4JAUA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
232
Chain Sequence
SKELERLKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 76
structure length 232
sequence length 241
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jauA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jauA02
4MPNA 1BGQA 2XJJA 3B28A 4BQGA 4XKKA 4GFNA 5CF0A 2YECA 1JM6A 4P7AA 3C0EA 4MP2A 1B62A 4URLA 2LFSA 4O07A 2YK9A 2BU6A 3R4PA 2IWUA 1UYGA 4O05A 1UY7A 4H7QA 1ZWHA 2FWZA 2VCIA 1NHJA 3TTZA 3EKOA 4MP7A 3G7EA 4ZVIA 4I3HA 1I5AA 1YSZA 4XD8A 4CE3A 3LNUA 2BU8A 4KQVA 4NH7A 1L0OA 4CWTA 3EHHA 2YGFA 3R92A 2QFOA 1Z59A 3H80A 4FCRA 3EKRA 4MPEA 2GFDA 2BYHA 3ZKDA 4ASGA 4XIRA 2WI6A 2YI6A 3ZCCA 3TZ0A 1ZXNA 3A0RA 1UY9A 4BXIA 3C11A 3FT5A 2HG1A 2YJXA 3B27A 2IWXA 3T10A 5B1OA 2BREA 5CPHA 4YKTA 4XTJA 3OMUA 2VW5A 1YERA 4LWEA 1KZNA 4EFTA 3OPDA 2LFRA 1UYEA 3CRKA 1YC1A 3HZ1A 2XDXA 3K97A 4XIQA 1TILA 3A0TA 3CGYA 5M4NA 4E00A 4KTNA 3RLRA 4K4OA 4ASAA 2YE6A 3HZ5A 3TK1A 4URNA 1GKZA 4XKOA 2XDKA 4AWOA 3A0WA 4PU9A 1QY8A 4L94A 1Z5BA 2YEIA 4B7PA 5FWKA 3ZXOA 1I5BA 1TC0A 5FNFA 1AH6A 2XJGA 3ZRWB 1TBWA 1YESA 1Z5AA 5D7RA 2O1UA 4BQJA 4JAUA 4ASBA 1YC3A 4H81A 5F5RA 1UY6A 1UYIA 2WI5A 2FWYA 2YEHA 3GIEA 3K60A 2YI7A 4CE2A 2QF6A 1PVGA 3U2DA 5GGZA 2YKIA 2HKJA 4EM7A 1ZW9A 4DUHA 2YEBA 4LWHA 2XDLA 1YT2A 1U2OA 3GIGB 2YKCA 4ZKIA 2BSMA 2QG0A 3B25A 5CTYA 1YT0A 1AH8A 4X9LA 4MTXA 1OSFA 3B26A 2BU2A 1YETA 4GCZA 4BIUA 4U7OA 5C93A 4L8ZA 5J6AA 2YE4A 1BKNA 1YC4A 2WI1A 2YE2A 4GQTA 4YKZA 5BODA 2VCJA 3T2SA 2WI7A 3K98A 4XIPA 3R91A 1U0ZA 3ZXQA 3HHUA 4HXWA 2WEPA 2CGFA 4XDMA 5D6QA 1YSRA 2XD6A 4EEHA 1Y8OA 3P32A 5IDJA 4GGLA 5M4PA 4CE1A 2YEJA 4QPJA 4PRXA 2YEAA 3O2FA 4KP4A 2CH4A 3JZ3A 2YE3A 4O0BA 3MD0A 3CWVA 4XCJA 3R4NA 3T1KA 2WERA 2YE7A 3VADA 4MPCA 2XDSA 4XITA 1Y4SA 4P8OA 1Y4UA 3OWDA 2Q8GA 2O1WA 3ZKBA 2WI3A 3BMYA 1I5DA 3TZ4A 4E01A 4CWNA 4AS9A 4JASA 4LWGA 1BXDA 2CG9A 3ZRXA 5M4MA 4FMTA 3RLPA 2XX4A 3DGEA 2IORA 4B6CA 4YKRA 2CCTA 1A4HA 3FV5A 1Y8NA 4YKWA 5B1NA 3CGZA 4L90A 4ASFA 3G7BA 2XABA 3O6OA 4U7NA 4R3MA 4LWIA 1UYDA 1I59A 1TC6A 3QDDA 2BZ5A 2FYPA 1YS3A 5D7DA 1GKXA 4URMA 2BYIA 1R62A 3NMQA 4AWQA 4V25A 4HYPA 4L91A 2E0AA 4WUBA 1US7A 3K99A 3RLQA 2P67A 2IOPA 2WI4A 2XHRA 2YEFA 1GJVA 5L3JA 3A0ZA 3SL2A 4EGKA 4R1FA 2BRCA 1UYKA 1Z5CA 2UWDA 3TZ5A 3OW6A 3CRLA 4KSHA 4DZYA 1BYQA 2YE8A 3OWBA 2XJXA 4EGHA 5D6PA 5FNCA 3A0YA 2EXLA 4JQLA 2QG2A 2ZBKB 3HEKA 4O09A 2ZKJA 5CTWA 5CTUA 2K5BA 2YE9A 3EHGA 4MT8A 1UYMA 4I5SA 4QPKA 3GIFA 3VHCA 1I5CA 4CWRA 2XK2A 3MNRP 3INWA 5FNDA 3NXSA 4H85A 3H4LA 4NH9A 3Q5KA 3ZM7A 2YEDA 5J71A 2JKIA 4EMVA 2H55A 5IDMA 4BAEA 1UYLA 2CCUA 2BU5A 4WUDA 2FXSA 3BM9A 1AMWA 1THNA 3T0HA 1H7UA 3U2KA 2Q8HA 2BT0A 3KE6A 3IEDA 4GEEA 1B3QA 5M4HA 4CWPA 3EHJA 4HZ5A 1UYFA 3TUHA 4WUCA 2CCSA 1EA6A 4V26A 3HYYA 3WHAA 2YEGA 2XX5A 3HYZA 2YJWA 4W7TA 3R4MA 2C2AA 3ZRWA 4UROA 1NHHA 1JOYA 1IXMA 2XHTA 4HZ0A 3D36A 3FT8A 3Q5JA 4HXZA 4XE2A 4MB9A 2YI0A 2BTZA 1AJ6A 4XKAA 5D7CA 3Q5LA 1NHIA 2WWWA 2IWSA 4XCLA 2YKBA 3ZRVA 4KSGA 2Q8IA 3PEJA 2YKJA 2JJCA 3TZ2A 5M4EA 3U67A 4JYBA 4CWOA 3GIGA 4Q20A 4U93A 3T0ZA 4EGIA 4HYMA 1TH8A 2ESAA 3A0XA 2YE5A 4GT1A 5IN9A 2GQPA 3G75A 2XCMA 2YI5A 1H7SA 2H8MA 2Q2EB 1QYEA 1UYHA 2ZDYA 2QM7A 2YGAA 2XX2A 1Y8PA 1I58A 3R4OA 4YKYA 5F3KA 4E02A 4GT8A 4AWPA 2AKPA 2XHXA 1EI1A 4JYCA 2YEEA 2QM8A 3QTFA 4YKXA 1MU5A 3PEHA 4L93A 3WQ9A 4FCQA 2WEQA 2VWCA 3EHFA 3D2RA 1QZRA 1MX0A 2FTKA 3O0IA 2BU7A 4PRVA 4O04A 4BIZA 3LPSA 3INXA 4CWQA 1UYCA 2YK2A 4KFGA 1S14A 3B24A 1B63A 2YKEA 4YKUA 1F51A 4XC0A 1UY8A 3VHAA 2HCHA 3D0BA 2PNRA 4NH8A 5BOCA 2Q8FA 1S16A 1TIDA 1ZXMA 4LWFA 4MBCA 5CTXA 3VHDA 4LP0A 2IOQA 4EFUA 1YT1A 5M4KA 1AM1A 1KIJA 4HY6A 4MOTA 4FPPA 2XDUA 4LC1A 2O1VA 4FCPA 4PL9A 4CWFA 4YKQA 4JAVA 4R3AA 2WI2A 4HY1A 3RKZA 2ZDXA 2YGEA 4LPBA 4CWSA 1ID0A
chains in the Genus database with same CATH superfamily
1YDXA 3ZHQA 3DC6A 1SERA 3B28A 1RSOA 2JDIG 1FXKC 4P7AA 1SC5B 1XUQA 1DK1A 3AG7A 3C0EA 4MP2A 1R3IC 1B62A 5KHGA 4URLA 1MOFA 4LF9B 3R4PA 3M7MX 5A9GA 1UYGA 4TSFG 2P7TC 4H7QA 1AI5A 4FLWA 4BW5A 3TTZA 4I55B 4ZVIA 4X64B 5J2TA 1I5AA 4CE3A 1N32O 3UT5A 3VQWA 4LFBO 4KQVA 4NH7A 1L0OA 3EHHA 2YGFA 1Y4MA 3E86A 1SKVA 1GM7A 3B8NA 5BXZA 4KFMA 4JGSA 1MNGA 4O4JA 2GFDA 5EBWC 2BYHA 4JI1B 1PNLA 3ZKDA 4NTYA 4XIRA 2DW4A 2YDEA 2OT5A 2YI6A 3P3PA 2Y4TA 3A0RA 2BSKA 2LQTA 4I9WA 1RM1B 2HG1A 4DR2O 1YEWA 3OW2U 5CPHA 1OCCB 4DV1B 4XTJA 2AGAA 1YERA 4CS3A 1QVFU 4Z1VA 1KMIZ 3OPDA 4MSWC 2ILMA 1UYEA 3K9SA 2CE4A 1TVKB 3JD3A 1XNQO 3JAWA 1Q6IA 3RLRA 3CRAA 4ASAA 1N34O 5JVDB 3L75H 3HKDA 3ZMVA 2PI4A 5J2UB 4ICGA 3ZHUA 2ARHA 3C90A 2XDKA 2ZIMA 2OTJV 3A0WA 4J7ZA 1SQGA 2PTMA 1AR1B 3OT7A 4LF9O 1TC0A 4JF3A 2A7WA 4OPHA 1JA8A 4DV3B 1TBWA 1YESA 5IJ0A 3K57A 1Z5AA 1QQCA 2EZOA 3CCQV 5EYPB 3J80N 4JAUA 1PNMA 3CP1A 3T1YO 3ABKC 4N23A 1YC3A 5AG2A 4B08A 1R6TA 4OPAA 4H81A 4I7ZB 5CBHA 3FX7A 2FWYA 4X1YA 2YEHA 3CYGA 1D2DA 3K59A 3U2DA 4DUHA 1GMGA 4I50B 4LWHA 1HW7A 2PYJA 4DR1B 4JI1O 1YZBA 3EHBB 2BSMA 3L70H 4JZGA 4LP8A 2ATKC 4NYKA 4PHZA 5CTYA 5H2FZ 2HJFC 1NS1A 5GTHZ 4GCZA 3A0BZ 5C93A 2ZIOA 4JI0B 1DTOA 4DV1O 4JTAB 2IBZH 2UXDB 2WLJA 5B5EZ 1EZJA 1VF6C 4Z2WA 2AZ2A 3GVMA 3CC2V 1AILA 3UKMA 1Y74B 1AI6A 3RT3C 3OUSA 2VQFB 2WEPA 5D6QA 4LF5B 5L3FA 1YSRA 3ZN1A 2YI8A 5B1AC 3OGCC 2Y4UA 4EKWA 3G6EV 4EEHA 5IDJA 4CE1A 1RP3B 1M57C 4QPJA 4PRXA 2Q5ZA 3K3WA 4MTOA 1ENVA 3CC7V 4CC6A 5ITZB 5JJEB 4JYAB 5EC1C 2ZD9A 4XITA 4A5UB 2Q8GA 1Y4UA 4AILC 3F5WC 2WI3A 3BMYA 2MK3A 5JJNB 1I5DA 2C1IA 3TZ4A 1S5LZ 4AS9A 4JASA 4X8AA 2CG9A 4EFBA 4TQFA 5KA6A 1PL0A 2CCTA 5LMNB 3OR7C 4DR1O 2DYRC 2HG5C 1PD3A 2C1GA 2EINC 2XAQA 2XABA 1ZUQA 3O6OA 4R3MA 1ZAUA 1UYDA 2Q7HA 2R9AA 4O4IB 1GKXA 4JI0O 2BYIA 3W7WA 4AWQA 3VBBA 4HYPA 4L91A 2UXDO 5LHIA 1MZFA 3RLQA 4B7KA 2EIKB 4ABMA 1YTFD 1VP7A 2XHRA 1YITV 3I55V 1BMFG 3SL2A 1K4CC 4UCUA 1THZA 3SYPA 3BPZA 3T1HB 4R1FA 2FYUH 4EEQA 4CS2A 2VQFO 3E35A 4LF5O 2QKCA 2UWDA 2X6CA 1SA0B 1M57B 4FM1A 3OW6A 2X7RB 1JCHA 2E74B 2XJXA 1N36B 5EBMC 1MSDA 4JQLA 3H1KH 2Q7EA 3WB1A 3LNNA 5CTUA 2K5BA 3EHGA 3JCUZ 4MT8A 4I5SA 1KU9A 4LNUB 1I5CA 1GN3A 2XK2A 2XAFA 3O9OA 3INWA 1SQPH 3HKBA 1ZTEA 1YTFB 2LJ2A 3N2GB 3BY6A 3ZHVA 1X4TA 4PDVA 5J71A 3OMIB 3JAMN 1LUWA 2YIDA 1QNMA 2H55A 1XL4A 4RUEA 5IDMA 1EN5A 1UYLA 5CBFA 1AROP 1FS0G 3QNEA 1AP6A 1S3JA 4MVQA 1QU7A 5LMNO 1XBLA 4CH3A 4X20B 2ZR3A 3KE6A 1R3JC 4GEEA 5M4HA 4ASUG 2DOSA 4DRXB 5LMUO 3K5MA 4JI7B 2QJ1A 2ADPA 1SF9A 4FLUA 3SYCA 1BGYH 4JI2B 2Y69B 3IJ4A 5KHIA 2NR5A 2VWJA 4RAIA 1VQ4V 3WHAA 2XX5A 2WLKA 4J7JA 4YJ2B 3HYZA 2YXYA 1WNSA 2P4KA 2C2AA 4X1KA 1NHHA 1JOYA 4DR7B 4FJCC 1VMGA 5KLVH 3Q5JA 5CB4A 3AG3C 3T1HO 4YY3B 1GH6A 2GHYA 5D7CA 1XDCA 1N36O 2WSSG 3D36C 2YKBA 2DYSB 1RPRA 1GN6A 2BCCH 4NXNB 4KSGA 2Q8IA 3M8AA 3ZN0A 4LF7B 4FZ0A 1S76D 4KL1A 1KYOF 3TZ2A 2QSAA 4LWSA 4JYBA 4U93A 3BHPA 3SPIA 5IN9A 2GQPA 2GSMB 4JYYA 2YI5A 4LF4O 2ZDIA 1JR9A 4J9YB 2HHIA 1QYEA 4LFAB 5KMGB 4K8ZA 1QLNA 3ABMB 3GB7C 5F2VO 2QWNB 3DXRB 1BS3A 3JD0A 1XQ8A 2GTSA 3U10A 1N0JA 2JGDB 1GRJA 3PEHA 4L93A 5LGUA 1NH2D 4FCQA 5IJ9A 2LW1A 3DC5A 1SQXH 2OIGA 4JI7O 1VARA 1QZRA 2WLHA 2ZE8A 3RYCB 3JATA 3CCMV 2PUSA 1Q5OA 4LR3A 1SQVH 3LPSA 5EBLC 4J7KA 4G27B 4JI5B 5FPOA 3E2EA 1UYCA 1EM1A 2IJIA 3AG3B 1S14A 4GX5A 3K0GA 4HAMA 1FFXA 4DR7O 2X0LA 1H2GA 1VQOV 2OCHA 1US6A 2ZR2A 4J42A 3VHAA 4YY3O 5LP6A 1FPOA 1LUVA 3UQ8A 2AZ0A 4DR3B 4ZBMA 4NH8A 1ZLZA 2Q8FA 1YCIA 4WCEV 1ZXMA 1NH2B 3SGIA 3X2QB 3MAQA 3RYFB 4JV5B 5CA0A 1N33B 3ETDA 1F4NA 4LP0A 2IOQA 3VHDA 1GAXA 4EFUA 2ZNIA 3HKEA 1YT1A 2CGNA 1BHAA 4NXNO 1VQ7V 1HDJA 2YEVA 4LF7O 3UM7A 3CS5A 2Z0AA 3SJQC 4FCPA 4CWFA 4YKQA 2DWDC 2KG7B 5GONB 4JAVA 3N2KB 2YC0A 1I5YA 1NT2B 5H9CA 4ZI7A 3JYCA 2UXXA 1AJQA 1FD9A 1H2LA 4LFAO 1VIBA 3JD1A 1BGQA 1Y6XA 4UCTA 4MPNA 4TV9A 2A0LA 1YHQV 2XAGA 4AHCA 3CD6V 4G2KA 1HR0B 5LGTA 4B3MB 5KAFZ 4UV9A 2F43G 4IIJA 2L6LA 3B09A 5JH7B 4FFBA 4E2LA 5LA6B 4TV8B 2IWUA 2GDSA 2V7QG 2OYQA 1CPYA 4IGGA 1VQ8V 2WAMA 2VCIA 3T4DA 2W6IG 4JI5O 5KHJA 1YSZA 4XD8A 3ZHRA 3F5TA 1OCZB 3L73H 3VOUA 2BU8A 1KC8W 3CJHA 4TOIA 4XDLA 3R92A 1BQ0A 1Z59A 4DR3O 1GKFA 3JD2A 5BR8B 3CX5F 2UXBB 4MPEA 4HYOA 3ZHSA 4JV5O 1NI8A 4ASGA 3E8GA 3JAKA 3OE7G 2ZXWB 3IAYA 3TZ0A 4TQDA 4BXIA 3C11A 2F66C 2Y0PA 3F7VC 1B06A 3G4SV 1XMQB 2GBOA 1TUEB 3B27A 4TT3G 2HVJC 4FLXA 3CMAV 2BREA 4DYLA 4X89A 3TXQA 2VW5A 1K4DC 2PY5A 2LFRA 3FAVB 2B1IA 3HZ1A 