF8 B;  4JAU A;  1QHT A;  2YID A;  3SGI A;  3RYH A;  5CBF A;  2ESA A;  2OIG A;  3VQV A;  1P7G A;  3CWV A;  3K97 A;  2EIM C;  3A0W A;  1CPY A;  3EHH A;  3K5L A;  5H6R A;  4P30 A;  1P7B A;  3ZX6 A;  2FKX A;  5H6Q A;  5JCO A;  3RYI B;  3KZI Z;  3C3T A;  2JS5 A;  1XDC A;  3DXR B;  5BMV B;  4URL A;  3ZXO A;  3JSN A;  1MA1 A;  3STL C;  1PVG A;  2LW7 A;  5GON A;  4X1I B;  4DV3 O;  1MG1 A;  2FWZ A;  3ASO B;  1H8E G;  2Q7H A;  1SQX H;  4FM0 A;  1YSZ A;  4U7N A;  2QJ1 A;  1M56 C;  4CWN A;  2WAM A;  1XEQ A;  4GX1 A;  2X6B A;  1D2D A;  3Q5K A;  1HR0 O;  3T1K A;  3ABM C;  3A0B Z;  3JD1 A;  3QO8 A;  3UKM A;  3CXC U;  1YJW V;  5M4M A;  4X62 B;  5LGN A;  3ZN0 A;  3R65 A;  1R3L C;  4B3T O;  4K3A A;  4LR3 A;  3JAK B;  3OEH G;  4ASA A;  2ZT9 B;  4J10 A;  3T1H O;  1N33 O;  1H2K A;  1JX9 A;  2WSS G;  3BPZ A;  1Z5V A;  3E86 A;  2EIJ C;  2XAB A;  5J2T A;  3K03 A;  3LNU A;  3WU2 Z;  5CA0 B;  1R6T A;  4UVC A;  4YJ2 A;  1TBW A;  2QF6 A;  5EIB D;  1ZX3 A;  2HCH A;  3VHA A;  3OTO O;  1U96 A;  4DV7 B;  4D6T H;  2WA4 A;  1NVP D;  2D2C B;  1I5A A;  2CH4 A;  5FNC A;  2FML A;  3LSQ A;  1SKV A;  1VP7 A;  2DQ0 A;  5M4E A;  2UU9 O;  4WFH A;  4B3R O;  1R6K A;  4PJ0 Z;  2WI5 A;  4Q6G A;  2XHR A;  3ABL B;  2GTS A;  4GX5 A;  1OCR C;  2AKP A;  1XMO B;  2R9I A;  5L3F A;  3OWB A;  4CWF A;  4E2L A;  4MVU A;  1UY7 A;  2ZDY A;  1Q43 A;  3M8A A;  3JSL A;  3OMN B;  2YE7 A;  3QDD A;  3A8T A;  3HR0 A;  5LYJ A;  4O4L A;  2IBZ H;  4EGI A;  3BEH A;  2LGQ A;  1VQK V;  3AG2 C;  2VWJ A;  4HAM A;  4OGQ B;  1NH2 D;  3BY6 A;  3EKR A;  3B09 A;  3BCC H;  1IXM A;  2KB1 A;  1OHH G;  3U11 A;  4HNA B;  1AMW A;  4WF9 V;  1TVK B;  4BIO A;  2ITC C;  5GW7 A;  4JQL A;  4JYA O;  5FNF A;  4R6Z A;  2IJI A;  2ITD C;  4DRX A;  5BY1 A;  1Y8O A;  4DW0 A;  1M57 C;  1Y4U A;  2BTO A;  1S76 D;  2WLH A;  3A0R A;  4TUY A;  4NTW A;  2L35 A;  2IWS A;  2QWQ B;  3GB7 C;  2ZM6 O;  2WLK A;  2LJ2 A;  2QM8 A;  2QFO A;  3OWD A;  1IBL O;  1QNM A;  2DQ3 A;  3JZ3 A;  1AP5 A;  3ETQ A;  2W0F C;  3UO3 A;  2QTS A;  4DR7 B;  4MSW C;  4X66 B;  2JKI A;  1IUR A;  5TIS Z;  3R92 A;  5M4N A;  4PDM A;  1N36 O;  5IY5 C;  1FAF A;  2Q2E B;  2DWE C;  2F43 G;  1JM6 A;  3AG2 B;  2WEP A;  2P67 A;  4MW3 A;  5IWA O;  2E74 B;  4FFB A;  1LR1 A;  2QKA A;  2UUB O;  