4JAUA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
232
Chain Sequence
b'SKELERLKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 76
structure length 232
sequence length 241
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jauA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jauA02
3HZ1A 5L3JA 3R4OA 2LFRA 1UYDA 4MTXA 4AWQA 1PVGA 2IOQA 2ZDYA 2YE9A 4XTJA 4QPKA 4ZKIA 3TUHA 4CWOA 2BU6A 4XCLA 2BU5A 4E00A 3R4MA 2XDSA 4XITA 4KP4A 4FCRA 2BTZA 2YE7A 4WUDA 3JZ3A 2BYIA 3D2RA 3A0YA 3TK1A 5D6PA 2LFSA 2Q8FA 5CPHA 4PRXA 1Y4SA 1ZW9A 4I3HA 4NH8A 1YSRA 2XHRA 3GIEA 1ZXNA 4WUCA 2C2AA 2JJCA 4O04A 4CWSA 4MBCA 4X9LA 4YKZA 2YJWA 1QZRA 4LC1A 4LWEA 3TZ5A 4MT8A 2IWSA 2IOPA 1YETA 3NXSA 2IWUA 2VWCA 1Y8PA 4HY1A 4PRVA 4YKUA 2IWXA 3K97A 2XX5A 4KTNA 3K60A 2PNRA 3BMYA 2YGFA 4MP7A 2BRCA 5B1NA 5M4PA 1TH8A 1H7UA 1S14A 3HEKA 4W7TA 3ZXOA 4CWQA 1UYIA 1OSFA 1Z5CA 1YS3A 4H81A 4HXZA 4R3AA 1JOYA 4P8OA 3TZ0A 2QF6A 1BKNA 3EHGA 3RLQA 2O1UA 2FWZA 3OWBA 3OMUA 3OWDA 1AJ6A 2ZKJA 1KIJA 2Q8IA 3QDDA 2YEGA 1UY7A 2YGAA 2QM8A 3NMQA 3U2KA 1MX0A 4NH9A 3EKRA 1Y8NA 2JKIA 2EXLA 2CG9A 4ASBA 1U2OA 2YEFA 2O1WA 4CE3A 3SL2A 2BREA 1YC4A 1H7SA 4HZ0A 1L0OA 4EGIA 2ZDXA 4PU9A 5CTUA 4EMVA 5M4MA 5M4EA 2BSMA 3R4NA 4MOTA 2CCTA 5J71A 5D7RA 1TC0A 5D7DA 4B6CA 1U0ZA 2CGFA 4XKAA 3A0RA 4GFNA 2XD6A 3EKOA 3Q5JA 2YE6A 3R92A 3RKZA 3ZXQA 2XJXA 3B26A 4XC0A 1EI1A 4V26A 1F51A 4JYBA 2FWYA 2H8MA 2XK2A 2WI6A 2K5BA 1B63A 1Y8OA 4KQVA 1YT0A 5IDMA 3T0HA 3PEJA 4LWFA 5GGZA 1AH8A 5CF0A 4FCPA 1AMWA 2YE3A 4MPCA 4L90A 1UYGA 5M4KA 3LPSA 1YESA 3FT8A 3QTFA 4DZYA 1BYQA 4WUBA 2VCIA 3TTZA 1ID0A 2XDXA 3IEDA 4H7QA 3MD0A 2WI1A 3T0ZA 4DUHA 4HYMA 3K98A 4QPJA 1IXMA 4P7AA 1I5AA 2YI7A 4URMA 5IDJA 1EA6A 1UY6A 3ZRVA 3GIGB 2VW5A 4BIZA 4GT1A 3R91A 2FXSA 1THNA 1JM6A 3G75A 3WQ9A 1ZWHA 2YK2A 3B28A 3CWVA 2HCHA 3A0TA 4MP2A 4NH7A 3G7BA 2YE5A 3CGYA 5M4HA 2HKJA 2WI2A 4XDMA 2CCSA 3EHFA 4HYPA 4YKQA 4EFTA 4Q20A 3HZ5A 4K4OA 3ZRWB 1NHIA 1TILA 3D0BA 4XE2A 4CWFA 1GKZA 1ZXMA 1UYEA 2YK9A 2YE4A 4O05A 4JYCA 3CGZA 1UYCA 4LWHA 3H80A 3K99A 2YKEA 2YEAA 4O07A 4KSHA 4BAEA 2YJXA 4CWTA 4L8ZA 4XIPA 3OW6A 4KSGA 4U7NA 2XHTA 3T1KA 2QG2A 2YKCA 2BT0A 1YT1A 1UYLA 1UYMA 3INXA 1TBWA 3B27A 5M4NA 2XDLA 2O1VA 5CTXA 5D6QA 4EFUA 1BXDA 3P32A 4LWGA 4URNA 3HYZA 4MPNA 1I58A 5FWKA 4FPPA 4XKOA 1BGQA 4YKRA 2YKJA 3R4PA 4UROA 2YEJA 4GT8A 4EGHA 2CCUA 2XCMA 1NHJA 4YKYA 4PL9A 2BZ5A 2Q8GA 4BXIA 2WERA 4YKTA 4YKXA 4FMTA 2Q8HA 3ZKBA 4EM7A 3Q5KA 1NHHA 3C0EA 1Z5BA 4L94A 1UY8A 2WEPA 4CWRA 3WHAA 3O6OA 4GQTA 3T10A 1AM1A 4U7OA 1A4HA 4MPEA 4AWOA 4ASFA 3PEHA 5BOCA 2ZBKB 4V25A 4KFGA 3ZCCA 3RLPA 4JAVA 4L93A 4XCJA 4CWNA 2QFOA 2BU2A 2YI5A 4JQLA 2Q2EB 4LPBA 4U93A 3HYYA 2YEDA 1YSZA 2H55A 2AKPA 1GKXA 1QY8A 2YGEA 1YC3A 2FYPA 4H85A 4URLA 1S16A 2BU8A 1GJVA 2E0AA 2XJJA 1YC1A 4BQJA 2P67A 2YE2A 2YKBA 2GQPA 1KZNA 4HY6A 2HG1A 2ESAA 3O2FA 4R1FA 4FCQA 2QG0A 3DGEA 3GIGA 4EEHA 3LNUA 1TC6A 2GFDA 3EHJA 4HXWA 4R3MA 2CH4A 2WI5A 4MB9A 4O09A 5FNDA 3TZ4A 2FTKA 1AH6A 3TZ2A 3ZRWA 4B7PA 2XHXA 2YI6A 3H4LA 2XX4A 4AS9A 4HZ5A 3EHHA 1B62A 1US7A 3CRKA 4YKWA 2YKIA 3O0IA 4O0BA 4EGKA 3G7EA 4XKKA 5CTWA 2YEEA 3RLRA 1UYKA 2XDUA 3A0ZA 4ASGA 4CWPA 2XDKA 2XJGA 4L91A 1YT2A 3GIFA 3U2DA 2YECA 3U67A 1MU5A 4XIQA 1B3QA 3VHDA 5J6AA 5C93A 1Z5AA 2BYHA 4LWIA 3ZM7A 4GCZA 4AWPA 2WI7A 4BIUA 3INWA 3HHUA 4XD8A 2XX2A 3A0XA 3B25A 4XIRA 1QYEA 2YEHA 4E01A 1UYHA 2YE8A 4BQGA 2WI4A 5FNFA 3CRLA 1YERA 1Z59A 3FV5A 2WI3A 2YEBA 1I5CA 2UWDA 3VADA 5B1OA 2YI0A 5D7CA 3VHCA 3MNRP 2IORA 5BODA 3BM9A 5F3KA 4E02A 4CE2A 1I5DA 4ZVIA 4GGLA 3D36A 5IN9A 4CE1A 4ASAA 1R62A 3B24A 3FT5A 2BU7A 1UY9A 2YEIA 2VCJA 1I5BA 4JAUA 3KE6A 3C11A 2QM7A 3OPDA 3VHAA 4GEEA 4JASA 3Q5LA 4I5SA 1UYFA 3ZKDA 1I59A 3A0WA 4LP0A 2XABA 1Y4UA 3ZRXA 5F5RA 3T2SA 5CTYA 2WEQA 2WWWA 1TIDA 5FNCA
chains in the Genus database with same CATH superfamily
3R4OA 1M9NA 4HBNA 4O2BA 4MTXA 4AWQA 1H2SB 2HFEC 4QPKA 2EX3A 3AG3C 4ZKIA 1OCOB 4DRXA 2UXXA 2OWOA 3THOA 4C7UA 1BHBA 4FCRA 2MW2B 4JAAA 3JZ3A 3QO7A 2BYIA 1N33O 1MMMA 2DYSB 5B1BC 2LFSA 3SDLA 2Q8FA 4DV7B 1N32O 4LH6A 4B7KA 5CPHA 2CAZC 5KAIZ 3S3WA 3SYPA 4WFGA 3J80N 4NH8A 3OD4A 5JENA 5B1BB 1NZ6A 4B3RO 2XHRA 4CWSA 2QM4A 4O04A 2BTOA 1FFTB 1SZXA 3LSSA 3I56V 4DV6B 4I9WA 1SQXH 1QZRA 3E86A 1JMKC 1OV9A 4DV3B 1XMQO 1OCZC 2ODMA 1WA8B 3F5WC 2IWUA 2VWCA 3L70H 3JASA 4LR3A 5KMGA 1PL4A 2YGFA 3RBZA 4MVMA 2BRCA 2H3OA 3B4SA 3ICXA 1H7UA 1UFIA 4W7TA 2HJFC 2JEUA 4JPRA 1SQVH 4DR4B 4HXZA 4JI1B 4R3AA 4CBCA 4LF6B 3ZX6A 1BKNA 1PKXA 2M6YA 2Y69C 4PV1B 5DN6G 4QE9A 3OMUA 3OWDA 3BA8A 3ML0A 2ZE7A 1BZKA 4DV6O 5GONB 2Y69B 2XAQA 5C8YA 2VWJA 3ZS8C 1MX0A 1NVPB 1TAEA 3E8GA 1Y8NA 1HNXB 2W0XA 2QDOA 5J2TB 1CEZA 2XUMA 3ZJZA 5CA1B 1HR0O 2BCCH 5B3SC 4O4HA 2IJKA 1UPGA 2YI9A 1OCCB 2A79B 5K1PA 4EGIA 5TISZ 4WBNB 5LHGA 1KKDA 2CE4A 1FPOA 3P3NA 4X20A 4UB8Z 4K8ZA 4PU9A 4A5UB 3K0DA 1CP9A 1B06A 3D36C 2PGGA 4LFAB 5M4EA 5FPOA 2Y48A 1Q86W 2ZE5A 1M57C 3A0RA 4DV0B 5CB4B 2WLKA 1HNXO 1D5NA 2W0FC 2Q5ZA 4XC0A 3LDEA 2FWYA 1M57B 1KECA 2NN4A 5IDMA 1LR1A 4LNUB 1H38A 4LWFA 5GGZA 1AH8A 4DV2O 4BIOA 1H2LA 1KU9A 2JK5C 4W4KA 4FCPA 1B6QA 2P90A 4K8XA 2YE3A 1P7BA 2LW7A 1K7DA 4DZYA 3CB2A 4WUBA 4TWKA 3TXQA 1ID0A 3G67A 2GTSA 4I4TB 3FFQA 2YEVA 4H7QA 5CBHA 4LFAO 3MD0A 1YJNV 3O65A 4DR6O 5IDJA 3N2GA 4X62O 5KHJA 2VW5A 1R3LC 4GT1A 1E1RG 1KQSU 2FXSA 4RAIA 2F1MA 2WSSG 2LW1A 1ZWHA 3CCRV 4JTCB 5KHKA 3B28A 5KHHA 5LA6B 5ITZB 2WA4A 4FM1A 3L72H 5LYJB 1E1QG 4UCOA 4IT5A 2WI2A 1OCRB 4YKQA 4EFTA 1IDSA 1JJOA 1JFFA 2A7WA 4K4OA 4HZ3A 4K3AA 1J5EB 4PI2A 4FLZA 1RPRA 2WLIA 4JYCA 1IURA 2NLJC 3CRCA 2YC0A 3H1JH 3RYCB 2NR5A 3STZC 4TOIA 1YF2A 4LF9O 1I5YA 4KSHA 4PA7A 1WP8A 2ZE8A 2ZQMA 4CWTA 2OCHA 5IYBO 3OW6A 2IW5A 4U7NA 2XHTA 2QE7G 4H33A 1OHHG 4L87A 5B1AC 4O4JA 1MZEA 1YVWA 1UYLA 2YUAA 5JJEB 2C1GA 3INXA 2CK3G 1F4NA 4MTOA 1NVPD 3ASNB 4PDRA 1SA0A 4PI0A 4MVRA 5LXTB 4WFAV 5CTXA 1I0HA 4EFUA 4B08A 5JWPA 3JATB 4FFKA 3E89A 2UUBB 1Y6XA 1ZX3A 1G4YB 1R1BA 2WLLB 1N36B 4GT8A 1RP3B 3SJQC 1N4CA 2XCMA 4FIPC 4BXIA 4I55B 2WERA 3R66A 4YKTA 4YKXA 1SKVA 1NHHA 2RJZA 2B1IA 1O9HA 4DYLA 4J42A 1AM1A 4FK5C 4O4IB 2X6AA 1IZ3A 1M93A 1S3JA 4JV5O 1VQOV 1NT2B 4FZ1A 1FFXB 3JALA 4DR7B 1THZA 1FAFA 4KFGA 2UUBO 3T1HO 1Z5WA 3AK3A 4JQLA 3BA9A 5KX5A 3K5LA 4U93A 3HYYA 5LOVB 2H55A 3CC4V 1BMFG 3WG7C 3J7AU 3OEEG 1QR9A 3MHSC 1AJNA 2JGDA 1MNGA 2YE2A 3UT5A 2GQPA 3F5TA 4CH4A 1SC5B 4HY6A 1GM7A 3AEIA 4JI4O 2IJIA 3K58A 2PZSA 5AG2A 3L73H 4MVQA 1K92A 1TC6A 1P7GA 3E8FA 2ZDIC 3I55V 1PL0A 4LBEC 3GVMA 3K04A 1EZJA 2CH4A 3RWRD 4P30A 1QVFU 3P3PA 4W4LA 4FLUA 1JR9A 3A0HZ 1PNKA 3RVZA 4UVAA 3BVOA 1Y4MA 3HPLC 4B7PA 5H5NA 3DC5A 1YTFB 4WFEA 2EZOA 1B62A 1QHTA 2JVDA 3OTOO 2BTQA 4O0BA 2YEEA 3RLRA 2XDUA 1CPYA 2B5UA 4ASGA 1WLEA 1QCEA 4L91A 2AHYA 3OEHG 2AGAA 2IBZH 2YECA 1HNWO 3VHDA 2M7WA 3FD9A 4JTDB 5J6AA 2BYHA 1KUQA 3LMMA 3U11A 4FLYA 4DUZB 2ZT9B 2WI7A 3INWA 3HHUA 1FD9A 3SPGA 1BQ0A 4UV8A 1R73A 3T4DA 2PUSA 3CRAA 3H1HH 1Z59A 2WI3A 4I50B 3JYCA 1S76D 5EBMC 4FLXA 1HNZB 1IBKO 3E35A 5LP6A 3WU2Z 4O2AB 3U10A 5EIBC 3HKCB 1IX9A 1MABG 1NTMH 3VHCA 2HVKC 3JAWA 2ZIMA 4K35A 5CMUA 3S5TA 1NI8A 1W59A 4DV1B 2E76B 3UO3A 3BM9A 1G8MA 1TUBB 5IYCO 2DYRC 4DV5B 4CE2A 5IN9A 4YHHO 4ASAA 2PI5A 4TV9B 4GKKO 4UVCA 1UJWB 4IHJA 4LWSB 1I5BA 4JAUA 1RPOA 1M1KW 1BQZA 3AG2C 1KC8W 4F6RB 4JASA 2QWRB 1MA1A 3Q5LA 4I5SA 4MVUA 2QTSA 1UYFA 1I7FA 1HNZO 2F4VB 3AG2B 1W0KG 1RFYA 4F4LA 2KG7B 2WEQA 4DK1A 1KMIZ 1FJGB 4J80A 3HZ1A 5L3JA 1EN5A 1RSOA 2LQTA 1FYJA 2YE9A 1Q7YW 4IYHA 4HNAA 4ABMA 4E00A 4X64B 1MG1A 1YSCA 4KP4A 4UCRA 4WUDA 1P84F 3A0YA 1XQ8A 4BW5A 1VQPV 1GM8A 3IFXA 4ZOLB 4B3TO 4B3SB 1ZL8A 5JJJB 4MTGA 4ZI7B 3FB7C 2IJJA 2R9RB 5LMNO 3L71H 4B3MB 1YSRA 4WUCA 2JJCA 4DR5B 4MBCA 3HKEB 4J9YB 4ZBMA 2YJWA 3K0GA 2N05A 2HKOA 2KQXA 4MT8A 2IOPA 1B04A 1AVMA 4DW1A 3CXCU 5D5QA 2QR4A 3ABKC 4D6TH 4CS3A 4TQFA 2IWXA 1N0NA 4B7EA 2XX5A 2P7TC 4KTNA 3K60A 2PNRA 1MOFA 2Q7HA 4X1KA 4X64O 2P6JA 2ZM6B 5B1NA 1JQ0A 2ZCEA 3ABKB 4JI3O 1S14A 2X7RB 4CWQA 3ABUA 1UYIA 1OSFA 1YS3A 1S5HC 2B1GA 1K34A 3K59A 1FXKC 4B3SO 2F66C 3RLQA 5CA0A 3HKDA 1LUVA 2Q0OC 5EK0A 3LUTB 3CCQV 1Q6IA 4B3MO 1F4MA 1BT8A 3QDDA 1V9PA 2DQ3A 1VQ7V 4TT3G 2ZR2A 2H8PC 2YXYA 2QM8A 3NMQA 5FNVB 3S3XA 3U2KA 1AJPA 3RW0A 3RYHB 4LP8A 3H1IH 5F2VO 1DTOA 2JKIA 4EEQA 1H2NA 4ASBA 1U2OA 2YEFA 1V54B 5EIBD 4CE3A 4TUYB 5IJ0A 