4WBNA 3SJAC 1TILA 3A0TA 3CCEV 5M4NA 3E8HA 3RGBA 4E00A 4KTNA 5KX5A 4O4LA 3AG4C 2RMKB 3HZ5A 3E22A 2G38A 4WFGA 4JI8B 2DE0X 4C7UA 4HBNA 2CH7B 1HR0O 4DV7B 4B3MO 4AWOA 2Z5UA 4LFBB 4F6RB 4PU9A 5JCOA 4B7PA 3NR7A 5B1BC 3J7AU 5FWKA 1TA8A 2JGUA 1AH6A 5L3CA 2DWEC 3OM3B 4DR4O 2EILC 4GX0A 1DF5A 2HP8A 2W6JG 1IDSA 4OX9O 1YSCA 4TUYB 4R50A 1XHZA 5F5RA 3B2EE 3JARB 4DUYB 3AG1C 3JALA 2YI7A 1AVMA 2QKAA 4YJ3A 2QF6A 5GGZA 2HKJA 5LYJA 1ZW9A 3U0ZA 5BR8O 4I0XA 5IE9A 1MZEA 2EIMB 5EZYB 4MVRA 4ZKIA 4XDKA 4H13B 1AH8A 3B8MA 5IYBO 1B04A 2ZM6B 1XMQO 1YETA 4FLVA 4BIUA 3B77A 4L8ZA 5J6AA 2B9ZA 1N34B 3RYIA 4X1IA 3T2SA 3W7SA 2R9RB 1JFFA 4O4HA 3K98A 4K8XA 1Y66A 5CMUA 3A2FA 3WFVA 2WLLB 2BTQB 3ASNC 4JI8O 1EFRG 3D3IA 3T1YB 4X65O 4DV7O 3JASB 4F6EA 2YEJA 3RW0A 3O2FA 2IH3C 1CP9A 2OIEA 4PA4A 2XOKG 4EB6B 3MD0A 1TUBB 4PA6A 4XCJA 1KP2A 5D5QA 2YE7A 3VQYA 1EN6A 5LBQA 4I4TB 1ZWIC 1TGOA 1F23A 2DMXA 2Z3YA 5FL7G 4PV1B 4PJ0Z 5J9PC 4E01A 1V54C 2P4VA 1KECA 4DUYO 4LWGA 1NTKH 1BXDA 4O2AB 4O2BB 1CEZA 5M4MA 3RLPA 5KHKA 2XX4A 2IORA 3DSQA 4OXSA 1FYJA 2F23A 2UUCB 2E5LB 4L90A 3CGZA 1VQ6V 3TCUA 5CA1B 1V55C 1G6UA 3OAAG 3G7BA 4U7NA 4PDLA 2MW2B 2AXTZ 4D7TA 2QR4A 2ZM6O 1L0NH 2BZ5A 1FAFA 2FYPA 5D7DA 5FNVB 1FXKB 5JENA 4URMA 3BFRA 2RCVA 2KKWA 4YIPA 2E0AA 4WUBA 1US7A 1WB8A 2IOPA 2CTRA 5CA3A 2YEFA 1YIJV 3QTCA 4DXWA 5DEDA 3ZJZA 3EFFK 4I55A 1P4RA 1Q8IA 1WPBA 4EGKA 1HNWB 2WLIB 1UYKA 2ITDC 1Z5CA 4JAAA 5JJJB 3U11A 4KSHA 4DZYA 3E83A 2YE8A 4D6TH 5D6PA 1P84F 3A0YA 3K58A 1JPXA 1UPGA 3ZHTA 4HZ3A 4O09A 2ZKJA 1KKCA 5GW7A 5IYZB 2NLJC 4AQYB 1M1KW 3APOA 4H0LB 4QPKA 1QHTA 4UUJC 2BTOA 1YJ9V 1EZVH 3M99B 3LNMB 1V54B 2FL4A 4MW8A 3JCZA 3W7TA 1MA1A 1ROPA 4GX2A 1NQTA 4HNAB 4FLTA 1O9HA 1WJZA 2YUAA 4BAEA 1QLEC 4AI8A 1JX9A 2BU5A 1NR7A 4DV6B 2HVKC 1AMWA 4NR1A 1THNA 2RNBA 1YXBA 3G80A 1NKDA 1V55B 3SYQA 1SESA 2UUCO 3U2KA 2E5LO 2Q8HA 5LHHA 1IBKB 1TVKA 3KCYA 1B3QA 2H3OA 5C8YB 3EHJA 4B3SB 1Y76B 2CCSA 2QM4A 5JVDA 4QGPA 5J2UA 2Q0OC 1B6QA 5L3EA 2Y48A 2NN4A 3HYYA 1ZL8B 1SS3A 2EX3A 2PI5A 1Q90D 3CB2A 1PP9H 1WAZA 4WFBV 3LMMA 2DQ3A 2Q6AA 2YIBA 5EYPA 2M7WA 3RVZA 4MVSA 3ABKB 4QNHB 2HHHB 1HNWO 1A32A 3OR6C 4XKAA 1J95A 3Q5LA 2WWWA 2IWSA 2WA4A 1J5EB 1M56C 3Q4HB 4AQYO 4I50A 3QO5A 3SYAA 3ETGA 2OWOA 4EFEA 3T0ZA 1K34A 1SRYA 1KKDA 2R72A 1K7DA 1WP8A 3AK3A 2GV9A 2N05A 2XCMA 1QLEB 1H7SA 1Z5VA 2H8MA 2VQEO 1IURA 2QTOA 5LMUB 1UYHA 4ZIBA 1QR9A 2ZDYA 4DV6O 2QM7A 2YGAA 2WA3A 1WA8B 3A8TA 2EBOA 1Y8PA 3A0HZ 2ZDIC 1GM9A 1OCRC 3R4OA 4YKYA 5F3KA 2EIJC 4AWPA 1IBKO 2HEPA 3H1HH 2YEEA 3RYHB 4E4EA 3K5NA 1Y74A 3WQ9A 2WEQA 4WFHA 1Q7YW 4B3SO 3D2RA 1WN7A 5B1AB 5E79Z 3FB8C 2XT9A 2VRZA 3ASOC 1U97A 4O04A 4H33A 4JTDB 1DGSA 1SQFA 4FVMA 4CWQA 2YK2A 1JMKC 1NZ6A 5ITZA 3IGAC 4FM0A 3STZC 3D0BA 2HHHO 5DN6G 5JQGB 2PNRA 3IC7A 1TIDA 2JEXA 2LP7A 2P22C 4LF4B 2ZE7A 1YI2V 2EULA 4HY6A 4MOTA 3FB6C 1J5EO 2IJJA 4NTWA 4MVMA 1ZSPA 2DYRB 2P06A 3OMAB 2EINB 3RKZA 2ZDXA 3W7XA 2W0FC 2Q73A 4PI2A 3S3XA 4O4IA 3MHHC 1KP3A 4R8CA 1VF6A 3H1JH 1ID0A 1OCRB 4LF8B 3K06A 4QE9A 4YHHB 2LGWA 2F4VB 4ZOLB 2GUZB 4DV0B 4KXRA 4GFNA 3TJTA 1QCEA 5CF0A 2OTLV 1JM6A 4WFEA 4Q6GA 4O07A 2YK9A 4J9ZB 1SA0A 2BU6A 2OCCC 4O05A 3GWOA 1UY7A 1ZWHA 1BCCH 1HP8A 1Z5WA 1NHJA 3G7EA 4QIWF 5B3SC 3LNUA 2KSDA 4LH6A 1UJWB 4JI4B 3UO2A 4BIOA 4LNUA 1Q43A 3OTFA 3ABLC 1T5EA 4H37A 3N2GA 3ZEDA 4F4LA 4PELA 3H9VA 1M90W 4MTGA 2WI6A 5LL6Y 1P7GA 1ZXNA 1LR1A 3BA9A 1E1QG 1GN2A 2UUBB 1I94B 3KCXA 3FT5A 3OGIB 4IYHA 2YJXA 3D8CA 4UCOA 4ZHQB 4X20A 5GTIZ 1R6NA 4YKTA 3OMUA 4LWEA 4DRXA 4IHJB 4JI6B 5CBGA 3LUTB 2WLMA 3BRCA 4IYIA 2A3QA 4NKGB 5H6RA 4XIQA 1PM9A 1H2NA 4LF8O 3HKCB 4PD4F 4YHHO 4YJ2A 4JZ2A 3CSXA 2F4VO 1KBHA 4DV0O 2R9IA 3QVNA 2OCCB 1KQSU 4B3TB 2XASA 4FLYA 4L94A 1Q6HA 1Z5BA 2YEIA 1NJIW 3CEIA 4MVUA 3ZRWB 5B3SB 1R73A 3G6BA 4BQJA 1WLEA 1H2SB 1S72V 3ZS8C 2KB1A 5JCOC 4UCSA 5K1XA 1N0NA 5FLXN 4JI4O 1R1BA 3K79A 3T2MA 5LOVB 1UYIA 2Q4PA 1QR8A 3H1LH 3JSLA 4WFAV 1AI4A 3K60A 3AG2C 4CE2A 1PVGA 4EM7A 1OCOC 3OEHG 3WB2A 2YEBA 3K03A 1AB3A 2YICA 1U2OA 2IJHA 1K73W 3GIGB 1AJNA 1XILA 5KMGA 3BCCH 1Q3EA 4UCVA 1MSWD 1YT0A 3H01A 4X9LA 2UUBO 1I94O 4MVZA 3DXRA 1MG1A 1GO3F 2JGDA 3IC9A 2YE4A 1XREA 2WI1A 4GQTA 4YKZA 2VCJA 1I7FA 2WI7A 3UCSC 3E8BA 4JI6O 1S0VA 1I08A 3RYCA 4CC5A 3LSQA 3R91A 1U0ZA 1G8MA 3HHUA 4DR4B 4HXWA 4UCRA 1PV0A 2CUGA 2CGFA 5BMVB 4DV5O 4OX9B 2WPDG 3EVKA 2RJZA 4LBEC 2XD6A 4GGLA 2QWRB 5M4PA 3CXHF 1I5XA 2QE7G 5EIBC 4B3TO 3CC4V 3LSUA 2YEAA 4UV8A 2ZQMA 3STLC 2LGQA 2YE3A 4O0BA 1NBMG 3R4NA 3RYFA 3VADA 2XDSA 2HFEC 1YF2A 2CAZC 1Y4SA 1H2MA 2QDOA 4P8OA 3OWDA 3JSNA 3AG2B 4DR6B 1D5NA 2KG7A 5GONA 2P90A 3N2KA 2PGGA 3L72H 2JVDA 3ZRXA 4FMTA 2DQ0A 3DGEA 3CXCU 4U3JB 4MW3A 5EK0A 3CRMA 4K0KB 3G71V 3ETQA 2KQXA 5B1NA 3OD4A 5EIBD 2LW7A 1H8HG 1D5AA 4N21A 2QEXV 1E79G 3N27A 3CRRA 3ZMTA 1I59A 3MHSC 3QDDA 2JJ2G 2IU3A 4BWAA 1YS3A 4CH6A 3R66A 1I0HA 3NMQA 2RN9A 3SJBC 1NTMH 4X65B 5JH7A 4GKKO 4W4LA 5LA6A 4TV8A 2P67A 1RSOB 1N8RW 1GJVA 4K35A 1DLBA 3A0ZA 2BRCA 3IFXA 4KUMA 4PI0A 1K92A 1BYQA 4EGHA 4L8JA 1K5QA 5FNCA 2ZBKB 2H8PC 4H44B 5CTWA 4XDJA 1YJNV 5J2TB 4J41A 4BR6A 2YE9A 5EC2C 3UT5B 4GKJB 3GIFA 4CWRA 3MNRP 1R3KC 3I5DA 4RUFA 5FNDA 3KZIZ 3NXSA 4BW9A 3OFNG 4NH9A 2AHZA 4FFKA 3TGUH 3VQVA 2Y0IA 2UU9B 2YEDA 3SPGA 1VEWA 4IT5A 1NR1A 1SQBH 4O4JB 4DR6O 1H8EG 4EMVA 3LDEA 4LCUC 1BE3H 2ZT9B 2CCUA 1Q6UA 4WUDA 2FXSA 2BSKB 1SQQH 3T0HA 1KUQA 1H7UA 4GYCB 1YVWA 4K0KO 4FK5C 3FAVA 4L87A 1RM1C 2L35A 4OGQB 4X66B 3R65A 1OCCC 4CWPA 2DN9A 3AG4B 4HZ5A 4Z1MG 2BOBC 3WB0A 2CH7A 1H38A 4V26A 5KA5A 3JAWB 2YEGA 4X62O 4F6RA 5B1BB 1NVPD 3T1CA 2XNDG 2YJWA 3DTUB 2XAHA 3HKDB 1ZX3A 2EILB 1IXMA 5E1AC 1COWG 2XHTA 1XHXA 4HZ0A 3SR2C 3FT8A 3E89A 1N4CA 1AI7A 4MB9A 4TUYA 2BTZA 1AJ6A 3K5OA 5IWAO 5IJ0B 3AG1B 1NHIA 3LDCA 3JARA 4XCLA 3H1IH 2DJVA 1L1FA 3PEJA 2YKJA 1SETA 4GKJO 3PJSK 5LXTB 5M4EA 1NVPB 3U67A 5EZYA 3RFRA 1BT8A 4X1YB 3BEHA 4EGIA 1TH8A 2UXCB 4DW1A 2ESAA 2UU9O 2YE5A 4GT1A 4P2ZA 4DUZB 2FMLA 2ZE6A 3FB7C 3OMNB 1E1RG 2QKSA 4RO2A 1JJOA 2RQ6A 2HJDA 2XX2A 5L3GA 4E02A 3TETA 3P3NA 1JJ2U 5DECA 2XHXA 2YIBD 2K9PA 2A06H 3B40A 4X66O 3EHFA 3ASNB 2WLLA 2Q9LA 3FKSG 3RWRD 2K1EA 2BTQA 3O0IA 2Q68A 3B4SA 4B7EA 2BU7A 3LDDA 4BIZA 3KKYA 3JASA 4GX1A 4EB6A 2IH1C 5L3DA 4WF9V 3B24A 1TUBA 3ABTA 4TWKA 4YKUA 1F51A 4XC0A 1UY8A 4D7SA 2HCHA 3CRCA 4I4TA 1LNQA 4DW0A 5BOCA 5A2QN 1WP7A 3T4ZA 4P9OA 4X64O 4LWFA 4MBCA 5CTXA 1K3EA 1K8AW 1BQZA 1FFTB 4O2AA 4O2BA 2VQEB 3S5TA 1AM1A 5M4KA 1V9PA 5LXTA 3CRQA 4LC1A 1IVSA 2O1VA 4PL9A 4DV4B 2H94A 1L8DA 2AW9A 4NVPA 1ORQC 2UXCO 4UFZA 5CA1A 3KG2A 3QO7A 4DUZO 4CWSA 1VQPV 4J80A 1S5JA 5FNVA 1FXKA 3FD9A 3EXAA 1HNZB 4U3FH 1U96A 2EJ7A 3L74H 4LH7A 1S77D 3ZMUA 3SPHA 1O9GA 2XJJA 3HB3B 1BHBA 3E8FA 3BABA 4RQEA 2ZCEA 4BQGA 4XKKA 5D5PA 2YECA 4DV2B 3OUFA 2FB5A 3RN4A 3HR0A 2WLIA 4QE7A 2LFSA 1EBOA 3AEIA 4PA9A 1P7BA 1GTOA 2EIKC 1VF7A 2YS8A 1W0JG 3APQA 4B3RB 2FWZA 2XAJA 3HPLC 5B66Z 3EKOA 4MP7A 4UVCA 2JIZG 4I3HA 5HFLA 5IYZA 2Q69A 3THOA 1NTZH 4CWTA 3CE2A 2ETNA 3GWKC 4DK0A 2QFOA 2JJ1G 4WFFA 4DV3O 2IU0A 3H80A 4DR5B 4FCRA 2ADQB 3EKRA 2R70A 3SPJA 1M93A 4HNAA 2VS0A 1RPOA 2V4DA 4YIOA 3HKBB 4FLZA 3ZCCA 2YSUB 3BA8A 4XBFA 3CCSV 1FJGB 3QF7A 1UY9A 3ICXA 4DV4O 4LF6B 4IL6Z 2IWXA 3T10A 5H6QA 4UB8Z 5B1OA 5C8YA 1K97A 1KZNA 2JRIA 3CCVV 4EFTA 1Y76A 4MVOA 3CRKA 1YC1A 2IW5A 2XDXA 3K97A 2V1DA 1HNZO 1G1XB 3CGYA 1HWYA 2PF4E 2Q7GA 2M6YA 1K9MW 1ZL8A 4K4OA 2YE6A 2ITCC 1H2KA 3TK1A 4URNA 2WLNA 2ZKOA 3BAAA 2CDYA 3LSSA 4LFCB 1GKZA 2IJKA 2Y69C 4XKOA 2HKOA 4DV2O 1K33A 1FXHA 4GLXA 1QY8A 5CN0A 3ZXOA 1I5BA 4W4KA 3W7UA 5FNFA 2XJGA 4X1KB 5D7RA 4B3RO 2O1UA 5CB4B 1M56B 5JWPA 4MS2A 4ASBA 1W2BU 2D2CB 3Q4HA 1VQLV 4DO2A 5LP6C 1X59A 2W0XA 1UY6A 2IM9A 3K9AA 2WI5A 4UB6Z 3GIEA 1IBLB 2B5UA 3AK1A 2DYSC 3SYOA 1AP5A 2YKIA 3CCJV 1BZKA 3G67A 4DR5O 1VF5B 4JYAO 5IYCO 3ZMZA 2XDLA 4LWSB 1YT2A 3OTOB 2GTAA 2YKCA 2QG0A 3B25A 1EN4A 2ZNJA 4UXNA 1FJGO 3D3QA 1WA8A 4MTXA 1OSFA 3B26A 2NNUA 2BU2A 1W0KG 2QGNA 2X6AA 2EIJB 4LF6O 4U7OA 3FYEB 2JK5C 3RYHA 3K08A 1BKNA 1YC4A 2HR3A 4X88A 2YE2A 5BODA 3ABMC 4RWUA 2Q8VA 1Q86W 4XIPA 1JVMA 4JTCB 4CS4A 3ASOB 5TISZ 3ZXQA 3L71H 1F7YA 1CXZB 5IJ9B 3ZIAG 1VQ9V 4XDMA 4P9PA 4LFCO 3JATB 4NB5A 1Y8OA 3P32A 5H5NA 1VQ5V 1PKXA 4KP4A 5JQGA 2CH4A 3JZ3A 3RBZA 2UXNA 1AR4A 1FFXB 3CWVA 3T1KA 2WERA 4MPCA 1QBZA 3CWBH 3ZMSA 2FKXA 5LP6B 1F4MA 2O1WA 3ZKBA 3AK2A 4QJFB 1R6KA 