3FKS G;  4FZ0 A;  3CCR V;  2YDE A;  2ZR2 A;  4JI6 B;  4K8X A;  3JAT B;  1VQ7 V;  1I5D A;  3SJA C;  1IXB A;  2LFS A;  1VQ8 V;  4TQD A;  4FZ1 A;  1UYL A;  3CYG A;  2A7W A;  2O57 A;  4JZG A;  3OGI B;  3E22 A;  1B04 A;  1YJN V;  2BOC C;  3CME V;  2EIN C;  3PEJ A;  4X64 B;  1XL4 A;  5IJ0 A;  1AH8 A;  4FM1 A;  3L71 H;  2HG5 C;  5DED A;  1GKF A;  4H37 A;  2HHI A;  2P4K A;  4F4L A;  1E1R G;  3CC7 V;  5B1B B;  4XDK A;  5J2T B;  3UT5 B;  4JI3 O;  1RM1 B;  1KQS U;  1Y8N A;  1JVM A;  1YC1 A;  5KAF Z;  4HNA A;  1KP2 A;  1HR0 B;  1EA6 A;  3ZRW A;  4FM2 A;  4DO2 A;  4DUZ O;  3Q5J A;  4B3S B;  2V4D A;  3BMY A;  3OGC C;  1DF4 A;  3G71 V;  2XDU A;  4LWF A;  1TC0 A;  1VF6 C;  3CEI A;  4QE7 A;  3CCU V;  1KZN A;  1U2O A;  3R4O A;  2IH1 C;  3CWB H;  3E8H A;  2GTA A;  1FS0 G;  2Z3Y A;  2Q8V A;  4O07 A;  2JEU A;  1XOU A;  3OPD A;  1Y67 A;  2XDS A;  4DV1 B;  1ZWH A;  3TGU H;  1S16 A;  4DXW A;  2OWO A;  3O2F A;  5EBW C;  1PL0 A;  4PI2 A;  4K4O A;  2HVJ C;  2GBO A;  3JD2 A;  4Z1M G;  3C3S A;  5J2U A;  2IWX A;  3ABK B;  2UWD A;  4DV4 O;  4PI0 A;  4R50 A;  4FLX A;  2H94 A;  1B6Q A;  4B7E A;  2P06 A;  2YEH A;  3EHB B;  5F3K A;  1HNX O;  4ZI7 A;  4DR3 B;  4FIP C;  4WFB V;  4XKA A;  2X6A A;  3JAT A;  2OTL V;  1EBO A;  1UYH A;  2VQF O;  3INX A;  4FLZ A;  4OPA A;  5GGZ A;  4EGH A;  4U3F H;  1EI1 A;  3A0Z A;  4J11 A;  3K9S A;  3ZMT A;  2KG7 B;  1GTO A;  2HHH B;  4LF7 O;  1K7D A;  1F7Y A;  3O65 A;  4KFG A;  4KP4 A;  3NMQ A;  1AJ6 A;  3FFQ A;  1H2N A;  5JVD A;  3HKC B;  2ZQM A;  2LW1 A;  1SC5 B;  2LP7 A;  5IT9 N;  3EHF A;  3HYY A;  4DUH A;  5EYP A;  3WB1 A;  2QG0 A;  3ZMV A;  3ZHV A;  4UCO A;  3APO A;  4RQF A;  1BE3 H;  4AWQ A;  4MTX A;  1IBM O;  5KA6 A;  3MDS A;  3RT3 C;  2XUM A;  4IYI A;  3E8G A;  1MU5 A;  4NYK A;  2YEI A;  3D36 A;  5D6P A;  3U67 A;  3T4D A;  1ZUQ A;  2H8M A;  1IBK B;  5A2Q N;  3PEH A;  4PHZ A;  2YEB A;  4AWO A;  2K1E A;  4H44 B;  1QYE A;  3AG1 B;  2Q0A A;  1EN5 A;  1Q90 D;  2GQP A;  1AH6 A;  4NKG B;  3T1C A;  1ID0 A;  3APQ A;  2YS8 A;  5JQG B;  1K4D C;  1PL4 A;  2JGD A;  2VWK A;  3FAV A;  4ASF A;  3B28 A;  5CN0 A;  4JV5 B;  1RPO A;  2K5B A;  4JAA A;  1YDX A;  4PA6 A;  4JI1 O;  1KIJ A;  2HJF C;  1COW G;  3LDC A;  3G80 A;  2D3O W;  4LF5 B;  3RLR A;  3CE2 A;  3OMA