4JAUA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
232
Chain Sequence
b'SKELERLKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
molecule tags Transferase
source organism Thermotoga maritima
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
total genus 76
structure length 232
sequence length 241
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jauA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jauA02
3CWVA 1UYCA 2YE4A 4GT8A 2CH4A 3K99A 3R92A 4AS9A 3C11A 4EFUA 1H7SA 1UY9A 3C0EA 3VHDA 3VHAA 2YEAA 1QY8A 2XX5A 2YE8A 3Q5KA 1BYQA 3CRKA 5D7DA 4EM7A 2VWCA 2XCMA 2YJXA 5BODA 2QM7A 2XJGA 1I5CA 4ASFA 2XDXA 1TIDA 3NMQA 2FWZA 4MBCA 4O0BA 1Y4UA 4XKKA 4LWEA 2WERA 3R4PA 3T0ZA 4HXWA 5F5RA 3OPDA 1TILA 4E01A 5FWKA 2JJCA 1F51A 2YECA 4P7AA 2YGEA 3R91A 3B27A 5M4MA 4I5SA 2YE5A 2BT0A 1TBWA 2BTZA 2QG2A 5CTUA 3A0YA 5CTWA 1NHIA 3D2RA 4H85A 1OSFA 4EGIA 4BIZA 2CCUA 3R4NA 4YKYA 2Q8FA 2YGAA 2YEIA 3FT5A 4CWSA 1L0OA 4CE2A 2FTKA 2ZKJA 4R3MA 2ZBKB 1Y8PA 2Q8HA 4BXIA 2H8MA 2YEDA 1KZNA 3VADA 4HYMA 2IORA 4MP7A 2BYIA 2WI2A 2WI5A 3JZ3A 4H7QA 1THNA 4O09A 2JKIA 1GKZA 1YT1A 5CTYA 2YEHA 1EA6A 1UY6A 4EMVA 2CCSA 1ID0A 4PRXA 3U67A 4EEHA 1US7A 4MB9A 2YE9A 4L91A 1I5DA 2XK2A 4LWGA 4LWFA 2BU2A 3RLRA 1GJVA 4UROA 4PU9A 2XABA 2IWXA 1UYDA 1UY8A 2YE6A 4H81A 3ZKBA 4KP4A 4FCPA 4MPEA 4O05A 3A0XA 1ZWHA 3O6OA 4ZVIA 3T10A 4LPBA 2YGFA 4HZ5A 2WWWA 2P67A 2YJWA 4YKZA 3MD0A 3GIFA 2YE7A 4E00A 1UYGA 3ZRWA 4JQLA 4W7TA 4ASGA 2C2AA 1S14A 3B25A 2GFDA 5M4KA 4YKUA 4EGHA 1YERA 4GFNA 2QM8A 2IOQA 1Z5AA 4XITA 5M4NA 2YI0A 3A0WA 2LFSA 2WI6A 3U2DA 2YI6A 1AH8A 2YI7A 3ZKDA 4NH7A 4CWFA 3D0BA 3SL2A 4GQTA 4NH9A 1YESA 4DZYA 3B26A 1NHJA 4WUBA 4WUDA 1AM1A 4YKXA 1Z5BA 2FXSA 2CCTA 1YT0A 4KSGA 3EHJA 3FV5A 4GGLA 4PRVA 4JYBA 2QG0A 4L8ZA 4I3HA 3ZCCA 4CWRA 5D6QA 3Q5LA 4XD8A 2QF6A 3ZM7A 3HYYA 4JAUA 4ASAA 1EI1A 2XD6A 3FT8A 4FCQA 4XIQA 4L94A 1YSRA 3LNUA 3INXA 4CE1A 4BQGA 2K5BA 4AWOA 4XIPA 1Z59A 2BU8A 2YKCA 2YEBA 4YKTA 3HEKA 4AWPA 2XHXA 2Q2EB 3WQ9A 4FMTA 3T0HA 2YKBA 2O1WA 4FCRA 3RLPA 1UYLA 2WI4A 2XJJA 2WI1A 1UYFA 1I59A 4V25A 4MPNA 4MPCA 4HYPA 5IDMA 1Y8OA 1YC1A 3O0IA 2UWDA 2WI3A 2Q8GA 3GIGA 2XX4A 5B1OA 2WEPA 5C93A 4B6CA 4JASA 2VCJA 3B28A 4XKOA 5FNCA 4LP0A 2BYHA 5D6PA 1S16A 4KTNA 2BREA 1BKNA 2YEEA 1JOYA 2ESAA 4GCZA 2YI5A 2YKJA 4P8OA 1I5AA 4R1FA 1UYEA 1Y4SA 5J6AA 2Q8IA 3WHAA 2YEJA 2ZDYA 1UYMA 3QDDA 3G75A 4KSHA 4EGKA 3OWDA 1YS3A 5FNFA 1UYHA 5FNDA 4CE3A 2FWYA 5CF0A 1YC4A 3H80A 3PEJA 3INWA 3GIEA 4KQVA 3HYZA 3A0TA 4CWQA 1U0ZA 3OW6A 4LWHA 3G7BA 1YC3A 3D36A 1ZXMA 3EHFA 4MOTA 2BU7A 2E0AA 1B63A 3ZXQA 1ZW9A 2BRCA 4XCLA 2YK9A 4BIUA 4LWIA 3O2FA 1GKXA 4GEEA 1YETA 3EHGA 1PVGA 5BOCA 3BMYA 5J71A 3KE6A 4JYCA 3P32A 3OWBA 2WEQA 4MTXA 4U7OA 2GQPA 4E02A 4QPJA 3HZ1A 2CGFA 2VCIA 2XDLA 2YE2A 3BM9A 4QPKA 5L3JA 1A4HA 1UYKA 5F3KA 4GT1A 2XDUA 2BU5A 4HZ0A 4R3AA 1IXMA 4YKWA 2HG1A 2XHRA 3G7EA 4U7NA 3ZRWB 4HY6A 3DGEA 4K4OA 3EKOA 1AMWA 4L93A 3R4OA 2BZ5A 2XDSA 3LPSA 3K98A 2YKEA 1R62A 4WUCA 3TZ2A 3A0ZA 2WI7A 5CPHA 1MX0A 2BU6A 2FYPA 4HXZA 4O04A 5M4PA 2AKPA 2YEGA 1QZRA 4L90A 2XDKA 5D7RA 3HHUA 2IOPA 4LC1A 4CWTA 4MT8A 4X9LA 3CRLA 2O1VA 4ASBA 4KFGA 2XX2A 3OMUA 3EHHA 1B62A 5CTXA 5B1NA 5D7CA 3EKRA 3Q5JA 1U2OA 4ZKIA 4XTJA 1I58A 3PEHA 5IDJA 4BQJA 1TC6A 3ZRVA 4XIRA 2VW5A 4XDMA 3RLQA 3ZRXA 1Z5CA 2IWUA 2PNRA 3B24A 3TZ0A 4JAVA 4MP2A 3ZXOA 1H7UA 4URNA 4CWOA 4DUHA 4URMA 3TZ5A 3H4LA 1ZXNA 2ZDXA 3T2SA 5M4HA 2LFRA 1KIJA 4NH8A 2YEFA 2CG9A 4B7PA 4XKAA 3A0RA 1UY7A 3TK1A 1TC0A 2BSMA 2QFOA 3TUHA 4YKRA 3RKZA 4XC0A 1JM6A 5IN9A 2H55A 4Q20A 3K60A 3R4MA 4YKQA 3U2KA 3GIGB 2XHTA 2YKIA 4O07A 1MU5A 2O1UA 3TTZA 4BAEA 1BGQA 4HY1A 4URLA 1UYIA 1YSZA 1AJ6A 1YT2A 2YE3A 5GGZA 2XJXA 1Y8NA 4U93A 3CGYA 4CWPA 4FPPA 3HZ5A 3MNRP 3TZ4A 2HCHA 3IEDA 1AH6A 4AWQA 1TH8A 1BXDA 2IWSA 3VHCA 4EFTA 1NHHA 3K97A 4CWNA 2HKJA 3QTFA 4XE2A 2YK2A 5M4EA 3T1KA 1I5BA 4PL9A 3NXSA 1QYEA 2EXLA 4XCJA 3CGZA 1B3QA 4V26A
chains in the Genus database with same CATH superfamily
1Q3EA 5E79Z 4CS2A 5LBQA 1Y67A 3C11A 4PDMA 2XOKG 1UY9A 1VQMV 4X62O 2YEAA 4DV1O 1QY8A 2AZ2A 2KG7A 3H1HH 1M90W 3Q5KA 1PL4A 2VWCA 2YJXA 4FZ1A 3JAKA 3A0BZ 5EBMC 3BHPA 2N05A 2E3CA 2RJZA 3RYCB 3G6EV 5E1AC 4JTAB 1IVSA 2NR5A 5LA6B 3L71H 3NMQA 2ADPA 5IWAB 1QLEB 2X7RB 2QA4V 5LMUB 4DR6B 1Y4UA 4MBCA 2WLIA 2JIZG 2WERA 5F2VO 1WNSA 4HXWA 3T4ZA 3GB7C 3JARB 2Z3YA 4FVMA 3K03A 1NT2B 3QF7A 3OAAG 3AK2A 4DR5B 3B27A 4JI2O 3W7SA 2YE5A 3FB7C 3H1IH 1M93A 4J41A 3VQVA 2OYQA 3DC6A 4H85A 2Y4UA 1XL4A 4OX9B 1Y74B 3ZX6A 1K73W 2A3QA 1YTFD 2GBOA 4CE2A 2VWJA 2FTKA 3GWKC 3JAKB 4DRXB 3WFVA 2QEXV 2H8MA 3APQA 2IORA 1THNA 1MZEA 1IBMO 1Y6XA 4O09A 2AGAA 4XDKA 2B9ZA 3JAWA 2BSKB 1UY6A 4EMVA 4IIJA 2EULA 3ML0A 1R73A 2IU0A 1SERA 4PRXA 1W59A 4EFEA 2CTWA 2R9AA 5L3EA 1US7A 4MB9A 2NN4A 2YE9A 2XK2A 4X9QA 1JJOA 3BA8A 3TXSA 2HR3A 1GJVA 4DV3B 1URFA 1B06A 4X8AA 3H01A 1TVKA 2YE6A 4JAAA 4KP4A 3SYQA 2AZ0A 2UU9O 4LPBA 3RYIA 1IDSA 2QWNB 4IYHA 2P67A 1OCZB 4MVRA 2YJWA 4YKZA 3GIFA 2YE7A 1M9NA 1NVPB 1EN5A 4BIOA 1XMOB 2XHBA 