2O57A 4CWNA 1OZ0A 2P5OA 3X2QC 5CA0B 2QWQB 1IBLO 3HKEB 4CZZA 3J81N 4DK1A 1KB9F 4YXWG 5IY5C 2E3CA 2YEVB 3F7YC 5IYDO 2D3OW 4B6CA 4FZ1A 4YKRA 1A4HA 3S3WA 3FV5A 3OTOO 1Y8NA 3L9DA 4MTFA 1M9NA 4YKWA 4PDRA 4JPRA 4ASFA 1YJWV 3TXSA 4PA7A 1M4UA 4LWIA 1DF4A 3FYIB 1TC6A 3O65A 4ZI7B 2N74A 4ZOLA 2GUZA 4E72A 1IBMB 1R62A 2VWKA 2F95B 4DV5B 4V25A 3ZX6A 4G28B 4KHPB 4TV9B 2E76B 3K5LA 3K99A 4NTXA 3P30A 2HLDG 2WI4A 3SJCC 3WU2Z 2UUAB 5L3JA 5FPRA 3CYOA 1FKAO 2A9HA 4IIJB 4JI2O 4FFBB 3TZ5A 2YXLA 1URFA 3CRLA 4X9QA 3OWBA 5HFMA 1XMOB 4JI3B 2A79B 4UVAA 3ABLB 2EXLA 2QG2A 1K5SA 2RDCA 1PNKA 1NU1H 3HEKA 5BY1A 1Q81W 1VQKV 4PA3A 1G4YB 3CCRV 2XUMA 1UYMA 2QWPB 1OCZC 1M5IA 3VHCA 3QG5A 1R3LC 2XHBA 3CJHB 1VQMV 1OV9A 3CMEV 3UO3A 1SZXA 3CCLV 2CTPA 4H85A 1HNXB 3H4LA 5KUKA 4J10A 3Q5KA 2PZSA 3ZM7A 2JKIA 3ABUA 5IY5B 4ZHQA 4FM2A 3JAKB 2ZXWC 5KUMA 5L3BA 3BM9A 1GN4A 3JD4A 4IHJA 4FIPC 3CHXA 3ZRSA 5LHGA 4NXMB 1XEQA 2Q0AA 4GKKB 2CGOA 2JS5A 2BT0A 1W59A 3IEDA 5KAIZ 4UVBA 3RVYA 4GZRB 3HKCA 1XNRB 1UYFA 3TUHA 4WUCA 5K1PA 2YXHA 4WBNB 1EA6A 2P6JA 1IBMO 1Q82W 2LO1A 4KHPO 1Y67A 5KX5B 4O4LB 5IT9N 3E22B 3I56V 3R4MA 4W7TA 1WB7A 3ZRWA 4UROA 2N04A 2UUAO 1XL6A 3D36A 1S5HC 1KD1W 4HXZA 4XE2A 2CK3G 4J11A 2YI0A 2EZPA 5LOVA 1AJPA 1XMOO 4JI3O 4CH4A 4I9QA 4RQFA 4GUNA 3ZRVA 2QTSA 1XI1A 1OCOB 2JS3A 2JJCA 2EJRA 4P30A 3CCUV 5DM6V 4CWOA 3GIGA 4Q20A 3K0DA 4HYMA 3JALB 3OEEG 3SDLA 1HNXO 4YJ3B 2QA4V 1QVGU 3A0XA 2F1MA 5LYJB 3G75A 4I0XB 1N33O 1MABG 3CPWU 1IX9A 1RFYA 2EIMC 2Q2EB 1PPJH 3ZBHA 2BE3A 4CH5A 1IZ3A 2F93B 4PDMA 3WG7C 2CTWA 2ZINA 4NXMO 1I58A 4X62B 3FB5C 4GT8A 3K04A 1Z2GA 2AKPA 4CBCA 5BZBA 3BVOA 4JYCA 2QM8A 4BAYA 1EI1A 2XTAA 1MU5A 3QTFA 4YKXA 1OJHA 1XNRO 3RYIB 3VQXA 4X1IB 2VWCA 2BOCC 1OHHG 5BMVA 1JFFB 1BSMA 3PN1A 2FTKA 4O4HB 1MX0A 4PRVA 1UFIA 5IWAB 2CTQA 3INXA 2Q67A 2YI9A 3FFQA 4KFGA 1N32B 1B63A 2YKEA 2AHYA 5LGNA 3MDSA 1GK9A 2QWOB 1S16A 1P49A 1AR5A 1XOUA 1WPXA 2X6BA 3C3SA 1KIJA 2ODMA 1JQ0A 4FPPA 1GM8A 2XDUA 1MMMA 4U3JA 3ETEA 2YIAA 2PYLA 4K3AA 4DR2B 4R3AA 1L0LH 3QO8A 2WI2A 4HY1A 2B1GA 2UXBO 2YGEA 5KHHA 4LPBA 1SZTA 3ML0A 1FXVA 2E75B 2JEUA 1TAEA 4R6ZA 1IXBA 1PL4A 3C3TA 3SPCA 2ZE5A 3WG7B 1VQNV 1BL8A 1XNQB 4R7CA
chains in the Genus database with same CATH topology
1SERA 3B28A 2JDIG 1FXKC 4P7AA 3C0EA 4MP2A 1R3IC 1B62A 4URLA 1MOFA 3R4PA 1UYGA 4TSFG 2P7TC 4H7QA 1AI5A 4BW5A 3TTZA 4ZVIA 1I5AA 4CE3A 4KQVA 4NH7A 1L0OA 3EHHA 2YGFA 1Y4MA 3E86A 1GM7A 3B8NA 4KFMA 4JGSA 2GFDA 5EBWC 2BYHA 1PNLA 3ZKDA 4XIRA 2DW4A 2OT5A 2YI6A 3A0RA 4I9WA 1RM1B 2HG1A 3OW2U 5CPHA 1OCCB 4XTJA 1YERA 1QVFU 3OPDA 4MSWC 1UYEA 3JD3A 3RLRA 4ASAA 3ZMVA 2PI4A 2XDKA 2OTJV 3A0WA 1AR1B 1TC0A 4JF3A 1TBWA 1YESA 1Z5AA 2EZOA 3CCQV 4JAUA 1PNMA 3CP1A 3ABKC 4N23A 1YC3A 4H81A 5CBHA 2FWYA 2YEHA 3U2DA 4DUHA 1GMGA 4LWHA 3EHBB 2BSMA 4LP8A 2ATKC 5CTYA 2HJFC 4GCZA 5C93A 1DTOA 4JTAB 2WLJA 1EZJA 3CC2V 3UKMA 1AI6A 3OUSA 2WEPA 5D6QA 5L3FA 1YSRA 3ZN1A 5B1AC 3OGCC 4EKWA 3G6EV 4EEHA 5IDJA 4CE1A 1M57C 4QPJA 4PRXA 3K3WA 4MTOA 1ENVA 3CC7V 5EC1C 2ZD9A 4XITA 2Q8GA 1Y4UA 3F5WC 2WI3A 3BMYA 2MK3A 1I5DA 3TZ4A 4AS9A 4JASA 4X8AA 2CG9A 5KA6A 1PL0A 2CCTA 3OR7C 2DYRC 2HG5C 1PD3A 2EINC 2XAQA 2XABA 3O6OA 4R3MA 1UYDA 1GKXA 2BYIA 3W7WA 4AWQA 3VBBA 4HYPA 4L91A 5LHIA 3RLQA 2EIKB 1YTFD 2XHRA 1YITV 3I55V 1BMFG 3SL2A 1K4CC 3SYPA 1THZA 4R1FA 3E35A 2UWDA 2X6CA 3OW6A 1M57B 2X7RB 1JCHA 2XJXA 5EBMC 4JQLA 5CTUA 2K5BA 3EHGA 4MT8A 4I5SA 1I5CA 2XK2A 2XAFA 3INWA 1YTFB 3BY6A 4PDVA 5J71A 3OMIB 2H55A 1XL4A 4RUEA 5IDMA 1UYLA 5CBFA 1AROP 1FS0G 3QNEA 1S3JA 4MVQA 2ZR3A 3KE6A 1R3JC 4GEEA 5M4HA 4ASUG 3SYCA 2Y69B 4RAIA 1VQ4V 3WHAA 2XX5A 2WLKA 3HYZA 2C2AA 1NHHA 1JOYA 4FJCC 3Q5JA 3AG3C 2GHYA 5D7CA 2WSSG 2YKBA 2DYSB 1RPRA 4KSGA 2Q8IA 3ZN0A 1S76D 3TZ2A 4JYBA 4U93A 3SPIA 5IN9A 2GQPA 2GSMB 2YI5A 2ZDIA 4J9YB 1QYEA 1QLNA 3ABMB 3GB7C 3JD0A 3PEHA 4L93A 5LGUA 1NH2D 4FCQA 1QZRA 2WLHA 3CCMV 3LPSA 5EBLC 4G27B 3E2EA 1UYCA 2IJIA 1S14A 3AG3B 4GX5A 3K0GA 4HAMA 2X0LA 1H2GA 1VQOV 2ZR2A 3VHAA 4ZBMA 4NH8A 2Q8FA 4WCEV 1ZXMA 1NH2B 3X2QB 3VHDA 4LP0A 3ETDA 1F4NA 2IOQA 4EFUA 1YT1A 1BHAA 1VQ7V 2YEVA 3UM7A 4FCPA 3SJQC 4CWFA 4YKQA 2DWDC 4JAVA 1I5YA 5H9CA 3JYCA 2UXXA 1AJQA 3JD1A 1BGQA 4MPNA 2A0LA 1YHQV 2XAGA 3CD6V 4G2KA 5LGTA 4UV9A 2F43G 4E2LA 2IWUA 2V7QG 1CPYA 1VQ8V 2WAMA 2VCIA 3T4DA 2W6IG 1YSZA 4XD8A 1OCZB 3VOUA 2BU8A 1KC8W 4XDLA 3R92A 1Z59A 1GKFA 3JD2A 4MPEA 4HYOA 4ASGA 3E8GA 3OE7G 2ZXWB 3TZ0A 4BXIA 3C11A 3F7VC 3G4SV 1TUEB 3B27A 4TT3G 2HVJC 3CMAV 2BREA 4X89A 2VW5A 1K4DC 2LFRA 2B1IA 3HZ1A 1TILA 3A0TA 3CCEV 5M4NA 3E8HA 4E00A 4KTNA 3AG4C 3HZ5A 4WFGA 4AWOA 2Z5UA 4PU9A 4B7PA 5B1BC 5FWKA 1AH6A 5L3CA 2DWEC 3OM3B 2EILC 4GX0A 1DF5A 2W6JG 1YSCA 4R50A 5F5RA 3AG1C 2YI7A 2QF6A 5GGZA 2HKJA 1ZW9A 2EIMB 4MVRA 4ZKIA 4XDKA 1AH8A 3B8MA 5IYBO 1YETA 4BIUA 3B77A 4L8ZA 5J6AA 3T2SA 3W7SA 2R9RB 3K98A 1Y66A 5CMUA 3WFVA 2WLLB 3ASNC 1EFRG 3D3IA 2YEJA 3RW0A 3O2FA 2IH3C 1CP9A 4PA4A 2XOKG 3MD0A 4PA6A 4XCJA 1KP2A 2YE7A 5LBQA 1ZWIC 1F23A 2Z3YA 5FL7G 5J9PC 4E01A 1V54C 1KECA 4LWGA 1BXDA 1CEZA 5M4MA 3RLPA 2XX4A 2IORA 4OXSA 4L90A 3CGZA 1VQ6V 3TCUA 1V55C 3OAAG 3G7BA 4U7NA 4PDLA 2BZ5A 2FYPA 5D7DA 1FXKB 4URMA 2E0AA 4WUBA 1US7A 2IOPA 5CA3A 2YEFA 1YIJV 4DXWA 3ZJZA 3EFFK 1P4RA 4EGKA 2WLIB 1UYKA 2ITDC 1Z5CA 4KSHA 4DZYA 3E83A 2YE8A 5D6PA 3A0YA 1JPXA 4HZ3A 4O09A 2ZKJA 5GW7A 2NLJC 1M1KW 4QPKA 4UUJC 1YJ9V 3M99B 3LNMB 1V54B 4MW8A 3JCZA 3W7TA 1ROPA 4GX2A 1NQTA 4BAEA 1QLEC 1JX9A 2BU5A 1NR7A 2HVKC 1AMWA 1THNA 1NKDA 1V55B 3SYQA 1SESA 3U2KA 2Q8HA 5LHHA 1B3QA 3EHJA 2CCSA 1B6QA 5L3EA 2Y48A 3HYYA 2PI5A 4WFBV 2DQ3A 2Q6AA 2M7WA 3RVZA 4MVSA 3ABKB 4QNHB 4XKAA 3OR6C 1J95A 3Q5LA 2WWWA 2IWSA 1M56C 3QO5A 3SYAA 3ETGA 3T0ZA 1K34A 1SRYA 1KKDA 1K7DA 2XCMA 1QLEB 1H7SA 2H8MA 2QTOA 1UYHA 1QR9A 2ZDYA 2QM7A 2YGAA 2EBOA 1Y8PA 2ZDIC 1GM9A 1OCRC 3R4OA 4YKYA 5F3KA 2EIJC 4AWPA 2YEEA 3WQ9A 2WEQA 4WFHA 1Q7YW 3D2RA 5B1AB 3FB8C 3ASOC 4O04A 4H33A 4JTDB 4CWQA 2YK2A 3IGAC 3STZC 3D0BA 5DN6G 2PNRA 3IC7A 1TIDA 2JEXA 2LP7A 1YI2V 4HY6A 4MOTA 3FB6C 2IJJA 4MVMA 2DYRB 3OMAB 2EINB 3RKZA 2ZDXA 3W7XA 2W0FC 3MHHC 1KP3A 4R8CA 1ID0A 1OCRB 3K06A 4QE9A 4GFNA 1QCEA 5CF0A 2OTLV 1JM6A 4WFEA 4O07A 2YK9A 4J9ZB 2BU6A 2OCCC 4O05A 3GWOA 1UY7A 1ZWHA 1NHJA 3G7EA 4QIWF 5B3SC 3LNUA 1UJWB 3ABLC 4H37A 4F4LA 4PELA 1M90W 4MTGA 2WI6A 1ZXNA 1E1QG 3FT5A 2YJXA 1R6NA 4YKTA 3OMUA 4LWEA 5CBGA 3LUTB 2WLMA 5H6RA 4XIQA 2R9IA 2OCCB 1KQSU 2XASA 4L94A 1Z5BA 2YEIA 1NJIW 4MVUA 3ZRWB 5B3SB 1R73A 4BQJA 1WLEA 1S72V 2KB1A 3K79A 3T2MA 1UYIA 4WFAV 1QR8A 1AI4A 3K60A 3AG2C 4CE2A 1PVGA 4EM7A 1OCOC 3OEHG 2YEBA 3K03A 1U2OA 2IJHA 1K73W 3GIGB 1AJNA 1MSWD 1YT0A 3H01A 4X9LA 4MVZA 1MG1A 1GO3F 2YE4A 2WI1A 4GQTA 4YKZA 2VCJA 2WI7A 3E8BA 1S0VA 3LSQA 3R91A 1U0ZA 1G8MA 3HHUA 4HXWA 2CGFA 2WPDG 4LBEC 2XD6A 4GGLA 5M4PA 1I5XA 2QE7G 3CC4V 2YEAA 4UV8A 2ZQMA 3STLC 2YE3A 4O0BA 1NBMG 3R4NA 3VADA 2XDSA 2HFEC 1Y4SA 4P8OA 3OWDA 3AG2B 2P90A 3ZRXA 4FMTA 2DQ0A 3DGEA 3CXCU 4MW3A 5EK0A 3G71V 5B1NA 1H8HG 4N21A 2QEXV 1E79G 3ZMTA 1I59A 3MHSC 3QDDA 2JJ2G 2IU3A 1YS3A 3NMQA 2P67A 1N8RW 1GJVA 3A0ZA 1DLBA 2BRCA 3IFXA 4KUMA 1K92A 1BYQA 4EGHA 1K5QA 5FNCA 2ZBKB 2H8PC 5CTWA 4XDJA 1YJNV 2YE9A 5EC2C 3GIFA 4CWRA 3MNRP 1R3KC 4RUFA 5FNDA 3NXSA 3OFNG 4NH9A 2AHZA 2YEDA 3SPGA 1NR1A 1H8EG 4EMVA 3LDEA 4LCUC 2CCUA 4WUDA 2FXSA 3T0HA 1H7UA 4FK5C 1RM1C 4L87A 3R65A 1OCCC 4CWPA 3AG4B 4HZ5A 4Z1MG 2BOBC 1H38A 4V26A 5KA5A 2YEGA 5B1BB 1NVPD 3T1CA 2XNDG 2YJWA 3DTUB 2XAHA 2EILB 1IXMA 5E1AC 1COWG 2XHTA 4HZ0A 3FT8A 3E89A 1AI7A 4MB9A 2BTZA 1AJ6A 3AG1B 1NHIA 3LDCA 4XCLA 1L1FA 3PEJA 2YKJA 1SETA 3PJSK 5M4EA 1NVPB 3U67A 4EGIA 3BEHA 1TH8A 2ESAA 2YE5A 4GT1A 4P2ZA 3FB7C 3OMNB 1E1RG 2QKSA 4RO2A 2XX2A 5L3GA 4E02A 3TETA 1JJ2U 2XHXA 3EHFA 3ASNB 2WLLA 3FKSG 2K1EA 3O0IA 2Q68A 2BU7A 3LDDA 4BIZA 4GX1A 2IH1C 5L3DA 3B24A 4WF9V 3ABTA 4TWKA 4YKUA 1F51A 4XC0A 1UY8A 2HCHA 1LNQA 5BOCA 3T4ZA 4P9OA 4LWFA 4MBCA 5CTXA 1K3EA 1K8AW 1FFTB 5M4KA 1AM1A 4LC1A 2O1VA 4PL9A 2H94A 1ORQC 3KG2A 3QO7A 4CWSA 1VQPV 1FXKA 1S77D 3ZMUA 3SPHA 2XJJA 3HB3B 1BHBA 3E8FA 4RQEA 4BQGA 4XKKA 2YECA 3OUFA 2WLIA 4QE7A 2LFSA 1EBOA 3AEIA 4PA9A 1P7BA 1GTOA 2EIKC 1W0JG 2FWZA 2XAJA 3HPLC 3EKOA 4MP7A 4UVCA 2JIZG 4I3HA 5HFLA 2Q69A 4CWTA 2QFOA 2JJ1G 4WFFA 2IU0A 3H80A 4FCRA 3EKRA 3SPJA 1RPOA 3ZCCA 2YSUB 4XBFA 3CCSV 1UY9A 2IWXA 3T10A 5H6QA 5B1OA 1K97A 