B;  4FMT A;  3D0B A;  1VQN V;  5EBM C;  4H85 A;  4URO A;  2R9R B;  3B8N A;  2A3Q A;  4DR1 B;  4B3T B;  3GVM A;  3ZHR A;  1MSD A;  3EKO A;  5EC2 C;  1L8D A;  1VQP V;  4CS3 A;  2XAH A;  5LHI A;  4U3J A;  3LSS A;  1ZAU A;  5CTU A;  3CXH F;  3CCJ V;  2E5L O;  3E8B A;  5LXT B;  4PEL A;  3SYC A;  2RN9 A;  1MOF A;  1VQM V;  4ZOL B;  2HEP A;  3B4S A;  1RM1 C;  2JEX A;  2XAS A;  1BSM A;  3K99 A;  2M7W A;  3O6O A;  1OZ0 A;  1YSC A;  4X88 A;  3FD9 A;  4KL1 A;  2B9Z A;  4MB9 A;  1WLE A;  3CCQ V;  1ZTE A;  4LBE C;  3ZRW B;  4MVZ A;  4LC1 A;  3K04 A;  3ZIA G;  4O4J B;  2YI6 A;  5B3S B;  3DC5 A;  4UV8 A;  2BU6 A;  3ABM B;  4DV6 B;  4CS4 A;  1ZXM A;  4QE9 A;  3RYC A;  3TCU A;  2YKC A;  1N34 B;  3RYF A;  4H7Q A;  1R3J C;  4X20 B;  4DUZ B;  1I08 A;  2BTQ B;  4MOT A;  1N4C A;  2P4V A;  5CTY A;  2YE3 A;  3GIG A;  5GTH Z;  4WBN B;  3RVY A;  4NH8 A;  3T2S A;  4DW1 A;  1XBL A;  3F7V C;  4FFB B;  4IT5 A;  4GKJ O;  3LMM A;  1U97 A;  1BQZ A;  2X0L A;  4DV4 B;  5JH7 A;  3W7U A;  2AGA A;  1GN4 A;  3DSQ A;  3JYC A;  3X2Q C;  4E01 A;  1G4Y B;  1SET A;  3CPW U;  4DZY A;  3OE7 G;  4J80 A;  4FLW A;  4WFE A;  2BYH A;  5LP6 A;  4DV7 O;  3BHP A;  2WWW A;  4GEE A;  4PD4 F;  3Q4H B;  3CB2 A;  3OMI B;  1XL6 A;  4LWG A;  4MVM A;  4G27 B;  3ZMU A;  4EMV A;  3BAA A;  4P9P A;  2AZ0 A;  2YXL A;  4EEQ A;  1T5E A;  5C93 A;  3D3I A;  4NXN B;  5JCO C;  4ZVI A;  2DMX A;  1TC6 A;  1NVP B;  5EZY A;  4EEH A;  1AIL A;  1NU1 H;  1THZ A;  3ASN B;  2BSM A;  1BZK A;  3CYO A;  2YJW A;  3U2D A;  2E76 B;  1VQL V;  5FPR A;  2YI7 A;  2Q9L A;  3B26 A;  4YJ3 B;  1HNZ B;  2YE6 A;  1OSF A;  2YK9 A;  3BA9 A;  4JAV A;  4LP0 A;  4L94 A;  4AQY O;  1RFY A;  1FXK C;  1F51 A;  1XQ8 A;  2CAZ C;  1N36 B;  3IAY A;  3O0I A;  1BMF G;  2DJV A;  3T1Y O;  5IYZ A;  3AK3 A;  2CE4 A;  1FXK A;  3JD3 A;  1AB3 A;  4YKU A;  1X4T A;  2A06 H;  5ITZ B;  4TSF G;  3T0H A;  3A0Y A;  1AR5 A;  4FCQ A;  4J42 A;  4GLX A;  3JAL A; 
#chains in the Genus database with same CATH homology