2Q9LA 4KHPB 4EB6B 3K58A 1YIJV 3IGAC 1R3KC 3D8CA 4KXRA 5DM6V 2VRZA 1MMMA 1Z5AA 5M4NA 3FKSG 4FFBA 1US6A 2WI6A 1AJPA 2P4KA 2XASA 3U2DA 1M4UA 2KKWA 4RWUA 4NH7A 4CWFA 2MK3A 4UCRA 1PNKA 3LMMA 1YESA 4DZYA 4WUDA 3BY6A 4YKXA 4R6ZA 4YJ2A 4JI8B 1BT8A 1KP2A 5KUMA 1SQPH 5BMVB 1S5HC 2H3OA 1FD9A 4KSGA 4DRXA 1WA8B 4GGLA 1K9MW 4DR4O 4XD8A 4Q6GA 3ZHQA 4LBEC 2EIMC 3C3SA 4L94A 2PY5A 5B1BB 5LOVB 2PGGA 1KD1W 2K1EA 1R6KA 1VQ5V 3INXA 4AWOA 4ASUG 1Z59A 1R6NA 2YKCA 5B1AB 1A32A 1SQBH 4G28B 3CRRA 5K1PA 2XAGA 5KHHA 3HEKA 3EXAA 4AWPA 1AR5A 4YHHO 3WQ9A 4JTDB 1KKDA 3SPJA 1NS1A 4FCRA 2JGDB 1W0KG 3E89A 2ZCEA 4DO2A 4H37A 3K0DA 3QO8A 4B7KA 1WLEA 4MPNA 3F5TA 4B3RB 5IDMA 1Y8OA 3O0IA 1MOFA 2WI3A 3IFXA 4DXWA 5B1OA 3ZMZA 4P2ZA 4JI3O 3ZRSA 1F23A 2ZE5A 1AR4A 1IBKO 2CDYA 3SJCC 2FMLA 3UCSC 3CX5F 2YXLA 4KTNA 2BREA 1BKNA 5C8YB 2YEEA 5CBGA 4DV7B 2WA4A 2JJ1G 2R9RB 3M8AA 4MVQA 3WHAA 4B3TB 2ZDYA 2UXBO 3G75A 1TUBA 2QR4A 5JVDB 3BVOA 1XMQB 5FNDA 3LNNA 3T1HB 2HVKC 2FWYA 5CF0A 1YC4A 1V55C 3IAYA 1I0HA 2FKXA 1OCOB 3K3WA 2LJ2A 4K8ZA 3GIEA 3K5LA 4JGSA 3INWA 1X4TA 4JI2B 1K5QA 2QSAA 4CWQA 1SRYA 1WJZA 5C8YA 4NB5A 1YC3A 3JD0A 3G67A 3CRQA 1V54C 2UUCO 4FFBB 1NKDA 5BXZA 1W2BU 1FJGO 3ZXQA 4DUYO 1ZW9A 5JQGA 1S0VA 3CCSV 4K3AA 1M57C 3SJAC 4DYLA 1XI1A 2YK9A 4XCLA 3HKCB 5KAFZ 5KHIA 3E35A 5BOCA 1P49A 4JYCA 3OWBA 4MTXA 2GQPA 3ABKB 2N04A 4U3JB 5FLXN 4E02A 2OCHA 3JALB 1SA0A 3ASNC 1YJNV 2OIEA 3WG7B 2VCIA 4MVZA 5IE9A 4DV3O 1E1QG 2XDLA 3ASOB 2YE2A 4UCVA 1VF6A 4QPKA 1XUQA 5L3JA 1Q6UA 4OXSA 1OCCB 1KECA 3RYFA 5J2UA 2XDUA 4MVMA 2ZKOA 2BU5A 4HZ0A 5EC1C 4HY6A 3ZRWB 4X66O 5J2TB 4CBCA 3K04A 4DV2O 1H8EG 4DV6B 3R4OA 1COWG 2K9PA 4QGPA 2E75B 4BW5A 3LPSA 4J9YB 1R62A 4LFAB 2EJ7A 2GDSA 2XNDG 2WI7A 1PD3A 2ZE8A 1N33O 2YIDA 2AKPA 5LGTA 4TV9B 2XDKA 3HHUA 1K5SA 4GX0A 2Q0OC 4MT8A 4OPHA 5KMGB 2O1VA 1PKXA 1V54B 3EFFK 1K3EA 4DV5B 4DR1O 3E8HA 1PL0A 2XX2A 3E8BA 4ZI7B 3LDDA 4MVOA 3K5MA 4J80A 4MTGA 2F4VB 1OCOC 4R8CA 1V55B 5IJ9A 3JALA 4HAMA 1FS0G 5LHGA 1ENVA 4QJFB 3ZRVA 2QWRB 4E72A 1BL8A 2JDIG 4I9WA 1GKFA 4XDMA 4PJ0Z 2RMKB 4I55B 3RLQA 4UVCA 3ZMVA 2DE0X 3TZ0A 3BFRA 1HNWB 3F5WC 2UUBB 4TQFA 4CWOA 4W4KA 5J2TA 1ZL8A 4YIOA 2MW2B 1AI4A 1GH6A 2QWOB 4DK1A 3RWRD 2F23A 2YEFA 1XNQB 2HVJC 4LNUA 2CG9A 2IH3C 4YIPA 4UFZA 1TC0A 2QFOA 1IBLB 2FYUH 2PUSA 4YKRA 5H5NA 3DXRB 2H55A 2EILB 3K60A 3U2KA 3HKDB 4YKQA 4MS2A 5KMGA 3T1HO 2VQFO 5CA1B 1MU5A 4O07A 4D7SA 4TUYB 4BAEA 4B3RO 1SKVA 4MSWC 4URLA 2AHYA 4K35A 4GZRB 4FFKA 5EZYB 2XJXA 1Y66A 2PYLA 3NR7A 1Q86W 3H1JH 3SPIA 3TZ4A 1FXKC 2HCHA 3IEDA 2XUMA 5JENA 1WPBA 1NHHA 4P9PA 4YJ3A 1DGSA 2YIBA 1BHAA 3A0HZ 5KA6A 1SS3A 1Q6IA 3SPCA 4NYKA 3TCUA 5M4EA 1I5BA 1Q7YW 3CWBH 4PL9A 2WLLA 1GN4A 1QR8A 4XCJA 3VQYA 3L72H 4AQYO 3B8NA 3ZHTA 1JFFB 4MW8A 3Q4HB 1UYCA 2ITDC 4B7EA 4GT8A 4P9OA 3R92A 1RPOA 3SYPA 2W6IG 3C0EA 1KU9A 5BR8B 3VHAA 1I5YA 2ZXWB 1G6UA 1Q8IA 1H2NA 2YE8A 4JI6O 1BYQA 2BTOA 3CRKA 3B8MA 5B3SB 2RCVA 2XCMA 3OGCC 5BODA 4DUYB 3HR0A 2YIBD 4O4LB 1YXBA 4ASFA 4UVBA 4FLWA 1FFXA 4X62B 2Q7HA 1OZ0A 4ZI7A 2FWZA 1GO3F 2KQXA 1CXZB 2ZT9B 3JAWB 4XKKA 4J11A 3D36C 1J95A 4LNUB 1Z5VA 3T0ZA 1BZKA 1Y74A 3E8FA 1VQ9V 3L9DA 4TOIA 2UXCO 4LWSA 4LF6O 1M56B 3T2MA 4I50B 1F51A 5IY5C 4LF5O 1BSMA 3ETEA 3WB1A 3R91A 2DMXA 2Y48A 1KYOF 1TBWA 5FNVA 1YCIA 2ATKC 4TUYA 4H33A 2YI9A 5CTWA 1NHIA 1NZ6A 2CCUA 3BRCA 3W7XA 4YKYA 2Q8FA 4UV9A 3OM3B 4CH6A 1NQTA 2WA3A 4A5UB 2CTQA 3T1YO 2L35A 2Y69C 3SYOA 1EN6A 2IBZH 2JS3A 3HKBB 3ETGA 5KUKA 2R9IA 4DW1A 2DYSC 2VQEO 4JYYA 1SC5B 2Q8HA 1AI7A 2JK5C 4UCTA 3VADA 4X64O 4P30A 2WI2A 2WI5A 4N23A 1GK9A 4JPRA 2DWEC 1K97A 1YHQV 2O57A 4I0XB 2EIJB 1EA6A 1JX9A 1Y4MA 3Q4HA 3OD4A 4YHHB 2CCSA 2XAQA 3QTCA 4L87A 1WB7A 1H2MA 3K08A 1FJGB 2QM4A 2P4VA 4LWFA 3IJ4A 2BOCC 1G8MA 4PU9A 1FXHA 3ZHVA 4AHCA 1TUEB 1UPGA 3SYCA 4H81A 4X1YB 4MPEA 3T10A 3FAVB 3N2KB 4LCUC 4G2KA 5KHKA 4ZOLB 4GKKB 3MHHC 1L1FA 4E00A 4FLXA 4W7TA 1QLEC 4FM0A 4GX5A 3HKEA 4R50A 1GRJA 4GFNA 2JS5A 2X6BA 2QM8A 2V4DA 2CK3G 2IOQA 1NR1A 4LF7B 4B08A 2QJ1A 4ICGA 4JI8O 3ZBHA 2CTPA 3BAAA 2YI6A 3G6BA 2W0XA 1ZLZA 2YI7A 5EBWC 1YITV 3SL2A 3W7UA 4NH9A 2WLJA 4YY3B 1BQ0A 4WUBA 1AM1A 1R6TA 1WAZA 2UXCB 1VF6C 3LSQA 2DW4A 3CYOA 5L3CA 4JYBA 2QG0A 3BEHA 2FB5A 4JI7B 5HFLA 2QF6A 2DWDC 5JCOA 2XD6A 3JYCA 4LF9O 1YSRA 1KMIZ 3RYCA 5KAIZ 2ZD9A 5JH7B 1THZA 3UO2A 4BQGA 4NXNO 4CE1A 4X88A 2B1IA 3RYHA 4XIPA 2BU8A 2FL4A 2Q68A 3P3NA 3I55V 1W0JG 4ZIBA 4DV0B 2XHXA 2LW7A 4DV4B 3ZN0A 1H2SB 1SZTA 2QTOA 5IWAO 1UYLA 3RLPA 1QR9A 5FPRA 4UUJC 4WBNB 5CBHA 1YTFB 4YJ2B 2HHHB 1I59A 4W4LA 5L3GA 1NTMH 1FKAO 5LMNB 4MPCA 1XNQO 3S3WA 2AW9A 2UWDA 1JQ0A 2Q8GA 4MVUA 3RYIB 1XHXA 5JVDA 3CYGA 4JASA 4YY3O 2AHZA 4CS4A 3B28A 5H6QA 4XKOA 4RAIA 5EYPA 2ARHA 1G4YB 1F7YA 1JOYA 2ESAA 2ADQB 4J42A 2YI5A 1TVKB 4P8OA 2PTMA 1UYEA 3ETQA 2X6CA 2IW5A 1JPXA 1UYMA 3RYFB 3OWDA 3X2QB 1UYHA 4PA7A 1NBMG 2OT5A 1XILA 4CE3A 3K06A 2Y0PA 4B3MB 4IIJB 3SDLA 4DV4O 1OCCC 4LWHA 4JYAO 3EHBB 1YJ9V 1AVMA 2YSUB 4O4IB 2ZIMA 2ZIOA 3B4SA 3ASOC 2P5OA 3CC4V 2HEPA 3ASNB 2HJFC 1MNGA 3OEHG 1B63A 1XREA 1X59A 3ABKC 