3B8MA 1K33A 4YJ2A 2BREA 1YC4A 2WLNA 3WB1A 1H7SA 2CTQA 3KG2A 3OUFA 3CCLV 5JVDA 1SRYA 4K0KO 1VF7A 1V55B 3ZN1A 1H2MA 1XOUA 1ZSPA 4IIJA 1QLEC 1BCCH 1KD1W 1N32B 4JI7O 3BCCH 3VQXA 5M4MA 1Q8IA 3CMEV 2BSMA 2UXCB 4B3RB 5J71A 2DMXA 1AI7A 3GB7C 3ZMSA 5D7DA 2QKAA 3DC6A 3KCXA 4ZIBA 1XMQB 2XD6A 3EKOA 3Q5JA 2YE6A 2GUZB 1PD3A 4JYBA 2XK2A 1XNRO 4KQVA 2UU9O 1K9MW 2EILB 4FFBB 2ZINA 2ZNIA 3PEJA 5CF0A 3CHXA 3BPZA 1P49A 1MZFA 2CGNA 3AG3B 3BRCA 1SERA 1DK1A 1R6TA 1UYGA 3L9DA 1BYQA 4RQFA 4NXMO 2XDXA 1NR1A 3IEDA 3CC7V 2Q9LA 2WI1A 4BAYA 4GYCB 4HYMA 3FYEB 2YDEA 2Q4PA 3H01A 2UXCO 2XT9A 4P7AA 1I5AA 2YI7A 3LSUA 1J95A 4DR2O 1UY6A 3E22B 3CC2V 4BIZA 1WA8A 3R91A 3E83A 4JYYA 3CCUV 4JI5O 2YXLA 2EULA 3IGAC 1YI2V 1AP5A 3WQ9A 3MDSA 2EZPA 5IYZB 4JI2O 4CH6A 3A0TA 1GN2A 3EHBB 2YE5A 2ZIOA 2QJ1A 4HYPA 1OCZB 4ZHQB 1HR0B 4Q20A 3ZN0A 1NU1H 4JTAB 2KKWA 2Y0IA 3ZRWB 1TILA 3D0BA 4GLXA 2YK9A 1Y66A 2YE4A 4O05A 3CGZA 3ABLC 1UYCA 1FXVA 4YY3O 3TXSA 1AR5A 2R72A 1KP2A 5E1AC 4O07A 1JPXA 3JCUZ 1X4TA 3B09A 1S77D 4JI0B 3I5DA 5GONA 4DO2A 1S5LZ 3E8BA 4KSGA 3T1KA 2QG2A 1VF6A 2YKCA 4JYAO 2Q67A 2BT0A 2IU0A 2DN9A 4X1IB 1R6KA 5J2TA 1RM1C 3B8NA 3B27A 2CTWA 4PA6A 4WFHA 2XDLA 2O1VA 5CA1A 5D6QA 3SJCC 1YXBA 5IE9A 2PF4E 1GMGA 4MVOA 4LFBO 3KZIZ 4MPNA 4FPPA 1XUQA 2IJHA 1BGQA 2YIAA 4WBNA 2GSMB 4DV2B 3LDCA 2YEJA 3N2KB 1GKFA 1NHJA 4H44B 3CD6V 2BZ5A 3X2QC 5B3SB 1PM9A 1BS3A 1DLBA 4MW8A 4FMTA 4YIOA 5E79Z 2RCVA 4JI0O 3K57A 1Z5BA 3C0EA 2CGOA 2WEPA 3X2QB 1WPBA 1QU7A 5HFMA 4DR6B 3T10A 5CB4A 4X62B 3Q4HB 1Q3EA 5DM6V 3U0ZA 2RMKB 3PEHA 1TA8A 5JH7B 1XL4A 4LNUA 2JGUA 4V25A 3E8HA 3F7YC 4MW3A 4OPHA 5GW7A 2PY5A 1Y76B 2UUAO 4XCJA 1H2GA 1VQKV 2BU2A 3A2FA 1N0JA 5LGTA 5JCOA 2Q2EB 1HDJA 2RN9A 2YEDA 2EIKC 4H85A 2AKPA 1GKXA 1QY8A 4URLA 5A2QN 1L1FA 2JRIA 3HKBB 2AW9A 1K5SA 1M56C 2BU8A 4LF5O 2XJJA 4I4TA 3RFRA 4P2ZA 3K5MA 3G6BA 4BQJA 2P67A 3JSNA 2YKBA 1R3KC 4LF9B 2R70A 2HG1A 2ESAA 1M56B 3O2FA 2GV9A 5IY5C 2BOBC 2ITCC 2HEPA 3DGEA 4ICGA 3LNUA 5KHGA 4WFBV 1NJIW 3BHPA 3EVKA 5A9GA 1WB7A 2HG5C 2VS0A 3SYAA 3FX7A 1VP7A 4J9ZB 5LA6A 2EJ7A 4TSFG 5ITZA 2JEXA 2IH3C 2WI5A 4MB9A 3ABTA 5LYJA 4DXWA 4HAMA 3W7WA 3JAKB 1YJWV 4L8JA 2Q73A 2YI6A 4N23A 2XX4A 4AS9A 4EB6B 1US7A 3CRKA 3DXRA 3RYCA 3ZMTA 2P4KA 5JQGB 2XAHA 4XKKA 5CTWA 1UYKA 3SR2C 5LMUO 3CWBH 2XDKA 2R9AA 1K4DC 2Q6AA 2ADPA 3MAQA 3IAYA 3U2DA 1TVKB 2YXHA 2EIJC 5L3EA 4OX9B 1KBHA 4Q6GA 5C93A 3DTUB 1L8DA 4DK0A 1EM1A 4AWPA 2F23A 5EC2C 1XNQO 5LHIA 2HR3A 5LXTA 2XX2A 3JATA 4JV5B 3K3WA 5B1AB 3VQYA 4XIRA 1QYEA 4E01A 2WLLA 1Y67A 2K1EA 2L6LA 2ZE6A 5KUKA 5FNFA 3ETQA 1Y74B 1K5QA 4GX1A 3T1HB 4CZZA 3FV5A 4YXWG 2AHZA 2X6BA 4DR3O 3CRRA 2CDYA 2CTPA 2UWDA 2EIMC 3VADA 1L0NH 5KA5A 2EBOA 3K5OA 3N27A 2YI0A 4I55A 1ZUQA 3RYIB 4QIWF 2LO1A 1VQ5V 3BABA 1VQNV 5F3KA 4E02A 4JI8O 4JI4B 1I5DA 4OX9O 3L74H 4O4IA 4GGLA 3B24A 3FT5A 3CCVV 1VQMV 5IT9N 3P30A 2BU7A 3SGIA 1FFXA 2CH7B 2ZR3A 2UXNA 3G71V 5EZYB 3A8TA 3OUSA 4H13B 1YIJV 4Z1VA 5LOVA 1L0LH 3CYOA 3RYFB 3D3QA 2P4VA 3T2MA 4HYOA 1Y4UA 3ZRXA 5F5RA 2DJVA 3OTOB 2WWWA 3PJSK 2L35A 3CCSV 5H6RA 3JAMN 1GK9A 2LFRA 2MK3A 1UYDA 4PDLA 5FL7G 3OR7C 3WG7B 3TUHA 2ZNJA 3QF7A 4ASUG 5GTIZ 3CS5A 2Z5UA 2YIBD 1HNWB 1VQ4V 3GWOA 2BU5A 4CH5A 5J9PC 5BMVB 3K08A 2ZD9A 4JF3A 4XITA 1MSWD 2BTZA 1H8EG 2YE7A 4GUNA 4AHCA 2ZDIA 1SF9A 4LH7A 4X1YB 5KUMA 3D2RA 1K8AW 2ARHA 3TK1A 4LCUC 4DW0A 3T1YO 1ZLZA 1Y4SA 1ZW9A 5D5PA 4I3HA 3K9SA 4X9LA 4UCUA 1IBKB 4YKZA 4LC1A 1F23A 4LWEA 3TZ5A 2IWSA 1YETA 3AG1C 3SPHA 3NXSA 3AK2A 1ORQC 3VOUA 2IU3A 3D3IA 1AR4A 1U97A 3ZHUA 2OTLV 3FYIB 3RVYA 4YHHB 4R7CA 1TH8A 4LFCO 1GM9A 3ZXOA 1EN4A 3UKMA 3KKYA 4H81A 4GKKB 1ROPA 3TZ0A 2QF6A 3OAAG 4P9PA 2FWZA 4O2AA 1AJ6A 5H6QA 2ZKJA 3HKCA 2Q8IA 2ZXWC 2YEGA 3LNNA 1UY7A 4QGPA 2OCCC 3CRMA 2KB1A 2XNDG 1W0JG 3PN1A 2GTAA 1JX9A 1YEWA 3KCYA 3SPIA 3CPWU 1TUBA 1Q90D 2CG9A 5IJ9B 2Z0AA 2O1WA 5LP6C 1XILA 3SL2A 1GO3F 1GH6A 3C3SA 3UO2A 1FXHA 4PA9A 3AG4C 4TV9A 3UCSC 4LWSA 5FLXN 2DYRB 2F43G 2QSAA 4F6RA 2ZDXA 4TV8B 4DV4O 5LHHA 1P4RA 4B3TB 1GN6A 2VQFO 4EMVA 4XDKA 5L3FA 4WF9V 5LMNB 2CCTA 3CMAV 3RN4A 5D7RA 4E72A 2KG7A 1TC0A 1H8HG 1U0ZA 4N21A 2Q7GA 4XKAA 2PTMA 2G38A 1K3EA 2CUGA 4AILC 3RKZA 3OMIB 1EI1A 1PV0A 4V26A 3T4ZA 2H8MA 4KHPO 3JCZA 3ZHQA 4IHJB 2P5OA 3OGIB 1Y8OA 1YT0A 4QJFB 4DR1O 4AQYO 1XI1A 2NNUA 1EN6A 4FVMA 1G6UA 4JI3B 3NR7A 4ZOLA 1GTOA 3JARB 5EC1C 1XMOB 1N34O 4PHZA 5M4KA 3QTFA 3FT8A 1LUWA 1EFRG 3K03A 4ZI7A 4X65O 3TTZA 4NXNO 3D8CA 3H1LH 5EBWC 4LF8O 1IBLO 4DUHA 1QBZA 3HKEA 4J10A 4RO2A 2P06A 4QPJA 1IXMA 1M90W 3IC9A 3AK1A 5IWAO 5BR8O 2VWKA 4UFZA 3ZRVA 4FLWA 3GIGB 1Z5VA 3ZMVA 1JM6A 1VARA 3G75A 1AROP 2LGWA 4JZ2A 2LJ2A 5B66Z 3R65A 2PYLA 4U3JB 1VIBA 3WB0A 3B2EE 1N8RW 3IJ4A 4XDMA 5K1XA 4XE2A 4CWFA 2WLHA 1YHQV 1M4UA 4YJ3B 1XMOO 4K0KB 1NTZH 2E5LO 4LWHA 4X88A 2YKEA 2YEAA 1IBMB 4BAEA 2X0LA 4JI7B 1KYOF 1XDCA 5L3CA 4L8ZA 4UUJC 4XIPA 1XL6A 1YJ9V 1FXKB 1NS1A 2DWEC 3H9VA 3AG7A 3CX5F 3WB2A 1XHZA 1YT1A 2K9PA 3W7TA 2YSUB 3FKSG 3RYHA 4Z2WA 4PDVA 4O4LB 2QKCA 2WAMA 2LGQA 5M4NA 4TUYA 5LGUA 5CN0A 2HP8A 5J2UB 1BHAA 2ITDC 3P32A 5EYPB 2WLJA 3ABMC 1SQPH 1XNRB 1K4CC 2UU9B 4URNA 3OMNB 3HYZA 2BSKB 5CA0B 1URFA 1I58A 5FWKA 1YDXA 4LF4B 1BL8A 2Q69A 1SQBH 3FAVB 4YKRA 4UROA 3CXHF 2FKXA 5DECA 4F6EA 3RGBA 4YKYA 2Q8VA 3ASOC 4R6ZA 1IBMO 2Q8HA 4NXMB 1F7YA 3ZKBA 4IYIA 1HP8A 3CJHB 2HHHO 1ENVA 1UY8A 1QVGU 4NYKA 4BW9A 2GHYA 4LF7O 3WHAA 1QLEB 1DGSA 4GQTA 2HVJC 4DR2B 4R50A 4RWUA 1A4HA 4MPEA 2GUZA 4AWOA 2C1IA 4JI5B 2ETNA 5JVDB 3ZBHA 1QNMA 4I0XB 4JI2B 4FFBA 4JI6O 3QO5A 4L93A 2YI5A 2F95B 4G28B 3SYCA 4LF4O 2QTOA 4LPBA 1QQCA 3VBBA 1YSZA 2YGEA 1XBLA 1YC3A 2Q7EA 1S16A 2N04A 1GJVA 1OCOC 2E74B 4YY3B 2A9HA 1YC1A 2QGNA 4GKJB 4UCTA 1KZNA 2UXBO 4CH3A 4R1FA 1OZ0A 4O2BB 2DYSC 5LBQA 2QG0A 3E22A 4EEHA 2ATKC 1SETA 4JYAB 2OT5A 2GFDA 1Q81W 4DRXB 1NR7A 3EHJA 5IYZA 4HXWA 4R3MA 1YCIA 3G80A 3ZHRA 2VQEO 3OGCC 2QKSA 1WNSA 3QO8A 4ZHQA 2OYQA 5LGNA 3CCJV 2FTKA 1AH6A 3TZ2A 3ZRWA 2XHXA 3H4LA 1Q6UA 1WPXA 4LFBB 4UCVA 2A0LA 4CC6A 4EGKA 3TETA 3G4SV 1A32A 1VQ9V 5CBGA 4J11A 4CWPA 5JJNB 4GKJO 2XJGA 4NKGB 2HJDA 3CSXA 4P9OA 3O9OA 2BOCC 3GIFA 2DOSA 3ABLB 4X1IA 4WCEV 1MU5A 4XIQA 1B3QA 3JASB 4JGSA 4FLVA 1Z5AA 4LWIA 1DF5A 4GCZA 5KMGB 1WP7A 1K97A 3F7VC 1SESA 4XD8A 2OIGA 4GX5A 3B25A 4MVSA 4DV7O 1M5IA 2YEHA 2XOKG 2FYUH 2YE8A 4BQGA 1VF6C 2UUAB 3CRLA 2QWPB 1YERA 3M7MX 5H2FZ 1RM1B 2YEBA 5BXZA 3JSLA 2JDIG 3N2KA 3ZHTA 1I5CA 3L75H 2DW4A 3FB5C 4FZ0A 4DV3O 5H9CA 1BGYH 5B1OA 1NQTA 2UXDB 3B40A 5D7CA 1YITV 4FM2A 3MNRP 4LF5B 1S5JA 5C8YB 4UV9A 1QR8A 2IORA 2DE0X 1COWG 1OCCC 5BODA 3HR0A 5KAFZ 3QNEA 1GN4A 3TJTA 4EKWA 2EJRA 3D36A 2A06H 3Q4HA 4CE1A 1R62A 2ZKOA 2QEXV 4NB5A 4O4HB 4DR4O 1UY9A 5JH7A 3JD4A 4JI1O 2OTJV 4FJCC 4LF6O 1Y76A 3ZRSA 3C11A 4X20B 3OPDA 4GEEA 3SYQA 5EBLC 1I08A 1I59A 3A0WA 3ZEDA 3HKBA 1SS3A 3FB8C 3APOA 4BWAA 2UXDO 3T2SA 5KLVH 3STLC 1TIDA 5LL6Y 2IM9A 1KKCA 5LMUB 2EIKB 2YIBA 3OE7G 5JCOC 1PVGA 2KSDA 2IOQA 2ZDYA 4XTJA 4PJ0Z 4CWOA 2BU6A 2GBOA 4XCLA 3B77A 4G27B 3R4MA 2XDSA 1SQGA 4GX0A 1XNQB 5B5EZ 5IY5B 2F93B 3JAKA 3K06A 3IC7A 5D6PA 4PA4A 4PRXA 1SQQH 2FL4A 4EB6A 4YIPA 4E2LA 2YEVB 1ZXNA 3GIEA 2C2AA 4DR3B 2O57A 5JQGA 3CCEV 4D7TA 2YS8A 2YIDA 1EBOA 4FLTA 4XBFA 4EFEA 4DV0O 1OCRC 2N74A 3N2GB 4WFFA 2A3QA 3K5NA 1Y8PA 4HY1A 4H37A 4PRVA 1TVKA 4YKUA 4X9QA 3K97A 5L3GA 4JI8B 3DSQA 3BMYA 1AB3A 4MP7A 5M4PA 3HEKA 1JFFB 5CA3A 1Z5CA 3CE2A 1KB9F 1JOYA 4P8OA 2EIJB 3DXRB 1AI4A 2WLIB 1Y74A 5FPRA 3TCUA 3EHGA 1R3JC 4AI8A 3UM7A 2O1UA 3G6EV 3UQ8A 4EFBA 4QE7A 2DWDC 3OWBA 1HW7A 3ASNC 3RT3C 1KIJA 3RYIA 2YGAA 4O4JB 5L3DA 4BR6A 4NH9A 4CS2A 1G1XB 3EKRA 4OPAA 4Z1MG 3OTFA 4JZGA 2EXLA 2EIMB 2XAJA 1U96A 1SA0B 4J7ZA 4PA3A 2WPDG 4NR1A 3OR6C 2D3OW 2WA3A 2XHBA 2CH7A 1J5EO 4HZ0A 1L0OA 5EZYA 4X66B 3LNMB 2XAFA 3BEHA 1XREA 5CTUA 1IXBA 4KXRA 3RYFA 3W7XA 2QWQB 2W6JG 3T1YB 2H94A 3CP1A 3SPCA 3R4NA 3WFVA 1NH2B 4MOTA 3BY6A 2ADQB 4B6CA 1TGOA 2QA4V 2CGFA 2AZ0A 4GFNA 3R92A 1VQ8V 3ZXQA 3BFRA 2XJXA 3B26A 1F51A 4MVZA 2WI6A 1WB8A 2K5BA 2JIZG 5GTHZ 1B63A 1KP3A 2E3CA 5BMVA 3JALB 3T0HA 1N36O 3APQA 1AR1B 3J81N 2HHIA 5DEDA 3JD0A 3QTCA 4XDJA 4X1YA 1X59A 4LFCB 5KX5B 4X66O 3OM3B 2B9ZA 1AMWA 4MPCA 4L90A 3LPSA 3SJBC 1YESA 2RDCA 2VCIA 1ZWIC 4J7JA 1VMGA 2JS3A 3EXAA 4IL6Z 2DQ0A 4KFMA 3T0ZA 2YICA 2JGDB 1AI5A 1H2KA 3JD3A 3K98A 1AP6A 3MHHC 3UT5B 3GWKC 4URMA 2PYJA 1EA6A 1PPJH 1PP9H 1THNA 