 3FYI B;  2YGA A;  3K03 A;  3LNU A;  3ABL C;  4YKQ A;  4UVC A;  2HKJ A;  4J9Z B;  1G8M A;  2HVK C;  3HB3 B;  5B1A C;  1TBW A;  2H8P C;  3TZ5 A;  2QF6 A;  2YEC A;  4CWO A;  3JD4 A;  1FXK B;  2HCH A;  1GM7 A;  3VHA A;  4LPB A;  1R6N A;  2BU8 A;  1GJV A;  2BTZ A;  1NR1 A;  5DM6 V;  1YES A;  1NVP D;  5CA3 A;  5IY5 B;  1I5A A;  2CH4 A;  2YI0 A;  4RUE A;  5FNC A;  4O0B A;  5D7C A;  2C2A A;  2XDX A;  4E00 A;  1GO3 F;  1YHQ V;  3LSQ A;  4BIU A;  4QPK A;  2JDI G;  3CMA V;  3G6E V;  2DQ0 A;  5M4E A;  1BL8 A;  2WI1 A;  4WFH A;  4L8Z A;  1R6K A;  2JJ1 G;  2Y69 B;  2WI5 A;  4KTN A;  3ZKB A;  3B25 A;  4MTO A;  2XHR A;  4LWI A;  1K5Q A;  2IJJ A;  4JTD B;  3ABL B;  1R3I C;  1JCH A;  1P4R A;  2A79 B;  4GX5 A;  4XTJ A;  1OCR C;  4XD8 A;  1YT2 A;  3K08 A;  2AKP A;  2WI2 A;  1AI4 A;  2OCC B;  3WG7 B;  2R9I A;  2UXN A;  2O1V A;  3ZRX A;  5L3F A;  3OWB A;  1B63 A;  4CWF A;  1W2B U;  4R8C A;  4E2L A;  3G75 A;  4MVU A;  4EM7 A;  4ASB A;  1NJI W;  1UY7 A;  2ZDY A;  1E79 G;  1OCC C;  2AHZ A;  1PNK A;  2QG2 A;  3B24 A;  3T4Z A;  4HYP A;  3K60 A;  3TZ0 A;  3OMN B;  5B3S C;  1JOY A;  2YE7 A;  4N21 A;  3QDD A;  4LWE A;  2YE2 A;  1TH8 A;  2Y69 C;  1OCZ B;  1YET A;  2YSU B;  3ZKD A;  4JF3 A;  3K06 A;  4EGI A;  1I5X A;  5B1A B;  4FCP A;  4O09 A;  5CF0 A;  3BEH A;  1VQK V;  1U0Z A;  1LNQ A;  3AG2 C;  2FXS A;  4XCL A;  4R3A A;  2BZ5 A;  1DTO A;  5B1B C;  2ZKJ A;  1N8R W;  4G2K A;  1QZR A;  2HG1 A;  4HAM A;  4FPP A;  5LHG A;  1AI6 A;  3OFN G;  5L3G A;  3FT5 A;  5CTW A;  3CP1 A;  4HZ3 A;  3CRK A;  1NH2 D;  3BY6 A;  2BU5 A;  2YED A;  3EKR A;  2QEX V;  1IXM A;  2KB1 A;  1OHH G;  3E2E A;  3W7W A;  3MNR P;  4WFG A;  1AMW A;  2E0A A;  2WPD G;  2WLM A;  4WF9 V;  1TID A;  3B8M A;  3T2M A;  3CD6 V;  1K97 A;  1DLB A;  2VCJ A;  4W7T A;  2IJH A;  3PJS K;  2ZDI C;  2ITC C;  5GW7 A;  2P90 A;  1Z59 A;  2CK3 G;  4JQL A;  5FNF A;  4R6Z A;  3FB6 C;  2IJI A;  1OCC B;  2ITD C;  2CCU A;  3SPI A;  4ZBM A;  4XIT A;  2XOK G;  3QO7 A;  3TUH A;  4BAE A;  2IH3 C;  1Y8O A;  3CC4 V;  4QJF B;  1M57 C;  4OXS A;  3I55 V;  3ABK C;  2XHX A;  1Y4U A;  2H55 A;  3LDD A;  1S76 D;  2WLH A;  4R3M A;  3A0R A;  1W0J G;  2DYS C;  5EBL C;  1L1F A;  2IWS A;  3ZXQ A;  4BIZ A;  1NHJ A;  1PKX A;  3HZ5 A;  3GB7 C;  2WLL A;  1YC4 A;  1Y66 A;  2WLK A;  5E1A C;  4CWR A;  4YKY A;  4MVS A;  3RW0 A;  3H80 A;  4EKW A;  2QM8 A;  1K8A W;  5L3J A;  3R4M A;  2B1G A;  2QFO A;  4TWK A;  3HPL C;  3HHU A;  3OWD A;  4FCR A;  4GT8 A;  4WUC A;  3A0T A;  3QNE A;  3MHH C;  4JTA B;  3EHJ A;  2DQ3 A;  4HYO A;  