4D7TA 2JGUA 3JSNA 4FLTA 2PI5A 3JD1A 3L70H 3JD4A 1GAXA 1SF9A 4GEEA 3UM7A 3EHGA 2H8PC 4JI6B 2UUAB 3STLC 3LDCA 1N36B 4QPJA 5CA0B 1VQNV 3JD2A 2CGFA 1O9HA 3E86A 1UYKA 4GT1A 5AG2A 3OGIB 2CGNA 3K9SA 5LHHA 5LA6A 2XAFA 1SZXA 2GTAA 1QHTA 4LF6B 4L93A 4NTXA 3OUSA 4FJCC 2BZ5A 1FXKA 2HJDA 3JSLA 4O04A 4TQDA 4WCEV 4JV5B 1AROP 4GYCB 4X65O 3OTOO 4X66B 1QZRA 2YICA 3LUTB 2IOPA 4LC1A 1SQGA 1VQPV 2HHIA 3DXRA 5B66Z 4XDLA 3CRLA 4AI8A 4Z2WA 4DV7O 4FLYA 1S72V 4KFGA 1Q5OA 2A06H 3AG7A 1Q90D 2CE4A 2QKCA 1B62A 5CTXA 3AG3C 3GVMA 4TT3G 3Q5JA 2UUBO 1U2OA 1PM9A 4ZKIA 1AR1B 3VOUA 3N2GA 2Q7EA 4XTJA 2WAMA 5IJ0B 1YEWA 1G1XB 4BQJA 3CP1A 3IC9A 1TC6A 3ZS8C 2QWQB 2YI8A 1VARA 1I7FA 1Z5CA 2IWUA 2PNRA 2R72A 2Q67A 4IT5A 5LOVA 2F4VO 4HBNA 3JASA 4URNA 3ZJZA 4JI4B 5B1AC 5LXTB 5LYJA 1ZXNA 2EIJC 4O4HB 5B1BC 5JJJB 2HFEC 3SR2C 1JFFA 2LGQA 4PA4A 1L0NH 2D2CB 2JEUA 2Y4TA 4NH8A 5GTHZ 3A0RA 1UY7A 4PDLA 3CMAV 1KUQA 3TUHA 1RM1B 5IN9A 1K33A 3R4MA 3K0GA 4NVPA 1R3JC 2XHTA 1XOUA 1IBKB 1N0JA 2ZNIA 3CCQV 5KHJA 2V1DA 5LYJB 1DK1A 1D2DA 1YSZA 3B2EE 3H1LH 2YE3A 4UB6Z 4TWKA 4EEQA 4RUEA 3HKCA 1AP5A 1Y8NA 4N21A 3CGYA 4FPPA 3ZHRA 3AG4B 3MNRP 4JI0O 1MZFA 1YZBA 1TH8A 3H1KH 3OR7C 1BXDA 2IJKA 3CMEV 1KB9F 2LP7A 1YVWA 4X64B 3QTFA 1M56C 2P90A 3B77A 1AB3A 3T1KA 3JD3A 3M99B 3ICXA 1WP8A 3FYEB 2EXLA 1OCZC 3OR6C 4DR2B 1GN2A 1QCEA 4DV5O 1B3QA 4DR1B 4RUFA 4PDRA 2YE4A 3D3QA 2CH4A 3K99A 4AS9A 4F6RA 2BTQA 1H7SA 1S3JA 3HPLC 2YXHA 5EZYA 4R7CA 4DR3O 1BE3H 4J9ZB 1KQSU 2XX5A 3S5TA 3OE7G 4LWSB 4TV9A 4JI3B 4NXMO 4I55A 2OCCC 1PV0A 3LSUA 4BWAA 4JI1B 2QM7A 1SQFA 3CCMV 1I5CA 4PD4F 1HNWO 4JV5O 4O2AA 2P06A 5CA0A 1VQ8V 1KKCA 1GN6A 2HLDG 2P22C 2UUAO 3BABA 3TXQA 2RDCA 1RM1C 1TILA 1XMQO 4FIPC 4E01A 4P7AA 5EIBC 2LQTA 1SA0B 2BT0A 4WFEA 4FM1A 3JASB 2QG2A 2GSMB 2Q69A 2UXBB 1FXKB 3D2RA 1BQZA 1OSFA 4EGIA 4BIZA 2EIKB 2WLHA 1UJWB 1Q81W 4X1IB 4ZHQA 1CPYA 2PYJA 2EJRA 5IYCO 2YEIA 3FT5A 4CWSA 4E4EA 4JI4O 1N8RW 1L0OA 3HKEB 3L74H 1B6QA 3C3TA 4TV8A 4BXIA 4KUMA 4PA9A 4CC5A 2GUZA 1NTZH 3F7YC 5JWPA 1T5EA 4MP7A 5LGUA 5CA1A 2BYIA 3JZ3A 3F7VC 1B04A 4BR6A 1HR0B 1GKZA 4X1YA 1YT1A 1H8HG 2YEHA 3AG1C 1BGYH 3FB6C 4B3SB 1IURA 1HP8A 3CS5A 1QQCA 4AQYB 5GONA 4PI2A 4JI0B 4GX2A 1XQ8A 1I5XA 4CZZA 2Q0AA 4L91A 3CXCU 2IU3A 2BU2A 3RLRA 2PZSA 4UROA 5J2UB 2XABA 2IWXA 1SQQH 4AILC 1UYDA 4ZBMA 1I94B 3AK1A 3HKDA 1PNLA 3CCVV 1QVGU 4L8JA 2H94A 3K5NA 1R3LC 4DR4B 4FCPA 5L3BA 3A0XA 1ZWHA 1J5EO 1QBZA 3S3XA 1RFYA 2B1GA 4OX9O 4TSFG 2WWWA 5CB4A 5KA5A 2XTAA 3WB0A 1UYGA 1TAEA 4JQLA 2VWKA 2C2AA 2HG5C 4HYOA 2GFDA 5M4KA 1MSWD 3HB3B 1IXBA 1OV9A 3THOA 5JJEB 2N74A 4IHJA 2V7QG 4I7ZB 1P84F 4UXNA 2LFSA 4UCSA 1AH8A 4B3MO 1HNXO 3ZKDA 4Z1VA 2ZINA 2E5LB 2WLLB 3D0BA 1HWYA 4GQTA 3B26A 3RYHB 1NHJA 1PNMA 1S5JA 1PP9H 3SPGA 1GTOA 2EZOA 5ITZA 3ABMB 2FXSA 4NTYA 1YT0A 2CCTA 3EHJA 1CEZA 3WG7C 4PRVA 1V9PA 4L8ZA 3ZCCA 4CWRA 1EM1A 3G71V 4F6EA 3ZEDA 3CCEV 4JAUA 1KP3A 3FT8A 4XIQA 2E74B 4IL6Z 4DR5O 3CB2A 3UQ8A 5LHIA 1XNRB 1M57B 4YKTA 4F4LA 5ITZB 4LFCO 4UVAA 1VQ7V 1U96A 3J81N 2Q73A 3RBZA 2YKBA 3QO7A 1VQ4V 4NTWA 3OFNG 1Y76A 5GW7A 2WI4A 4O4IA 4TV8B 4NXNB 1UYFA 4PV1B 1VEWA 4EFBA 2QKSA 4V25A 5BMVA 2CAZC 3OTFA 3UT5A 4HYPA 3JCZA 1BCCH 3FAVA 3N2KA 1Z5WA 4XDJA 1HR0O 1O9GA 3CXHF 2WLKA 4B6CA 2ZNJA 5IYBO 2WPDG 1RSOB 3TETA 4GKKO 1K7DA 4YJ3B 4FLVA 4LP0A 5JCOC 2BYHA 3ZHUA 5D6PA 2PF4E 5H9CA 3APOA 3T1YB 1I5AA 2DQ0A 3PN1A 1Y4SA 3CCRV 2Q8IA 4DR6O 2LO1A 2YIAA 4EGKA 1YS3A 2ITCC 1ZTEA 2IJIA 4UV8A 4LFCB 4PELA 3PEJA 2QE7G 1HDJA 3HYZA 2CUGA 3ABLB 3E2EA 1N34O 1U0ZA 3OW6A 1DTOA 3G7BA 4LH7A 5KX5B 3ZHSA 2QDOA 3CCLV 3ABUA 1FPOA 3D36A 3EHFA 4MOTA 1QNMA 2BU7A 2E0AA 3FB8C 2KG7B 3R65A 3SGIA 2BRCA 1K34A 4FZ0A 5LP6B 3OEEG 4DR3B 4JYAB 3QNEA 2DYRB 3O2FA 1YETA 1RSOA 1PVGA 4X20A 5J71A 1TUBB 2BSKA 2GV9A 3P32A 1EBOA 3KCYA 1Q43A 4U7OA 4BAYA 3JCUZ 3K57A 2A9HA 3N27A 1TA8A 3VQXA 1I08A 1VQLV 2E5LO 2XAHA 5FNVB 1ZAUA 1IZ3A 3MHSC 4O4LA 4C7UA 1A4HA 5F3KA 3CPWU 1SESA 2JRIA 4GLXA 3G4SV 1SQXH 1IXMA 2VQEB 2OTJV 3BA9A 4QE7A 3BPZA 1FAFA 2XHRA 3G7EA 4U7NA 2ZM6O 3DGEA 3J7AU 1E79G 1AMWA 5A2QN 1N4CA 3FB5C 2XDSA 2YKEA 4WUCA 5GTIZ 3TZ2A 3A0ZA 1K4DC 4JZ2A 1MX0A 2FYPA 5L3DA 4HXZA 3P3PA 1BS3A 2UUCB 2YEGA 4U3FH 2ILMA 5D7RA 4CWTA 3TGUH 2YEVB 1L8DA 3TJTA 3B09A 1HW7A 1N0NA 2ETNA 4ASBA 3ABLC 3FX7A 2ODMA 3RGBA 3QVNA 5LXTA 3KCXA 3WU2Z 2DYSB 1AJQA 1D5NA 2NNUA 3PEHA 3OUFA 5IDJA 4E2LA 5LL6Y 2Y69B 3C90A 4GUNA 3T1CA 4XIRA 2VW5A 1VF7A 3ETDA 1ZSPA 2YEVA 3CRAA 3ZRXA 2JGDA 2A0LA 4JAVA 3U11A 4NR1A 1HNXB 2Q6AA 4MP2A 3ZXOA 1NU1H 2YDEA 2ZM6B 4KL1A 2BOBC 5LMUO 4URMA 5JJNB 2ZDXA 4RO2A 3T2SA 1KIJA 2WLIB 5KHGA 5LMNO 1S5LZ 4MTFA 2QWPB 5IY5B 4B7PA 3E22B 4G27B 1XL6A 2IJJA 4CH3A 3CJHA 2CGOA 2BSMA 4PHZA 4XC0A 1JMKC 4XBFA 5DN6G 2OWOA 4CH5A 3FD9A 2YKIA 2Q7GA 5B5EZ 4WFFA 2O1UA 2GTSA 5IYZA 1BGQA 4HY1A 1N34B 1XNRO 3VBBA 1OCRB 5LP6A 2JVDA 2ZQMA 2GHYA 4U93A 2EINB 5CA3A 4CWPA 1BMFG 4X20B 4I4TA 1JJ2U 3HZ5A 5B3SC 5CBFA 4GKJB 1DF5A 2QTSA 2ZXWC 3K79A 3K97A 4LFBO 2IM9A 4CWNA 3L73H 1NTKH 4MVSA 5EYPB 4QIWF 3DTUB 4DR7B 4XE2A 1IBMB 2F43G 2F1MA 