1MSDA 4RUFA 2Y0PA 3ZHSA 2YK2A 3CWVA 2HCHA 2AZ2A 4MP2A 4NH7A 4DR7O 3G7BA 3BAAA 3CGYA 5M4HA 2HKJA 3OMAB 1ZTEA 2CCSA 3EHFA 1XEQA 3OFNG 3AG1B 3HZ5A 1NHIA 3CEIA 4MSWC 1GKZA 1ZXMA 1UYEA 1LNQA 1AI6A 1VEWA 3H80A 2BTQB 3TGUH 1I5XA 1PNMA 5CBFA 3K99A 2R9IA 4DV4B 2XASA 4QNHB 4I7ZB 1DF4A 4I50A 2CTRA 5KHIA 2VQFB 3ZHVA 2YJXA 4NVPA 1R3IC 1GAXA 3VQWA 4UXNA 1US6A 3SYOA 3CCMV 1PNLA 4IGGA 1UYMA 2BE3A 4U3FH 1TBWA 1BE3H 2D2CB 5IJ9A 2WLMA 1HWYA 3ZIAG 2Q68A 2ZXWB 1E79G 1BXDA 4KHPB 2OCCB 4LWGA 2Y4TA 4DR1B 4AQYB 4XKOA 2UUCB 2YKJA 3R4PA 1D5AA 5HFLA 4MTFA 4TV8A 4EGHA 1Z2GA 5LP6B 2CCUA 4PD4F 1WAZA 4PL9A 1N34B 1FKAO 1NTKH 2XAGA 3AG4B 2Q8GA 4MS2A 3C3TA 4X65B 4NXNB 1Q5OA 4EM7A 3JAWB 2RNBA 4LF8B 3Q5KA 1IBLB 1OJHA 3ZMUA 2Z3YA 4L94A 1JVMA 1CXZB 4CWRA 1NH2D 3O6OA 5IWAB 3T1CA 5BR8B 4DUZO 4U7OA 3JD1A 4ASFA 1I94B 1Q43A 4RQEA 3SPJA 5BOCA 1Q6HA 2ZBKB 3C90A 3ZCCA 2V1DA 4JAVA 3RLPA 1BSMA 4CWNA 1TUEB 2QFOA 1VF5B 3ETGA 2YI8A 4FM0A 2UUCO 2RQ6A 3JARA 3VQVA 1SZTA 4UCSA 2FYPA 3OT7A 4PDMA 4GZRB 3K9AA 4NTYA 3HB3B 2E0AA 3CRQA 1QLNA 2E5LB 2P22C 4J7KA 4H0LB 1AILA 3W7UA 5IYDO 4DV1O 1S72V 1T5EA 4DV5O 4FCQA 1RSOB 1NKDA 2Y4UA 1WJZA 3GIGA 2AXTZ 1IVSA 4HNAB 4NTXA 4U3JA 2ILMA 1I94O 3M99B 4O09A 5FNDA 4OXSA 3TZ4A 3W7SA 1GRJA 2LP7A 3A0BZ 2EINC 1ZL8B 2PI4A 1K73W 1ZAUA 1YTFD 2F4VO 4X8AA 4YJ3A 1S0VA 4HZ5A 3EHHA 3H1KH 4YKWA 4OGQB 2YKIA 3O0IA 2V7QG 1XHXA 2GDSA 3G7EA 5BY1A 2EINB 1FJGO 1JJ2U 3QG5A 3A0ZA 1WN7A 4X89A 3ETEA 1VQ6V 5L3BA 3QVNA 1EZVH 1NBMG 2OIEA 1YT2A 3K79A 1FXKA 2FMLA 3U67A 4TQDA 3SJAC 2HHHB 2QWOB 2JJ2G 5FNVA 3JD2A 4LF7B 3ZM7A 4O4LA 3ZMZA 3E2EA 1FS0G 2HLDG 3EFFK 4X1KB 4BIUA 4KL1A 5J2UA 1O9GA 3A0XA 4CS4A 5EYPA 1UYHA 2BSKA 4PELA 4CC5A 2WI4A 4JI6B 3FAVA 1W2BU 3HKDB 4DR5O 3M8AA 1SQFA 3ETDA 4KUMA 1V54C 2JS5A 2IH1C 4DUYB 3ABMB 5KA6A 1D2DA 1YZBA 3CJHA 3LSQA 4RUEA 2UXBB 4GX2A 4R8CA 1V55C 4G2KA 4ZVIA 3FB6C 2ZM6O 4E4EA 2FB5A 3ASOB 2JJ1G 2E75B 2X6CA 4D7SA 1Q82W 5IJ0B 1JCHA 4YJ2B 4J41A 2YEIA 4I0XA 2VCJA 1GN3A 1N33B 3LDDA 3KE6A 2VQEB 2QM7A 4I9QA 5BZBA 1AJQA 1JA8A 4UVBA 2VRZA 3VHAA 4NTWA 3OW2U 2QWNB 4IIJB 4UB6Z 3ZKDA 4LP0A 4XDLA 3CYGA 2W6IG 2XABA 2XTAA 2Q0AA 4DUYO 5CTYA 1R6NA 1VQLV 2EILC 2V4DA 5FNCA
chains in the Genus database with same CATH topology
3R4OA 1M9NA 4MTXA 4AWQA 2HFEC 4QPKA 4ZKIA 3AG3C 1OCOB 2UXXA 1BHBA 4FCRA 3JZ3A 3QO7A 2BYIA 2DYSB 5B1BC 2LFSA 2Q8FA 5CPHA 3SYPA 4WFGA 4NH8A 5B1BB 4CWSA 2XHRA 4O04A 1FFTB 3LSSA 3I56V 4I9WA 1QZRA 3E86A 1OCZC 3F5WC 2IWUA 2VWCA 2YGFA 3RBZA 4MVMA 2BRCA 1H7UA 4W7TA 2HJFC 2JEUA 4JPRA 4HXZA 4R3AA 4CBCA 1BKNA 1PKXA 2Y69C 5DN6G 4QE9A 3OMUA 3OWDA 3ML0A 2Y69B 2XAQA 1MX0A 1NVPB 3E8GA 1Y8NA 1CEZA 3ZJZA 5B3SC 2IJKA 1OCCB 2A79B 4EGIA 5LHGA 1KKDA 4PU9A 3K0DA 1CP9A 5M4EA 2Y48A 1Q86W 1M57C 3A0RA 2WLKA 2W0FC 4XC0A 3LDEA 2FWYA 1M57B 1KECA 5IDMA 1H38A 4LWFA 5GGZA 1AH8A 2JK5C 4FCPA 1B6QA 2P90A 2YE3A 1P7BA 1K7DA 4DZYA 4WUBA 4TWKA 1ID0A 2YEVA 4H7QA 5CBHA 3MD0A 1YJNV 5IDJA 2VW5A 1R3LC 4GT1A 1E1RG 1KQSU 2FXSA 4RAIA 2WSSG 1ZWHA 3CCRV 4JTCB 3B28A 1E1QG 2WI2A 1OCRB 4YKQA 4EFTA 4K4OA 4HZ3A 1RPRA 2WLIA 4JYCA 2NLJC 3STZC 1I5YA 4KSHA 4PA7A 2ZQMA 4CWTA 5IYBO 3OW6A 2IW5A 4U7NA 2XHTA 2QE7G 4H33A 1OHHG 4L87A 5B1AC 1UYLA 3INXA 2CK3G 1F4NA 4MTOA 1NVPD 3ASNB 4PDRA 4MVRA 4WFAV 5CTXA 4EFUA 3E89A 1G4YB 2WLLB 4GT8A 3SJQC 2XCMA 4FIPC 4BXIA 2WERA 4YKTA 4YKXA 1NHHA 2B1IA 1AM1A 4FK5C 2X6AA 1S3JA 1VQOV 1THZA 4KFGA 4JQLA 4U93A 3HYYA 2H55A 3CC4V 1BMFG 3WG7C 3OEEG 1QR9A 3MHSC 1AJNA 2YE2A 2GQPA 4HY6A 1GM7A 3AEIA 2IJIA 4MVQA 1K92A 1TC6A 3E8FA 2ZDIC 3I55V 1PL0A 4LBEC 3K04A 1EZJA 2CH4A 4P30A 1QVFU 3RVZA 1PNKA 4UVAA 1Y4MA 3HPLC 4B7PA 1YTFB 4WFEA 2EZOA 1B62A 4O0BA 3RLRA 2YEEA 2XDUA 1CPYA 2B5UA 4ASGA 1WLEA 1QCEA 4L91A 2AHYA 3OEHG 2YECA 3VHDA 2M7WA 4JTDB 5J6AA 2BYHA 2WI7A 3INWA 3HHUA 3SPGA 4UV8A 1R73A 3T4DA 1Z59A 2WI3A 3JYCA 1S76D 5EBMC 3E35A 1MABG 3VHCA 2HVKC 5CMUA 3BM9A 1G8MA 5IYCO 2DYRC 4CE2A 5IN9A 4ASAA 2PI5A 4UVCA 1UJWB 1I5BA 4JAUA 1RPOA 1M1KW 3AG2C 1KC8W 4JASA 3Q5LA 4I5SA 4MVUA 1UYFA 3AG2B 1W0KG 4F4LA 2WEQA 3HZ1A 5L3JA 2YE9A 1Q7YW 4E00A 1MG1A 1YSCA 4KP4A 4WUDA 3A0YA 4BW5A 1VQPV 1GM8A 3IFXA 4MTGA 3FB7C 2IJJA 2R9RB 1YSRA 4WUCA 2JJCA 4MBCA 4J9YB 4ZBMA 2YJWA 3K0GA 2HKOA 4MT8A 2IOPA 3CXCU 3ABKC 2IWXA 2XX5A 2P7TC 4KTNA 3K60A 2PNRA 1MOFA 2P6JA 5B1NA 1JQ0A 3ABKB 1S14A 2X7RB 4CWQA 3ABUA 1UYIA 1OSFA 1YS3A 1S5HC 2B1GA 1K34A 1FXKC 3RLQA 5EK0A 3LUTB 3CCQV 1F4MA 3QDDA 2DQ3A 1VQ7V 4TT3G 2ZR2A 2H8PC 2QM8A 3NMQA 3U2KA 1AJPA 3RW0A 4LP8A 2JKIA 1DTOA 4ASBA 1U2OA 2YEFA 1V54B 4CE3A 3B8MA 1K33A 2BREA 1YC4A 2WLNA 1H7SA 3KG2A 3OUFA 3CCLV 1SRYA 1V55B 3ZN1A 1QLEC 1KD1W 5M4MA 3CMEV 2BSMA 5J71A 1AI7A 3GB7C 3ZMSA 5D7DA 2XD6A 3EKOA 3Q5JA 2YE6A 1PD3A 4JYBA 2XK2A 4KQVA 1K9MW 2EILB 3PEJA 5CF0A 3AG3B 1SERA 1UYGA 1BYQA 4RQFA 2XDXA 1NR1A 3IEDA 3CC7V 2WI1A 4BAYA 4HYMA 3FYEB 3H01A 4P7AA 1I5AA 2YI7A 1J95A 1UY6A 3CC2V 4BIZA 3R91A 3E83A 3CCUV 3IGAC 1YI2V 3WQ9A 2EZPA 3A0TA 3EHBB 2YE5A 4HYPA 1OCZB 4Q20A 3ZN0A 4JTAB 3ZRWB 1TILA 3D0BA 2YK9A 1Y66A 2YE4A 4O05A 3CGZA 3ABLC 1UYCA 1FXVA 1KP2A 5E1AC 4O07A 1JPXA 1S77D 4DO2A 3E8BA 4KSGA 3T1KA 2QG2A 2YKCA 2Q67A 2BT0A 2IU0A 1R6KA 1RM1C 3B8NA 3B27A 4PA6A 4WFHA 2XDLA 2O1VA 5D6QA 1GMGA 4MVOA 4MPNA 4FPPA 2IJHA 1BGQA 2GSMB 3LDCA 2YEJA 1GKFA 1NHJA 3CD6V 2BZ5A 3X2QC 5B3SB 1DLBA 4MW8A 4FMTA 3C0EA 1Z5BA 2WEPA 3X2QB 5HFMA 3T10A 5DM6V 3PEHA 1XL4A 4V25A 3E8HA 3F7YC 4MW3A 5GW7A 4XCJA 1H2GA 1VQKV 2BU2A 5LGTA 2Q2EB 2YEDA 2EIKC 4H85A 2AKPA 1GKXA 1QY8A 4URLA 1L1FA 1K5SA 1M56C 2BU8A 2XJJA 4P2ZA 4BQJA 2P67A 2YKBA 1R3KC 2HG1A 2ESAA 1M56B 3O2FA 5IY5C 2BOBC 2ITCC 3DGEA 3LNUA 4WFBV 1NJIW 2HG5C 3SYAA 4J9ZB 4TSFG 2JEXA 2IH3C 2WI5A 4MB9A 3ABTA 3W7WA 4DXWA 4HAMA 1YJWV 2YI6A 4N23A 2XX4A 4AS9A 1US7A 3CRKA 3ZMTA 4XKKA 5CTWA 2XAHA 1UYKA 2XDKA 1K4DC 2Q6AA 3U2DA 2EIJC 5L3EA 5C93A 3DTUB 4AWPA 5EC2C 5LHIA 2HR3A 2XX2A 3K3WA 5B1AB 4XIRA 1QYEA 4E01A 2WLLA 2K1EA 5KUKA 5FNFA 4GX1A 1K5QA 4CZZA 3FV5A 4YXWG 2AHZA 2X6BA 2UWDA 2EIMC 3VADA 5KA5A 2EBOA 2YI0A 4QIWF 1VQ5V 1VQNV 5F3KA 4E02A 1I5DA 4GGLA 3B24A 3FT5A 3CCVV 1VQMV 2BU7A 3P30A 2ZR3A 2UXNA 3G71V 3OUSA 1YIJV 3CYOA 3T2MA 4HYOA 1Y4UA 3ZRXA 5F5RA 2WWWA 3PJSK 3CCSV 5H6RA 1GK9A 2LFRA 2MK3A 1UYDA 4PDLA 5FL7G 3OR7C 3WG7B 3TUHA 4ASUG 2Z5UA 1VQ4V 3GWOA 2BU5A 5J9PC 3K08A 2ZD9A 4JF3A 4XITA 1MSWD 2BTZA 1H8EG 2YE7A 2ZDIA 5KUMA 3D2RA 1K8AW 3TK1A 4LCUC 1Y4SA 1ZW9A 4I3HA 4X9LA 4YKZA 4LC1A 1F23A 4LWEA 3TZ5A 2IWSA 1YETA 3AG1C 3SPHA 3NXSA 1ORQC 3VOUA 2IU3A 3D3IA 2OTLV 3FYIB 3RVYA 4R7CA 1TH8A 1GM9A 3ZXOA 3UKMA 4H81A 1ROPA 3TZ0A 2QF6A 3OAAG 4P9PA 2FWZA 1AJ6A 5H6QA 2ZKJA 2Q8IA 2ZXWC 2YEGA 1UY7A 2OCCC 2KB1A 2XNDG 1W0JG 1JX9A 3SPIA 3CPWU 2CG9A 2O1WA 3SL2A 1GO3F 1FXHA 4PA9A 3AG4C 2DYRB 2F43G 2ZDXA 5LHHA 1P4RA 4EMVA 4XDKA 5L3FA 4WF9V 2CCTA 3CMAV 5D7RA 1TC0A 1H8HG 1U0ZA 4N21A 4XKAA 1K3EA 3RKZA 3OMIB 1EI1A 4V26A 3T4ZA 2H8MA 3JCZA 1Y8OA 1YT0A 4QJFB 2NNUA 1GTOA 5EC1C 5M4KA 3QTFA 3FT8A 1EFRG 3K03A 3TTZA 5EBWC 4DUHA 1QBZA 4RO2A 4QPJA 1IXMA 1M90W 3ZRVA 3GIGB 3ZMVA 1JM6A 3G75A 1AROP 3R65A 1N8RW 4XDMA 4XE2A 4CWFA 2WLHA 1YHQV 4LWHA 4X88A 2YKEA 2YEAA 4BAEA 2X0LA 5L3CA 4L8ZA 4UUJC 4XIPA 1XL6A 1YJ9V 1FXKB 2DWEC 1YT1A 3W7TA 2YSUB 3FKSG 4PDVA 2WAMA 5M4NA 5LGUA 5CN0A 1BHAA 2ITDC 3P32A 2WLJA 3ABMC 1K4CC 4URNA 3OMNB 3HYZA 1I58A 5FWKA 1BL8A 2Q69A 4YKRA 4UROA 4YKYA 3ASOC 4R6ZA 2Q8HA 3ZKBA 1ENVA 1UY8A 1QVGU 2GHYA 3WHAA 1QLEB 4GQTA 2HVJC 4R50A 1A4HA 4MPEA 4AWOA 3QO5A 4L93A 2YI5A 4G28B 3SYCA 2QTOA 4LPBA 2YGEA 3VBBA 1YSZA 1YC3A 1S16A 1GJVA 1OCOC 2A9HA 1YC1A 1KZNA 4R1FA 1OZ0A 2DYSC 5LBQA 2QG0A 4EEHA 2ATKC 1SETA 2OT5A 2GFDA 1Q81W 1NR7A 3EHJA 4HXWA 4R3MA 3OGCC 2QKSA 3QO8A 5LGNA 3CCJV 2FTKA 1AH6A 3TZ2A 3ZRWA 2XHXA 3H4LA 1WPXA 2A0LA 4EGKA 3TETA 3G4SV 1VQ9V 5CBGA 4CWPA 2XJGA 4P9OA 2BOCC 3GIFA 3ABLB 4WCEV 1MU5A 4XIQA 1B3QA 4JGSA 1Z5AA 4LWIA 1DF5A 4GCZA 1K97A 3F7VC 1SESA 4XD8A 4GX5A 3B25A 4MVSA 2YEHA 2XOKG 2YE8A 4BQGA 3CRLA 1YERA 1RM1B 2YEBA 2JDIG 1I5CA 2DW4A 3FB5C 5H9CA 5B1OA 1NQTA 5D7CA 1YITV 3MNRP 4UV9A 1QR8A 2IORA 1COWG 1OCCC 5BODA 3QNEA 4EKWA 2EJRA 3D36A 4CE1A 1R62A 2QEXV 1UY9A 3JD4A 2OTJV 4FJCC 3ZRSA 3C11A 3OPDA 4GEEA 3SYQA 5EBLC 1I59A 3A0WA 3FB8C 3T2SA 3STLC 1TIDA 2EIKB 3OE7G 1PVGA 2IOQA 2ZDYA 4XTJA 4CWOA 2BU6A 4XCLA 3B77A 4G27B 3R4MA 2XDSA 4GX0A 5IY5B 3K06A 3IC7A 5D6PA 4PA4A 4PRXA 4E2LA 