2XAB A;  3JZ3 A;  4YKR A;  2W0F C;  1TIL A;  4MPE A;  4B7P A;  1YJ9 V;  3AG1 C;  1EFR G;  2B5U A;  4LP8 A;  4MSW C;  1DF5 A;  2JKI A;  3GIG B;  4XIQ A;  3STZ C;  1A4H A;  5D7R A;  3R92 A;  5M4N A;  4PDM A;  2UXX A;  3SYQ A;  5IY5 C;  2YEJ A;  3OAA G;  4L91 A;  4O05 A;  2NNU A;  2DWE C;  2Q2E B;  2F43 G;  3SL2 A;  2YE5 A;  2ZDI A;  1JM6 A;  3AG2 B;  2WEP A;  2YKB A;  3HEK A;  2P67 A;  1SRY A;  4MW3 A;  5L3E A;  4CWS A;  1QCE A;  3NXS A;  1AR1 B;  4CWP A;  4KSH A;  1UYF A;  4E02 A;  3FKS G;  3FV5 A;  3CCR V;  3LDE A;  3UM7 A;  2ZR2 A;  3RLP A;  3P30 A;  1BGQ A;  2NLJ C;  1VQ7 V;  1I5D A;  2LFS A;  1VQ8 V;  4KFM A;  4PA3 A;  4AWP A;  1UYL A;  1I5B A;  1Y4M A;  4MBC A;  1SER A;  5LBQ A;  3K0G A;  4YKX A;  1L0O A;  1UYC A;  1ZXN A;  4I9W A;  3G7E A;  1R73 A;  1Q81 W;  4PL9 A;  2XX2 A;  3DGE A;  3LPS A;  2AHY A;  1YJN V;  1NR7 A;  2BOC C;  3CME V;  2EIN C;  5LHH A;  1FXH A;  3PEJ A;  1XL4 A;  3R4N A;  4HXW A;  5IYC O;  2Q8F A;  1YC3 A;  1AI7 A;  3CCS V;  1BXD A;  2EIL C;  5CTX A;  4X9L A;  4YKW A;  3AG4 B;  4MTG A;  4QIW F;  1AH8 A;  4YXW G;  2WLI A;  4CE1 A;  2HG5 C;  3VHC A;  1F4M A;  3INW A;  4KUM A;  4GX0 A;  1GKF A;  4H37 A;  4JGS A;  4JPR A;  4MT8 A;  3ZM7 A;  5KUK A;  4P7A A;  3ZN1 A;  1NH2 B;  1WPX A;  4QPJ A;  2YEV A;  4F4L A;  1E1R G;  2XJJ A;  3CC7 V;  5B1B B;  2CCT A;  2Q6A A;  3WFV A;  4WFA V;  4XDK A;  4N23 A;  3SJQ C;  3E8F A;  3EHG A;  1RM1 B;  1I5C A;  1KQS U;  1Y8N A;  1JVM A;  3K9A A;  1UJW B;  1YC1 A;  2WLL B;  4WUD A;  1EA6 A;  1KP2 A;  2XAG A;  3ZRW A;  1US7 A;  1JPX A;  2ZXW C;  2WLI B;  5HFL A;  4DO2 A;  2VW5 A;  3B27 A;  3Q5J A;  1VQ9 V;  3G4S V;  1QBZ A;  1AJN A;  2BRC A;  3BMY A;  3OGC C;  5F5R A;  1NHI A;  2YEA A;  5LGT A;  1DF4 A;  2HR3 A;  3G71 V;  1VQO V;  2QM7 A;  1KD1 W;  1VQ5 V;  1S14 A;  2XDU A;  3TTZ A;  4LWF A;  2Y48 A;  1TC0 A;  1NKD A;  4MP2 A;  4QE7 A;  3CCU V;  1UYM A;  2YKI A;  2W6I G;  1S0V A;  1KZN A;  1U2O A;  2IH1 C;  1Y4S A;  3E8H A;  1QY8 A;  1FS0 G;  2Z3Y A;  5L3D A;  1RPR A;  1CP9 A;  2P6J A;  2X6C A;  2ZR3 A;  3ML0 A;  2BU2 A;  3FT8 A;  3GIF A;  2WI6 A;  3OW2 U;  2WI3 A;  4XC0 A;  2XAQ A;  5LGU A;  4O07 A;  3CRL A;  4UXN A;  2HLD G;  2JEU A;  4GX2 A;  4MTF A;  3OPD A;  2XDS A;  3WQ9 A;  4CWQ A;  3GIE