3ZMSA 1NR7A 4J10A 1AI5A 1ROPA 3ABMC 3DC5A 1QYEA 1FYJA 1U97A 3GWOA 1QU7A 1D5AA 2Q8VA 4X89A 3CGZA 3B40A 4WFAV 4V26A 5J9PC 3CWVA 2F95B 3ZIAG 4EFUA 3A2FA 1YI2V 3VHDA 2CTRA 1SETA 1S76D 3DSQA 1LR1A 2XAJA 4JI5O 2UXDB 5D7DA 4EM7A 1MA1A 1DLBA 5IYZB 1J5EB 2L6LA 1H38A 1ZUQA 2XJGA 2LW1A 1DF4A 4O4JB 2XDXA 1VP7A 1N33B 4WFGA 4X1KA 1TIDA 3RFRA 4I4TB 1MSDA 1K8AW 1VIBA 3AK3A 4O0BA 3D3IA 4J7ZA 4LWEA 2EILC 3R4PA 1R1BA 2ZE6A 5F5RA 5D5PA 3OPDA 3BCCH 2ZDIA 2JJ2G 5FWKA 1YDXA 4IGGA 5D5QA 3RVZA 2JJCA 4WBNA 2YECA 2P7TC 3CE2A 2YGEA 5M4MA 3WB2A 4I5SA 4UB8Z 3U0ZA 5CMUA 1VMGA 2XT9A 1ZWIC 2BTZA 1JR9A 2CH7A 5CTUA 4X1KB 3A0YA 3QG5A 3LSSA 1NH2B 4PDVA 4WF9V 5FPOA 4DV2B 3R4NA 4CS3A 3K9AA 1N32B 2G38A 2YGAA 1PPJH 5BR8O 1E1RG 1P7GA 3UKMA 2C1GA 3E22A 3AG1B 3LNMB 4LF8B 5GONB 4JI5B 1XEQA 4LF4O 2ZKJA 1GM7A 5EIBD 4PA3A 4R3MA 2ZBKB 1Y8PA 3AG2B 2YEDA 2R70A 1KZNA 3QO5A 4HYMA 4FLUA 1IX9A 2WLNA 4H7QA 3CRCA 2BE3A 2JKIA 5CTYA 2B5UA 1I94O 4FK5C 3W7WA 1ID0A 4F6RB 2IJHA 3U67A 5DECA 2JEXA 4EEHA 2EIKC 3CRMA 2VS0A 4IYIA 1I5DA 4LWGA 4HZ3A 1FFTB 4MTOA 5IJ0A 4LFBB 1OHHG 2WLMA 1P4RA 2HP8A 1UY8A 2CH7B 4B3SO 4IHJB 3O9OA 2DOSA 3ZKBA 5KLVH 4O05A 3KZIZ 4CH4A 1AI6A 1VQKV 3O6OA 4ZVIA 3OMNB 3KKYA 2WSSG 1KC8W 2YGFA 4LP8A 3JATB 4HZ5A 1AILA 2EZPA 3MD0A 2W6JG 4KFMA 1WA8A 4O4HA 3ZRWA 4ASGA 1S14A 4OGQB 3B25A 1WP7A 3CSXA 4JF3A 4YKUA 4EGHA 3STZC 1IBLO 1VQ6V 3R66A 1YERA 1GM9A 3L75H 4XITA 3G80A 3CCJV 1YSCA 5EC2C 1GM8A 2LGWA 3FFQA 1Q82W 2YI0A 3A0WA 4DV6O 2OCCB 2HHHO 3EVKA 3KG2A 4LFAO 4DW0A 2QGNA 3SJQC 2RN9A 2EINC 4I9QA 3N2GB 5IYDO 4O2BA 2ZE7A 1OCRC 4WFHA 1N36O 1HNZB 4U3JA 5DEDA 1Z5BA 5K1XA 1GN3A 1NI8A 2C1IA 4DR7O 3FV5A 5IJ9B 4LF5B 4J7JA 1NH2D 4I3HA 4DV1B 5D6QA 3Q5LA 3ZM7A 3HYYA 3OT7A 4ASAA 1RPRA 1EI1A 4FCQA 3JAMN 4NXMB 3LNUA 4O2BB 4WFBV 1KBHA 1H2KA 3K5OA 1FFXB 1ZX3A 2ZR2A 2K5BA 4O2AB 2YEBA 3AG4C 1K92A 1WN7A 2Q2EB 4BW9A 4FMTA 2RQ6A 4RQEA 3T0HA 3OTOB 1P7BA 4LF8O 2O1WA 2DJVA 3SPHA 4O4JA 2BCCH 2OIGA 2F93B 2XJJA 2WI1A 3ZN1A 1F4MA 2P6JA 1VF5B 2GUZB 2YS8A 2UXXA 4GX1A 5A9GA 1YC1A 3OW2U 3GIGA 4LF4B 2XX4A 2WEPA 3JATA 5C93A 2X0LA 4YXWG 2VCJA 1NJIW 1UFIA 4FM2A 3T4DA 3UO3A 5FNCA 2M6YA 5JH7A 2VQFB 1EFRG 1F4NA 4QE9A 1S16A 1EZJA 1EN4A 2Q4PA 4GCZA 2YKJA 4R1FA 1WB8A 5J6AA 1XHZA 3AEIA 2YEJA 2DQ3A 3QDDA 4GKJO 4KSHA 2EIMB 5H6RA 4LH6A 1RP3B 1L0LH 5FNFA 3J80N 2BTQB 2E76B 4I0XA 1LUVA 2A7WA 1EZVH 1R3IC 3H80A 1Z2GA 4KQVA 3A0TA 1TGOA 4ZHQB 3AG3B 3I56V 4B3TO 4Z1MG 1LNQA 2HKOA 3OMIB 4X65B 1ZXMA 2IH1C 2AXTZ 1YJWV 3HKBA 5LGNA 1JA8A 4JI1O 5CN0A 4H44B 1OJHA 1N32O 4BIUA 3MDSA 3ZMTA 3MAQA 1AJNA 4LWIA 2M7WA 1GKXA 2DYRC 3RW0A 5LP6C 2UXDO 3BMYA 3KE6A 4CC6A 4ZOLA 2WEQA 3O65A 5L3FA 1NVPD 3HZ1A 4DR2O 3RVYA 5HFMA 1XBLA 1JCHA 2W0FC 1AP6A 3JARA 3BM9A 5FL7G 2ZDIC 2KB1A 1XMOO 3RN4A 4K0KO 1FXVA 4R3AA 3K59A 4YKWA 3ZMUA 2HG1A 1WPXA 4QNHB 5BZBA 4K4OA 3PJSK 4JTCB 3EKOA 4K8XA 4JI7O 4J7KA 3K98A 4EKWA 1H2GA 5CPHA 3VQWA 4LF9B 2BU6A 4PI0A 1H2LA 5M4PA 1ORQC 3SYAA 4L90A 2Q5ZA 5JQGB 4X9LA 4ABMA 4HNAA 3A8TA 1QVFU 1XDCA 4LR3A 2A79B 1GMGA 1M1KW 3OMUA 4X1IA 3EHHA 5B1NA 5D7CA 3I5DA 3EKRA 5H2FZ 1HNZO 4LF7O 1I58A 3X2QC 1K4CC 3CD6V 3H9VA 1CP9A 4HNAB 2YC0A 3CJHB 1YF2A 3IC7A 3B24A 2F66C 1H7UA 3LDEA 4DUHA 2KSDA 3CCUV 4JZGA 3CEIA 3TZ5A 5CB4B 3H4LA 1JVMA 4H0LB 4DUZB 2X6AA 2ZR3A 5M4HA 2LFRA 4PA6A 3M7MX 3SJBC 1Y76B 2YXYA 2EBOA 4DV0O 4D6TH 4XKAA 3TK1A 2PI4A 4OPAA 3FYIB 2Z0AA 3AG2C 3RKZA 3CC2V 1JM6A 3E8GA 2RNBA 4Q20A 1M5IA 3GIGB 1MG1A 5EK0A 3CHXA 4DK0A 4EB6A 1ZL8B 2UXNA 3TTZA 1Q6HA 1S77D 1UYIA 1AJ6A 1YT2A 5GGZA 3UT5B 3CC7V 2Y0IA 4UCUA 4NKGB 3ABTA 4FLZA 1VQOV 4UCOA 3P30A 1MABG 2YUAA 1AH6A 4AWQA 2D3OW 2IWSA 3VHCA 4EFTA 2QKAA 5TISZ 2Z5UA 2UU9B 4RQFA 5BY1A 3W7TA 2HKJA 5KX5A 1QLNA 2EX3A 2OTLV 3E83A 2YK2A 2DN9A 1SQVH 4MW3A 4H13B 4K0KB 3NXSA 3U10A 5IT9N 2NLJC 4KHPO 4DUZO 1BHBA 5EBLC 1LUWA 3OMAB 3RT3C 4I50A
chains in the Genus database with same CATH topology
4RUFA 5J9PC 2ITDC 4PDRA 1UYCA 2YE4A 3ZIAG 4P9OA 5LBQA 2CH4A 3K99A 4GT8A 3R92A 1RPOA 3C11A 4AS9A 4EFUA 4PDMA 2XOKG 1H7SA 1UY9A 1S3JA 3HPLC 2W6IG 3SYPA 1VQMV 1YI2V 3C0EA 3VHDA 3VHAA 4R7CA 1SETA 1S76D 2YEAA 1I5YA 1QY8A 4J9ZB 1KQSU 2ZXWB 2XX5A 1M90W 2XAJA 3OE7G 2YE8A 1BYQA 3Q5KA 3CRKA 5D7DA 3B8MA 5B3SB 4EM7A 2VWCA 2XCMA 2OCCC 2YJXA 1DLBA 3OGCC 5EBMC 5BODA 2QM7A 1H38A 3CCMV 2XJGA 3G6EV 1I5CA 1DF4A 5E1AC 4ASFA 4UVBA 2XDXA 4JTAB 4WFGA 1OZ0A 1TIDA 3NMQA 1K8AW 2FWZA 1VQ8V 1GO3F 1QLEB 2X7RB 2QA4V 4MBCA 4O0BA 1Y4UA 4XKKA 2HLDG 2WLIA 3D3IA 2JIZG 4LWEA 2EILC 2WERA 3R4PA 1J95A 3T0ZA 4HXWA 3T4ZA 3GB7C 2Z3YA 5F5RA 1RM1C 3E8FA 1VQ9V 3OPDA 1TILA 3K03A 1M56B 2JJ2G 2ZDIA 4FIPC 3T2MA 4E01A 3OAAG 3CWVA 2JJCA 5FWKA 1F51A 3RVZA 2YECA 5IY5C 4P7AA 2P7TC 3ETEA 2YGEA 3R91A 3B27A 5M4MA 4I5SA 3W7SA 2Y48A 5CMUA 2YE5A 2BT0A 1TBWA 3FB7C 1ZWIC 4WFEA 2BTZA 2QG2A 2ATKC 5CTUA 2GSMB 2Q69A 4H33A 3A0YA 1FXKB 1NHIA 3D2RA 5CTWA 3LSSA 1NH2B 4PDVA 4WF9V 4H85A 1OSFA 4EGIA 4BIZA 2CCUA 3W7XA 1XL4A 3R4NA 4YKYA 2EIKB 2WLHA 3K9AA 1UJWB 1Q81W 2Q8FA 4UV9A 3OM3B 1K73W 1NQTA 2YGAA 1CPYA 2EJRA 5IYCO 1E1RG 2YEIA 