2YEVB 1ZXNA 3GIEA 2C2AA 3CCEV 1EBOA 4XBFA 1OCRC 4WFFA 1Y8PA 4HY1A 4H37A 4PRVA 4YKUA 3K97A 5L3GA 3BMYA 4MP7A 5M4PA 3HEKA 5CA3A 1Z5CA 1JOYA 4P8OA 2EIJB 1AI4A 2WLIB 3TCUA 3EHGA 1R3JC 3UM7A 2O1UA 3G6EV 4QE7A 2DWDC 3OWBA 3ASNC 1KIJA 2YGAA 5L3DA 4NH9A 3EKRA 4Z1MG 2EXLA 2EIMB 2XAJA 4PA3A 2WPDG 3OR6C 2D3OW 4HZ0A 1L0OA 3LNMB 2XAFA 3BEHA 5CTUA 3W7XA 2W6JG 2H94A 3CP1A 3SPCA 3R4NA 3WFVA 1NH2B 4MOTA 3BY6A 4B6CA 2QA4V 2CGFA 4GFNA 3R92A 1VQ8V 3ZXQA 2XJXA 3B26A 1F51A 4MVZA 2WI6A 2K5BA 2JIZG 1B63A 1KP3A 3T0HA 1AR1B 3JD0A 4XDJA 3OM3B 1AMWA 4MPCA 4L90A 3LPSA 1YESA 2VCIA 1ZWIC 2DQ0A 4KFMA 3T0ZA 1AI5A 3JD3A 3K98A 3MHHC 4URMA 1EA6A 1THNA 4RUFA 2YK2A 3CWVA 2HCHA 4MP2A 4NH7A 3G7BA 3CGYA 5M4HA 2HKJA 3OMAB 2CCSA 3EHFA 3OFNG 3AG1B 3HZ5A 1NHIA 4MSWC 1GKZA 1ZXMA 1UYEA 1LNQA 1AI6A 3H80A 1I5XA 1PNMA 5CBFA 3K99A 2R9IA 2XASA 4QNHB 1DF4A 2YJXA 1R3IC 4UXNA 3SYOA 3CCMV 1PNLA 1UYMA 1TBWA 2WLMA 1HWYA 3ZIAG 2Q68A 2ZXWB 1E79G 1BXDA 2OCCB 4LWGA 4XKOA 2YKJA 3R4PA 5HFLA 4MTFA 4EGHA 2CCUA 4PL9A 2XAGA 3AG4B 2Q8GA 4MS2A 4EM7A 3Q5KA 3ZMUA 2Z3YA 4L94A 1JVMA 4CWRA 1NH2D 3O6OA 3T1CA 4U7OA 3JD1A 4ASFA 4RQEA 3SPJA 5BOCA 2ZBKB 3ZCCA 2V1DA 4JAVA 3RLPA 4CWNA 1TUEB 2QFOA 3ETGA 1SZTA 2FYPA 4PDMA 3K9AA 3HB3B 2E0AA 1QLNA 3W7UA 5IYDO 1S72V 4FCQA 1NKDA 3GIGA 3M99B 4O09A 5FNDA 4OXSA 3TZ4A 3W7SA 2LP7A 2EINC 2PI4A 1K73W 1YTFD 4X8AA 1S0VA 4HZ5A 3EHHA 4YKWA 2YKIA 3O0IA 2V7QG 3G7EA 2EINB 1JJ2U 3A0ZA 4X89A 3ETEA 1VQ6V 5L3BA 1NBMG 1YT2A 3K79A 1FXKA 3U67A 2JJ2G 3JD2A 3ZM7A 3ZMZA 3E2EA 1FS0G 2HLDG 3EFFK 4BIUA 3A0XA 1UYHA 4PELA 2WI4A 1W2BU 3ETDA 4KUMA 1V54C 2IH1C 3ABMB 5KA6A 3LSQA 4RUEA 4GX2A 4R8CA 1V55C 4G2KA 4ZVIA 3FB6C 3ASOB 2JJ1G 2X6CA 1Q82W 1JCHA 2YEIA 2VCJA 3LDDA 3KE6A 2QM7A 5BZBA 1AJQA 4UVBA 3VHAA 3OW2U 3ZKDA 4LP0A 4XDLA 2W6IG 2XABA 5CTYA 1R6NA 1VQLV 2EILC 5FNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HZ1 A;  5L3J A;  3R4O A;  2LFR A;  1UYD A;  4MTX A;  4AWQ A;  1PVG A;  2IOQ A;  2ZDY A;  2YE9 A;  4XTJ A;  4QPK A;  4ZKI A;  3TUH A;  4CWO A;  2BU6 A;  4XCL A;  2BU5 A;  4E00 A;  3R4M A;  2XDS A;  4XIT A;  4KP4 A;  4FCR A;  2BTZ A;  2YE7 A;  4WUD A;  3JZ3 A;  2BYI A;  3D2R A;  3A0Y A;  3TK1 A;  5D6P A;  2LFS A;  2Q8F A;  5CPH A;  4PRX A;  1Y4S A;  1ZW9 A;  4I3H A;  4NH8 A;  1YSR A;  2XHR A;  3GIE A;  1ZXN A;  4WUC A;  2C2A A;  2JJC A;  4O04 A;  4CWS A;  4MBC A;  4X9L A;  4YKZ A;  2YJW A;  1QZR A;  4LC1 A;  4LWE A;  3TZ5 A;  4MT8 A;  2IWS A;  2IOP A;  1YET A;  3NXS A;  2IWU A;  2VWC A;  1Y8P A;  4HY1 A;  4PRV A;  4YKU A;  2IWX A;  3K97 A;  2XX5 A;  4KTN A;  3K60 A;  2PNR A;  3BMY A;  2YGF A;  4MP7 A;  2BRC A;  5B1N A;  5M4P A;  1TH8 A;  1H7U A;  1S14 A;  3HEK A;  4W7T A;  3ZXO A;  4CWQ A;  1UYI A;  1OSF A;  1Z5C A;  1YS3 A;  4H81 A;  4HXZ A;  4R3A A;  1JOY A;  4P8O A;  3TZ0 A;  2QF6 A;  1BKN A;  3EHG A;  3RLQ A;  2O1U A;  2FWZ A;  3OWB A;  3OMU A;  3OWD A;  1AJ6 A;  2ZKJ A;  1KIJ A;  2Q8I A;  3QDD A;  2YEG A;  1UY7 A;  2YGA A;  2QM8 A;  3NMQ A;  3U2K A;  1MX0 A;  4NH9 A;  3EKR A;  1Y8N A;  2JKI A;  2EXL A;  2CG9 A;  4ASB A;  1U2O A;  2YEF A;  2O1W A;  4CE3 A;  3SL2 A;  2BRE A;  1YC4 A;  1H7S A;  4HZ0 A;  1L0O A;  4EGI A;  2ZDX A;  4PU9 A;  5CTU A;  4EMV A;  5M4M A;  5M4E A;  2BSM A;  3R4N A;  4MOT A;  2CCT A;  5J71 A;  5D7R A;  1TC0 A;  5D7D A;  4B6C A;  1U0Z A;  2CGF A;  4XKA A;  3A0R A;  4GFN A;  2XD6 A;  3EKO A;  3Q5J A;  2YE6 A;  3R92 A;  3RKZ A;  3ZXQ A;  2XJX A;  3B26 A;  4XC0 A;  1EI1 A;  4V26 A;  1F51 A;  4JYB A;  2FWY A;  2H8M A;  2XK2 A;  2WI6 A;  2K5B A;  1B63 A;  1Y8O A;  4KQV A;  1YT0 A;  5IDM A;  3T0H A;  3PEJ A;  4LWF A;  5GGZ A;  1AH8 A;  5CF0 A;  4FCP A;  1AMW A;  2YE3 A;  4MPC A;  4L90 A;  1UYG A;  5M4K A;  3LPS A;  1YES A;  3FT8 A;  3QTF A;  4DZY A;  1BYQ A;  4WUB A;  2VCI A;  3TTZ A;  1ID0 A;  2XDX A;  3IED A;  4H7Q A;  3MD0 A;  2WI1 A;  3T0Z A;  4DUH A;  4HYM A;  3K98 A;  4QPJ A;  1IXM A;  4P7A A;  1I5A A;  2YI7 A;  4URM A;  5IDJ A;  1EA6 A;  1UY6 A;  3ZRV A;  3GIG B;  2VW5 A;  4BIZ A;  4GT1 A;  3R91 A;  2FXS A;  1THN A;  1JM6 A;  3G75 A;  3WQ9 A;  1ZWH A;  2YK2 A;  3B28 A;  3CWV A;  2HCH A;  3A0T A;  4MP2 A;  4NH7 A;  3G7B A;  2YE5 A;  3CGY A;  5M4H A;  2HKJ A;  2WI2 A;  4XDM A;  2CCS A;  3EHF A;  4HYP A;  4YKQ A;  4EFT A;  4Q20 A;  3HZ5 A;  4K4O A;  3ZRW B;  1NHI A;  1TIL A;  3D0B A;  4XE2 A;  4CWF A;  1GKZ A;  1ZXM A;  1UYE A;  2YK9 A;  2YE4 A;  4O05 A;  4JYC A;  3CGZ A;  1UYC A;  4LWH A;  3H80 A;  3K99 A;  2YKE A;  2YEA A;  4O07 A;  4KSH A;  4BAE A;  2YJX A;  4CWT A;  4L8Z A;  4XIP A;  3OW6 A;  4KSG A;  4U7N A;  2XHT A;  3T1K A;  2QG2 A;  2YKC A;  2BT0 A;  1YT1 A;  1UYL A;  1UYM A;  3INX A;  1TBW A;  3B27 A;  5M4N A;  2XDL A;  2O1V A;  5CTX A;  5D6Q A;  4EFU A;  1BXD A;  3P32 A;  4LWG A;  4URN A;  3HYZ A;  4MPN A;  1I58 A;  5FWK A;  4FPP A;  4XKO A;  1BGQ A;  4YKR A;  2YKJ A;  3R4P A;  4URO A;  2YEJ A;  4GT8 A;  4EGH A;  2CCU A;  2XCM A;  1NHJ A;  4YKY A;  4PL9 A;  2BZ5 A;  2Q8G A;  4BXI A;  2WER A;  4YKT A;  4YKX A;  4FMT A;  2Q8H A;  3ZKB A;  4EM7 A;  3Q5K A;  1NHH A;  3C0E A;  1Z5B A;  4L94 A;  1UY8 A;  2WEP A;  4CWR A;  3WHA A;  3O6O A;  4GQT A;  3T10 A;  1AM1 A;  4U7O A;  1A4H A;  4MPE A;  4AWO A;  4ASF A;  3PEH A;  5BOC A;  2ZBK B;  4V25 A;  4KFG A;  3ZCC A;  3RLP A;  4JAV A;  4L93 A;  4XCJ A;  4CWN A;  2QFO A;  2BU2 A;  2YI5 A;  4JQL A;  2Q2E B;  4LPB A;  4U93 A;  3HYY A;  2YED A;  1YSZ A;  2H55 A;  2AKP A;  1GKX A;  1QY8 A;  2YGE A;  1YC3 A;  2FYP A;  4H85 A;  4URL A;  1S16 A;  2BU8 A;  1GJV A;  2E0A A;  2XJJ A;  1YC1 A;  4BQJ A;  2P67 A;  2YE2 A;  2YKB A;  2GQP A;  1KZN A;  4HY6 A;  2HG1 A;  2ESA A;  3O2F A;  4R1F A;  4FCQ A;  2QG0 A;  3DGE A;  3GIG A;  4EEH A;  3LNU A;  1TC6 A;  2GFD A;  3EHJ A;  4HXW A;  4R3M A;  2CH4 A;  2WI5 A;  4MB9 A;  4O09 A;  5FND A;  3TZ4 A;  2FTK A;  1AH6 A;  3TZ2 A;  3ZRW A;  4B7P A;  2XHX A;  2YI6 A;  3H4L A;  2XX4 A;  4AS9 A;  4HZ5 A;  3EHH A;  1B62 A;  1US7 A;  3CRK A;  4YKW A;  2YKI A;  3O0I A;  4O0B A;  4EGK A;  3G7E A;  4XKK A;  5CTW A;  2YEE A;  3RLR A;  1UYK A;  2XDU A;  3A0Z A;  4ASG A;  4CWP A;  2XDK A;  2XJG A;  4L91 A;  1YT2 A;  3GIF A;  3U2D A;  2YEC A;  3U67 A;  1MU5 A;  4XIQ A;  1B3Q A;  3VHD A;  5J6A A;  5C93 A;  1Z5A A;  2BYH A;  4LWI A;  3ZM7 A;  4GCZ A;  4AWP A;  2WI7 A;  4BIU A;  3INW A;  3HHU A;  4XD8 A;  2XX2 A;  3A0X A;  3B25 A;  4XIR A;  1QYE A;  2YEH A;  4E01 A;  1UYH A;  2YE8 A;  4BQG A;  2WI4 A;  5FNF A;  3CRL A;  1YER A;  1Z59 A;  3FV5 A;  2WI3 A;  2YEB A;  1I5C A;  2UWD A;  3VAD A;  5B1O A;  2YI0 A;  5D7C A;  3VHC A;  3MNR P;  2IOR A;  5BOD A;  3BM9 A;  5F3K A;  4E02 A;  4CE2 A;  1I5D A;  4ZVI A;  4GGL A;  3D36 A;  5IN9 A;  4CE1 A;  4ASA A;  1R62 A;  3B24 A;  3FT5 A;  2BU7 A;  1UY9 A;  2YEI A;  2VCJ A;  1I5B A;  4JAU A;  3KE6 A;  3C11 A;  2QM7 A;  3OPD A;  3VHA A;  4GEE A;  4JAS A;  3Q5L A;  4I5S A;  1UYF A;  3ZKD A;  1I59 A;  3A0W A;  4LP0 A;  2XAB A;  1Y4U A;  3ZRX A;  5F5R A;  3T2S A;  5CTY A;  2WEQ A;  2WWW A;  1TID A;  5FNC A; 
#chains in the Genus database with same CATH topology