A;  1BYQ A;  1ZWH A;  2OT5 A;  1S16 A;  1OCZ C;  4DXW A;  3FB5 C;  3HZ1 A;  1YS3 A;  1UYI A;  1VQ4 V;  2W6J G;  2HFE C;  3O2F A;  4BQJ A;  4WFF A;  5EBW C;  1PL0 A;  4FK5 C;  4K4O A;  1S77 D;  2HVJ C;  3JD2 A;  2PI5 A;  2PNR A;  4Z1M G;  2IWX A;  2EZO A;  3OR6 C;  3ZMS A;  3ABK B;  2UWD A;  1AI5 A;  4GQT A;  3E89 A;  4Q20 A;  4R50 A;  1MSW D;  4L93 A;  3R4P A;  2H94 A;  1B6Q A;  2WER A;  3AG3 C;  4NH7 A;  1QR9 A;  2YEH A;  4G28 B;  4GCZ A;  2Q68 A;  3EHB B;  5F3K A;  5DN6 G;  4WUB A;  1NQT A;  3VOU A;  4FIP C;  2YKJ A;  5H9C A;  1EZJ A;  4WFB V;  3SPH A;  4XKA A;  1B3Q A;  1K3E A;  2JJC A;  2X6A A;  2OTL V;  4YKT A;  1M9N A;  1KP3 A;  2JIZ G;  2YEE A;  1EBO A;  5CBG A;  1UYH A;  2BRE A;  2EXL A;  1QR8 A;  3INX A;  4PDV A;  4URM A;  1QLE B;  1SES A;  3E35 A;  2IJK A;  4V25 A;  2YGF A;  5GGZ A;  4EGH A;  2WI7 A;  1EI1 A;  3A0Z A;  2CCS A;  1V55 B;  4O04 A;  3ZMT A;  1GTO A;  2B1I A;  2Q69 A;  4PA4 A;  3TK1 A;  5HFM A;  1K33 A;  4CWT A;  3R4O A;  1M56 B;  1QLN A;  1K4C C;  3TZ4 A;  1K7D A;  1YT1 A;  4XKO A;  5FWK A;  4JAS A;  1YIT V;  1ORQ C;  2ZBK B;  1OCO B;  1KKD A;  1GM9 A;  3ASO C;  3Q5L A;  4KP4 A;  1QVF U;  3NMQ A;  1AJ6 A;  4KFG A;  1S5H C;  4R1F A;  2WLN A;  5B1N A;  2YEV B;  2XDK A;  4L87 A;  4QNH B;  1H8H G;  2ZQM A;  1M90 W;  2VCI A;  4GGL A;  2XND G;  3EHF A;  2LP7 A;  3HYY A;  4AS9 A;  4DUH A;  4UVA A;  2QG0 A;  1SZT A;  4UVB A;  2A0L A;  3ZMV A;  3OEE G;  4HYM A;  2BT0 A;  2QA4 V;  1QLE C;  2XX5 A;  4RQF A;  3ETE A;  2O1W A;  4AWQ A;  4MTX A;  2EIJ B;  4X8A A;  2A9H A;  4BW5 A;  1PD3 A;  3K3W A;  1UY8 A;  5KA6 A;  3VBB A;  4U93 A;  2P7T C;  2BU7 A;  4ASU G;  3E8G A;  2LFR A;  1MU5 A;  4URN A;  2YEI A;  2EIM B;  3D36 A;  2GHY A;  5D6P A;  1AJP A;  4P8O A;  3LNM B;  1UYK A;  3T4D A;  3U67 A;  2GSM B;  3MD0 A;  4GT1 A;  2FYP A;  4CBC A;  2H8M A;  2XAJ A;  5D7D A;  3A0X A;  5EK0 A;  1I59 A;  3K79 A;  1V55 C;  3GWO A;  4MPN A;  3PEH A;  3F5W C;  4JYB A;  2ZDX A;  3SPJ A;  5CMU A;  2YEB A;  1YIJ V;  2K1E A;  4HZ5 A;  5CPH A;  3RLQ A;  4AWO A;  2YEG A;  1QYE A;  1Z5C A;  3AG1 B;  2MK3 A;  1PNL A;  3RBZ A;  1YT0 A;  3OW6 A;  3FB7 C;  2XAF A;  3F7Y C;  4RO2 A;  1Q86 W;  4I5S A;  4PA7 A;  2CG9 A;  2GQP A;  3C0E A;  3C11 A;  2YEF A;  1AH6 A;  