3FT5A 4CWSA 3UKMA 3AG1B 2Y69C 1N8RW 3LNMB 1YTFD 3SYOA 1L0OA 4CE2A 3ETGA 2FTKA 1B6QA 2R9IA 5KUKA 1GM7A 2ZKJA 2DYSC 4PA3A 4R3MA 3WFVA 1Y8PA 3AG2B 4KUMA 4PA9A 1AI7A 2JK5C 2QEXV 2H8MA 2YEDA 1KZNA 2Q8HA 3F7YC 3VADA 4P30A 3QO5A 4HYMA 2IORA 4MP7A 5LGUA 2BYIA 2WI2A 2WLNA 2WI5A 4N23A 3JZ3A 1GK9A 3F7VC 4JPRA 1THNA 4H7QA 2DWEC 4O09A 1K97A 4XDKA 1YHQV 2JKIA 1GKZA 1YT1A 1H8HG 2EIJB 5CTYA 2YEHA 3AG1C 1EA6A 3FB6C 1UY6A 4EMVA 1JX9A 1Y4MA 2B5UA 3ML0A 1R73A 4FK5C 2IU0A 3W7WA 1SERA 1ID0A 2CCSA 4PRXA 2XAQA 2IJHA 3U67A 2JEXA 4L87A 5L3EA 4EEHA 1US7A 2EIKC 4GX2A 3K08A 4MB9A 4CZZA 1I5XA 2YE9A 1I5DA 2XK2A 4L91A 4LWGA 4LWFA 4HZ3A 2BOCC 1FFTB 4MTOA 3CXCU 2IU3A 2BU2A 3RLRA 1OHHG 1G8MA 2HR3A 1GJVA 4UROA 2WLMA 4PU9A 2XABA 4X8AA 3H01A 1FXHA 2IWXA 1P4RA 1UYDA 1UY8A 4ZBMA 2YE6A 3CCVV 1PNLA 1TUEB 3SYCA 1QVGU 4H81A 3ZKBA 2H94A 1R3LC 4KP4A 4FCPA 4MPEA 3SYQA 4O05A 5L3BA 1AI6A 1VQKV 1ZWHA 3A0XA 3O6OA 4ZVIA 3OMNB 3T10A 1QBZA 4LPBA 4LCUC 2WSSG 1KC8W 2YGFA 2B1GA 4G2KA 4LP8A 4HZ5A 4TSFG 2WWWA 2EZPA 2P67A 1OCZB 4MVRA 2YJWA 4YKZA 3MD0A 3MHHC 3GIFA 1L1FA 5KA5A 2W6JG 4KFMA 2YE7A 4E00A 1M9NA 1UYGA 3ZRWA 4JQLA 4W7TA 1NVPB 1QLEC 2C2AA 4ASGA 4GX5A 1S14A 2HG5C 4HYOA 4R50A 3B25A 2GFDA 4JF3A 5M4KA 1MSWD 3HB3B 4YKUA 4EGHA 3STZC 1VQ6V 1YERA 1YIJV 1GM9A 4GFNA 3IGAC 1R3KC 5DM6V 2X6BA 2QM8A 2CK3G 1Z5AA 1NR1A 2V7QG 3CCJV 2IOQA 4XITA 5M4NA 1YSCA 3FKSG 1GM8A 5EC2C 1Q82W 2YI0A 3A0WA 4UXNA 2LFSA 2WI6A 1AJPA 2OCCB 2XASA 3KG2A 3U2DA 2YI6A 1AH8A 3SJQC 2EINC 2YI7A 3ZKDA 5EBWC 2WLLB 4NH7A 4CWFA 2MK3A 1YITV 5IYDO 3D0BA 1PNKA 3SL2A 3W7UA 1OCRC 1HWYA 4GQTA 2WLJA 1YESA 4WFHA 3B26A 4NH9A 2O1WA 4DZYA 1NHJA 4WUBA 4WUDA 1AM1A 1PNMA 3BY6A 4YKXA 4R6ZA 1KP2A 1Z5BA 5KUMA 3SPGA 1GTOA 1S5HC 2EZOA 3ABMB 3LSQA 2CCTA 2DW4A 3CYOA 1YT0A 2FXSA 3EHJA 1CEZA 3FV5A 3WG7C 5L3CA 4GGLA 4PRVA 1NH2D 4JYBA 2QG0A 3BEHA 4L8ZA 4I3HA 1K9MW 3ZCCA 4CWRA 3G71V 5HFLA 3Q5LA 4XD8A 5D6QA 2QF6A 2DWDC 3CCEV 4JAUA 1KP3A 3HYYA 1RPRA 1EI1A 4LBEC 2EIMC 2XD6A 4ASAA 3FT8A 4FCQA 3JYCA 4XIQA 4L94A 1YSRA 3LNUA 2ZD9A 5B1BB 4WFBV 1KD1W 2K1EA 1R6KA 1THZA 1VQ5V 3INXA 2ZR2A 2K5BA 4X88A 4AWOA 2B1IA 4XIPA 4ASUG 1Z59A 1R6NA 2BU8A 2YKCA 2Q68A 5B1AB 2YEBA 5LHIA 1M57B 4G28B 4YKTA 3AG4C 1K92A 4F4LA 2XAGA 1W0JG 3I55V 3HEKA 4AWPA 2XHXA 2Q2EB 4UVAA 1VQ7V 3WQ9A 4JTDB 4FMTA 3RBZA 4RQEA 2YKBA 3T0HA 1KKDA 1P7BA 3QO7A 3SPJA 1SZTA 2QTOA 3ZN0A 1VQ4V 3SPHA 1UYLA 4FCRA 3RLPA 1W0KG 3OFNG 4BXIA 5GW7A 3E89A 1QR9A 2WI4A 4UUJC 4DO2A 5CBHA 4H37A 2WI1A 3ZN1A 1F4MA 2P6JA 3K0DA 1YTFB 1UYFA 3QO8A 2XJJA 1I59A 2QKSA 5L3GA 4V25A 2UXXA 1WLEA 4GX1A 4MPNA 4MPCA 4HYPA 3JCZA 5IDMA 1Y8OA 1YC1A 3O0IA 2UWDA 1JQ0A 1MOFA 3IFXA 4MVUA 4XDJA 3OW2U 2WI3A 2Q8GA 4DXWA 3GIGA 2XX4A 5B1OA 2WEPA 5C93A 2X0LA 2WLKA 4B6CA 4YXWG 3ZMZA 5IYBO 4JASA 2VCJA 2AHZA 3B28A 1NJIW 2WPDG 5H6QA 3T4DA 4XKOA 4P2ZA 3ZRSA 3TETA 5FNCA 1K7DA 4RAIA 1F23A 1EFRG 4LP0A 2BYHA 1G4YB 1F4NA 5D6PA 4QE9A 1S16A 1EZJA 2BREA 1BKNA 4KTNA 2YEEA 5H9CA 1JOYA 2ESAA 5CBGA 4GCZA 2YI5A 2YKJA 4P8OA 2JJ1G 2DQ0A 1I5AA 1UYEA 4R1FA 2R9RB 1Y4SA 3CCRV 5J6AA 2X6CA 2IW5A 4MVQA 1JPXA 3AEIA 2YEJA 2ZDYA 2Q8IA 1UYMA 3WHAA 2DQ3A 3G75A 3QDDA 4KSHA 2EIMB 5H6RA 4EGKA 3OWDA 1YS3A 5FNFA 3X2QB 1UYHA 4PA7A 1NBMG 2OT5A 5FNDA 4CE3A 3K06A 2HVKC 2FWYA 5CF0A 1YC4A 2ITCC 1V55C 2IJIA 4UV8A 4PELA 1OCOB 1R3IC 3H80A 3K3WA 3PEJA 3INWA 3GIEA 4KQVA 2QE7G 4JGSA 3HYZA 3ABLB 1K5QA 3A0TA 3E2EA 1OCCC 4CWQA 1SRYA 3AG3B 1U0ZA 3OW6A 1DTOA 3I56V 4LWHA 3G7BA 3EHBB 4Z1MG 1YJ9V 1YC3A 2YSUB 3JD0A 3ASOC 1LNQA 2HKOA 3CCLV 3CC4V 1V54C 3ABUA 3OMIB 3D36A 1ZXMA 3EHFA 2IH1C 3ASNB 1YJWV 2HJFC 4MOTA 2BU7A 2E0AA 3OEHG 1NKDA 5LGNA 3FB8C 1W2BU 1B63A 3ZXQA 5CN0A 3ABKC 1ZW9A 3R65A 2BRCA 1S0VA 3CCSV 1K34A 2PI5A 1M57C 3JD1A 4BIUA 2YK9A 3ZMTA 4XCLA 3OEEG 3JD4A 1AJNA 3QNEA 4LWIA 2DYRB 2M7WA 3O2FA 1GKXA 4GEEA 3UM7A 2DYRC 1YETA 3RW0A 3EHGA 3E35A 1PVGA 5BOCA 2H8PC 3BMYA 5J71A 3KE6A 4JYCA 3P32A 3STLC 3OWBA 1EBOA 3LDCA 2WEQA 4MTXA 4U7OA 3ABKB 4BAYA 2GQPA 5L3FA 4E02A 2A9HA 4QPJA 1NVPD 1VQNV 3JD2A 3ASNC 3HZ1A 3RVYA 1VQLV 2CGFA 1YJNV 5HFMA 3WG7B 2XAHA 3E86A 4MVZA 1JCHA 1E1QG 2W0FC 3ASOB 2VCIA 2XDLA 2YE2A 3BM9A 4QPKA 3MHSC 5FL7G 5L3JA 2ZDIC 1A4HA 1UYKA 4OXSA 5F3KA 4GT1A 3CPWU 1OCCB 1KECA 1SESA 2KB1A 2XDUA 4MVMA 2BU5A 3G4SV 1FXVA 1IXMA 2OTJV 5LHHA 4HZ0A 4R3AA 2XAFA 4QE7A 4YKWA 5EC1C 3ZMUA 1WPXA 2HG1A 2XHRA 4U7NA 3ZRWB 3G7EA 4HY6A 4QNHB 4PL9A 3DGEA 5BZBA 4CBCA 3K04A 4K4OA 3PJSK 4JTCB 3EKOA 1H8EG 1E79G 1AMWA 4L93A 3OUSA 4FJCC 3R4OA 1COWG 1FXKA 2BZ5A 4BW5A 3FB5C 2XDSA 4J9YB 2YKEA 3K98A 1R62A 3LPSA 4WUCA 4EKWA 2XNDG 3TZ2A 1H2GA 2WI7A 1K4DC 3A0ZA 1PD3A 5CPHA 1MX0A 2BU6A 2FYPA 5L3DA 4WCEV 1AROP 4HXZA 4O04A 2AKPA 5M4PA 2ZBKB 2YEGA 5LGTA 1ORQC 3SYAA 1QZRA 4L90A 2XDKA 5D7RA 3LUTB 3HHUA 2IOPA 4LC1A 1K5SA 4GX0A 1VQPV 4CWTA 4MT8A 4XDLA 4X9LA 2YEVB 3CRLA 1QVFU 3ZM7A 2O1VA 1S72V 1PKXA 1V54B 3EFFK 4KFGA 4ASBA 1K3EA 3E8HA 1PL0A 2XX2A 3E8BA 2A79B 1GMGA 1M1KW 3OMUA 3LDDA 4MVOA 1B62A 3EHHA 3AG3C 5B1NA 3EKRA 5CTXA 5D7CA 3ABLC 4MTGA 4BQGA 4TT3G 3Q5JA 1OCOC 