 3R4O A;  1M9N A;  4HBN A;  4O2B A;  4MTX A;  4AWQ A;  1H2S B;  2HFE C;  4QPK A;  2EX3 A;  3AG3 C;  4ZKI A;  1OCO B;  4DRX A;  2UXX A;  2OWO A;  3THO A;  4C7U A;  1BHB A;  4FCR A;  2MW2 B;  4JAA A;  3JZ3 A;  3QO7 A;  2BYI A;  1N33 O;  1MMM A;  2DYS B;  5B1B C;  2LFS A;  3SDL A;  2Q8F A;  4DV7 B;  1N32 O;  4LH6 A;  4B7K A;  5CPH A;  2CAZ C;  5KAI Z;  3S3W A;  3SYP A;  4WFG A;  3J80 N;  4NH8 A;  3OD4 A;  5JEN A;  5B1B B;  1NZ6 A;  4B3R O;  2XHR A;  4CWS A;  2QM4 A;  4O04 A;  2BTO A;  1FFT B;  1SZX A;  3LSS A;  3I56 V;  4DV6 B;  4I9W A;  1SQX H;  1QZR A;  3E86 A;  1JMK C;  1OV9 A;  4DV3 B;  1XMQ O;  1OCZ C;  2ODM A;  1WA8 B;  3F5W C;  2IWU A;  2VWC A;  3L70 H;  3JAS A;  4LR3 A;  5KMG A;  1PL4 A;  2YGF A;  3RBZ A;  4MVM A;  2BRC A;  2H3O A;  3B4S A;  3ICX A;  1H7U A;  1UFI A;  4W7T A;  2HJF C;  2JEU A;  4JPR A;  1SQV H;  4DR4 B;  4HXZ A;  4JI1 B;  4R3A A;  4CBC A;  4LF6 B;  3ZX6 A;  1BKN A;  1PKX A;  2M6Y A;  2Y69 C;  4PV1 B;  5DN6 G;  4QE9 A;  3OMU A;  3OWD A;  3BA8 A;  3ML0 A;  2ZE7 A;  1BZK A;  4DV6 O;  5GON B;  2Y69 B;  2XAQ A;  5C8Y A;  2VWJ A;  3ZS8 C;  1MX0 A;  1NVP B;  1TAE A;  3E8G A;  1Y8N A;  1HNX B;  2W0X A;  2QDO A;  5J2T B;  1CEZ A;  2XUM A;  3ZJZ A;  5CA1 B;  1HR0 O;  2BCC H;  5B3S C;  4O4H A;  2IJK A;  1UPG A;  2YI9 A;  1OCC B;  2A79 B;  5K1P A;  4EGI A;  5TIS Z;  4WBN B;  5LHG A;  1KKD A;  2CE4 A;  1FPO A;  3P3N A;  4X20 A;  4UB8 Z;  4K8Z A;  4PU9 A;  4A5U B;  3K0D A;  1CP9 A;  1B06 A;  3D36 C;  2PGG A;  4LFA B;  5M4E A;  5FPO A;  2Y48 A;  1Q86 W;  2ZE5 A;  1M57 C;  3A0R A;  4DV0 B;  5CB4 B;  2WLK A;  1HNX O;  1D5N A;  2W0F C;  2Q5Z A;  4XC0 A;  3LDE A;  2FWY A;  1M57 B;  1KEC A;  2NN4 A;  5IDM A;  1LR1 A;  4LNU B;  1H38 A;  4LWF A;  5GGZ A;  1AH8 A;  4DV2 O;  4BIO A;  1H2L A;  1KU9 A;  2JK5 C;  4W4K A;  4FCP A;  1B6Q A;  2P90 A;  4K8X A;  2YE3 A;  1P7B A;  2LW7 A;  1K7D A;  4DZY A;  3CB2 A;  4WUB A;  4TWK A;  3TXQ A;  1ID0 A;  3G67 A;  2GTS A;  4I4T B;  3FFQ A;  2YEV A;  4H7Q A;  5CBH A;  4LFA O;  3MD0 A;  1YJN V;  3O65 A;  4DR6 O;  5IDJ A;  3N2G A;  4X62 O;  5KHJ A;  2VW5 A;  1R3L C;  4GT1 A;  1E1R G;  1KQS U;  2FXS A;  4RAI A;  2F1M A;  2WSS G;  2LW1 A;  1ZWH A;  3CCR V;  4JTC B;  5KHK A;  3B28 A;  5KHH A;  5LA6 B;  5ITZ B;  2WA4 A;  4FM1 A;  3L72 H;  5LYJ B;  1E1Q G;  4UCO A;  4IT5 A;  2WI2 A;  1OCR B;  4YKQ A;  4EFT A;  1IDS A;  1JJO A;  1JFF A;  2A7W A;  4K4O A;  4HZ3 A;  4K3A A;  1J5E B;  4PI2 A;  4FLZ A;  1RPR A;  2WLI A;  4JYC A;  1IUR A;  2NLJ C;  3CRC A;  2YC0 A;  3H1J H;  3RYC B;  2NR5 A;  3STZ C;  4TOI A;  1YF2 A;  4LF9 O;  1I5Y A;  4KSH A;  4PA7 A;  1WP8 A;  2ZE8 A;  2ZQM A;  4CWT A;  2OCH A;  5IYB O;  3OW6 A;  2IW5 A;  4U7N A;  2XHT A;  2QE7 G;  4H33 A;  1OHH G;  4L87 A;  5B1A C;  4O4J A;  1MZE A;  1YVW A;  1UYL A;  2YUA A;  5JJE B;  2C1G A;  3INX A;  2CK3 G;  1F4N A;  4MTO A;  1NVP D;  3ASN B;  4PDR A;  1SA0 A;  4PI0 A;  4MVR A;  5LXT B;  4WFA V;  5CTX A;  1I0H A;  4EFU A;  4B08 A;  5JWP A;  3JAT B;  4FFK A;  3E89 A;  2UUB B;  1Y6X A;  1ZX3 A;  1G4Y B;  1R1B A;  2WLL B;  1N36 B;  4GT8 A;  1RP3 B;  3SJQ C;  1N4C A;  2XCM A;  4FIP C;  4BXI A;  4I55 B;  2WER A;  3R66 A;  4YKT A;  4YKX A;  1SKV A;  1NHH A;  2RJZ A;  2B1I A;  1O9H A;  4DYL A;  4J42 A;  1AM1 A;  4FK5 C;  4O4I B;  2X6A A;  1IZ3 A;  1M93 A;  1S3J A;  4JV5 O;  1VQO V;  1NT2 B;  4FZ1 A;  1FFX B;  3JAL A;  4DR7 B;  1THZ A;  1FAF A;  4KFG A;  2UUB O;  3T1H O;  1Z5W A;  3AK3 A;  4JQL A;  3BA9 A;  5KX5 A;  3K5L A;  4U93 A;  3HYY A;  5LOV B;  2H55 A;  3CC4 V;  1BMF G;  3WG7 C;  3J7A U;  3OEE G;  1QR9 A;  3MHS C;  1AJN A;  2JGD A;  1MNG A;  2YE2 A;  3UT5 A;  2GQP A;  3F5T A;  4CH4 A;  1SC5 B;  4HY6 A;  1GM7 A;  3AEI A;  4JI4 O;  2IJI A;  3K58 A;  2PZS A;  5AG2 A;  3L73 H;  4MVQ A;  1K92 A;  1TC6 A;  1P7G A;  3E8F A;  2ZDI C;  3I55 V;  1PL0 A;  4LBE C;  3GVM A;  3K04 A;  1EZJ A;  2CH4 A;  3RWR D;  4P30 A;  1QVF U;  3P3P A;  4W4L A;  4FLU A;  1JR9 A;  3A0H Z;  1PNK A;  3RVZ A;  4UVA A;  3BVO A;  1Y4M A;  3HPL C;  4B7P A;  5H5N A;  3DC5 A;  1YTF B;  4WFE A;  2EZO A;  1B62 A;  1QHT A;  2JVD A;  3OTO O;  2BTQ A;  4O0B A;  2YEE A;  3RLR A;  2XDU A;  1CPY A;  2B5U A;  4ASG A;  1WLE A;  1QCE A;  4L91 A;  2AHY A;  3OEH G;  2AGA A;  2IBZ H;  2YEC A;  1HNW O;  3VHD A;  2M7W A;  3FD9 A;  4JTD B;  5J6A A;  2BYH A;  1KUQ A;  3LMM A;  3U11 A;  4FLY A;  4DUZ B;  2ZT9 B;  2WI7 A;  3INW A;  3HHU A;  1FD9 A;  3SPG A;  1BQ0 A;  4UV8 A;  1R73 A;  3T4D A;  2PUS A;  3CRA A;  3H1H H;  1Z59 A;  2WI3 A;  4I50 B;  3JYC A;  1S76 D;  5EBM C;  4FLX A;  1HNZ B;  1IBK O;  3E35 A;  5LP6 A;  3WU2 Z;  4O2A B;  3U10 A;  5EIB C;  3HKC B;  1IX9 A;  1MAB G;  1NTM H;  3VHC A;  2HVK C;  3JAW A;  2ZIM A;  4K35 A;  5CMU A;  3S5T A;  1NI8 A;  1W59 A;  4DV1 B;  2E76 B;  3UO3 A;  3BM9 A;  1G8M A;  1TUB B;  5IYC O;  2DYR C;  4DV5 B;  4CE2 A;  5IN9 A;  4YHH O;  4ASA A;  2PI5 A;  4TV9 B;  4GKK O;  4UVC A;  1UJW B;  4IHJ A;  4LWS B;  1I5B A;  4JAU A;  1RPO A;  1M1K W;  1BQZ A;  3AG2 C;  1KC8 W;  4F6R B;  4JAS A;  2QWR B;  1MA1 A;  3Q5L A;  4I5S A;  4MVU A;  2QTS A;  1UYF A;  1I7F A;  1HNZ O;  2F4V B;  3AG2 B;  1W0K G;  1RFY A;  4F4L A;  2KG7 B;  2WEQ A;  4DK1 A;  1KMI Z;  1FJG B;  4J80 A;  3HZ1 A;  5L3J A;  1EN5 A;  1RSO A;  2LQT A;  1FYJ A;  2YE9 A;  1Q7Y W;  4IYH A;  4HNA A;  4ABM A;  4E00 A;  4X64 B;  1MG1 A;  1YSC A;  4KP4 A;  4UCR A;  4WUD A;  1P84 F;  3A0Y A;  1XQ8 A;  4BW5 A;  1VQP V;  1GM8 A;  3IFX A;  4ZOL B;  4B3T O;  4B3S B;  1ZL8 A;  5JJJ B;  4MTG A;  4ZI7 B;  3FB7 C;  2IJJ A;  2R9R B;  5LMN O;  3L71 H;  4B3M B;  1YSR A;  4WUC A;  2JJC A;  4DR5 B;  4MBC A;  3HKE B;  4J9Y B;  4ZBM A;  2YJW A;  3K0G A;  2N05 A;  2HKO A;  2KQX A;  4MT8 A;  2IOP A;  1B04 A;  1AVM A;  4DW1 A;  3CXC U;  5D5Q A;  2QR4 A;  3ABK C;  4D6T H;  4CS3 A;  4TQF A;  2IWX A;  1N0N A;  4B7E A;  2XX5 A;  2P7T C;  4KTN A;  3K60 A;  2PNR A;  1MOF A;  2Q7H A;  4X1K A;  4X64 O;  2P6J A;  2ZM6 B;  5B1N A;  1JQ0 A;  2ZCE A;  3ABK B;  4JI3 O;  1S14 A;  2X7R B;  4CWQ A;  3ABU A;  1UYI A;  1OSF A;  1YS3 A;  1S5H C;  2B1G A;  1K34 A;  3K59 A;  1FXK C;  4B3S O;  2F66 C;  3RLQ A;  5CA0 A;  3HKD A;  1LUV A;  2Q0O C;  5EK0 A;  3LUT B;  3CCQ V;  1Q6I A;  4B3M O;  1F4M A;  1BT8 A;  3QDD A;  1V9P A;  2DQ3 A;  1VQ7 V;  4TT3 G;  2ZR2 A;  2H8P C;  2YXY A;  2QM8 A;  3NMQ A;  5FNV B;  3S3X A;  3U2K A;  1AJP A;  3RW0 A;  3RYH B;  4LP8 A;  3H1I H;  5F2V O;  1DTO A;  2JKI A;  4EEQ A;  1H2N A;  4ASB A;  1U2O A;  2YEF A;  1V54 B;  5EIB D;  4CE3 A;  4TUY B;  5IJ0 A;  3B8M A;  1K33 A;  4YJ2 A;  2BRE A;  1YC4 A;  2WLN A;  3WB1 A;  1H7S A;  2CTQ A;  3KG2 A;  3OUF A;  3CCL V;  5JVD A;  1SRY A;  4K0K O;  1VF7 A;  1V55 B;  3ZN1 A;  1H2M A;  1XOU A;  1ZSP A;  4IIJ A;  1QLE C;  1BCC H;  1KD1 W;  1N32 B;  4JI7 O;  3BCC H;  3VQX A;  5M4M A;  1Q8I A;  3CME V;  2BSM A;  2UXC B;  4B3R B;  5J71 A;  2DMX A;  1AI7 A;  3GB7 C;  3ZMS A;  5D7D A;  2QKA A;  3DC6 A;  3KCX A;  4ZIB A;  1XMQ B;  2XD6 A;  3EKO A;  3Q5J A;  2YE6 A;  2GUZ B;  1PD3 A;  4JYB A;  2XK2 A;  1XNR O;  4KQV A;  2UU9 O;  1K9M W;  2EIL B;  4FFB B;  2ZIN A;  2ZNI A;  3PEJ A;  5CF0 A;  3CHX A;  3BPZ A;  1P49 A;  1MZF A;  2CGN A;  3AG3 B;  3BRC A;  1SER A;  1DK1 A;  1R6T A;  1UYG A;  3L9D A;  1BYQ A;  4RQF A;  4NXM O;  2XDX A;  1NR1 A;  3IED A;  3CC7 V;  2Q9L A;  2WI1 A;  4BAY A;  4GYC B;  4HYM A;  3FYE B;  2YDE A;  2Q4P A;  3H01 A;  2UXC O;  2XT9 A;  4P7A A;  1I5A A;  2YI7 A;  3LSU A;  1J95 A;  4DR2 O;  1UY6 A;  3E22 B;  3CC2 V;  4BIZ A;  1WA8 A;  3R91 A;  3E83 A;  4JYY A;  3CCU V;  4JI5 O;  2YXL A;  2EUL A;  3IGA C;  1YI2 V;  1AP5 A;  3WQ9 A;  3MDS A;  2EZP A;  5IYZ B;  4JI2 O;  4CH6 A;  3A0T A;  1GN2 A;  3EHB B;  2YE5 A;  2ZIO A;  2QJ1 A;  4HYP A;  1OCZ B;  4ZHQ B;  1HR0 B;  4Q20 A;  3ZN0 A;  1NU1 H;  4JTA B;  2KKW A;  2Y0I A;  3ZRW B;  1TIL A;  3D0B A;  4GLX A;  2YK9 A;  1Y66 A;  2YE4 A;  4O05 A;  3CGZ A;  3ABL C;  1UYC A;  1FXV A;  4YY3 O;  3TXS A;  1AR5 A;  2R72 A;  1KP2 A;  5E1A C;  4O07 A;  1JPX A;  3JCU Z;  1X4T A;  3B09 A;  1S77 D;  4JI0 B;  3I5D A;  5GON A;  4DO2 A;  1S5L Z;  3E8B A;  4KSG A;  3T1K A;  2QG2 A;  1VF6 A;  2YKC A;  4JYA O;  2Q67 A;  2BT0 A;  2IU0 A;  2DN9 A;  4X1I B;  1R6K A;  5J2T A;  1RM1 C;  3B8N A;  3B27 A;  2CTW A;  4PA6 A;  4WFH A;  2XDL A;  2O1V A;  5CA1 A;  5D6Q A;  3SJC C;  1YXB A;  5IE9 A;  2PF4 E;  1GMG A;  4MVO A;  4LFB O;  3KZI Z;  4MPN A;  4FPP A;  1XUQ A;  2IJH A;  1BGQ A;  2YIA A;  4WBN A;  2GSM B;  4DV2 B;  3LDC A;  2YEJ A;  3N2K B;  1GKF A;  1NHJ A;  4H44 B;  3CD6 V;  2BZ5 A;  3X2Q C;  5B3S B;  1PM9 A;  1BS3 A;  1DLB A;  4MW8 A;  4FMT A;  4YIO A;  5E79 Z;  2RCV A;  4JI0 O;  3K57 A;  1Z5B A;  3C0E A;  2CGO A;  2WEP A;  3X2Q B;  1WPB A;  1QU7 A;  5HFM A;  4DR6 B;  3T10 A;  5CB4 A;  4X62 B;  3Q4H B;  1Q3E A;  5DM6 V;  3U0Z A;  2RMK B;  3PEH A;  1TA8 A;  5JH7 B;  1XL4 A;  4LNU A;  2JGU A;  4V25 A;  3E8H A;  3F7Y C;  4MW3 A;  4OPH A;  5GW7 A;  2PY5 A;  1Y76 B;  2UUA O;  4XCJ A;  1H2G A;  1VQK V;  2BU2 A;  3A2F A;  1N0J A;  5LGT A;  5JCO A;  2Q2E B;  1HDJ A;  2RN9 A;  2YED A;  2EIK C;  4H85 A;  2AKP A;  1GKX A;  1QY8 A;  4URL A;  5A2Q N;  1L1F A;  2JRI A;  3HKB B;  2AW9 A;  1K5S A;  1M56 C;  2BU8 A;  4LF5 O;  2XJJ A;  4I4T A;  3RFR A;  4P2Z A;  3K5M