1KZNA 3CCVV 4EFTA 4MVOA 3CRKA 1YC1A 2IW5A 2XDXA 3K97A 2V1DA 3CGYA 1HWYA 1K9MW 4K4OA 2YE6A 2ITCC 3TK1A 4URNA 2WLNA 3LSSA 1GKZA 2IJKA 2Y69C 4XKOA 2HKOA 1K33A 1FXHA 1QY8A 5CN0A 3ZXOA 1I5BA 3W7UA 5FNFA 2XJGA 5D7RA 2O1UA 1M56B 4MS2A 4ASBA 1W2BU 1VQLV 4DO2A 1UY6A 3K9AA 2WI5A 3GIEA 2B5UA 2DYSC 3SYOA 2YKIA 3CCJV 5IYCO 3ZMZA 2XDLA 1YT2A 2YKCA 2QG0A 3B25A 4UXNA 4MTXA 1OSFA 3B26A 2NNUA 2BU2A 1W0KG 2X6AA 2EIJB 4U7OA 3FYEB 2JK5C 3K08A 1BKNA 1YC4A 2HR3A 4X88A 2YE2A 5BODA 3ABMC 1Q86W 4XIPA 1JVMA 4JTCB 3ASOB 3ZXQA 3ZIAG 1VQ9V 4XDMA 4P9PA 1Y8OA 3P32A 1VQ5V 1PKXA 4KP4A 2CH4A 3JZ3A 3RBZA 2UXNA 3CWVA 3T1KA 2WERA 4MPCA 1QBZA 3ZMSA 1F4MA 2O1WA 3ZKBA 4QJFB 1R6KA 4CWNA 1OZ0A 3X2QC 4CZZA 4YXWG 5IY5C 2D3OW 2YEVB 3F7YC 5IYDO 4B6CA 4YKRA 1A4HA 3FV5A 1Y8NA 4MTFA 4YKWA 1M9NA 4PDRA 4JPRA 4ASFA 1YJWV 4PA7A 4LWIA 1DF4A 3FYIB 1TC6A 1R62A 4V25A 4G28B 3K99A 3P30A 2HLDG 2WI4A 5L3JA 3CYOA 2A9HA 3TZ5A 3CRLA 3OWBA 5HFMA 2A79B 4UVAA 3ABLB 2EXLA 2QG2A 1K5SA 1PNKA 3HEKA 1Q81W 1VQKV 4PA3A 1G4YB 3CCRV 1UYMA 1OCZC 3VHCA 1R3LC 1VQMV 3CMEV 3CCLV 4H85A 3H4LA 5KUKA 3Q5KA 3ZM7A 2JKIA 3ABUA 5IY5B 2ZXWC 5KUMA 5L3BA 3BM9A 3JD4A 4FIPC 3ZRSA 5LHGA 2BT0A 3IEDA 4UVBA 3RVYA 1UYFA 3TUHA 4WUCA 1EA6A 2P6JA 1Q82W 3I56V 3R4MA 4W7TA 3ZRWA 4UROA 1XL6A 3D36A 1S5HC 1KD1W 4HXZA 4XE2A 2CK3G 2YI0A 2EZPA 1AJPA 4RQFA 3ZRVA 1OCOB 2JJCA 2EJRA 4P30A 3CCUV 5DM6V 4CWOA 3GIGA 4Q20A 3K0DA 4HYMA 3OEEG 2QA4V 1QVGU 3A0XA 3G75A 1MABG 3CPWU 2EIMC 2Q2EB 4PDMA 3WG7C 1I58A 3FB5C 4GT8A 3K04A 2AKPA 4CBCA 5BZBA 4JYCA 1EI1A 2QM8A 4BAYA 3QTFA 4YKXA 1MU5A 2VWCA 2BOCC 1OHHG 1MX0A 2FTKA 4PRVA 3INXA 2Q67A 4KFGA 1B63A 2YKEA 2AHYA 5LGNA 1GK9A 1S16A 1WPXA 2X6BA 1KIJA 1JQ0A 4FPPA 1GM8A 2XDUA 3ETEA 4R3AA 3QO8A 2WI2A 4HY1A 2B1GA 2YGEA 4LPBA 1SZTA 3ML0A 1FXVA 2JEUA 4R6ZA 3SPCA 3WG7B 1VQNV 1BL8A 4R7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPN A;  1BGQ A;  2XJJ A;  3B28 A;  4BQG A;  4XKK A;  4GFN A;  5CF0 A;  2YEC A;  1JM6 A;  4P7A A;  3C0E A;  4MP2 A;  1B62 A;  4URL A;  2LFS A;  4O07 A;  2YK9 A;  2BU6 A;  3R4P A;  2IWU A;  1UYG A;  4O05 A;  1UY7 A;  4H7Q A;  1ZWH A;  2FWZ A;  2VCI A;  1NHJ A;  3TTZ A;  3EKO A;  4MP7 A;  3G7E A;  4ZVI A;  4I3H A;  1I5A A;  1YSZ A;  4XD8 A;  4CE3 A;  3LNU A;  2BU8 A;  4KQV A;  4NH7 A;  1L0O A;  4CWT A;  3EHH A;  2YGF A;  3R92 A;  2QFO A;  1Z59 A;  3H80 A;  4FCR A;  3EKR A;  4MPE A;  2GFD A;  2BYH A;  3ZKD A;  4ASG A;  4XIR A;  2WI6 A;  2YI6 A;  3ZCC A;  3TZ0 A;  1ZXN A;  3A0R A;  1UY9 A;  4BXI A;  3C11 A;  3FT5 A;  2HG1 A;  2YJX A;  3B27 A;  2IWX A;  3T10 A;  5B1O A;  2BRE A;  5CPH A;  4YKT A;  4XTJ A;  3OMU A;  2VW5 A;  1YER A;  4LWE A;  1KZN A;  4EFT A;  3OPD A;  2LFR A;  1UYE A;  3CRK A;  1YC1 A;  3HZ1 A;  2XDX A;  3K97 A;  4XIQ A;  1TIL A;  3A0T A;  3CGY A;  5M4N A;  4E00 A;  4KTN A;  3RLR A;  4K4O A;  4ASA A;  2YE6 A;  3HZ5 A;  3TK1 A;  4URN A;  1GKZ A;  4XKO A;  2XDK A;  4AWO A;  3A0W A;  4PU9 A;  1QY8 A;  4L94 A;  1Z5B A;  2YEI A;  4B7P A;  5FWK A;  3ZXO A;  1I5B A;  1TC0 A;  5FNF A;  1AH6 A;  2XJG A;  3ZRW B;  1TBW A;  1YES A;  1Z5A A;  5D7R A;  2O1U A;  4BQJ A;  4JAU A;  4ASB A;  1YC3 A;  4H81 A;  5F5R A;  1UY6 A;  1UYI A;  2WI5 A;  2FWY A;  2YEH A;  3GIE A;  3K60 A;  2YI7 A;  4CE2 A;  2QF6 A;  1PVG A;  3U2D A;  5GGZ A;  2YKI A;  2HKJ A;  4EM7 A;  1ZW9 A;  4DUH A;  2YEB A;  4LWH A;  2XDL A;  1YT2 A;  1U2O A;  3GIG B;  2YKC A;  4ZKI A;  2BSM A;  2QG0 A;  3B25 A;  5CTY A;  1YT0 A;  1AH8 A;  4X9L A;  4MTX A;  1OSF A;  3B26 A;  2BU2 A;  1YET A;  4GCZ A;  4BIU A;  4U7O A;  5C93 A;  4L8Z A;  5J6A A;  2YE4 A;  1BKN A;  1YC4 A;  2WI1 A;  2YE2 A;  4GQT A;  4YKZ A;  5BOD A;  2VCJ A;  3T2S A;  2WI7 A;  3K98 A;  4XIP A;  3R91 A;  1U0Z A;  3ZXQ A;  3HHU A;  4HXW A;  2WEP A;  2CGF A;  4XDM A;  5D6Q A;  1YSR A;  2XD6 A;  4EEH A;  1Y8O A;  3P32 A;  5IDJ A;  4GGL A;  5M4P A;  4CE1 A;  2YEJ A;  4QPJ A;  4PRX A;  2YEA A;  3O2F A;  4KP4 A;  2CH4 A;  3JZ3 A;  2YE3 A;  4O0B A;  3MD0 A;  3CWV A;  4XCJ A;  3R4N A;  3T1K A;  2WER A;  2YE7 A;  3VAD A;  4MPC A;  2XDS A;  4XIT A;  1Y4S A;  4P8O A;  1Y4U A;  3OWD A;  2Q8G A;  2O1W A;  3ZKB A;  2WI3 A;  3BMY A;  1I5D A;  3TZ4 A;  4E01 A;  4CWN A;  4AS9 A;  4JAS A;  4LWG A;  1BXD A;  2CG9 A;  3ZRX A;  5M4M A;  4FMT A;  3RLP A;  2XX4 A;  3DGE A;  2IOR A;  4B6C A;  4YKR A;  2CCT A;  1A4H A;  3FV5 A;  1Y8N A;  4YKW A;  5B1N A;  3CGZ A;  4L90 A;  4ASF A;  3G7B A;  2XAB A;  3O6O A;  4U7N A;  4R3M A;  4LWI A;  1UYD A;  1I59 A;  1TC6 A;  3QDD A;  2BZ5 A;  2FYP A;  1YS3 A;  5D7D A;  1GKX A;  4URM A;  2BYI A;  1R62 A;  3NMQ A;  4AWQ A;  4V25 A;  4HYP A;  4L91 A;  2E0A A;  4WUB A;  1US7 A;  3K99 A;  3RLQ A;  2P67 A;  2IOP A;  2WI4 A;  2XHR A;  2YEF A;  1GJV A;  5L3J A;  3A0Z A;  3SL2 A;  4EGK A;  4R1F A;  2BRC A;  1UYK A;  1Z5C A;  2UWD A;  3TZ5 A;  3OW6 A;  3CRL A;  4KSH A;  4DZY A;  1BYQ A;  2YE8 A;  3OWB A;  2XJX A;  4EGH A;  5D6P A;  5FNC A;  3A0Y A;  2EXL A;  4JQL A;  2QG2 A;  2ZBK B;  3HEK A;  4O09 A;  2ZKJ A;  5CTW A;  5CTU A;  2K5B A;  2YE9 A;  3EHG A;  4MT8 A;  1UYM A;  4I5S A;  4QPK A;  3GIF A;  3VHC A;  1I5C A;  4CWR A;  2XK2 A;  3MNR P;  3INW A;  5FND A;  3NXS A;  4H85 A;  3H4L A;  4NH9 A;  3Q5K A;  3ZM7 A;  2YED A;  5J71 A;  2JKI A;  4EMV A;  2H55 A;  5IDM A;  4BAE A;  1UYL A;  2CCU A;  2BU5 A;  4WUD A;  2FXS A;  3BM9 A;  1AMW A;  1THN A;  3T0H A;  1H7U A;  3U2K A;  2Q8H A;  2BT0 A;  3KE6 A;  3IED A;  4GEE A;  1B3Q A;  5M4H A;  4CWP A;  3EHJ A;  4HZ5 A;  1UYF A;  3TUH A;  4WUC A;  2CCS A;  1EA6 A;  4V26 A;  3HYY A;  3WHA A;  2YEG A;  2XX5 A;  3HYZ A;  2YJW A;  4W7T A;  3R4M A;  2C2A A;  3ZRW A;  4URO A;  1NHH A;  1JOY A;  1IXM A;  2XHT A;  4HZ0 A;  3D36 A;  3FT8 A;  3Q5J A;  4HXZ A;  4XE2 A;  4MB9 A;  2YI0 A;  2BTZ A;  1AJ6 A;  4XKA A;  5D7C A;  3Q5L A;  1NHI A;  2WWW A;  2IWS A;  4XCL A;  2YKB A;  3ZRV A;  4KSG A;  2Q8I A;  3PEJ A;  2YKJ A;  2JJC A;  3TZ2 A;  5M4E A;  3U67 A;  4JYB A;  4CWO A;  3GIG A;  4Q20 A;  4U93 A;  3T0Z A;  4EGI A;  4HYM A;  1TH8 A;  2ESA A;  3A0X A;  2YE5 A;  4GT1 A;  5IN9 A;  2GQP A;  3G75 A;  2XCM A;  2YI5 A;  1H7S A;  2H8M A;  2Q2E B;  1QYE A;  1UYH A;  2ZDY A;  2QM7 A;  2YGA A;  2XX2 A;  1Y8P A;  1I58 A;  3R4O A;  4YKY A;  5F3K A;  4E02 A;  4GT8 A;  4AWP A;  2AKP A;  2XHX A;  1EI1 A;  4JYC A;  2YEE A;  2QM8 A;  3QTF A;  4YKX A;  1MU5 A;  3PEH A;  4L93 A;  3WQ9 A;  4FCQ A;  2WEQ A;  2VWC A;  3EHF A;  3D2R A;  1QZR A;  1MX0 A;  2FTK A;  3O0I A;  2BU7 A;  4PRV A;  4O04 A;  4BIZ A;  3LPS A;  3INX A;  4CWQ A;  1UYC A;  2YK2 A;  4KFG A;  1S14 A;  3B24 A;  1B63 A;  2YKE A;  4YKU A;  1F51 A;  4XC0 A;  1UY8 A;  3VHA A;  2HCH A;  3D0B A;  2PNR A;  4NH8 A;  5BOC A;  2Q8F A;  1S16 A;  1TID A;  1ZXM A;  4LWF A;  4MBC A;  5CTX A;  3VHD A;  4LP0 A;  2IOQ A;  4EFU A;  1YT1 A;  5M4K A;  1AM1 A;  1KIJ A;  4HY6 A;  4MOT A;  4FPP A;  2XDU A;  4LC1 A;  2O1V A;  4FCP A;  4PL9 A;  4CWF A;  4YKQ A;  4JAV A;  4R3A A;  2WI2 A;  4HY1 A;  3RKZ A;  2ZDX A;  2YGE A;  4LPB A;  4CWS A;  1ID0 A; 
#chains in the Genus database with same CATH topology