1U2OA 4R8CA 1V55B 4ZKIA 1AR1B 2DYSB 3VOUA 4XTJA 1AJQA 2WAMA 1I58A 2NNUA 4HAMA 3PEHA 3OUFA 1FS0G 3X2QC 4E2LA 5IDJA 5LHGA 1ENVA 4BQJA 1K4CC 4QJFB 3CD6V 3CP1A 2Y69B 1TC6A 3ZRVA 3T1CA 4XIRA 2VW5A 4KSGA 1BL8A 2JDIG 1CP9A 3ETDA 4I9WA 2YEVA 1GKFA 4XDMA 3IC7A 3RLQA 3ZRXA 1Z5CA 4UVCA 3ZMVA 2IWUA 2Q67A 2PNRA 2A0LA 4JAVA 3B24A 3TZ0A 2Q6AA 3F5WC 4MP2A 3ZXOA 1H7UA 4URNA 4CWOA 3ZJZA 3LDEA 4DUHA 3CCUV 2BOBC 4URMA 5B1AC 3TZ5A 1AI4A 3H4LA 1JVMA 1ZXNA 2ZDXA 2X6AA 2EIJC 2ZR3A 4RO2A 5B1BC 2LFRA 4PA6A 1KIJA 3T2SA 5M4HA 2HFEC 2WLIB 4PA4A 2JEUA 4NH8A 2YEFA 2HVJC 2EBOA 4MTFA 2CG9A 2IH3C 5IY5B 4B7PA 4G27B 4XKAA 3A0RA 1UY7A 1XL6A 3TK1A 2IJJA 4PDLA 2PI4A 1TC0A 3FYIB 3CMAV 2BSMA 2QFOA 1RM1B 3AG2C 3TUHA 4YKRA 3RKZA 3CC2V 4XC0A 1JM6A 3E8GA 5IN9A 1K33A 2H55A 4XBFA 4Q20A 2EILB 3K60A 3R4MA 4YKQA 3U2KA 4MS2A 5DN6G 3K0GA 1R3JC 3GIGB 1MG1A 2XHTA 5EK0A 2YKIA 4O07A 1MU5A 2UXNA 4WFFA 2O1UA 3TTZA 4BAEA 4CE1A 3CCQV 4MSWC 1S77D 1BGQA 4HY1A 2V1DA 3VBBA 1UYIA 4URLA 2AHYA 1OCRB 1YSZA 1AJ6A 1YT2A 2YE3A 5GGZA 4TWKA 4RUEA 2XJXA 2ZQMA 1Y66A 2GHYA 3CC7V 1Y8NA 2EINB 4N21A 5CA3A 1Q86W 3CGYA 4FPPA 4U93A 4CWPA 3ABTA 1BMFG 3AG4B 1JJ2U 3HZ5A 3MNRP 3SPIA 1VQOV 5B3SC 3TZ4A 1FXKC 5CBFA 2HCHA 3P30A 3IEDA 1MABG 1AH6A 4AWQA 1DF5A 1TH8A 2D3OW 1BXDA 2ZXWC 3K79A 3OR7C 1NHHA 2IJKA 2IWSA 3K97A 3VHCA 2Z5UA 4EFTA 3CGZA 4P9PA 3CMEV 4CWNA 2LP7A 4RQFA 3W7TA 2HKJA 4MVSA 1BHAA 4QIWF 3DTUB 3QTFA 5KA6A 4XE2A 1QLNA 2F43G 1M56C 3SPCA 3E83A 2P90A 2OTLV 2YK2A 3TCUA 3B77A 3ZMSA 5M4EA 1NR7A 3T1KA 1I5BA 3JD3A 1AI5A 4MW3A 1ROPA 1Q7YW 3ABMC 3M99B 2WLLA 3NXSA 2NLJC 3FYEB 1BHBA 1QYEA 1QR8A 1OCZC 2EXLA 3OR6C 5EBLC 4XCJA 3GWOA 3OMAB 3B8NA 4MW8A 4X89A 1QCEA 4WFAV 1B3QA 4V26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWV A;  1UYC A;  2YE4 A;  4GT8 A;  2CH4 A;  3K99 A;  3R92 A;  4AS9 A;  3C11 A;  4EFU A;  1H7S A;  1UY9 A;  3C0E A;  3VHD A;  3VHA A;  2YEA A;  1QY8 A;  2XX5 A;  2YE8 A;  3Q5K A;  1BYQ A;  3CRK A;  5D7D A;  4EM7 A;  2VWC A;  2XCM A;  2YJX A;  5BOD A;  2QM7 A;  2XJG A;  1I5C A;  4ASF A;  2XDX A;  1TID A;  3NMQ A;  2FWZ A;  4MBC A;  4O0B A;  1Y4U A;  4XKK A;  4LWE A;  2WER A;  3R4P A;  3T0Z A;  4HXW A;  5F5R A;  3OPD A;  1TIL A;  4E01 A;  5FWK A;  2JJC A;  1F51 A;  2YEC A;  4P7A A;  2YGE A;  3R91 A;  3B27 A;  5M4M A;  4I5S A;  2YE5 A;  2BT0 A;  1TBW A;  2BTZ A;  2QG2 A;  5CTU A;  3A0Y A;  5CTW A;  1NHI A;  3D2R A;  4H85 A;  1OSF A;  4EGI A;  4BIZ A;  2CCU A;  3R4N A;  4YKY A;  2Q8F A;  2YGA A;  2YEI A;  3FT5 A;  4CWS A;  1L0O A;  4CE2 A;  2FTK A;  2ZKJ A;  4R3M A;  2ZBK B;  1Y8P A;  2Q8H A;  4BXI A;  2H8M A;  2YED A;  1KZN A;  3VAD A;  4HYM A;  2IOR A;  4MP7 A;  2BYI A;  2WI2 A;  2WI5 A;  3JZ3 A;  4H7Q A;  1THN A;  4O09 A;  2JKI A;  1GKZ A;  1YT1 A;  5CTY A;  2YEH A;  1EA6 A;  1UY6 A;  4EMV A;  2CCS A;  1ID0 A;  4PRX A;  3U67 A;  4EEH A;  1US7 A;  4MB9 A;  2YE9 A;  4L91 A;  1I5D A;  2XK2 A;  4LWG A;  4LWF A;  2BU2 A;  3RLR A;  1GJV A;  4URO A;  4PU9 A;  2XAB A;  2IWX A;  1UYD A;  1UY8 A;  2YE6 A;  4H81 A;  3ZKB A;  4KP4 A;  4FCP A;  4MPE A;  4O05 A;  3A0X A;  1ZWH A;  3O6O A;  4ZVI A;  3T10 A;  4LPB A;  2YGF A;  4HZ5 A;  2WWW A;  2P67 A;  2YJW A;  4YKZ A;  3MD0 A;  3GIF A;  2YE7 A;  4E00 A;  1UYG A;  3ZRW A;  4JQL A;  4W7T A;  4ASG A;  2C2A A;  1S14 A;  3B25 A;  2GFD A;  5M4K A;  4YKU A;  4EGH A;  1YER A;  4GFN A;  2QM8 A;  2IOQ A;  1Z5A A;  4XIT A;  5M4N A;  2YI0 A;  3A0W A;  2LFS A;  2WI6 A;  3U2D A;  2YI6 A;  1AH8 A;  2YI7 A;  3ZKD A;  4NH7 A;  4CWF A;  3D0B A;  3SL2 A;  4GQT A;  4NH9 A;  1YES A;  4DZY A;  3B26 A;  1NHJ A;  4WUB A;  4WUD A;  1AM1 A;  4YKX A;  1Z5B A;  2FXS A;  2CCT A;  1YT0 A;  4KSG A;  3EHJ A;  3FV5 A;  4GGL A;  4PRV A;  4JYB A;  2QG0 A;  4L8Z A;  4I3H A;  3ZCC A;  4CWR A;  5D6Q A;  3Q5L A;  4XD8 A;  2QF6 A;  3ZM7 A;  3HYY A;  4JAU A;  4ASA A;  1EI1 A;  2XD6 A;  3FT8 A;  4FCQ A;  4XIQ A;  4L94 A;  1YSR A;  3LNU A;  3INX A;  4CE1 A;  4BQG A;  2K5B A;  4AWO A;  4XIP A;  1Z59 A;  2BU8 A;  2YKC A;  2YEB A;  4YKT A;  3HEK A;  4AWP A;  2XHX A;  2Q2E B;  3WQ9 A;  4FMT A;  3T0H A;  2YKB A;  2O1W A;  4FCR A;  3RLP A;  1UYL A;  2WI4 A;  2XJJ A;  2WI1 A;  1UYF A;  1I59 A;  4V25 A;  4MPN A;  4MPC A;  4HYP A;  5IDM A;  1Y8O A;  1YC1 A;  3O0I A;  2UWD A;  2WI3 A;  2Q8G A;  3GIG A;  2XX4 A;  5B1O A;  2WEP A;  5C93 A;  4B6C A;  4JAS A;  2VCJ A;  3B28 A;  4XKO A;  5FNC A;  4LP0 A;  2BYH A;  5D6P A;  1S16 A;  4KTN A;  2BRE A;  1BKN A;  2YEE A;  1JOY A;  2ESA A;  4GCZ A;  2YI5 A;  2YKJ A;  4P8O A;  1I5A A;  4R1F A;  1UYE A;  1Y4S A;  5J6A A;  2Q8I A;  3WHA A;  2YEJ A;  2ZDY A;  1UYM A;  3QDD A;  3G75 A;  4KSH A;  4EGK A;  3OWD A;  1YS3 A;  5FNF A;  1UYH A;  5FND A;  4CE3 A;  2FWY A;  5CF0 A;  1YC4 A;  3H80 A;  3PEJ A;  3INW A;  3GIE A;  4KQV A;  3HYZ A;  3A0T A;  4CWQ A;  1U0Z A;  3OW6 A;  4LWH A;  3G7B A;  1YC3 A;  3D36 A;  1ZXM A;  3EHF A;  4MOT A;  2BU7 A;  2E0A A;  1B63 A;  3ZXQ A;  1ZW9 A;  2BRC A;  4XCL A;  2YK9 