A;  3G6B A;  4BQJ A;  2P67 A;  3JSN A;  2YKB A;  1R3K C;  4LF9 B;  2R70 A;  2HG1 A;  2ESA A;  1M56 B;  3O2F A;  2GV9 A;  5IY5 C;  2BOB C;  2ITC C;  2HEP A;  3DGE A;  4ICG A;  3LNU A;  5KHG A;  4WFB V;  1NJI W;  3BHP A;  3EVK A;  5A9G A;  1WB7 A;  2HG5 C;  2VS0 A;  3SYA A;  3FX7 A;  1VP7 A;  4J9Z B;  5LA6 A;  2EJ7 A;  4TSF G;  5ITZ A;  2JEX A;  2IH3 C;  2WI5 A;  4MB9 A;  3ABT A;  5LYJ A;  4DXW A;  4HAM A;  3W7W A;  3JAK B;  1YJW V;  4L8J A;  2Q73 A;  2YI6 A;  4N23 A;  2XX4 A;  4AS9 A;  4EB6 B;  1US7 A;  3CRK A;  3DXR A;  3RYC A;  3ZMT A;  2P4K A;  5JQG B;  2XAH A;  4XKK A;  5CTW A;  1UYK A;  3SR2 C;  5LMU O;  3CWB H;  2XDK A;  2R9A A;  1K4D C;  2Q6A A;  2ADP A;  3MAQ A;  3IAY A;  3U2D A;  1TVK B;  2YXH A;  2EIJ C;  5L3E A;  4OX9 B;  1KBH A;  4Q6G A;  5C93 A;  3DTU B;  1L8D A;  4DK0 A;  1EM1 A;  4AWP A;  2F23 A;  5EC2 C;  1XNQ O;  5LHI A;  2HR3 A;  5LXT A;  2XX2 A;  3JAT A;  4JV5 B;  3K3W A;  5B1A B;  3VQY A;  4XIR A;  1QYE A;  4E01 A;  2WLL A;  1Y67 A;  2K1E A;  2L6L A;  2ZE6 A;  5KUK A;  5FNF A;  3ETQ A;  1Y74 B;  1K5Q A;  4GX1 A;  3T1H B;  4CZZ A;  3FV5 A;  4YXW G;  2AHZ A;  2X6B A;  4DR3 O;  3CRR A;  2CDY A;  2CTP A;  2UWD A;  2EIM C;  3VAD A;  1L0N H;  5KA5 A;  2EBO A;  3K5O A;  3N27 A;  2YI0 A;  4I55 A;  1ZUQ A;  3RYI B;  4QIW F;  2LO1 A;  1VQ5 V;  3BAB A;  1VQN V;  5F3K A;  4E02 A;  4JI8 O;  4JI4 B;  1I5D A;  4OX9 O;  3L74 H;  4O4I A;  4GGL A;  3B24 A;  3FT5 A;  3CCV V;  1VQM V;  5IT9 N;  3P30 A;  2BU7 A;  3SGI A;  1FFX A;  2CH7 B;  2ZR3 A;  2UXN A;  3G71 V;  5EZY B;  3A8T A;  3OUS A;  4H13 B;  1YIJ V;  4Z1V A;  5LOV A;  1L0L H;  3CYO A;  3RYF B;  3D3Q A;  2P4V A;  3T2M A;  4HYO A;  1Y4U A;  3ZRX A;  5F5R A;  2DJV A;  3OTO B;  2WWW A;  3PJS K;  2L35 A;  3CCS V;  5H6R A;  3JAM N;  1GK9 A;  2LFR A;  2MK3 A;  1UYD A;  4PDL A;  5FL7 G;  3OR7 C;  3WG7 B;  3TUH A;  2ZNJ A;  3QF7 A;  4ASU G;  5GTI Z;  3CS5 A;  2Z5U A;  2YIB D;  1HNW B;  1VQ4 V;  3GWO A;  2BU5 A;  4CH5 A;  5J9P C;  5BMV B;  3K08 A;  2ZD9 A;  4JF3 A;  4XIT A;  1MSW D;  2BTZ A;  1H8E G;  2YE7 A;  4GUN A;  4AHC A;  2ZDI A;  1SF9 A;  4LH7 A;  4X1Y B;  5KUM A;  3D2R A;  1K8A W;  2ARH A;  3TK1 A;  4LCU C;  4DW0 A;  3T1Y O;  1ZLZ A;  1Y4S A;  1ZW9 A;  5D5P A;  4I3H A;  3K9S A;  4X9L A;  4UCU A;  1IBK B;  4YKZ A;  4LC1 A;  1F23 A;  4LWE A;  3TZ5 A;  2IWS A;  1YET A;  3AG1 C;  3SPH A;  3NXS A;  3AK2 A;  1ORQ C;  3VOU A;  2IU3 A;  3D3I A;  1AR4 A;  1U97 A;  3ZHU A;  2OTL V;  3FYI B;  3RVY A;  4YHH B;  4R7C A;  1TH8 A;  4LFC O;  1GM9 A;  3ZXO A;  1EN4 A;  3UKM A;  3KKY A;  4H81 A;  4GKK B;  1ROP A;  3TZ0 A;  2QF6 A;  3OAA G;  4P9P A;  2FWZ A;  4O2A A;  1AJ6 A;  5H6Q A;  2ZKJ A;  3HKC A;  2Q8I A;  2ZXW C;  2YEG A;  3LNN A;  1UY7 A;  4QGP A;  2OCC C;  3CRM A;  2KB1 A;  2XND G;  1W0J G;  3PN1 A;  2GTA A;  1JX9 A;  1YEW A;  3KCY A;  3SPI A;  3CPW U;  1TUB A;  1Q90 D;  2CG9 A;  5IJ9 B;  2Z0A A;  2O1W A;  5LP6 C;  1XIL A;  3SL2 A;  1GO3 F;  1GH6 A;  3C3S A;  3UO2 A;  1FXH A;  4PA9 A;  3AG4 C;  4TV9 A;  3UCS C;  4LWS A;  5FLX N;  2DYR B;  2F43 G;  2QSA A;  4F6R A;  2ZDX A;  4TV8 B;  4DV4 O;  5LHH A;  1P4R A;  4B3T B;  1GN6 A;  2VQF O;  4EMV A;  4XDK A;  5L3F A;  4WF9 V;  5LMN B;  2CCT A;  3CMA V;  3RN4 A;  5D7R A;  4E72 A;  2KG7 A;  1TC0 A;  1H8H G;  1U0Z A;  4N21 A;  2Q7G A;  4XKA A;  2PTM A;  2G38 A;  1K3E A;  2CUG A;  4AIL C;  3RKZ A;  3OMI B;  1EI1 A;  1PV0 A;  4V26 A;  3T4Z A;  2H8M A;  4KHP O;  3JCZ A;  3ZHQ A;  4IHJ B;  2P5O A;  3OGI B;  1Y8O A;  1YT0 A;  4QJF B;  4DR1 O;  4AQY O;  1XI1 A;  2NNU A;  1EN6 A;  4FVM A;  1G6U A;  4JI3 B;  3NR7 A;  4ZOL A;  1GTO A;  3JAR B;  5EC1 C;  1XMO B;  1N34 O;  4PHZ A;  5M4K A;  3QTF A;  3FT8 A;  1LUW A;  1EFR G;  3K03 A;  4ZI7 A;  4X65 O;  3TTZ A;  4NXN O;  3D8C A;  3H1L H;  5EBW C;  4LF8 O;  1IBL O;  4DUH A;  1QBZ A;  3HKE A;  4J10 A;  4RO2 A;  2P06 A;  4QPJ A;  1IXM A;  1M90 W;  3IC9 A;  3AK1 A;  5IWA O;  5BR8 O;  2VWK A;  4UFZ A;  3ZRV A;  4FLW A;  3GIG B;  1Z5V A;  3ZMV A;  1JM6 A;  1VAR A;  3G75 A;  1ARO P;  2LGW A;  4JZ2 A;  2LJ2 A;  5B66 Z;  3R65 A;  2PYL A;  4U3J B;  1VIB A;  3WB0 A;  3B2E E;  1N8R W;  3IJ4 A;  4XDM A;  5K1X A;  4XE2 A;  4CWF A;  2WLH A;  1YHQ V;  1M4U A;  4YJ3 B;  1XMO O;  4K0K B;  1NTZ H;  2E5L O;  4LWH A;  4X88 A;  2YKE A;  2YEA A;  1IBM B;  4BAE A;  2X0L A;  4JI7 B;  1KYO F;  1XDC A;  5L3C A;  4L8Z A;  4UUJ C;  4XIP A;  1XL6 A;  1YJ9 V;  1FXK B;  1NS1 A;  2DWE C;  3H9V A;  3AG7 A;  3CX5 F;  3WB2 A;  1XHZ A;  1YT1 A;  2K9P A;  3W7T A;  2YSU B;  3FKS G;  3RYH A;  4Z2W A;  4PDV A;  4O4L B;  2QKC A;  2WAM A;  2LGQ A;  5M4N A;  4TUY A;  5LGU A;  5CN0 A;  2HP8 A;  5J2U B;  1BHA A;  2ITD C;  3P32 A;  5EYP B;  2WLJ A;  3ABM C;  1SQP H;  1XNR B;  1K4C C;  2UU9 B;  4URN A;  3OMN B;  3HYZ A;  2BSK B;  5CA0 B;  1URF A;  1I58 A;  5FWK A;  1YDX A;  4LF4 B;  1BL8 A;  2Q69 A;  1SQB H;  3FAV B;  4YKR A;  4URO A;  3CXH F;  2FKX A;  5DEC A;  4F6E A;  3RGB A;  4YKY A;  2Q8V A;  3ASO C;  4R6Z A;  1IBM O;  2Q8H A;  4NXM B;  1F7Y A;  3ZKB A;  4IYI A;  1HP8 A;  3CJH B;  2HHH O;  1ENV A;  1UY8 A;  1QVG U;  4NYK A;  4BW9 A;  2GHY A;  4LF7 O;  3WHA A;  1QLE B;  1DGS A;  4GQT A;  2HVJ C;  4DR2 B;  4R50 A;  4RWU A;  1A4H A;  4MPE A;  2GUZ A;  4AWO A;  2C1I A;  4JI5 B;  2ETN A;  5JVD B;  3ZBH A;  1QNM A;  4I0X B;  4JI2 B;  4FFB A;  4JI6 O;  3QO5 A;  4L93 A;  2YI5 A;  2F95 B;  4G28 B;  3SYC A;  4LF4 O;  2QTO A;  4LPB A;  1QQC A;  3VBB A;  1YSZ A;  2YGE A;  1XBL A;  1YC3 A;  2Q7E A;  1S16 A;  2N04 A;  1GJV A;  1OCO C;  2E74 B;  4YY3 B;  2A9H A;  1YC1 A;  2QGN A;  4GKJ B;  4UCT A;  1KZN A;  2UXB O;  4CH3 A;  4R1F A;  1OZ0 A;  4O2B B;  2DYS C;  5LBQ A;  2QG0 A;  3E22 A;  4EEH A;  2ATK C;  1SET A;  4JYA B;  2OT5 A;  2GFD A;  1Q81 W;  4DRX B;  1NR7 A;  3EHJ A;  5IYZ A;  4HXW A;  4R3M A;  1YCI A;  3G80 A;  3ZHR A;  2VQE O;  3OGC C;  2QKS A;  1WNS A;  3QO8 A;  4ZHQ A;  2OYQ A;  5LGN A;  3CCJ V;  2FTK A;  1AH6 A;  3TZ2 A;  3ZRW A;  2XHX A;  3H4L A;  1Q6U A;  1WPX A;  4LFB B;  4UCV A;  2A0L A;  4CC6 A;  4EGK A;  3TET A;  3G4S V;  1A32 A;  1VQ9 V;  5CBG A;  4J11 A;  4CWP A;  5JJN B;  4GKJ O;  2XJG A;  4NKG B;  2HJD A;  3CSX A;  4P9O A;  3O9O A;  2BOC C;  3GIF A;  2DOS A;  3ABL B;  4X1I A;  4WCE V;  1MU5 A;  4XIQ A;  1B3Q A;  3JAS B;  4JGS A;  4FLV A;  1Z5A A;  4LWI A;  1DF5 A;  4GCZ A;  5KMG B;  1WP7 A;  1K97 A;  3F7V C;  1SES A;  4XD8 A;  2OIG A;  4GX5 A;  3B25 A;  4MVS A;  4DV7 O;  1M5I A;  2YEH A;  2XOK G;  2FYU H;  2YE8 A;  4BQG A;  1VF6 C;  2UUA B;  3CRL A;  2QWP B;  1YER A;  3M7M X;  5H2F Z;  1RM1 B;  2YEB A;  5BXZ A;  3JSL A;  2JDI G;  3N2K A;  3ZHT A;  1I5C A;  3L75 H;  2DW4 A;  3FB5 C;  4FZ0 A;  4DV3 O;  5H9C A;  1BGY H;  5B1O A;  1NQT A;  2UXD B;  3B40 A;  5D7C A;  1YIT V;  4FM2 A;  3MNR P;  4LF5 B;  1S5J A;  5C8Y B;  4UV9 A;  1QR8 A;  2IOR A;  2DE0 X;  1COW G;  1OCC C;  5BOD A;  3HR0 A;  5KAF Z;  3QNE A;  1GN4 A;  3TJT A;  4EKW A;  2EJR A;  3D36 A;  2A06 H;  3Q4H A;  4CE1 A;  1R62 A;  2ZKO A;  2QEX V;  4NB5 A;  4O4H B;  4DR4 O;  1UY9 A;  5JH7 A;  3JD4 A;  4JI1 O;  2OTJ V;  4FJC C;  4LF6 O;  1Y76 A;  3ZRS A;  3C11 A;  4X20 B;  3OPD A;  4GEE A;  3SYQ A;  5EBL C;  1I08 A;  1I59 A;  3A0W A;  3ZED A;  3HKB A;  1SS3 A;  3FB8 C;  3APO A;  4BWA A;  2UXD O;  3T2S A;  5KLV H;  3STL C;  1TID A;  5LL6 Y;  2IM9 A;  1KKC A;  5LMU B;  2EIK B;  2YIB A;  3OE7 G;  5JCO C;  1PVG A;  2KSD A;  2IOQ A;  2ZDY A;  4XTJ A;  4PJ0 Z;  4CWO A;  2BU6 A;  2GBO A;  4XCL A;  3B77 A;  4G27 B;  3R4M A;  2XDS A;  1SQG A;  4GX0 A;  1XNQ B;  5B5E Z;  5IY5 B;  2F93 B;  3JAK A;  3K06 A;  3IC7 A;  5D6P A;  4PA4 A;  4PRX A;  1SQQ H;  2FL4 A;  4EB6 A;  4YIP A;  4E2L A;  2YEV B;  1ZXN A;  3GIE A;  2C2A A;  4DR3 B;  2O57 A;  5JQG A;  3CCE V;  4D7T A;  2YS8 A;  2YID A;  1EBO A;  4FLT A;  4XBF A;  4EFE A;  4DV0 O;  1OCR C;  2N74 A;  3N2G B;  4WFF A;  2A3Q A;  3K5N A;  1Y8P A;  4HY1 A;  4H37 A;  4PRV A;  1TVK A;  4YKU A;  4X9Q A;  3K97 A;  5L3G A;  4JI8 B;  3DSQ A;  3BMY A;  1AB3 A;  4MP7 A;  5M4P A;  3HEK A;  1JFF B;  5CA3 A;  1Z5C A;  3CE2 A;  1KB9 F;  1JOY A;  4P8O A;  2EIJ B;  3DXR B;  1AI4 A;  2WLI B;  1Y74 A;  5FPR