 1YDX A;  3ZHQ A;  3DC6 A;  1SER A;  3B28 A;  1RSO A;  2JDI G;  1FXK C;  4P7A A;  1SC5 B;  1XUQ A;  1DK1 A;  3AG7 A;  3C0E A;  4MP2 A;  1R3I C;  1B62 A;  5KHG A;  4URL A;  1MOF A;  4LF9 B;  3R4P A;  3M7M X;  5A9G A;  1UYG A;  4TSF G;  2P7T C;  4H7Q A;  1AI5 A;  4FLW A;  4BW5 A;  3TTZ A;  4I55 B;  4ZVI A;  4X64 B;  5J2T A;  1I5A A;  4CE3 A;  1N32 O;  3UT5 A;  3VQW A;  4LFB O;  4KQV A;  4NH7 A;  1L0O A;  3EHH A;  2YGF A;  1Y4M A;  3E86 A;  1SKV A;  1GM7 A;  3B8N A;  5BXZ A;  4KFM A;  4JGS A;  1MNG A;  4O4J A;  2GFD A;  5EBW C;  2BYH A;  4JI1 B;  1PNL A;  3ZKD A;  4NTY A;  4XIR A;  2DW4 A;  2YDE A;  2OT5 A;  2YI6 A;  3P3P A;  2Y4T A;  3A0R A;  2BSK A;  2LQT A;  4I9W A;  1RM1 B;  2HG1 A;  4DR2 O;  1YEW A;  3OW2 U;  5CPH A;  1OCC B;  4DV1 B;  4XTJ A;  2AGA A;  1YER A;  4CS3 A;  1QVF U;  4Z1V A;  1KMI Z;  3OPD A;  4MSW C;  2ILM A;  1UYE A;  3K9S A;  2CE4 A;  1TVK B;  3JD3 A;  1XNQ O;  3JAW A;  1Q6I A;  3RLR A;  3CRA A;  4ASA A;  1N34 O;  5JVD B;  3L75 H;  3HKD A;  3ZMV A;  2PI4 A;  5J2U B;  4ICG A;  3ZHU A;  2ARH A;  3C90 A;  2XDK A;  2ZIM A;  2OTJ V;  3A0W A;  4J7Z A;  1SQG A;  2PTM A;  1AR1 B;  3OT7 A;  4LF9 O;  1TC0 A;  4JF3 A;  2A7W A;  4OPH A;  1JA8 A;  4DV3 B;  1TBW A;  1YES A;  5IJ0 A;  3K57 A;  1Z5A A;  1QQC A;  2EZO A;  3CCQ V;  5EYP B;  3J80 N;  4JAU A;  1PNM A;  3CP1 A;  3T1Y O;  3ABK C;  4N23 A;  1YC3 A;  5AG2 A;  4B08 A;  1R6T A;  4OPA A;  4H81 A;  4I7Z B;  5CBH A;  3FX7 A;  2FWY A;  4X1Y A;  2YEH A;  3CYG A;  1D2D A;  3K59 A;  3U2D A;  4DUH A;  1GMG A;  4I50 B;  4LWH A;  1HW7 A;  2PYJ A;  4DR1 B;  4JI1 O;  1YZB A;  3EHB B;  2BSM A;  3L70 H;  4JZG A;  4LP8 A;  2ATK C;  4NYK A;  4PHZ A;  5CTY A;  5H2F Z;  2HJF C;  1NS1 A;  5GTH Z;  4GCZ A;  3A0B Z;  5C93 A;  2ZIO A;  4JI0 B;  1DTO A;  4DV1 O;  4JTA B;  2IBZ H;  2UXD B;  2WLJ A;  5B5E Z;  1EZJ A;  1VF6 C;  4Z2W A;  2AZ2 A;  3GVM A;  3CC2 V;  1AIL A;  3UKM A;  1Y74 B;  1AI6 A;  3RT3 C;  3OUS A;  2VQF B;  2WEP A;  5D6Q A;  4LF5 B;  5L3F A;  1YSR A;  3ZN1 A;  2YI8 A;  5B1A C;  3OGC C;  2Y4U A;  4EKW A;  3G6E V;  4EEH A;  5IDJ A;  4CE1 A;  1RP3 B;  1M57 C;  4QPJ A;  4PRX A;  2Q5Z A;  3K3W A;  4MTO A;  1ENV A;  3CC7 V;  4CC6 A;  5ITZ B;  5JJE B;  4JYA B;  5EC1 C;  2ZD9 A;  4XIT A;  4A5U B;  2Q8G A;  1Y4U A;  4AIL C;  3F5W C;  2WI3 A;  3BMY A;  2MK3 A;  5JJN B;  1I5D A;  2C1I A;  3TZ4 A;  1S5L Z;  4AS9 A;  4JAS A;  4X8A A;  2CG9 A;  4EFB A;  4TQF A;  5KA6 A;  1PL0 A;  2CCT A;  5LMN B;  3OR7 C;  4DR1 O;  2DYR C;  2HG5 C;  1PD3 A;  2C1G A;  2EIN C;  2XAQ A;  2XAB A;  1ZUQ A;  3O6O A;  4R3M A;  1ZAU A;  1UYD A;  2Q7H A;  2R9A A;  4O4I B;  1GKX A;  4JI0 O;  2BYI A;  3W7W A;  4AWQ A;  3VBB A;  4HYP A;  4L91 A;  2UXD O;  5LHI A;  1MZF A;  3RLQ A;  4B7K A;  2EIK B;  4ABM A;  1YTF D;  1VP7 A;  2XHR A;  1YIT V;  3I55 V;  1BMF G;  3SL2 A;  1K4C C;  4UCU A;  1THZ A;  3SYP A;  3BPZ A;  3T1H B;  4R1F A;  2FYU H;  4EEQ A;  4CS2 A;  2VQF O;  3E35 A;  4LF5 O;  2QKC A;  2UWD A;  2X6C A;  1SA0 B;  1M57 B;  4FM1 A;  3OW6 A;  2X7R B;  1JCH A;  2E74 B;  2XJX A;  1N36 B;  5EBM C;  1MSD A;  4JQL A;  3H1K H;  2Q7E A;  3WB1 A;  3LNN A;  5CTU A;  2K5B A;  3EHG A;  3JCU Z;  4MT8 A;  4I5S A;  1KU9 A;  4LNU B;  1I5C A;  1GN3 A;  2XK2 A;  2XAF A;  3O9O A;  3INW A;  1SQP H;  3HKB A;  1ZTE A;  1YTF B;  2LJ2 A;  3N2G B;  3BY6 A;  3ZHV A;  1X4T A;  4PDV A;  5J71 A;  3OMI B;  3JAM N;  1LUW A;  2YID A;  1QNM A;  2H55 A;  1XL4 A;  4RUE A;  5IDM A;  1EN5 A;  1UYL A;  5CBF A;  1ARO P;  1FS0 G;  3QNE A;  1AP6 A;  1S3J A;  4MVQ A;  1QU7 A;  5LMN O;  1XBL A;  4CH3 A;  4X20 B;  2ZR3 A;  3KE6 A;  1R3J C;  4GEE A;  5M4H A;  4ASU G;  2DOS A;  4DRX B;  5LMU O;  3K5M A;  4JI7 B;  2QJ1 A;  2ADP A;  1SF9 A;  4FLU A;  3SYC A;  1BGY H;  4JI2 B;  2Y69 B;  3IJ4 A;  5KHI A;  2NR5 A;  2VWJ A;  4RAI A;  1VQ4 V;  3WHA A;  2XX5 A;  2WLK A;  4J7J A;  4YJ2 B;  3HYZ A;  2YXY A;  1WNS A;  2P4K A;  2C2A A;  4X1K A;  1NHH A;  1JOY A;  4DR7 B;  4FJC C;  1VMG A;  5KLV H;  3Q5J A;  5CB4 A;  3AG3 C;  3T1H O;  4YY3 B;  1GH6 A;  2GHY A;  5D7C A;  1XDC A;  1N36 O;  2WSS G;  3D36 C;  2YKB A;  2DYS B;  1RPR A;  1GN6 A;  2BCC H;  4NXN B;  4KSG A;  2Q8I A;  3M8A A;  3ZN0 A;  4LF7 B;  4FZ0 A;  1S76 D;  4KL1 A;  1KYO F;  3TZ2 A;  2QSA A;  4LWS A;  4JYB A;  4U93 A;  3BHP A;  3SPI A;  5IN9 A;  2GQP A;  2GSM B;  4JYY A;  2YI5 A;  4LF4 O;  2ZDI A;  1JR9 A;  4J9Y B;  2HHI A;  1QYE A;  4LFA B;  5KMG B;  4K8Z A;  1QLN A;  3ABM B;  3GB7 C;  5F2V O;  2QWN B;  3DXR B;  1BS3 A;  3JD0 A;  1XQ8 A;  2GTS A;  3U10 A;  1N0J A;  2JGD B;  1GRJ A;  3PEH A;  4L93 A;  5LGU A;  1NH2 D;  4FCQ A;  5IJ9 A;  2LW1 A;  3DC5 A;  1SQX H;  2OIG A;  4JI7 O;  1VAR A;  1QZR A;  2WLH A;  2ZE8 A;  3RYC B;  3JAT A;  3CCM V;  2PUS A;  1Q5O A;  4LR3 A;  1SQV H;  3LPS A;  5EBL C;  4J7K A;  4G27 B;  4JI5 B;  5FPO A;  3E2E A;  1UYC A;  1EM1 A;  2IJI A;  3AG3 B;  1S14 A;  4GX5 A;  3K0G A;  4HAM A;  1FFX A;  4DR7 O;  2X0L A;  1H2G A;  1VQO V;  2OCH A;  1US6 A;  2ZR2 A;  4J42 A;  3VHA A;  4YY3 O;  5LP6 A;  1FPO A;  1LUV A;  3UQ8 A;  2AZ0 A;  4DR3 B;  4ZBM A;  4NH8 A;  1ZLZ A;  2Q8F A;  1YCI A;  4WCE V;  1ZXM A;  1NH2 B;  3SGI A;  3X2Q B;  3MAQ A;  3RYF B;  4JV5 B;  5CA0 A;  1N33 B;  3ETD A;  1F4N A;  4LP0 A;  2IOQ A;  3VHD A;  1GAX A;  4EFU A;  2ZNI A;  3HKE A;  1YT1 A;  2CGN A;  1BHA A;  4NXN O;  1VQ7 V;  1HDJ A;  2YEV A;  4LF7 O;  3UM7 A;  3CS5 A;  2Z0A A;  3SJQ C;  4FCP A;  4CWF A;  4YKQ A;  2DWD C;  2KG7 B;  5GON B;  4JAV A;  3N2K B;  2YC0 A;  1I5Y A;  1NT2 B;  5H9C A;  4ZI7 A;  3JYC A;  2UXX A;  1AJQ A;  1FD9 A;  1H2L A;  4LFA O;  1VIB A;  3JD1 A;  1BGQ A;  1Y6X A;  4UCT A;  4MPN A;  4TV9 A;  2A0L A;  1YHQ V;  2XAG A;  4AHC A;  3CD6 V;  4G2K A;  1HR0 B;  5LGT A;  4B3M B;  5KAF Z;  4UV9 A;  2F43 G;  4IIJ A;  2L6L A;  3B09 A;  5JH7 B;  4FFB A;  4E2L A;  5LA6 B;  4TV8 B;  2IWU A;  2GDS A;  2V7Q G;  2OYQ A;  1CPY A;  4IGG A;  1VQ8 V;  2WAM A;  2VCI A;  3T4D A;  2W6I G;  4JI5 O;  5KHJ A;  1YSZ A;  4XD8 A;  3ZHR A;  3F5T A;  1OCZ B;  3L73 H;  3VOU A;  2BU8 A;  1KC8 W;  3CJH A;  4TOI A;  4XDL A;  3R92 A;  1BQ0 A;  1Z59 A;  4DR3 O;  1GKF A;  3JD2 A;  5BR8 B;  3CX5 F;  2UXB B;  4MPE A;  4HYO A;  3ZHS A;  4JV5 O;  1NI8 A;  4ASG A;  3E8G A;  3JAK A;  3OE7 G;  2ZXW B;  3IAY A;  3TZ0 A;  4TQD A;  4BXI A;  3C11 A;  2F66 C;  2Y0P A;  3F7V C;  1B06 A;  3G4S V;  1XMQ B;  2GBO A;  1TUE B;  3B27 A;  4TT3 G;  2HVJ C;  4FLX A;  3CMA V;  2BRE A;  4DYL A;  4X89 A;  3TXQ A;  2VW5 A;  1K4D C;  2PY5 A;  2LFR A;  3FAV B;  2B1I A;  3HZ1 A;  4WBN A;  3SJA C;  1TIL A;  3A0T A;  3CCE V;  5M4N A;  3E8H A;  3RGB A;  4E00 A;  4KTN A;  5KX5 A;  4O4L A;  3AG4 C;  2RMK B;  3HZ5 A;  3E22 A;  2G38 A;  4WFG A;  4JI8 B;  2DE0 X;  4C7U A;  4HBN A;  2CH7 B;  1HR0 O;  4DV7 B;  4B3M O;  4AWO A;  2Z5U A;  4LFB B;  4F6R B;  4PU9 A;  5JCO A;  4B7P A;  3NR7 A;  5B1B C;  3J7A U;  5FWK A;  1TA8 A;  2JGU A;  1AH6 A;  5L3C A;  2DWE C;  3OM3 B;  4DR4 O;  2EIL C;  4GX0 A;  1DF5 A;  2HP8 A;  2W6J G;  1IDS A;  4OX9 O;  1YSC A;  4TUY B;  4R50 A;  1XHZ A;  5F5R A;  3B2E E;  3JAR B;  4DUY B;  3AG1 C;  3JAL A;  2YI7 A;  1AVM A;  2QKA A;  4YJ3 A;  2QF6 A;  5GGZ A;  2HKJ A;  5LYJ A;  1ZW9 A;  3U0Z A;  5BR8 O;  4I0X A;  5IE9 A;  1MZE A;  2EIM B;  5EZY B;  4MVR A;  4ZKI A;  4XDK A;  4H13 B;  1AH8 A;  3B8M A;  5IYB O;  1B04 A;  2ZM6 B;  1XMQ O;  1YET A;  4FLV A;  4BIU A;  3B77 A;  4L8Z A;  5J6A A;  2B9Z A;  1N34 B;  3RYI A;  4X1I A;  3T2S A;  3W7S A;  2R9R B;  1JFF A;  4O4H A;  3K98 A;  4K8X A;  1Y66 A;  5CMU A;  3A2F A;  3WFV A;  2WLL B;  2BTQ B;  3ASN C;  4JI8 O;  1EFR G;  3D3I A;  3T1Y B;  4X65 O;  4DV7 O;  3JAS B;  4F6E A;  2YEJ A;  3RW0 A;  3O2F A;  2IH3 C;  1CP9 A;  2OIE A;  4PA4 A;  2XOK G;  4EB6 B;  3MD0 A;  1TUB B;  4PA6 A;  4XCJ A;  1KP2 A;  5D5Q A;  2YE7 A;  3VQY A;  1EN6 A;  5LBQ A;  4I4T B;  1ZWI C;  1TGO A;  1F23 A;  2DMX A;  2Z3Y A;  5FL7 G;  4PV1 B;  4PJ0 Z;  5J9P C;  4E01 A;  1V54 C;  2P4V A;  1KEC A;  4DUY O;  4LWG A;  1NTK H;  1BXD A;  4O2A B;  4O2B B;  1CEZ A;  5M4M A;  3RLP A;  5KHK A;  2XX4 A;  2IOR A;  3DSQ A;  4OXS A;  1FYJ A;  2F23 A;  2UUC B;  2E5L B;  4L90 A;  3CGZ A;  1VQ6 V;  3TCU A;  5CA1 B;  1V55 C;  1G6U A;  3OAA G;  3G7B A;  4U7N A;  4PDL A;  2MW2 B;  2AXT Z;  4D7T A;  2QR4 A;  2ZM6 O;  1L0N H;  2BZ5 A;  1FAF A;  2FYP A;  5D7D A;  5FNV B;  1FXK B;  5JEN A;  4URM A;  3BFR A;  2RCV A;  2KKW A;  4YIP A;  2E0A A;  4WUB A;  1US7 A;  1WB8 A;  2IOP A;  2CTR A;  5CA3 A;  2YEF A;  1YIJ V;  3QTC A;  4DXW A;  5DED A;  3ZJZ A;  3EFF K;  4I55 A;  1P4R A;  1Q8I A;  1WPB A;  4EGK A;  1HNW B;  2WLI B;  1UYK A;  2ITD C;  1Z5C A;  4JAA A;  5JJJ B;  3U11 A;  4KSH A;  4DZY A;  3E83 A;  2YE8 A;  4D6T H;  5D6P A;  1P84 F;  3A0Y A;  3K58 A;  1JPX A;  1UPG A;  3ZHT A;  4HZ3 A;  4O09 A;  2ZKJ A;  1KKC A;  5GW7 A;  5IYZ B;  2NLJ C;  4AQY B;  1M1K W;  3APO A;  4H0L B;  4QPK A;  1QHT A;  4UUJ C;  2BTO A;  1YJ9 V;  1EZV H;  3M99 B;  3LNM B;  1V54 B;  2FL4 A;  4MW8 A;  3JCZ A;  3W7T A;  1MA1 A;  1ROP A;  4GX2 A;  1NQT A;  4HNA B;  4FLT A;  1O9H A;  1WJZ A;  2YUA A;  4BAE A;  1QLE C;  4AI8 A;  1JX9 A;  2BU5 A;  1NR7 A;  4DV6 B;  2HVK C;  1AMW A;  4NR1 A;  1THN A;  2RNB A;  1YXB A;  3G80 A;  1NKD A;  1V55 B;  3SYQ A;  1SES A;  2UUC O;  3U2K A;  