A;  4BIU A;  4LWI A;  3O2F A;  1GKX A;  4GEE A;  1YET A;  3EHG A;  1PVG A;  5BOC A;  3BMY A;  5J71 A;  3KE6 A;  4JYC A;  3P32 A;  3OWB A;  2WEQ A;  4MTX A;  4U7O A;  2GQP A;  4E02 A;  4QPJ A;  3HZ1 A;  2CGF A;  2VCI A;  2XDL A;  2YE2 A;  3BM9 A;  4QPK A;  5L3J A;  1A4H A;  1UYK A;  5F3K A;  4GT1 A;  2XDU A;  2BU5 A;  4HZ0 A;  4R3A A;  1IXM A;  4YKW A;  2HG1 A;  2XHR A;  3G7E A;  4U7N A;  3ZRW B;  4HY6 A;  3DGE A;  4K4O A;  3EKO A;  1AMW A;  4L93 A;  3R4O A;  2BZ5 A;  2XDS A;  3LPS A;  3K98 A;  2YKE A;  1R62 A;  4WUC A;  3TZ2 A;  3A0Z A;  2WI7 A;  5CPH A;  1MX0 A;  2BU6 A;  2FYP A;  4HXZ A;  4O04 A;  5M4P A;  2AKP A;  2YEG A;  1QZR A;  4L90 A;  2XDK A;  5D7R A;  3HHU A;  2IOP A;  4LC1 A;  4CWT A;  4MT8 A;  4X9L A;  3CRL A;  2O1V A;  4ASB A;  4KFG A;  2XX2 A;  3OMU A;  3EHH A;  1B62 A;  5CTX A;  5B1N A;  5D7C A;  3EKR A;  3Q5J A;  1U2O A;  4ZKI A;  4XTJ A;  1I58 A;  3PEH A;  5IDJ A;  4BQJ A;  1TC6 A;  3ZRV A;  4XIR A;  2VW5 A;  4XDM A;  3RLQ A;  3ZRX A;  1Z5C A;  2IWU A;  2PNR A;  3B24 A;  3TZ0 A;  4JAV A;  4MP2 A;  3ZXO A;  1H7U A;  4URN A;  4CWO A;  4DUH A;  4URM A;  3TZ5 A;  3H4L A;  1ZXN A;  2ZDX A;  3T2S A;  5M4H A;  2LFR A;  1KIJ A;  4NH8 A;  2YEF A;  2CG9 A;  4B7P A;  4XKA A;  3A0R A;  1UY7 A;  3TK1 A;  1TC0 A;  2BSM A;  2QFO A;  3TUH A;  4YKR A;  3RKZ A;  4XC0 A;  1JM6 A;  5IN9 A;  2H55 A;  4Q20 A;  3K60 A;  3R4M A;  4YKQ A;  3U2K A;  3GIG B;  2XHT A;  2YKI A;  4O07 A;  1MU5 A;  2O1U A;  3TTZ A;  4BAE A;  1BGQ A;  4HY1 A;  4URL A;  1UYI A;  1YSZ A;  1AJ6 A;  1YT2 A;  2YE3 A;  5GGZ A;  2XJX A;  1Y8N A;  4U93 A;  3CGY A;  4CWP A;  4FPP A;  3HZ5 A;  3MNR P;  3TZ4 A;  2HCH A;  3IED A;  1AH6 A;  4AWQ A;  1TH8 A;  1BXD A;  2IWS A;  3VHC A;  4EFT A;  1NHH A;  3K97 A;  4CWN A;  2HKJ A;  3QTF A;  4XE2 A;  2YK2 A;  5M4E A;  3T1K A;  1I5B A;  4PL9 A;  3NXS A;  1QYE A;  2EXL A;  4XCJ A;  3CGZ A;  1B3Q A;  4V26 A; 
#chains in the Genus database with same CATH topology
 1Q3E A;  5E79 Z;  4CS2 A;  5LBQ A;  1Y67 A;  3C11 A;  4PDM A;  2XOK G;  1UY9 A;  1VQM V;  4X62 O;  2YEA A;  4DV1 O;  1QY8 A;  2AZ2 A;  2KG7 A;  3H1H H;  1M90 W;  3Q5K A;  1PL4 A;  2VWC A;  2YJX A;  4FZ1 A;  3JAK A;  3A0B Z;  5EBM C;  3BHP A;  2N05 A;  2E3C A;  2RJZ A;  3RYC B;  3G6E V;  5E1A C;  4JTA B;  1IVS A;  2NR5 A;  5LA6 B;  3L71 H;  3NMQ A;  2ADP A;  5IWA B;  1QLE B;  2X7R B;  2QA4 V;  5LMU B;  4DR6 B;  1Y4U A;  4MBC A;  2WLI A;  2JIZ G;  2WER A;  5F2V O;  1WNS A;  4HXW A;  3T4Z A;  3GB7 C;  3JAR B;  2Z3Y A;  4FVM A;  3K03 A;  1NT2 B;  3QF7 A;  3OAA G;  3AK2 A;  4DR5 B;  3B27 A;  4JI2 O;  3W7S A;  2YE5 A;  3FB7 C;  3H1I H;  1M93 A;  4J41 A;  3VQV A;  2OYQ A;  3DC6 A;  4H85 A;  2Y4U A;  1XL4 A;  4OX9 B;  1Y74 B;  3ZX6 A;  1K73 W;  2A3Q A;  1YTF D;  2GBO A;  4CE2 A;  2VWJ A;  2FTK A;  3GWK C;  3JAK B;  4DRX B;  3WFV A;  2QEX V;  2H8M A;  3APQ A;  2IOR A;  1THN A;  1MZE A;  1IBM O;  1Y6X A;  4O09 A;  2AGA A;  4XDK A;  2B9Z A;  3JAW A;  2BSK B;  1UY6 A;  4EMV A;  4IIJ A;  2EUL A;  3ML0 A;  1R73 A;  2IU0 A;  1SER A;  4PRX A;  1W59 A;  4EFE A;  2CTW A;  2R9A A;  5L3E A;  1US7 A;  4MB9 A;  2NN4 A;  2YE9 A;  2XK2 A;  4X9Q A;  1JJO A;  3BA8 A;  3TXS A;  2HR3 A;  1GJV A;  4DV3 B;  1URF A;  1B06 A;  4X8A A;  3H01 A;  1TVK A;  2YE6 A;  4JAA A;  4KP4 A;  3SYQ A;  2AZ0 A;  2UU9 O;  4LPB A;  3RYI A;  1IDS A;  2QWN B;  4IYH A;  2P67 A;  1OCZ B;  4MVR A;  2YJW A;  4YKZ A;  3GIF A;  2YE7 A;  1M9N A;  1NVP B;  1EN5 A;  4BIO A;  1XMO B;  2XHB A;  2Q9L A;  4KHP B;  4EB6 B;  3K58 A;  1YIJ V;  3IGA C;  1R3K C;  3D8C A;  4KXR A;  5DM6 V;  2VRZ A;  1MMM A;  1Z5A A;  5M4N A;  3FKS G;  4FFB A;  1US6 A;  2WI6 A;  1AJP A;  2P4K A;  2XAS A;  3U2D A;  1M4U A;  2KKW A;  4RWU A;  4NH7 A;  4CWF A;  2MK3 A;  4UCR A;  1PNK A;  3LMM A;  1YES A;  4DZY A;  4WUD A;  3BY6 A;  4YKX A;  4R6Z A;  4YJ2 A;  4JI8 B;  1BT8 A;  1KP2 A;  5KUM A;  1SQP H;  5BMV B;  1S5H C;  2H3O A;  1FD9 A;  4KSG A;  4DRX A;  1WA8 B;  4GGL A;  1K9M W;  4DR4 O;  4XD8 A;  4Q6G A;  3ZHQ A;  4LBE C;  2EIM C;  3C3S A;  4L94 A;  2PY5 A;  5B1B B;  5LOV B;  2PGG A;  1KD1 W;  2K1E A;  1R6K A;  1VQ5 V;  3INX A;  4AWO A;  4ASU G;  1Z59 A;  1R6N A;  2YKC A;  5B1A B;  1A32 A;  1SQB H;  4G28 B;  3CRR A;  5K1P A;  2XAG A;  5KHH A;  3HEK A;  3EXA A;  4AWP A;  1AR5 A;  4YHH O;  3WQ9 A;  4JTD B;  1KKD A;  3SPJ A;  1NS1 A;  4FCR A;  2JGD B;  1W0K G;  3E89 A;  2ZCE A;  4DO2 A;  4H37 A;  3K0D A;  3QO8 A;  4B7K A;  1WLE A;  4MPN A;  3F5T A;  4B3R B;  5IDM A;  1Y8O A;  3O0I A;  1MOF A;  2WI3 A;  3IFX A;  4DXW A;  5B1O A;  3ZMZ A;  4P2Z A;  4JI3 O;  3ZRS A;  1F23 A;  2ZE5 A;  1AR4 A;  1IBK O;  2CDY A;  3SJC C;  2FML A;  3UCS C;  3CX5 F;  2YXL A;  4KTN A;  2BRE A;  1BKN A;  5C8Y B;  2YEE A;  5CBG A;  4DV7 B;  2WA4 A;  2JJ1 G;  2R9R B;  3M8A A;  4MVQ A;  3WHA A;  4B3T B;  2ZDY A;  2UXB O;  3G75 A;  1TUB A;  2QR4 A;  5JVD B;  3BVO A;  1XMQ B;  5FND A;  3LNN A;  3T1H B;  2HVK