A;  3TCU A;  3EHG A;  1R3J C;  4AI8 A;  3UM7 A;  2O1U A;  3G6E V;  3UQ8 A;  4EFB A;  4QE7 A;  2DWD C;  3OWB A;  1HW7 A;  3ASN C;  3RT3 C;  1KIJ A;  3RYI A;  2YGA A;  4O4J B;  5L3D A;  4BR6 A;  4NH9 A;  4CS2 A;  1G1X B;  3EKR A;  4OPA A;  4Z1M G;  3OTF A;  4JZG A;  2EXL A;  2EIM B;  2XAJ A;  1U96 A;  1SA0 B;  4J7Z A;  4PA3 A;  2WPD G;  4NR1 A;  3OR6 C;  2D3O W;  2WA3 A;  2XHB A;  2CH7 A;  1J5E O;  4HZ0 A;  1L0O A;  5EZY A;  4X66 B;  3LNM B;  2XAF A;  3BEH A;  1XRE A;  5CTU A;  1IXB A;  4KXR A;  3RYF A;  3W7X A;  2QWQ B;  2W6J G;  3T1Y B;  2H94 A;  3CP1 A;  3SPC A;  3R4N A;  3WFV A;  1NH2 B;  4MOT A;  3BY6 A;  2ADQ B;  4B6C A;  1TGO A;  2QA4 V;  2CGF A;  2AZ0 A;  4GFN A;  3R92 A;  1VQ8 V;  3ZXQ A;  3BFR A;  2XJX A;  3B26 A;  1F51 A;  4MVZ A;  2WI6 A;  1WB8 A;  2K5B A;  2JIZ G;  5GTH Z;  1B63 A;  1KP3 A;  2E3C A;  5BMV A;  3JAL B;  3T0H A;  1N36 O;  3APQ A;  1AR1 B;  3J81 N;  2HHI A;  5DED A;  3JD0 A;  3QTC A;  4XDJ A;  4X1Y A;  1X59 A;  4LFC B;  5KX5 B;  4X66 O;  3OM3 B;  2B9Z A;  1AMW A;  4MPC A;  4L90 A;  3LPS A;  3SJB C;  1YES A;  2RDC A;  2VCI A;  1ZWI C;  4J7J A;  1VMG A;  2JS3 A;  3EXA A;  4IL6 Z;  2DQ0 A;  4KFM A;  3T0Z A;  2YIC A;  2JGD B;  1AI5 A;  1H2K A;  3JD3 A;  3K98 A;  1AP6 A;  3MHH C;  3UT5 B;  3GWK C;  4URM A;  2PYJ A;  1EA6 A;  1PPJ H;  1PP9 H;  1THN A;  1MSD A;  4RUF A;  2Y0P A;  3ZHS A;  2YK2 A;  3CWV A;  2HCH A;  2AZ2 A;  4MP2 A;  4NH7 A;  4DR7 O;  3G7B A;  3BAA A;  3CGY A;  5M4H A;  2HKJ A;  3OMA B;  1ZTE A;  2CCS A;  3EHF A;  1XEQ A;  3OFN G;  3AG1 B;  3HZ5 A;  1NHI A;  3CEI A;  4MSW C;  1GKZ A;  1ZXM A;  1UYE A;  1LNQ A;  1AI6 A;  1VEW A;  3H80 A;  2BTQ B;  3TGU H;  1I5X A;  1PNM A;  5CBF A;  3K99 A;  2R9I A;  4DV4 B;  2XAS A;  4QNH B;  4I7Z B;  1DF4 A;  4I50 A;  2CTR A;  5KHI A;  2VQF B;  3ZHV A;  2YJX A;  4NVP A;  1R3I C;  1GAX A;  3VQW A;  4UXN A;  1US6 A;  3SYO A;  3CCM V;  1PNL A;  4IGG A;  1UYM A;  2BE3 A;  4U3F H;  1TBW A;  1BE3 H;  2D2C B;  5IJ9 A;  2WLM A;  1HWY A;  3ZIA G;  2Q68 A;  2ZXW B;  1E79 G;  1BXD A;  4KHP B;  2OCC B;  4LWG A;  2Y4T A;  4DR1 B;  4AQY B;  4XKO A;  2UUC B;  2YKJ A;  3R4P A;  1D5A A;  5HFL A;  4MTF A;  4TV8 A;  4EGH A;  1Z2G A;  5LP6 B;  2CCU A;  4PD4 F;  1WAZ A;  4PL9 A;  1N34 B;  1FKA O;  1NTK H;  2XAG A;  3AG4 B;  2Q8G A;  4MS2 A;  3C3T A;  4X65 B;  4NXN B;  1Q5O A;  4EM7 A;  3JAW B;  2RNB A;  4LF8 B;  3Q5K A;  1IBL B;  1OJH A;  3ZMU A;  2Z3Y A;  4L94 A;  1JVM A;  1CXZ B;  4CWR A;  1NH2 D;  3O6O A;  5IWA B;  3T1C A;  5BR8 B;  4DUZ O;  4U7O A;  3JD1 A;  4ASF A;  1I94 B;  1Q43 A;  4RQE A;  3SPJ A;  5BOC A;  1Q6H A;  2ZBK B;  3C90 A;  3ZCC A;  2V1D A;  4JAV A;  3RLP A;  1BSM A;  4CWN A;  1TUE B;  2QFO A;  1VF5 B;  3ETG A;  2YI8 A;  4FM0 A;  2UUC O;  2RQ6 A;  3JAR A;  3VQV A;  1SZT A;  4UCS A;  2FYP A;  3OT7 A;  4PDM A;  4GZR B;  3K9A A;  4NTY A;  3HB3 B;  2E0A A;  3CRQ A;  1QLN A;  2E5L B;  2P22 C;  4J7K A;  4H0L B;  1AIL A;  3W7U A;  5IYD O;  4DV1 O;  1S72 V;  1T5E A;  4DV5 O;  4FCQ A;  1RSO B;  1NKD A;  2Y4U A;  1WJZ A;  3GIG A;  2AXT Z;  1IVS A;  4HNA B;  4NTX A;  4U3J A;  2ILM A;  1I94 O;  3M99 B;  4O09 A;  5FND A;  4OXS A;  3TZ4 A;  3W7S A;  1GRJ A;  2LP7 A;  3A0B Z;  2EIN C;  1ZL8 B;  2PI4 A;  1K73 W;  1ZAU A;  1YTF D;  2F4V O;  4X8A A;  4YJ3 A;  1S0V A;  4HZ5 A;  3EHH A;  3H1K H;  4YKW A;  4OGQ B;  2YKI A;  3O0I A;  2V7Q G;  1XHX A;  2GDS A;  3G7E A;  5BY1 A;  2EIN B;  1FJG O;  1JJ2 U;  3QG5 A;  3A0Z A;  1WN7 A;  4X89 A;  3ETE A;  1VQ6 V;  5L3B A;  3QVN A;  1EZV H;  1NBM G;  2OIE A;  1YT2 A;  3K79 A;  1FXK A;  2FML A;  3U67 A;  4TQD A;  3SJA C;  2HHH B;  2QWO B;  2JJ2 G;  5FNV A;  3JD2 A;  4LF7 B;  3ZM7 A;  4O4L A;  3ZMZ A;  3E2E A;  1FS0 G;  2HLD G;  3EFF K;  4X1K B;  4BIU A;  4KL1 A;  5J2U A;  1O9G A;  3A0X A;  4CS4 A;  5EYP A;  1UYH A;  2BSK A;  4PEL A;  4CC5 A;  2WI4 A;  4JI6 B;  3FAV A;  1W2B U;  3HKD B;  4DR5 O;  3M8A A;  1SQF A;  3ETD A;  4KUM A;  1V54 C;  2JS5 A;  2IH1 C;  4DUY B;  3ABM B;  5KA6 A;  1D2D A;  1YZB A;  3CJH A;  3LSQ A;  4RUE A;  2UXB B;  4GX2 A;  4R8C A;  1V55 C;  4G2K A;  4ZVI A;  3FB6 C;  2ZM6 O;  4E4E A;  2FB5 A;  3ASO B;  2JJ1 G;  2E75 B;  2X6C A;  4D7S A;  1Q82 W;  5IJ0 B;  1JCH A;  4YJ2 B;  4J41 A;  2YEI A;  4I0X A;  2VCJ A;  1GN3 A;  1N33 B;  3LDD A;  3KE6 A;  2VQE B;  2QM7 A;  4I9Q A;  5BZB A;  1AJQ A;  1JA8 A;  4UVB A;  2VRZ A;  3VHA A;  4NTW A;  3OW2 U;  2QWN B;  4IIJ B;  4UB6 Z;  3ZKD A;  4LP0 A;  4XDL A;  3CYG A;  2W6I G;  2XAB A;  2XTA A;  2Q0A A;  4DUY O;  5CTY A;  1R6N A;  1VQL V;  2EIL C;  2V4D A;  5FNC A; 
#chains in the Genus database with same CATH homology
 3R4O A;  1M9N A;  4MTX A;  4AWQ A;  2HFE C;  4QPK A;  4ZKI A;  3AG3 C;  1OCO B;  2UXX A;  1BHB A;  4FCR A;  3JZ3 A;  3QO7 A;  2BYI A;  2DYS B;  5B1B C;  2LFS A;  2Q8F A;  5CPH A;  3SYP A;  4WFG A;  4NH8 A;  5B1B B;  4CWS A;  2XHR A;  4O04 A;  1FFT B;  3LSS A;  3I56 V;  4I9W A;  1QZR A;  3E86 A;  1OCZ C;  3F5W C;  2IWU A;  2VWC A;  2YGF A;  3RBZ A;  4MVM A;  2BRC A;  1H7U A;  4W7T A;  2HJF C;  2JEU A;  4JPR A;  4HXZ A;  4R3A A;  4CBC A;  1BKN A;  1PKX A;  2Y69 C;  5DN6 G;  4QE9 A;  3OMU A;  3OWD A;  3ML0 A;  2Y69 B;  2XAQ A;  1MX0 A;  1NVP B;  3E8G A;  1Y8N A;  1CEZ A;  3ZJZ A;  5B3S C;  2IJK A;  1OCC B;  2A79 B;  4EGI A;  5LHG A;  1KKD A;  4PU9 A;  3K0D A;  1CP9 A;  5M4E A;  2Y48 A;  1Q86 W;  1M57 C;  3A0R A;  2WLK A;  2W0F C;  4XC0 A;  3LDE A;  2FWY A;  1M57 B;  1KEC A;  5IDM A;  1H38 A;  4LWF A;  5GGZ A;  1AH8 A;  2JK5 C;  4FCP A;  1B6Q A;  2P90 A;  2YE3 A;  1P7B A;  1K7D A;  4DZY A;  4WUB A;  4TWK A;  1ID0 A;  2YEV A;  4H7Q A;  5CBH A;  3MD0 A;  1YJN V;  5IDJ A;  2VW5 A;  1R3L C;  4GT1 A;  1E1R G;  1KQS U;  2FXS A;  4RAI A;  2WSS G;  1ZWH A;  3CCR V;  4JTC B;  3B28 A;  1E1Q G;  2WI2 A;  1OCR B;  4YKQ A;  4EFT A;  4K4O A;  4HZ3 A;  1RPR A;  2WLI A;  4JYC A;  2NLJ C;  3STZ C;  1I5Y A;  4KSH A;  4PA7 A;  2ZQM A;  4CWT A;  5IYB O;  3OW6 A;  2IW5 A;  4U7N A;  2XHT A;  2QE7 G;  4H33 A;  1OHH G;  4L87 A;  5B1A C;  1UYL A;  3INX A;  2CK3 G;  1F4N A;  4MTO A;  1NVP D;  3ASN B;  4PDR A;  4MVR A;  4WFA V;  5CTX A;  4EFU A;  3E89 A;  1G4Y B;  2WLL B;  4GT8 A;  3SJQ C;  2XCM A;  4FIP C;  4BXI A;  2WER A;  4YKT A;  4YKX A;  1NHH A;  2B1I A;  1AM1 A;  4FK5 C;  2X6A A;  1S3J A;  1VQO V;  1THZ A;  4KFG A;  4JQL A;  4U93 A;  3HYY A;  2H55 A;  3CC4 V;  1BMF G;  3WG7 C;  3OEE G;  1QR9 A;  3MHS C;  1AJN A;  2YE2 A;  2GQP A;  4HY6 A;  1GM7 A;  3AEI A;  2IJI A;  4MVQ A;  1K92 A;  1TC6 A;  3E8F A;  2ZDI C;  3I55 V;  1PL0 A;  4LBE C;  3K04 A;  1EZJ A;  2CH4 A;  4P30 A;  1QVF U;  3RVZ A;  1PNK A;  4UVA A;  1Y4M A;  3HPL C;  4B7P A;  1YTF B;  4WFE A;  2EZO A;  1B62 A;  4O0B A;  3RLR A;  2YEE A;  2XDU A;  1CPY A;  2B5U A;  4ASG A;  1WLE A;  1QCE A;  4L91 A;  2AHY A;  3OEH G;  2YEC A;  3VHD A;  2M7W A;  4JTD B;  5J6A A;  2BYH A;  2WI7 A;  3INW A;  3HHU A;  3SPG A;  4UV8 A;  1R73 A;  3T4D A;  1Z59 A;  2WI3 A;  3JYC A;  1S76 D;  5EBM C;  3E35 A;  1MAB G;  3VHC A;  2HVK C;  5CMU A;  3BM9 A;  1G8M A;  5IYC O;  2DYR C;  4CE2 A;  5IN9 A;  4ASA A;  2PI5 A;  4UVC A;  1UJW B;  1I5B A;  4JAU A;  1RPO A;  1M1K W;  3AG2 C;  1KC8 W;  4JAS A;  3Q5L A;  4I5S A;  4MVU A;  1UYF A;  3AG2 B;  1W0K G;  4F4L A;  2WEQ A;  3HZ1 A;  5L3J A;  2YE9 A;  1Q7Y W;  4E00 A;  1MG1 A;  1YSC A;  4KP4 A;  4WUD A;  3A0Y A;  4BW5 A;  1VQP V;  1GM8 A;  3IFX A;  4MTG A;  3FB7 C;  2IJJ A;  2R9R B;  1YSR A;  4WUC A;  2JJC A;  4MBC A;  4J9Y B;  4ZBM A;  2YJW A;  3K0G A;  2HKO A;  4MT8 A;  2IOP A;  3CXC U;  3ABK C;  2IWX A;  2XX5 A;  2P7T C;  4KTN A;  3K60 A;  2PNR A;  1MOF A;  2P6J A;  5B1N A;  1JQ0 A;  3ABK B;  1S14 A;  2X7R B;  4CWQ A;  3ABU A;  1UYI A;  1OSF A;  1YS3 A;  1S5H C;  2B1G A;  1K34 A;  1FXK C;  3RLQ A;  5EK0 A;  3LUT B;  3CCQ V;  1F4M A;  3QDD A;  2DQ3 A;  1VQ7 V;  4TT3 G;  2ZR2 A;  2H8P C;  2QM8 A;  3NMQ A;  3U2K A;  1AJP A;  3RW0 A;  4LP8 A;  2JKI A;  1DTO A;  4ASB A;  1U2O A;  2YEF A;  1V54 B;  4CE3 A;  3B8M A;  1K33 A;  2BRE A;  1YC4 A;  2WLN A;  1H7S A;  3KG2 A;  3OUF A;  3CCL V;  1SRY A;  1V55 B;  3ZN1 A;  1QLE C;  1KD1 W;  5M4M A;  3CME V;  2BSM A;  5J71 