2E5L O;  2Q8H A;  5LHH A;  1IBK B;  1TVK A;  3KCY A;  1B3Q A;  2H3O A;  5C8Y B;  3EHJ A;  4B3S B;  1Y76 B;  2CCS A;  2QM4 A;  5JVD A;  4QGP A;  5J2U A;  2Q0O C;  1B6Q A;  5L3E A;  2Y48 A;  2NN4 A;  3HYY A;  1ZL8 B;  1SS3 A;  2EX3 A;  2PI5 A;  1Q90 D;  3CB2 A;  1PP9 H;  1WAZ A;  4WFB V;  3LMM A;  2DQ3 A;  2Q6A A;  2YIB A;  5EYP A;  2M7W A;  3RVZ A;  4MVS A;  3ABK B;  4QNH B;  2HHH B;  1HNW O;  1A32 A;  3OR6 C;  4XKA A;  1J95 A;  3Q5L A;  2WWW A;  2IWS A;  2WA4 A;  1J5E B;  1M56 C;  3Q4H B;  4AQY O;  4I50 A;  3QO5 A;  3SYA A;  3ETG A;  2OWO A;  4EFE A;  3T0Z A;  1K34 A;  1SRY A;  1KKD A;  2R72 A;  1K7D A;  1WP8 A;  3AK3 A;  2GV9 A;  2N05 A;  2XCM A;  1QLE B;  1H7S A;  1Z5V A;  2H8M A;  2VQE O;  1IUR A;  2QTO A;  5LMU B;  1UYH A;  4ZIB A;  1QR9 A;  2ZDY A;  4DV6 O;  2QM7 A;  2YGA A;  2WA3 A;  1WA8 B;  3A8T A;  2EBO A;  1Y8P A;  3A0H Z;  2ZDI C;  1GM9 A;  1OCR C;  3R4O A;  4YKY A;  5F3K A;  2EIJ C;  4AWP A;  1IBK O;  2HEP A;  3H1H H;  2YEE A;  3RYH B;  4E4E A;  3K5N A;  1Y74 A;  3WQ9 A;  2WEQ A;  4WFH A;  1Q7Y W;  4B3S O;  3D2R A;  1WN7 A;  5B1A B;  5E79 Z;  3FB8 C;  2XT9 A;  2VRZ A;  3ASO C;  1U97 A;  4O04 A;  4H33 A;  4JTD B;  1DGS A;  1SQF A;  4FVM A;  4CWQ A;  2YK2 A;  1JMK C;  1NZ6 A;  5ITZ A;  3IGA C;  4FM0 A;  3STZ C;  3D0B A;  2HHH O;  5DN6 G;  5JQG B;  2PNR A;  3IC7 A;  1TID A;  2JEX A;  2LP7 A;  2P22 C;  4LF4 B;  2ZE7 A;  1YI2 V;  2EUL A;  4HY6 A;  4MOT A;  3FB6 C;  1J5E O;  2IJJ A;  4NTW A;  4MVM A;  1ZSP A;  2DYR B;  2P06 A;  3OMA B;  2EIN B;  3RKZ A;  2ZDX A;  3W7X A;  2W0F C;  2Q73 A;  4PI2 A;  3S3X A;  4O4I A;  3MHH C;  1KP3 A;  4R8C A;  1VF6 A;  3H1J H;  1ID0 A;  1OCR B;  4LF8 B;  3K06 A;  4QE9 A;  4YHH B;  2LGW A;  2F4V B;  4ZOL B;  2GUZ B;  4DV0 B;  4KXR A;  4GFN A;  3TJT A;  1QCE A;  5CF0 A;  2OTL V;  1JM6 A;  4WFE A;  4Q6G A;  4O07 A;  2YK9 A;  4J9Z B;  1SA0 A;  2BU6 A;  2OCC C;  4O05 A;  3GWO A;  1UY7 A;  1ZWH A;  1BCC H;  1HP8 A;  1Z5W A;  1NHJ A;  3G7E A;  4QIW F;  5B3S C;  3LNU A;  2KSD A;  4LH6 A;  1UJW B;  4JI4 B;  3UO2 A;  4BIO A;  4LNU A;  1Q43 A;  3OTF A;  3ABL C;  1T5E A;  4H37 A;  3N2G A;  3ZED A;  4F4L A;  4PEL A;  3H9V A;  1M90 W;  4MTG A;  2WI6 A;  5LL6 Y;  1P7G A;  1ZXN A;  1LR1 A;  3BA9 A;  1E1Q G;  1GN2 A;  2UUB B;  1I94 B;  3KCX A;  3FT5 A;  3OGI B;  4IYH A;  2YJX A;  3D8C A;  4UCO A;  4ZHQ B;  4X20 A;  5GTI Z;  1R6N A;  4YKT A;  3OMU A;  4LWE A;  4DRX A;  4IHJ B;  4JI6 B;  5CBG A;  3LUT B;  2WLM A;  3BRC A;  4IYI A;  2A3Q A;  4NKG B;  5H6R A;  4XIQ A;  1PM9 A;  1H2N A;  4LF8 O;  3HKC B;  4PD4 F;  4YHH O;  4YJ2 A;  4JZ2 A;  3CSX A;  2F4V O;  1KBH A;  4DV0 O;  2R9I A;  3QVN A;  2OCC B;  1KQS U;  4B3T B;  2XAS A;  4FLY A;  4L94 A;  1Q6H A;  1Z5B A;  2YEI A;  1NJI W;  3CEI A;  4MVU A;  3ZRW B;  5B3S B;  1R73 A;  3G6B A;  4BQJ A;  1WLE A;  1H2S B;  1S72 V;  3ZS8 C;  2KB1 A;  5JCO C;  4UCS A;  5K1X A;  1N0N A;  5FLX N;  4JI4 O;  1R1B A;  3K79 A;  3T2M A;  5LOV B;  1UYI A;  2Q4P A;  1QR8 A;  3H1L H;  3JSL A;  4WFA V;  1AI4 A;  3K60 A;  3AG2 C;  4CE2 A;  1PVG A;  4EM7 A;  1OCO C;  3OEH G;  3WB2 A;  2YEB A;  3K03 A;  1AB3 A;  2YIC A;  1U2O A;  2IJH A;  1K73 W;  3GIG B;  1AJN A;  1XIL A;  5KMG A;  3BCC H;  1Q3E A;  4UCV A;  1MSW D;  1YT0 A;  3H01 A;  4X9L A;  2UUB O;  1I94 O;  4MVZ A;  3DXR A;  1MG1 A;  1GO3 F;  2JGD A;  3IC9 A;  2YE4 A;  1XRE A;  2WI1 A;  4GQT A;  4YKZ A;  2VCJ A;  1I7F A;  2WI7 A;  3UCS C;  3E8B A;  4JI6 O;  1S0V A;  1I08 A;  3RYC A;  4CC5 A;  3LSQ A;  3R91 A;  1U0Z A;  1G8M A;  3HHU A;  4DR4 B;  4HXW A;  4UCR A;  1PV0 A;  2CUG A;  2CGF A;  5BMV B;  4DV5 O;  4OX9 B;  2WPD G;  3EVK A;  2RJZ A;  4LBE C;  2XD6 A;  4GGL A;  2QWR B;  5M4P A;  3CXH F;  1I5X A;  2QE7 G;  5EIB C;  4B3T O;  3CC4 V;  3LSU A;  2YEA A;  4UV8 A;  2ZQM A;  3STL C;  2LGQ A;  2YE3 A;  4O0B A;  1NBM G;  3R4N A;  3RYF A;  3VAD A;  2XDS A;  2HFE C;  1YF2 A;  2CAZ C;  1Y4S A;  1H2M A;  2QDO A;  4P8O A;  3OWD A;  3JSN A;  3AG2 B;  4DR6 B;  1D5N A;  2KG7 A;  5GON A;  2P90 A;  3N2K A;  2PGG A;  3L72 H;  2JVD A;  3ZRX A;  4FMT A;  2DQ0 A;  3DGE A;  3CXC U;  4U3J B;  4MW3 A;  5EK0 A;  3CRM A;  4K0K B;  3G71 V;  3ETQ A;  2KQX A;  5B1N A;  3OD4 A;  5EIB D;  2LW7 A;  1H8H G;  1D5A A;  4N21 A;  2QEX V;  1E79 G;  3N27 A;  3CRR A;  3ZMT A;  1I59 A;  3MHS C;  3QDD A;  2JJ2 G;  2IU3 A;  4BWA A;  1YS3 A;  4CH6 A;  3R66 A;  1I0H A;  3NMQ A;  2RN9 A;  3SJB C;  1NTM H;  4X65 B;  5JH7 A;  4GKK O;  4W4L A;  5LA6 A;  4TV8 A;  2P67 A;  1RSO B;  1N8R W;  1GJV A;  4K35 A;  1DLB A;  3A0Z A;  2BRC A;  3IFX A;  4KUM A;  4PI0 A;  1K92 A;  1BYQ A;  4EGH A;  4L8J A;  1K5Q A;  5FNC A;  2ZBK B;  2H8P C;  4H44 B;  5CTW A;  4XDJ A;  1YJN V;  5J2T B;  4J41 A;  4BR6 A;  2YE9 A;  5EC2 C;  3UT5 B;  4GKJ B;  3GIF A;  4CWR A;  3MNR P;  1R3K C;  3I5D A;  4RUF A;  5FND A;  3KZI Z;  3NXS A;  4BW9 A;  3OFN G;  4NH9 A;  2AHZ A;  4FFK A;  3TGU H;  3VQV A;  2Y0I A;  2UU9 B;  2YED A;  3SPG A;  1VEW A;  4IT5 A;  1NR1 A;  1SQB H;  4O4J B;  4DR6 O;  1H8E G;  4EMV A;  3LDE A;  4LCU C;  1BE3 H;  2ZT9 B;  2CCU A;  1Q6U A;  4WUD A;  2FXS A;  2BSK B;  1SQQ H;  3T0H A;  1KUQ A;  1H7U A;  4GYC B;  1YVW A;  4K0K O;  4FK5 C;  3FAV A;  4L87 A;  1RM1 C;  2L35 A;  4OGQ B;  4X66 B;  3R65 A;  1OCC C;  4CWP A;  2DN9 A;  3AG4 B;  4HZ5 A;  4Z1M G;  2BOB C;  3WB0 A;  2CH7 A;  1H38 A;  4V26 A;  5KA5 A;  3JAW B;  2YEG A;  4X62 O;  4F6R A;  5B1B B;  1NVP D;  3T1C A;  2XND G;  2YJW A;  3DTU B;  2XAH A;  3HKD B;  1ZX3 A;  2EIL B;  1IXM A;  5E1A C;  1COW G;  2XHT A;  1XHX A;  4HZ0 A;  3SR2 C;  3FT8 A;  3E89 A;  1N4C A;  1AI7 A;  4MB9 A;  4TUY A;  2BTZ A;  1AJ6 A;  3K5O A;  5IWA O;  5IJ0 B;  3AG1 B;  1NHI A;  3LDC A;  3JAR A;  4XCL A;  3H1I H;  2DJV A;  1L1F A;  3PEJ A;  2YKJ A;  1SET A;  4GKJ O;  3PJS K;  5LXT B;  5M4E A;  1NVP B;  3U67 A;  5EZY A;  3RFR A;  1BT8 A;  4X1Y B;  3BEH A;  4EGI A;  1TH8 A;  2UXC B;  4DW1 A;  2ESA A;  2UU9 O;  2YE5 A;  4GT1 A;  4P2Z A;  4DUZ B;  2FML A;  2ZE6 A;  3FB7 C;  3OMN B;  1E1R G;  2QKS A;  4RO2 A;  1JJO A;  2RQ6 A;  2HJD A;  2XX2 A;  5L3G A;  4E02 A;  3TET A;  3P3N A;  1JJ2 U;  5DEC A;  2XHX A;  2YIB D;  2K9P A;  2A06 H;  3B40 A;  4X66 O;  3EHF A;  3ASN B;  2WLL A;  2Q9L A;  3FKS G;  3RWR D;  2K1E A;  2BTQ A;  3O0I A;  2Q68 A;  3B4S A;  4B7E A;  2BU7 A;  3LDD A;  4BIZ A;  3KKY A;  3JAS A;  4GX1 A;  4EB6 A;  2IH1 C;  5L3D A;  4WF9 V;  3B24 A;  1TUB A;  3ABT A;  4TWK A;  4YKU A;  1F51 A;  4XC0 A;  1UY8 A;  4D7S A;  2HCH A;  3CRC A;  4I4T A;  1LNQ A;  4DW0 A;  5BOC A;  5A2Q N;  1WP7 A;  3T4Z A;  4P9O A;  4X64 O;  4LWF A;  4MBC A;  5CTX A;  1K3E A;  1K8A W;  1BQZ A;  1FFT B;  4O2A A;  4O2B A;  2VQE B;  3S5T A;  1AM1 A;  5M4K A;  1V9P A;  5LXT A;  3CRQ A;  4LC1 A;  1IVS A;  2O1V A;  4PL9 A;  4DV4 B;  2H94 A;  1L8D A;  2AW9 A;  4NVP A;  1ORQ C;  2UXC O;  4UFZ A;  5CA1 A;  3KG2 A;  3QO7 A;  4DUZ O;  4CWS A;  1VQP V;  4J80 A;  1S5J A;  5FNV A;  1FXK A;  3FD9 A;  3EXA A;  1HNZ B;  4U3F H;  1U96 A;  2EJ7 A;  3L74 H;  4LH7 A;  1S77 D;  3ZMU A;  3SPH A;  1O9G A;  2XJJ A;  3HB3 B;  1BHB A;  3E8F A;  3BAB A;  4RQE A;  2ZCE A;  4BQG A;  4XKK A;  5D5P A;  2YEC A;  4DV2 B;  3OUF A;  2FB5 A;  3RN4 A;  3HR0 A;  2WLI A;  4QE7 A;  2LFS A;  1EBO A;  3AEI A;  4PA9 A;  1P7B A;  1GTO A;  2EIK C;  1VF7 A;  2YS8 A;  1W0J G;  3APQ A;  4B3R B;  2FWZ A;  2XAJ A;  3HPL C;  5B66 Z;  3EKO A;  4MP7 A;  4UVC A;  2JIZ G;  4I3H A;  5HFL A;  5IYZ A;  2Q69 A;  3THO A;  1NTZ H;  4CWT A;  3CE2 A;  2ETN A;  3GWK C;  4DK0 A;  2QFO A;  2JJ1 G;  4WFF A;  4DV3 O;  2IU0 A;  3H80 A;  4DR5 B;  4FCR A;  2ADQ B;  3EKR A;  2R70 A;  3SPJ A;  1M93 A;  4HNA A;  2VS0 A;  1RPO A;  2V4D A;  4YIO A;  3HKB B;  4FLZ A;  3ZCC A;  2YSU B;  3BA8 A;  4XBF A;  3CCS V;  1FJG B;  3QF7 A;  1UY9 A;  3ICX A;  4DV4 O;  4LF6 B;  4IL6 Z;  2IWX A;  3T10 A;  5H6Q A;  4UB8 Z;  5B1O A;  5C8Y A;  1K97 A;  1KZN A;  2JRI A;  3CCV V;  4EFT A;  1Y76 A;  4MVO A;  3CRK A;  1YC1 A;  2IW5 A;  2XDX A;  3K97 A;  2V1D A;  1HNZ O;  1G1X B;  3CGY A;  1HWY A;  2PF4 E;  2Q7G A;  2M6Y A;  1K9M W;  1ZL8 A;  4K4O A;  2YE6 A;  2ITC C;  1H2K A;  3TK1 A;  4URN A;  2WLN A;  2ZKO A;  3BAA