4DZY A;  4V26 A;  3T1C A;  3HYZ A;  1ID0 A;  1E1Q G;  3G7B A;  3FB8 C;  1K4D C;  3SPC A;  3SPG A;  2CGF A;  1I5Y A;  1J95 A;  1PNM A;  3ZCC A;  5M4K A;  1GK9 A;  2DYS B;  2BOB C;  4MS2 A;  4MW8 A;  3SYO A;  5IYB O;  1VQ6 V;  3B28 A;  2Q8G A;  4ASF A;  1ZWI C;  5CN0 A;  1RPO A;  3CCL V;  2K5B A;  1BHA A;  1KIJ A;  1UYG A;  4PA6 A;  1HWY A;  2QTO A;  4J9Y B;  2PI4 A;  1GKX A;  1THN A;  2WI4 A;  2YKE A;  3CGY A;  4PRX A;  3ZMZ A;  2YGE A;  1M1K W;  1BHB A;  2HJF C;  1COW G;  3LDC A;  2D3O W;  3DTU B;  1Y8P A;  3MHS C;  4U7O A;  1BKN A;  1Z5A A;  4RQE A;  3P32 A;  3RLR A;  4PU9 A;  3OMA B;  4FMT A;  4XDJ A;  1JQ0 A;  4MVQ A;  2YK2 A;  3D0B A;  3IED A;  3KE6 A;  5J71 A;  1VQN V;  5D6Q A;  5EBM C;  2FTK A;  4JYC A;  4H85 A;  2IOR A;  1K34 A;  4LCU C;  2Q8I A;  4URO A;  2R9R B;  3B8N A;  1KEC A;  1AJQ A;  4PA9 A;  4B6C A;  5M4H A;  3WHA A;  3RKZ A;  3OUS A;  4XDL A;  2XK2 A;  3ABT A;  1MAB G;  2YE4 A;  4L90 A;  1ROP A;  2DYR B;  5BOC A;  1M57 B;  3EKO A;  4GFN A;  5EC2 C;  1VQP V;  4R7C A;  4RUF A;  2XAH A;  1MX0 A;  3RVZ A;  3D2R A;  4P2Z A;  4EFU A;  5KA5 A;  3ASN C;  5LHI A;  2XCM A;  3LSS A;  2HKO A;  3CCJ V;  3U2K A;  5CTU A;  3M99 B;  3E8B A;  2DYR C;  4PEL A;  2YJX A;  3SYC A;  2EIN B;  4CZZ A;  4H33 A;  1MOF A;  3CCV V;  1VQM V;  4HY1 A;  3TET A;  1S72 V;  4P9O A;  1YTF B;  1RM1 C;  2JEX A;  2XAS A;  1Z5B A;  4MVR A;  4KQV A;  3IFX A;  3VHD A;  4HXZ A;  1NHH A;  3K99 A;  5M4P A;  4XCJ A;  4XDM A;  2M7W A;  3O6O A;  4I3H A;  1OZ0 A;  4XIP A;  3AEI A;  1YSC A;  3ETG A;  2GFD A;  1W0K G;  4X88 A;  3OR7 C;  2IU3 A;  1OCO C;  2Q67 A;  3ETD A;  4MB9 A;  1WLE A;  3CCQ V;  1K5S A;  4LBE C;  3JCZ A;  3ZRW B;  2XD6 A;  2IWU A;  4MVZ A;  4KSG A;  4HY6 A;  4EGK A;  2IW5 A;  5IDJ A;  2Z5U A;  3AG3 B;  3K04 A;  4LC1 A;  5EC1 C;  3ZIA G;  3ZRS A;  1Q7Y W;  3K98 A;  5IYD O;  3SYP A;  3H01 A;  2YI6 A;  4TT3 G;  5B3S B;  3FYE B;  3OUF A;  2JK5 C;  3ABM B;  4UV8 A;  5L3B A;  1B62 A;  2BU6 A;  1ZXM A;  2WEQ A;  1NBM G;  1UYD A;  3TZ2 A;  3W7S A;  1YER A;  4QE9 A;  3H4L A;  4NH9 A;  1R3K C;  3TCU A;  2XJX A;  2YKC A;  3OMU A;  1GM8 A;  1YSR A;  1Q82 W;  3BM9 A;  2EZP A;  3CC2 V;  4X89 A;  1R3J C;  3QO5 A;  3W7T A;  4H7Q A;  4XKK A;  3E83 A;  2DW4 A;  1F4N A;  2DWD C;  