A;  1AI7 A;  3GB7 C;  3ZMS A;  5D7D A;  2XD6 A;  3EKO A;  3Q5J A;  2YE6 A;  1PD3 A;  4JYB A;  2XK2 A;  4KQV A;  1K9M W;  2EIL B;  3PEJ A;  5CF0 A;  3AG3 B;  1SER A;  1UYG A;  1BYQ A;  4RQF A;  2XDX A;  1NR1 A;  3IED A;  3CC7 V;  2WI1 A;  4BAY A;  4HYM A;  3FYE B;  3H01 A;  4P7A A;  1I5A A;  2YI7 A;  1J95 A;  1UY6 A;  3CC2 V;  4BIZ A;  3R91 A;  3E83 A;  3CCU V;  3IGA C;  1YI2 V;  3WQ9 A;  2EZP A;  3A0T A;  3EHB B;  2YE5 A;  4HYP A;  1OCZ B;  4Q20 A;  3ZN0 A;  4JTA B;  3ZRW B;  1TIL A;  3D0B A;  2YK9 A;  1Y66 A;  2YE4 A;  4O05 A;  3CGZ A;  3ABL C;  1UYC A;  1FXV A;  1KP2 A;  5E1A C;  4O07 A;  1JPX A;  1S77 D;  4DO2 A;  3E8B A;  4KSG A;  3T1K A;  2QG2 A;  2YKC A;  2Q67 A;  2BT0 A;  2IU0 A;  1R6K A;  1RM1 C;  3B8N A;  3B27 A;  4PA6 A;  4WFH A;  2XDL A;  2O1V A;  5D6Q A;  1GMG A;  4MVO A;  4MPN A;  4FPP A;  2IJH A;  1BGQ A;  2GSM B;  3LDC A;  2YEJ A;  1GKF A;  1NHJ A;  3CD6 V;  2BZ5 A;  3X2Q C;  5B3S B;  1DLB A;  4MW8 A;  4FMT A;  3C0E A;  1Z5B A;  2WEP A;  3X2Q B;  5HFM A;  3T10 A;  5DM6 V;  3PEH A;  1XL4 A;  4V25 A;  3E8H A;  3F7Y C;  4MW3 A;  5GW7 A;  4XCJ A;  1H2G A;  1VQK V;  2BU2 A;  5LGT A;  2Q2E B;  2YED A;  2EIK C;  4H85 A;  2AKP A;  1GKX A;  1QY8 A;  4URL A;  1L1F A;  1K5S A;  1M56 C;  2BU8 A;  2XJJ A;  4P2Z A;  4BQJ A;  2P67 A;  2YKB A;  1R3K C;  2HG1 A;  2ESA A;  1M56 B;  3O2F A;  5IY5 C;  2BOB C;  2ITC C;  3DGE A;  3LNU A;  4WFB V;  1NJI W;  2HG5 C;  3SYA A;  4J9Z B;  4TSF G;  2JEX A;  2IH3 C;  2WI5 A;  4MB9 A;  3ABT A;  3W7W A;  4DXW A;  4HAM A;  1YJW V;  2YI6 A;  4N23 A;  2XX4 A;  4AS9 A;  1US7 A;  3CRK A;  3ZMT A;  4XKK A;  5CTW A;  2XAH A;  1UYK A;  2XDK A;  1K4D C;  2Q6A A;  3U2D A;  2EIJ C;  5L3E A;  5C93 A;  3DTU B;  4AWP A;  5EC2 C;  5LHI A;  2HR3 A;  2XX2 A;  3K3W A;  5B1A B;  4XIR A;  1QYE A;  4E01 A;  2WLL A;  2K1E A;  5KUK A;  5FNF A;  4GX1 A;  1K5Q A;  4CZZ A;  3FV5 A;  4YXW G;  2AHZ A;  2X6B A;  2UWD A;  2EIM C;  3VAD A;  5KA5 A;  2EBO A;  2YI0 A;  4QIW F;  1VQ5 V;  1VQN V;  5F3K A;  4E02 A;  1I5D A;  4GGL A;  3B24 A;  3FT5 A;  3CCV V;  1VQM V;  2BU7 A;  3P30 A;  2ZR3 A;  2UXN A;  3G71 V;  3OUS A;  1YIJ V;  3CYO A;  3T2M A;  4HYO A;  1Y4U A;  3ZRX A;  5F5R A;  2WWW A;  3PJS K;  3CCS V;  5H6R A;  1GK9 A;  2LFR A;  2MK3 A;  1UYD A;  4PDL A;  5FL7 G;  3OR7 C;  3WG7 B;  3TUH A;  4ASU G;  2Z5U A;  1VQ4 V;  3GWO A;  2BU5 A;  5J9P C;  3K08 A;  2ZD9 A;  4JF3 A;  4XIT A;  1MSW D;  2BTZ A;  1H8E G;  2YE7 A;  2ZDI A;  5KUM A;  3D2R A;  1K8A W;  3TK1 A;  4LCU C;  1Y4S A;  1ZW9 A;  4I3H A;  4X9L A;  4YKZ A;  4LC1 A;  1F23 A;  4LWE A;  3TZ5 A;  2IWS A;  1YET A;  3AG1 C;  3SPH A;  3NXS A;  1ORQ C;  3VOU A;  2IU3 A;  3D3I A;  2OTL V;  3FYI B;  3RVY A;  4R7C A;  1TH8 A;  1GM9 A;  3ZXO A;  3UKM A;  4H81 A;  1ROP A;  3TZ0 A;  2QF6 A;  3OAA G;  4P9P A;  2FWZ A;  1AJ6 A;  5H6Q A;  2ZKJ A;  2Q8I A;  2ZXW C;  2YEG A;  1UY7 A;  2OCC C;  2KB1 A;  2XND G;  1W0J G;  1JX9 A;  3SPI A;  3CPW U;  2CG9 A;  2O1W A;  3SL2 A;  1GO3 F;  1FXH A;  4PA9 A;  3AG4 C;  2DYR B;  2F43 G;  2ZDX A;  5LHH A;  1P4R A;  4EMV A;  4XDK A;  5L3F A;  4WF9 V;  2CCT A;  3CMA V;  5D7R A;  1TC0 A;  1H8H G;  1U0Z A;  4N21 A;  4XKA A;  1K3E A;  3RKZ A;  3OMI B;  1EI1 A;  4V26 A;  3T4Z A;  2H8M A;  3JCZ A;  1Y8O A;  1YT0 A;  4QJF B;  2NNU A;  1GTO A;  5EC1 C;  5M4K A;  3QTF A;  3FT8 A;  1EFR G;  3K03 A;  3TTZ A;  5EBW C;  4DUH A;  1QBZ A;  4RO2 A;  4QPJ A;  1IXM A;  1M90 W;  3ZRV A;  3GIG B;  3ZMV A;  1JM6 A;  3G75 A;  1ARO P;  3R65 A;  1N8R W;  4XDM A;  4XE2 A;  4CWF A;  2WLH A;  1YHQ V;  4LWH A;  4X88 A;  2YKE A;  2YEA A;  4BAE A;  2X0L A;  5L3C A;  4L8Z A;  4UUJ C;  4XIP A;  1XL6 A;  1YJ9 V;  1FXK B;  2DWE C;  1YT1 A;  3W7T A;  2YSU B;  3FKS G;  4PDV A;  2WAM A;  5M4N A;  5LGU A;  5CN0 A;  1BHA A;  2ITD C;  3P32 A;  2WLJ A;  3ABM C;  1K4C C;  4URN A;  3OMN B;  3HYZ A;  1I58 A;  5FWK A;  1BL8 A;  2Q69 A;  4YKR A;  4URO A;  4YKY A;  3ASO C;  4R6Z A;  2Q8H A;  3ZKB A;  1ENV A;  1UY8 A;  1QVG U;  2GHY A;  3WHA A;  1QLE B;  4GQT A;  2HVJ C;  4R50 A;  1A4H A;  4MPE A;  4AWO A;  3QO5 A;  4L93 A;  2YI5 A;  4G28 B;  3SYC A;  2QTO A;  4LPB A;  2YGE A;  3VBB A;  1YSZ A;  1YC3 A;  1S16 A;  1GJV A;  1OCO C;  2A9H A;  1YC1 A;  1KZN A;  4R1F A;  1OZ0 A;  2DYS C;  5LBQ A;  2QG0 A;  4EEH A;  2ATK C;  1SET A;  2OT5 A;  2GFD A;  1Q81 W;  1NR7 A;  3EHJ A;  4HXW A;  4R3M A;  3OGC C;  2QKS A;  3QO8 A;  5LGN A;  3CCJ V;  2FTK A;  1AH6 A;  3TZ2 A;  3ZRW A;  2XHX A;  3H4L A;  1WPX A;  2A0L A;  4EGK A;  3TET A;  3G4S V;  1VQ9 V;  5CBG A;  4CWP A;  2XJG A;  4P9O A;  2BOC C;  3GIF A;  3ABL B;  4WCE V;  1MU5 A;  4XIQ A;  1B3Q A;  4JGS A;  1Z5A A;  4LWI A;  1DF5 A;  4GCZ A;  1K97 A;  3F7V C;  1SES A;  4XD8 A;  4GX5 A;  3B25 A;  4MVS A;  2YEH A;  2XOK G;  2YE8 A;  4BQG A;  3CRL A;  1YER A;  1RM1 B;  2YEB A;  2JDI G;  1I5C A;  2DW4 A;  3FB5 C;  5H9C A;  5B1O A;  1NQT A;  5D7C A;  1YIT V;  3MNR P;  4UV9 A;  1QR8 A;  2IOR A;  1COW G;  1OCC C;  5BOD A;  3QNE A;  4EKW A;  2EJR A;  3D36 A;  4CE1 A;  1R62 A;  2QEX V;  1UY9 A;  3JD4 A;  2OTJ V;  4FJC C;  3ZRS A;  3C11 A;  3OPD A;  4GEE A;  3SYQ A;  5EBL C;  1I59 A;  3A0W A;  3FB8 C;  3T2S A;  3STL C;  1TID A;  2EIK B;  3OE7 G;  1PVG A;  2IOQ A;  2ZDY A;  4XTJ A;  4CWO A;  2BU6 A;  4XCL A;  3B77 A;  4G27 B;  3R4M A;  2XDS A;  4GX0 A;  5IY5 B;  3K06 A;  3IC7 A;  5D6P A;  4PA4 A;  4PRX A;  4E2L A;  2YEV B;  1ZXN A;  3GIE A;  2C2A A;  3CCE V;  1EBO A;  4XBF A;  1OCR C;  4WFF A;  1Y8P A;  4HY1 A;  4H37 A;  4PRV A;  4YKU A;  3K97 A;  5L3G A;  3BMY A;  4MP7 A;  5M4P A;  3HEK A;  5CA3 A;  1Z5C A;  1JOY A;  4P8O A;  2EIJ B;  1AI4 A;  2WLI B;  3TCU A;  3EHG A;  1R3J C;  3UM7 A;  2O1U A;  3G6E V;  4QE7 A;  2DWD C;  3OWB A;  3ASN C;  1KIJ A;  2YGA A;  5L3D A;  4NH9 A;  3EKR A;  4Z1M G;  2EXL A;  2EIM B;  2XAJ A;  4PA3 A;  2WPD G;  3OR6 C;  2D3O W;  4HZ0 A;  1L0O A;  3LNM B;  2XAF A;  3BEH A;  5CTU A;  3W7X A;  2W6J G;  2H94 A;  3CP1 A;  3SPC A;  3R4N A;  3WFV A;  1NH2 B;  4MOT A;  3BY6 A;  4B6C A;  2QA4 V;  2CGF A;  4GFN A;  3R92 A;  1VQ8 V;  3ZXQ A;  2XJX A;  3B26 A;  1F51 A;  4MVZ A;  2WI6 A;  2K5B A;  2JIZ G;  1B63 A;  1KP3 A;  3T0H A;  1AR1 B;  3JD0 A;  4XDJ A;  3OM3 B;  1AMW A;  4MPC A;  4L90 A;  3LPS A;  1YES A;  2VCI A;  1ZWI C;  2DQ0 A;  4KFM A;  3T0Z A;  1AI5 A;  3JD3 A;  3K98 A;  3MHH C;  4URM A;  1EA6 A;  1THN A;  4RUF A;  2YK2 A;  3CWV A;  2HCH A;  4MP2 A;  4NH7 A;  3G7B A;  3CGY A;  5M4H A;  2HKJ A;  3OMA B;  2CCS A;  3EHF A;  3OFN G;  3AG1 B;  3HZ5 A;  1NHI A;  4MSW C;  1GKZ A;  1ZXM A;  1UYE A;  1LNQ A;  1AI6 A;  3H80 A;  1I5X A;  1PNM A;  5CBF A;  3K99 A;  2R9I A;  2XAS A;  4QNH B;  1DF4 A;  2YJX A;  1R3I C;  4UXN A;  3SYO A;  3CCM V;  1PNL A;  1UYM A;  1TBW A;  2WLM A;  1HWY A;  3ZIA G;  2Q68 A;  2ZXW B;  1E79 G;  1BXD A;  2OCC B;  4LWG A;  4XKO A;  2YKJ A;  3R4P A;  5HFL A;  4MTF A;  4EGH A;  2CCU A;  4PL9 A;  2XAG A;  3AG4 B;  2Q8G A;  4MS2 A;  4EM7 A;  3Q5K A;  3ZMU A;  2Z3Y A;  4L94 A;  1JVM A;  4CWR A;  1NH2 D;  3O6O A;  3T1C A;  4U7O A;  3JD1 A;  4ASF A;  4RQE A;  3SPJ A;  5BOC A;  2ZBK B;  3ZCC A;  2V1D A;  4JAV A;  3RLP A;  4CWN A;  1TUE B;  2QFO A;  3ETG A;  1SZT A;  2FYP A;  4PDM A;  3K9A A;  3HB3 B;  2E0A A;  1QLN A;  3W7U A;  5IYD O;  1S72 V;  4FCQ A;  1NKD A;  3GIG A;  3M99 B;  4O09 A;  5FND A;  4OXS A;  3TZ4 A;  3W7S A;  2LP7 A;  2EIN C;  2PI4 A;  1K73 W;  1YTF D;  4X8A A;  1S0V A;  4HZ5 A;  3EHH A;  4YKW A;  2YKI A;  3O0I A;  2V7Q G;  3G7E A;  2EIN B;  1JJ2 U;  3A0Z A;  4X89 A;  3ETE A;  1VQ6 V;  5L3B A;  1NBM G;  1YT2 A;  3K79 A;  1FXK A;  3U67 A;  2JJ2 G;  3JD2 A;  3ZM7 A;  3ZMZ A;  3E2E A;  1FS0 G;  2HLD G;  3EFF K;  4BIU A;  3A0X A;  1UYH A;  4PEL A;  2WI4 A;  1W2B U;  3ETD A;  4KUM A;  1V54 C;  2IH1 C;  3ABM B;  5KA6 A;  3LSQ A;  4RUE A;  4GX2 A;  4R8C A;  1V55 C;  4G2K A;  4ZVI A;  3FB6 C;  3ASO B;  2JJ1 G;  2X6C A;  1Q82 W;  1JCH A;  2YEI A;  2VCJ A;  3LDD A;  3KE6 A;  2QM7 A;  5BZB A;  1AJQ A;  4UVB A;  3VHA A;  3OW2 U;  3ZKD A;  4LP0 A;  4XDL A;  2W6I G;  2XAB A;  5CTY A;  1R6N A;  1VQL V;  2EIL C;  5FNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...