A;  2CDY A;  3LSS A;  4LFC B;  1GKZ A;  2IJK A;  2Y69 C;  4XKO A;  2HKO A;  4DV2 O;  1K33 A;  1FXH A;  4GLX A;  1QY8 A;  5CN0 A;  3ZXO A;  1I5B A;  4W4K A;  3W7U A;  5FNF A;  2XJG A;  4X1K B;  5D7R A;  4B3R O;  2O1U A;  5CB4 B;  1M56 B;  5JWP A;  4MS2 A;  4ASB A;  1W2B U;  2D2C B;  3Q4H A;  1VQL V;  4DO2 A;  5LP6 C;  1X59 A;  2W0X A;  1UY6 A;  2IM9 A;  3K9A A;  2WI5 A;  4UB6 Z;  3GIE A;  1IBL B;  2B5U A;  3AK1 A;  2DYS C;  3SYO A;  1AP5 A;  2YKI A;  3CCJ V;  1BZK A;  3G67 A;  4DR5 O;  1VF5 B;  4JYA O;  5IYC O;  3ZMZ A;  2XDL A;  4LWS B;  1YT2 A;  3OTO B;  2GTA A;  2YKC A;  2QG0 A;  3B25 A;  1EN4 A;  2ZNJ A;  4UXN A;  1FJG O;  3D3Q A;  1WA8 A;  4MTX A;  1OSF A;  3B26 A;  2NNU A;  2BU2 A;  1W0K G;  2QGN A;  2X6A A;  2EIJ B;  4LF6 O;  4U7O A;  3FYE B;  2JK5 C;  3RYH A;  3K08 A;  1BKN A;  1YC4 A;  2HR3 A;  4X88 A;  2YE2 A;  5BOD A;  3ABM C;  4RWU A;  2Q8V A;  1Q86 W;  4XIP A;  1JVM A;  4JTC B;  4CS4 A;  3ASO B;  5TIS Z;  3ZXQ A;  3L71 H;  1F7Y A;  1CXZ B;  5IJ9 B;  3ZIA G;  1VQ9 V;  4XDM A;  4P9P A;  4LFC O;  3JAT B;  4NB5 A;  1Y8O A;  3P32 A;  5H5N A;  1VQ5 V;  1PKX A;  4KP4 A;  5JQG A;  2CH4 A;  3JZ3 A;  3RBZ A;  2UXN A;  1AR4 A;  1FFX B;  3CWV A;  3T1K A;  2WER A;  4MPC A;  1QBZ A;  3CWB H;  3ZMS A;  2FKX A;  5LP6 B;  1F4M A;  2O1W A;  3ZKB A;  3AK2 A;  4QJF B;  1R6K A;  2O57 A;  4CWN A;  1OZ0 A;  2P5O A;  3X2Q C;  5CA0 B;  2QWQ B;  1IBL O;  3HKE B;  4CZZ A;  3J81 N;  4DK1 A;  1KB9 F;  4YXW G;  5IY5 C;  2E3C A;  2YEV B;  3F7Y C;  5IYD O;  2D3O W;  4B6C A;  4FZ1 A;  4YKR A;  1A4H A;  3S3W A;  3FV5 A;  3OTO O;  1Y8N A;  3L9D A;  4MTF A;  1M9N A;  4YKW A;  4PDR A;  4JPR A;  4ASF A;  1YJW V;  3TXS A;  4PA7 A;  1M4U A;  4LWI A;  1DF4 A;  3FYI B;  1TC6 A;  3O65 A;  4ZI7 B;  2N74 A;  4ZOL A;  2GUZ A;  4E72 A;  1IBM B;  1R62 A;  2VWK A;  2F95 B;  4DV5 B;  4V25 A;  3ZX6 A;  4G28 B;  4KHP B;  4TV9 B;  2E76 B;  3K5L A;  3K99 A;  4NTX A;  3P30 A;  2HLD G;  2WI4 A;  3SJC C;  3WU2 Z;  2UUA B;  5L3J A;  5FPR A;  3CYO A;  1FKA O;  2A9H A;  4IIJ B;  4JI2 O;  4FFB B;  3TZ5 A;  2YXL A;  1URF A;  3CRL A;  4X9Q A;  3OWB A;  5HFM A;  1XMO B;  4JI3 B;  2A79 B;  4UVA A;  3ABL B;  2EXL A;  2QG2 A;  1K5S A;  2RDC A;  1PNK A;  1NU1 H;  3HEK A;  5BY1 A;  1Q81 W;  1VQK V;  4PA3 A;  1G4Y B;  3CCR V;  2XUM A;  1UYM A;  2QWP B;  1OCZ C;  1M5I A;  3VHC A;  3QG5 A;  1R3L C;  2XHB A;  3CJH B;  1VQM V;  1OV9 A;  3CME V;  3UO3 A;  1SZX A;  3CCL V;  2CTP A;  4H85 A;  1HNX B;  3H4L A;  5KUK A;  4J10 A;  3Q5K A;  2PZS A;  3ZM7 A;  2JKI A;  3ABU A;  5IY5 B;  4ZHQ A;  4FM2 A;  3JAK B;  2ZXW C;  5KUM A;  5L3B A;  3BM9 A;  1GN4 A;  3JD4 A;  4IHJ A;  4FIP C;  3CHX A;  3ZRS A;  5LHG A;  4NXM B;  1XEQ A;  2Q0A A;  4GKK B;  2CGO A;  2JS5 A;  2BT0 A;  1W59 A;  3IED A;  5KAI Z;  4UVB A;  3RVY A;  4GZR B;  3HKC A;  1XNR B;  1UYF A;  3TUH A;  4WUC A;  5K1P A;  2YXH A;  4WBN B;  1EA6 A;  2P6J A;  1IBM O;  1Q82 W;  2LO1 A;  4KHP O;  1Y67 A;  5KX5 B;  4O4L B;  5IT9 N;  3E22 B;  3I56 V;  3R4M A;  4W7T A;  1WB7 A;  3ZRW A;  4URO A;  2N04 A;  2UUA O;  1XL6 A;  3D36 A;  1S5H C;  1KD1 W;  4HXZ A;  4XE2 A;  2CK3 G;  4J11 A;  2YI0 A;  2EZP A;  5LOV A;  1AJP A;  1XMO O;  4JI3 O;  4CH4 A;  4I9Q A;  4RQF A;  4GUN A;  3ZRV A;  2QTS A;  1XI1 A;  1OCO B;  2JS3 A;  2JJC A;  2EJR A;  4P30 A;  3CCU V;  5DM6 V;  4CWO A;  3GIG A;  4Q20 A;  3K0D A;  4HYM A;  3JAL B;  3OEE G;  3SDL A;  1HNX O;  4YJ3 B;  2QA4 V;  1QVG U;  3A0X A;  2F1M A;  5LYJ B;  3G75 A;  4I0X B;  1N33 O;  1MAB G;  3CPW U;  1IX9 A;  1RFY A;  2EIM C;  2Q2E B;  1PPJ H;  3ZBH A;  2BE3 A;  4CH5 A;  1IZ3 A;  2F93 B;  4PDM A;  3WG7 C;  2CTW A;  2ZIN A;  4NXM O;  1I58 A;  4X62 B;  3FB5 C;  4GT8 A;  3K04 A;  1Z2G A;  2AKP A;  4CBC A;  5BZB A;  3BVO A;  4JYC A;  2QM8 A;  4BAY A;  1EI1 A;  2XTA A;  1MU5 A;  3QTF A;  4YKX A;  1OJH A;  1XNR O;  3RYI B;  3VQX A;  4X1I B;  2VWC A;  2BOC C;  1OHH G;  5BMV A;  1JFF B;  1BSM A;  3PN1 A;  2FTK A;  4O4H B;  1MX0 A;  4PRV A;  1UFI A;  5IWA B;  2CTQ A;  3INX A;  2Q67 A;  2YI9 A;  3FFQ A;  4KFG A;  1N32 B;  1B63 A;  2YKE A;  2AHY A;  5LGN A;  3MDS A;  1GK9 A;  2QWO B;  1S16 A;  1P49 A;  1AR5 A;  1XOU A;  1WPX A;  2X6B A;  3C3S A;  1KIJ A;  2ODM A;  1JQ0 A;  4FPP A;  1GM8 A;  2XDU A;  1MMM A;  4U3J A;  3ETE A;  2YIA A;  2PYL A;  4K3A A;  4DR2 B;  4R3A A;  1L0L H;  3QO8 A;  2WI2 A;  4HY1 A;  2B1G A;  2UXB O;  2YGE A;  5KHH A;  4LPB A;  1SZT A;  3ML0 A;  1FXV A;  2E75 B;  2JEU A;  1TAE A;  4R6Z A;  1IXB A;  1PL4 A;  3C3T A;  3SPC A;  2ZE5 A;  3WG7 B;  1VQN V;  1BL8 A;  1XNQ B;  4R7C A; 
#chains in the Genus database with same CATH homology
 1SER A;  3B28 A;  2JDI G;  1FXK C;  4P7A A;  3C0E A;  4MP2 A;  1R3I C;  1B62 A;  4URL A;  1MOF A;  3R4P A;  1UYG A;  4TSF G;  2P7T C;  4H7Q A;  1AI5 A;  4BW5 A;  3TTZ A;  4ZVI A;  1I5A A;  4CE3 A;  4KQV A;  4NH7 A;  1L0O A;  3EHH A;  2YGF A;  1Y4M A;  3E86 A;  1GM7 A;  3B8N A;  4KFM A;  4JGS A;  2GFD A;  5EBW C;  2BYH A;  1PNL A;  3ZKD A;  4XIR A;  2DW4 A;  2OT5 A;  2YI6 A;  3A0R A;  4I9W A;  1RM1 B;  2HG1 A;  3OW2 U;  5CPH A;  1OCC B;  4XTJ A;  1YER A;  1QVF U;  3OPD A;  4MSW C;  1UYE A;  3JD3 A;  3RLR A;  4ASA A;  3ZMV A;  2PI4 A;  2XDK A;  2OTJ V;  3A0W A;  1AR1 B;  1TC0 A;  4JF3 A;  1TBW A;  1YES A;  1Z5A A;  2EZO A;  3CCQ V;  4JAU A;  1PNM A;  3CP1 A;  3ABK C;  4N23 A;  1YC3 A;  4H81 A;  5CBH A;  2FWY A;  2YEH A;  3U2D A;  4DUH A;  1GMG A;  4LWH A;  3EHB B;  2BSM A;  4LP8 A;  2ATK C;  5CTY A;  2HJF C;  4GCZ A;  5C93 A;  1DTO A;  4JTA B;  2WLJ A;  1EZJ A;  3CC2 V;  3UKM A;  1AI6 A;  3OUS A;  2WEP A;  5D6Q A;  5L3F A;  1YSR A;  3ZN1 A;  5B1A C;  3OGC C;  4EKW A;  3G6E V;  4EEH A;  5IDJ A;  4CE1 A;  1M57 C;  4QPJ A;  4PRX A;  3K3W A;  4MTO A;  1ENV A;  3CC7 V;  5EC1 C;  2ZD9 A;  4XIT A;  2Q8G A;  1Y4U A;  3F5W C;  2WI3 A;  3BMY A;  2MK3 A;  1I5D A;  3TZ4 A;  4AS9 A;  4JAS A;  4X8A A;  2CG9 A;  5KA6 A;  1PL0 A;  2CCT A;  3OR7 C;  2DYR C;  2HG5 C;  1PD3 A;  2EIN C;  2XAQ A;  2XAB A;  3O6O A;  4R3M A;  1UYD A;  1GKX A;  2BYI A;  3W7W A;  4AWQ A;  3VBB A;  4HYP A;  4L91 A;  5LHI A;  3RLQ A;  2EIK B;  1YTF D;  2XHR A;  1YIT V;  3I55 V;  1BMF G;  3SL2 A;  1K4C C;  3SYP A;  1THZ A;  4R1F A;  3E35 A;  2UWD A;  2X6C A;  3OW6 A;  1M57 B;  2X7R B;  1JCH A;  2XJX A;  5EBM C;  4JQL A;  5CTU A;  2K5B A;  3EHG A;  4MT8 A;  4I5S A;  1I5C A;  2XK2 A;  2XAF A;  3INW A;  1YTF B;  3BY6 A;  4PDV A;  5J71 A;  3OMI B;  2H55 A;  1XL4 A;  4RUE A;  5IDM A;  1UYL A;  5CBF A;  1ARO P;  1FS0 G;  3QNE A;  1S3J A;  4MVQ A;  2ZR3 A;  3KE6 A;  1R3J C;  4GEE A;  5M4H A;  4ASU G;  3SYC A;  2Y69 B;  4RAI A;  1VQ4 V;  3WHA A;  2XX5 A;  2WLK A;  3HYZ A;  2C2A A;  1NHH A;  1JOY A;  4FJC C;  3Q5J A;  3AG3 C;  2GHY A;  5D7C A;  2WSS G;  2YKB A;  2DYS B;  1RPR A;  4KSG A;  2Q8I A;  3ZN0 A;  1S76 D;  3TZ2 A;  4JYB A;  4U93 A;  3SPI A;  5IN9 A;  2GQP A;  2GSM B;  2YI5 A;  2ZDI A;  4J9Y B;  1QYE A;  1QLN A;  3ABM B;  3GB7 C;  3JD0 A;  3PEH A;  4L93 A;  5LGU A;  1NH2 D;  4FCQ A;  1QZR A;  2WLH A;  3CCM V;  3LPS A;  5EBL C;  4G27 B;  3E2E A;  1UYC A;  2IJI A;  1S14 A;  3AG3 B;  4GX5 A;  3K0G A;  4HAM A;  2X0L A;  1H2G A;  1VQO V;  2ZR2 A;  3VHA A;  4ZBM A;  4NH8 A;  2Q8F A;  4WCE V;  1ZXM A;  1NH2 B;  3X2Q B;  3VHD A;  4LP0 A;  3ETD A;  1F4N A;  2IOQ A;  4EFU A;  1YT1 A;  1BHA A;  1VQ7 V;  2YEV A;  3UM7 A;  4FCP A;  3SJQ C;  4CWF A;  4YKQ A;  2DWD C;  4JAV A;  1I5Y A;  5H9C A;  3JYC A;  2UXX A;  1AJQ A;  3JD1 A;  1BGQ A;  4MPN A;  2A0L A;  1YHQ V;  2XAG A;  3CD6 V;  4G2K A;  5LGT A;  4UV9 A;  2F43 G;  4E2L A;  2IWU A;  2V7Q G;  1CPY A;  1VQ8 V;  2WAM A;  2VCI A;  3T4D A;  2W6I G;  1YSZ A;  4XD8 A;  1OCZ B;  3VOU A;  2BU8 A;  1KC8 W;  4XDL A;  3R92 A;  1Z59 A;  1GKF A;  3JD2 A;  4MPE A;  4HYO A;  4ASG A;  3E8G A;  3OE7 G;  2ZXW B;  3TZ0 A;  4BXI A;  3C11 A;  3F7V C;  3G4S V;  1TUE B;  3B27 A;  4TT3 G;  2HVJ C;  3CMA V;  2BRE A;  4X89 A;  2VW5 A;  1K4D C;  2LFR A;  2B1I A;  3HZ1 A;  1TIL A;  3A0T A;  3CCE V;  5M4N A;  3E8H A;  4E00 A;  4KTN A;  3AG4 C;  3HZ5 A;  4WFG A;  4AWO A;  2Z5U A;  4PU9 A;  4B7P A;  5B1B C;  5FWK A;  1AH6 A;  5L3C A;  2DWE C;  3OM3 