2V1D A;  3IGA C;  2BYI A;  2YI5 A;  1K92 A;  5IN9 A;  4MOT A;  4WCE V;  5CTY A;  5B1O A;  2YE3 A;  3GIG A;  1UY9 A;  1UY6 A;  3RVY A;  4XBF A;  4NH8 A;  3CCM V;  1GKZ A;  1F23 A;  4UUJ C;  1OCR B;  3T2S A;  2XX4 A;  4CE3 A;  4ZKI A;  4PDR A;  3F7V C;  2IU0 A;  2ZXW B;  3CGZ A;  5CBH A;  1S3J A;  5FL7 G;  3OM3 B;  2EIK C;  1H7U A;  3SYA A;  1R62 A;  2X0L A;  1ARO P;  2EBO A;  3W7X A;  3W7U A;  3R91 A;  2ATK C;  1K9M W;  2XJG A;  2FWY A;  3JYC A;  3X2Q C;  1YI2 V;  1H7S A;  4E01 A;  4PRV A;  4JAU A;  4MPC A;  1G4Y B;  1SET A;  3CPW U;  3CCE V;  1ZW9 A;  3OE7 G;  5CBF A;  5J9P C;  4WFE A;  1GMG A;  4RAI A;  1H38 A;  1YTF D;  2BYH A;  2ESA A;  3T0Z A;  4MP7 A;  2XDL A;  4JTC B;  2WWW A;  1FXV A;  3CWV A;  3K97 A;  2EIM C;  3AG4 C;  1K73 W;  4GEE A;  3A0W A;  1CPY A;  3IC7 A;  4UV9 A;  3EHH A;  3OMI B;  5J6A A;  2EIL B;  5H6R A;  4P30 A;  1P7B A;  2X7R B;  1XL6 A;  3EFF K;  5H6Q A;  4BXI A;  4LWG A;  4MVM A;  4G27 B;  3ZMU A;  3ABU A;  4EMV A;  3ZRV A;  4P9P A;  4XE2 A;  4URL A;  2VWC A;  4HZ0 A;  3ZXO A;  1AM1 A;  2QE7 G;  4BQG A;  5C93 A;  3STL C;  3D3I A;  2ZD9 A;  4BAY A;  1PVG A;  3QTF A;  4EFT A;  3T10 A;  1JJ2 U;  2YE9 A;  4ZVI A;  3VAD A;  1TC6 A;  1MG1 A;  1FFT B;  1V54 C;  2FWZ A;  4ASG A;  3ASO B;  1NVP B;  1H8E G;  2QKS A;  2WLJ A;  1H2G A;  4EEH A;  3ASN B;  2BSM A;  1THZ A;  5L3C A;  4LWH A;  1YSZ A;  4U7N A;  1ENV A;  3CYO A;  3JD0 A;  2IOP A;  2YJW A;  3U2D A;  2Q8H A;  4MVO A;  1M56 C;  3I56 V;  4CWN A;  1VQL V;  2YI7 A;  3LUT B;  2WAM A;  3B26 A;  4GX1 A;  1TUE B;  2X6B A;  1QVG U;  2O1U A;  3Q5K A;  5FND A;  2YE6 A;  3T1K A;  3X2Q B;  1OSF A;  3K0D A;  2YK9 A;  5BOD A;  2OCC C;  4JAV A;  3ABM C;  3WG7 C;  5BZB A;  4L94 A;  4LP0 A;  5IDM A;  1FXK C;  5KUM A;  1F51 A;  2EIK B;  3JD1 A;  3QO8 A;  3UKM A;  1KC8 W;  4CE2 A;  3CXC U;  3O0I A;  1BMF G;  1YJW V;  4XIR A;  5M4M A;  2YE8 A;  5LGN A;  3ZN0 A;  3R65 A;  2EJR A;  4YKZ A;  1R3L C;  3B77 A;  2OTJ V;  4FJC C;  1UYE A;  1V54 B;  2V7Q G;  3KG2 A;  3OEH G;  2IOQ A;  4ASA A;  1FXK A;  2XHT A;  2JJ2 G;  3JD3 A;  4YKU A;  1JX9 A;  2WSS G;  1CEZ A;  4TSF G;  3T0H A;  3A0Y A;  4H81 A;  3E86 A;  3ZJZ A;  4FCQ A;  1I58 A;  2EIJ C;  4PDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...