B;  2EIL C;  4GX0 A;  1DF5 A;  2W6J G;  1YSC A;  4R50 A;  5F5R A;  3AG1 C;  2YI7 A;  2QF6 A;  5GGZ A;  2HKJ A;  1ZW9 A;  2EIM B;  4MVR A;  4ZKI A;  4XDK A;  1AH8 A;  3B8M A;  5IYB O;  1YET A;  4BIU A;  3B77 A;  4L8Z A;  5J6A A;  3T2S A;  3W7S A;  2R9R B;  3K98 A;  1Y66 A;  5CMU A;  3WFV A;  2WLL B;  3ASN C;  1EFR G;  3D3I A;  2YEJ A;  3RW0 A;  3O2F A;  2IH3 C;  1CP9 A;  4PA4 A;  2XOK G;  3MD0 A;  4PA6 A;  4XCJ A;  1KP2 A;  2YE7 A;  5LBQ A;  1ZWI C;  1F23 A;  2Z3Y A;  5FL7 G;  5J9P C;  4E01 A;  1V54 C;  1KEC A;  4LWG A;  1BXD A;  1CEZ A;  5M4M A;  3RLP A;  2XX4 A;  2IOR A;  4OXS A;  4L90 A;  3CGZ A;  1VQ6 V;  3TCU A;  1V55 C;  3OAA G;  3G7B A;  4U7N A;  4PDL A;  2BZ5 A;  2FYP A;  5D7D A;  1FXK B;  4URM A;  2E0A A;  4WUB A;  1US7 A;  2IOP A;  5CA3 A;  2YEF A;  1YIJ V;  4DXW A;  3ZJZ A;  3EFF K;  1P4R A;  4EGK A;  2WLI B;  1UYK A;  2ITD C;  1Z5C A;  4KSH A;  4DZY A;  3E83 A;  2YE8 A;  5D6P A;  3A0Y A;  1JPX A;  4HZ3 A;  4O09 A;  2ZKJ A;  5GW7 A;  2NLJ C;  1M1K W;  4QPK A;  4UUJ C;  1YJ9 V;  3M99 B;  3LNM B;  1V54 B;  4MW8 A;  3JCZ A;  3W7T A;  1ROP A;  4GX2 A;  1NQT A;  4BAE A;  1QLE C;  1JX9 A;  2BU5 A;  1NR7 A;  2HVK C;  1AMW A;  1THN A;  1NKD A;  1V55 B;  3SYQ A;  1SES A;  3U2K A;  2Q8H A;  5LHH A;  1B3Q A;  3EHJ A;  2CCS A;  1B6Q A;  5L3E A;  2Y48 A;  3HYY A;  2PI5 A;  4WFB V;  2DQ3 A;  2Q6A A;  2M7W A;  3RVZ A;  4MVS A;  3ABK B;  4QNH B;  4XKA A;  3OR6 C;  1J95 A;  3Q5L A;  2WWW A;  2IWS A;  1M56 C;  3QO5 A;  3SYA A;  3ETG A;  3T0Z A;  1K34 A;  1SRY A;  1KKD A;  1K7D A;  2XCM A;  1QLE B;  1H7S A;  2H8M A;  2QTO A;  1UYH A;  1QR9 A;  2ZDY A;  2QM7 A;  2YGA A;  2EBO A;  1Y8P A;  2ZDI C;  1GM9 A;  1OCR C;  3R4O A;  4YKY A;  5F3K A;  2EIJ C;  4AWP A;  2YEE A;  3WQ9 A;  2WEQ A;  4WFH A;  1Q7Y W;  3D2R A;  5B1A B;  3FB8 C;  3ASO C;  4O04 A;  4H33 A;  4JTD B;  4CWQ A;  2YK2 A;  3IGA C;  3STZ C;  3D0B A;  5DN6 G;  2PNR A;  3IC7 A;  1TID A;  2JEX A;  2LP7 A;  1YI2 V;  4HY6 A;  4MOT A;  3FB6 C;  2IJJ A;  4MVM A;  2DYR B;  3OMA B;  2EIN B;  3RKZ A;  2ZDX A;  3W7X A;  2W0F C;  3MHH C;  1KP3 A;  4R8C A;  1ID0 A;  1OCR B;  3K06 A;  4QE9 A;  4GFN A;  1QCE A;  5CF0 A;  2OTL V;  1JM6 A;  4WFE A;  4O07 A;  2YK9 A;  4J9Z B;  2BU6 A;  2OCC C;  4O05 A;  3GWO A;  1UY7 A;  1ZWH A;  1NHJ A;  3G7E A;  4QIW F;  5B3S C;  3LNU A;  1UJW B;  3ABL C;  4H37 A;  4F4L A;  4PEL A;  1M90 W;  4MTG A;  2WI6 A;  1ZXN A;  1E1Q G;  3FT5 A;  2YJX A;  1R6N A;  4YKT A;  3OMU A;  4LWE A;  5CBG A;  3LUT B;  2WLM A;  5H6R A;  4XIQ A;  2R9I A;  2OCC B;  1KQS U;  2XAS A;  4L94 A;  1Z5B A;  2YEI A;  1NJI W;  4MVU A;  3ZRW B;  5B3S B;  1R73 A;  4BQJ A;  1WLE A;  1S72 V;  2KB1 A;  3K79 A;  3T2M A;  1UYI A;  4WFA V;  1QR8 A;  1AI4 A;  3K60 A;  3AG2 C;  4CE2 A;  1PVG A;  4EM7 A;  1OCO C;  3OEH G;  2YEB A;  3K03 A;  1U2O A;  2IJH A;  1K73 W;  3GIG B;  1AJN A;  1MSW D;  1YT0 A;  3H01 A;  4X9L A;  4MVZ A;  1MG1 A;  1GO3 F;  2YE4 A;  2WI1 A;  4GQT A;  4YKZ A;  2VCJ A;  2WI7 A;  3E8B A;  1S0V A;  3LSQ A;  3R91 A;  1U0Z A;  1G8M A;  3HHU A;  4HXW A;  2CGF A;  2WPD G;  4LBE C;  2XD6 A;  4GGL A;  5M4P A;  1I5X A;  2QE7 G;  3CC4 V;  2YEA A;  4UV8 A;  2ZQM A;  3STL C;  2YE3 A;  4O0B A;  1NBM G;  3R4N A;  3VAD A;  2XDS A;  2HFE C;  1Y4S A;  4P8O A;  3OWD A;  3AG2 B;  2P90 A;  3ZRX A;  4FMT A;  2DQ0 A;  3DGE A;  3CXC U;  4MW3 A;  5EK0 A;  3G71 V;  5B1N A;  1H8H G;  4N21 A;  2QEX V;  1E79 G;  3ZMT A;  1I59 A;  3MHS C;  3QDD A;  2JJ2 G;  2IU3 A;  1YS3 A;  3NMQ A;  2P67 A;  1N8R W;  1GJV A;  3A0Z A;  1DLB A;  2BRC A;  3IFX A;  4KUM A;  1K92 A;  1BYQ A;  4EGH A;  1K5Q A;  5FNC A;  2ZBK B;  2H8P C;  5CTW A;  4XDJ A;  1YJN V;  2YE9 A;  5EC2 C;  3GIF A;  4CWR A;  3MNR P;  1R3K C;  4RUF A;  5FND A;  3NXS A;  3OFN G;  4NH9 A;  2AHZ A;  2YED A;  3SPG A;  1NR1 A;  1H8E G;  4EMV A;  3LDE A;  4LCU C;  2CCU A;  4WUD A;  2FXS A;  3T0H A;  1H7U A;  4FK5 C;  1RM1 C;  4L87 A;  3R65 A;  1OCC C;  4CWP A;  3AG4 B;  4HZ5 A;  4Z1M G;  2BOB C;  1H38 A;  4V26 A;  5KA5 A;  2YEG A;  5B1B B;  1NVP D;  3T1C A;  2XND G;  2YJW A;  3DTU B;  2XAH A;  2EIL B;  1IXM A;  5E1A C;  1COW G;  2XHT A;  4HZ0 A;  3FT8 A;  3E89 A;  1AI7 A;  4MB9 A;  2BTZ A;  1AJ6 A;  3AG1 B;  1NHI A;  3LDC A;  4XCL A;  1L1F A;  3PEJ A;  2YKJ A;  1SET A;  3PJS K;  5M4E A;  1NVP B;  3U67 A;  4EGI A;  3BEH A;  1TH8 A;  2ESA A;  2YE5 A;  4GT1 A;  4P2Z A;  3FB7 C;  3OMN B;  1E1R G;  2QKS A;  4RO2 A;  2XX2 A;  5L3G A;  4E02 A;  3TET A;  1JJ2 U;  2XHX A;  3EHF A;  3ASN B;  2WLL A;  3FKS G;  2K1E A;  3O0I A;  2Q68 A;  2BU7 A;  3LDD A;  4BIZ A;  4GX1 A;  2IH1 C;  5L3D A;  3B24 A;  4WF9 V;  3ABT A;  4TWK A;  4YKU A;  1F51 A;  4XC0 A;  1UY8 A;  2HCH A;  1LNQ A;  5BOC A;  3T4Z A;  4P9O A;  4LWF A;  4MBC A;  5CTX A;  1K3E A;  1K8A W;  1FFT B;  5M4K A;  1AM1 A;  4LC1 A;  2O1V A;  4PL9 A;  2H94 A;  1ORQ C;  3KG2 A;  3QO7 A;  4CWS A;  1VQP V;  1FXK A;  1S77 D;  3ZMU A;  3SPH A;  2XJJ A;  3HB3 B;  1BHB A;  3E8F A;  4RQE A;  4BQG A;  4XKK A;  2YEC A;  3OUF A;  2WLI A;  4QE7 A;  2LFS A;  1EBO A;  3AEI A;  4PA9 A;  1P7B A;  1GTO A;  2EIK C;  1W0J G;  2FWZ A;  2XAJ A;  3HPL C;  3EKO A;  4MP7 A;  4UVC A;  2JIZ G;  4I3H A;  5HFL A;  2Q69 A;  4CWT A;  2QFO A;  2JJ1 G;  4WFF A;  2IU0 A;  3H80 A;  4FCR A;  3EKR A;  3SPJ A;  1RPO A;  3ZCC A;  2YSU B;  4XBF A;  3CCS V;  1UY9 A;  2IWX A;  3T10 A;  5H6Q A;  5B1O A;  1K97 A;  1KZN A;  3CCV V;  4EFT A;  4MVO A;  3CRK A;  1YC1 A;  2IW5 A;  2XDX A;  3K97 A;  2V1D A;  3CGY A;  1HWY A;  1K9M W;  4K4O A;  2YE6 A;  2ITC C;  3TK1 A;  4URN A;  2WLN A;  3LSS A;  1GKZ A;  2IJK A;  2Y69 C;  4XKO A;  2HKO A;  1K33 A;  1FXH A;  1QY8 A;  5CN0 A;  3ZXO A;  1I5B A;  3W7U A;  5FNF A;  2XJG A;  5D7R A;  2O1U A;  1M56 B;  4MS2 A;  4ASB A;  1W2B U;  1VQL V;  4DO2 A;  1UY6 A;  3K9A A;  2WI5 A;  3GIE A;  2B5U A;  2DYS C;  3SYO A;  2YKI A;  3CCJ V;  5IYC O;  3ZMZ A;  2XDL A;  1YT2 A;  2YKC A;  2QG0 A;  3B25 A;  4UXN A;  4MTX A;  1OSF A;  3B26 A;  2NNU A;  2BU2 A;  1W0K G;  2X6A A;  2EIJ B;  4U7O A;  3FYE B;  2JK5 C;  3K08 A;  1BKN A;  1YC4 A;  2HR3 A;  4X88 A;  2YE2 A;  5BOD A;  3ABM C;  1Q86 W;  4XIP A;  1JVM A;  4JTC B;  3ASO B;  3ZXQ A;  3ZIA G;  1VQ9 V;  4XDM A;  4P9P A;  1Y8O A;  3P32 A;  1VQ5 V;  1PKX A;  4KP4 A;  2CH4 A;  3JZ3 A;  3RBZ A;  2UXN A;  3CWV A;  3T1K A;  2WER A;  4MPC A;  1QBZ A;  3ZMS A;  1F4M A;  2O1W A;  3ZKB A;  4QJF B;  1R6K A;  4CWN A;  1OZ0 A;  3X2Q C;  4CZZ A;  4YXW G;  5IY5 C;  2D3O W;  2YEV B;  3F7Y C;  5IYD O;  4B6C A;  4YKR A;  1A4H A;  3FV5 A;  1Y8N A;  4MTF A;  4YKW A;  1M9N A;  4PDR A;  4JPR A;  4ASF A;  1YJW V;  4PA7 A;  4LWI A;  1DF4 A;  3FYI B;  1TC6 A;  1R62 A;  4V25 A;  4G28 B;  3K99 A;  3P30 A;  2HLD G;  2WI4 A;  5L3J A;  3CYO A;  2A9H A;  3TZ5 A;  3CRL A;  3OWB A;  5HFM A;  2A79 B;  4UVA A;  3ABL B;  2EXL A;  2QG2 A;  1K5S A;  1PNK A;  3HEK A;  1Q81 W;  1VQK V;  4PA3 A;  1G4Y B;  3CCR V;  1UYM A;  1OCZ C;  3VHC A;  1R3L C;  1VQM V;  3CME V;  3CCL V;  4H85 A;  3H4L A;  5KUK A;  3Q5K A;  3ZM7 A;  2JKI A;  3ABU A;  5IY5 B;  2ZXW C;  5KUM A;  5L3B A;  3BM9 A;  3JD4 A;  4FIP C;  3ZRS A;  5LHG A;  2BT0 A;  3IED A;  4UVB A;  3RVY A;  1UYF A;  3TUH A;  4WUC A;  1EA6 A;  2P6J A;  1Q82 W;  3I56 V;  3R4M A;  4W7T A;  3ZRW A;  4URO A;  1XL6 A;  3D36 A;  1S5H C;  1KD1 W;  4HXZ A;  4XE2 A;  2CK3 G;  2YI0 A;  2EZP A;  1AJP A;  4RQF A;  3ZRV A;  1OCO B;  2JJC A;  2EJR A;  4P30 A;  3CCU V;  5DM6 V;  4CWO A;  3GIG A;  4Q20 A;  3K0D A;  4HYM A;  3OEE G;  2QA4 V;  1QVG U;  3A0X A;  3G75 A;  1MAB G;  3CPW U;  2EIM C;  2Q2E B;  4PDM A;  3WG7 C;  1I58 A;  3FB5 C;  4GT8 A;  3K04 A;  2AKP A;  4CBC A;  5BZB A;  4JYC A;  1EI1 A;  2QM8 A;  4BAY A;  3QTF A;  4YKX A;  1MU5 A;  2VWC A;  2BOC C;  1OHH G;  1MX0 A;  2FTK A;  4PRV A;  3INX A;  2Q67 A;  4KFG A;  1B63 A;  2YKE A;  2AHY A;  5LGN A;  1GK9 A;  1S16 A;  1WPX A;  2X6B A;  1KIJ A;  1JQ0 A;  4FPP A;  1GM8 A;  2XDU A;  3ETE A;  4R3A A;  3QO8 A;  2WI2 A;  4HY1 A;  2B1G A;  2YGE A;  4LPB A;  1SZT A;  3ML0 A;  1FXV A;  2JEU A;  4R6Z A;  3SPC A;  3WG7 B;  1VQN V;  1BL8 A;  4R7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...