C;  2FWY A;  5CF0 A;  1YC4 A;  1V55 C;  3IAY A;  1I0H A;  2FKX A;  1OCO B;  3K3W A;  2LJ2 A;  4K8Z A;  3GIE A;  3K5L A;  4JGS A;  3INW A;  1X4T A;  4JI2 B;  1K5Q A;  2QSA A;  4CWQ A;  1SRY A;  1WJZ A;  5C8Y A;  4NB5 A;  1YC3 A;  3JD0 A;  3G67 A;  3CRQ A;  1V54 C;  2UUC O;  4FFB B;  1NKD A;  5BXZ A;  1W2B U;  1FJG O;  3ZXQ A;  4DUY O;  1ZW9 A;  5JQG A;  1S0V A;  3CCS V;  4K3A A;  1M57 C;  3SJA C;  4DYL A;  1XI1 A;  2YK9 A;  4XCL A;  3HKC B;  5KAF Z;  5KHI A;  3E35 A;  5BOC A;  1P49 A;  4JYC A;  3OWB A;  4MTX A;  2GQP A;  3ABK B;  2N04 A;  4U3J B;  5FLX N;  4E02 A;  2OCH A;  3JAL B;  1SA0 A;  3ASN C;  1YJN V;  2OIE A;  3WG7 B;  2VCI A;  4MVZ A;  5IE9 A;  4DV3 O;  1E1Q G;  2XDL A;  3ASO B;  2YE2 A;  4UCV A;  1VF6 A;  4QPK A;  1XUQ A;  5L3J A;  1Q6U A;  4OXS A;  1OCC B;  1KEC A;  3RYF A;  5J2U A;  2XDU A;  4MVM A;  2ZKO A;  2BU5 A;  4HZ0 A;  5EC1 C;  4HY6 A;  3ZRW B;  4X66 O;  5J2T B;  4CBC A;  3K04 A;  4DV2 O;  1H8E G;  4DV6 B;  3R4O A;  1COW G;  2K9P A;  4QGP A;  2E75 B;  4BW5 A;  3LPS A;  4J9Y B;  1R62 A;  4LFA B;  2EJ7 A;  2GDS A;  2XND G;  2WI7 A;  1PD3 A;  2ZE8 A;  1N33 O;  2YID A;  2AKP A;  5LGT A;  4TV9 B;  2XDK A;  3HHU A;  1K5S A;  4GX0 A;  2Q0O C;  4MT8 A;  4OPH A;  5KMG B;  2O1V A;  1PKX A;  1V54 B;  3EFF K;  1K3E A;  4DV5 B;  4DR1 O;  3E8H A;  1PL0 A;  2XX2 A;  3E8B A;  4ZI7 B;  3LDD A;  4MVO A;  3K5M A;  4J80 A;  4MTG A;  2F4V B;  1OCO C;  4R8C A;  1V55 B;  5IJ9 A;  3JAL A;  4HAM A;  1FS0 G;  5LHG A;  1ENV A;  4QJF B;  3ZRV A;  2QWR B;  4E72 A;  1BL8 A;  2JDI G;  4I9W A;  1GKF A;  4XDM A;  4PJ0 Z;  2RMK B;  4I55 B;  3RLQ A;  4UVC A;  3ZMV A;  2DE0 X;  3TZ0 A;  3BFR A;  1HNW B;  3F5W C;  2UUB B;  4TQF A;  4CWO A;  4W4K A;  5J2T A;  1ZL8 A;  4YIO A;  2MW2 B;  1AI4 A;  1GH6 A;  2QWO B;  4DK1 A;  3RWR D;  2F23 A;  2YEF A;  1XNQ B;  2HVJ C;  4LNU A;  2CG9 A;  2IH3 C;  4YIP A;  4UFZ A;  1TC0 A;  2QFO A;  1IBL B;  2FYU H;  2PUS A;  4YKR A;  5H5N A;  3DXR B;  2H55 A;  2EIL B;  3K60 A;  3U2K A;  3HKD B;  4YKQ A;  4MS2 A;  5KMG A;  3T1H O;  2VQF O;  5CA1 B;  1MU5 A;  4O07 A;  4D7S A;  4TUY B;  4BAE A;  4B3R O;  1SKV A;  4MSW C;  4URL A;  2AHY A;  4K35 A;  4GZR B;  4FFK A;  5EZY B;  2XJX A;  1Y66 A;  2PYL A;  3NR7 A;  1Q86 W;  3H1J H;  3SPI A;  3TZ4 A;  1FXK C;  2HCH A;  3IED A;  2XUM A;  5JEN A;  1WPB A;  1NHH A;  4P9P A;  4YJ3 A;  1DGS A;  2YIB A;  1BHA A;  3A0H Z;  5KA6 A;  1SS3 A;  1Q6I A;  3SPC A;  4NYK A;  3TCU A;  5M4E A;  1I5B A;  1Q7Y W;  3CWB H;  4PL9 A;  2WLL A;  1GN4 A;  1QR8 A;  4XCJ A;  3VQY A;  3L72 H;  4AQY O;  3B8N A;  3ZHT A;  1JFF B;  4MW8 A;  3Q4H B;  1UYC A;  2ITD C;  4B7E A;  4GT8 A;  4P9O A;  3R92 A;  1RPO A;  3SYP A;  2W6I G;  3C0E A;  1KU9 A;  5BR8 B;  3VHA A;  1I5Y A;  2ZXW B;  1G6U A;  1Q8I A;  1H2N A;  2YE8 A;  4JI6 O;  1BYQ A;  2BTO A;  3CRK A;  3B8M A;  5B3S B;  2RCV A;  2XCM A;  3OGC C;  5BOD A;  4DUY B;  3HR0 A;  2YIB D;  4O4L B;  1YXB A;  4ASF A;  4UVB A;  4FLW A;  1FFX A;  4X62 B;  2Q7H A;  1OZ0 A;  4ZI7 A;  2FWZ A;  1GO3 F;  2KQX A;  1CXZ B;  2ZT9 B;  3JAW B;  4XKK A;  4J11 A;  3D36 C;  1J95 A;  4LNU B;  1Z5V A;  3T0Z A;  1BZK A;  1Y74 A;  3E8F A;  1VQ9 V;  3L9D A;  4TOI A;  2UXC O;  4LWS A;  4LF6 O;  1M56 B;  3T2M A;  4I50 B;  1F51 A;  5IY5 C;  4LF5 O;  1BSM A;  3ETE A;  3WB1 A;  3R91 A;  2DMX A;  2Y48 A;  1KYO F;  1TBW A;  5FNV A;  1YCI A;  2ATK C;  4TUY A;  4H33 A;  2YI9 A;  5CTW A;  1NHI A;  1NZ6 A;  2CCU A;  3BRC A;  3W7X A;  4YKY A;  2Q8F A;  4UV9 A;  3OM3 B;  4CH6 A;  1NQT A;  2WA3 A;  4A5U B;  2CTQ A;  3T1Y O;  2L35 A;  2Y69 C;  3SYO A;  1EN6 A;  2IBZ H;  2JS3 A;  3HKB B;  3ETG A;  5KUK A;  2R9I A;  4DW1 A;  2DYS C;  2VQE O;  4JYY A;  1SC5 B;  2Q8H A;  1AI7 A;  2JK5 C;  4UCT A;  3VAD A;  4X64 O;  4P30 A;  2WI2 A;  2WI5 A;  4N23 A;  1GK9 A;  4JPR A;  2DWE C;  1K97 A;  1YHQ V;  2O57 A;  4I0X B;  2EIJ B;  1EA6 A;  1JX9 A;  1Y4M A;  3Q4H A;  3OD4 A;  4YHH B;  2CCS A;  2XAQ A;  3QTC A;  4L87 A;  1WB7 A;  1H2M A;  3K08 A;  1FJG B;  2QM4 A;  2P4V A;  4LWF A;  3IJ4 A;  2BOC C;  1G8M A;  4PU9 A;  1FXH A;  3ZHV A;  4AHC A;  1TUE B;  1UPG A;  3SYC A;  4H81 A;  4X1Y B;  4MPE A;  3T10 A;  3FAV B;  3N2K B;  4LCU C;  4G2K A;  5KHK A;  4ZOL B;  4GKK B;  3MHH C;  1L1F A;  4E00 A;  4FLX A;  4W7T A;  1QLE C;  4FM0 A;  4GX5 A;  3HKE A;  4R50 A;  1GRJ A;  4GFN A;  2JS5 A;  2X6B A;  2QM8 A;  2V4D A;  2CK3 G;  2IOQ A;  1NR1 A;  4LF7 B;  4B08 A;  2QJ1 A;  4ICG A;  4JI8 O;  3ZBH A;  2CTP A;  3BAA A;  2YI6 A;  3G6B A;  2W0X A;  1ZLZ A;  2YI7 A;  5EBW C;  1YIT V;  3SL2 A;  3W7U A;  4NH9 A;  2WLJ A;  4YY3 B;  1BQ0 A;  4WUB A;  1AM1 A;  1R6T A;  1WAZ A;  2UXC B;  1VF6 C;  3LSQ A;  2DW4 A;  3CYO A;  5L3C A;  4JYB A;  2QG0 A;  3BEH A;  2FB5 A;  4JI7 B;  5HFL A;  2QF6 A;  2DWD C;  5JCO A;  2XD6 A;  3JYC A;  4LF9 O;  1YSR A;  1KMI Z;  3RYC A;  5KAI Z;  2ZD9 A;  5JH7 B;  1THZ A;  3UO2 A;  4BQG A;  4NXN O;  4CE1 A;  4X88 A;  2B1I A;  3RYH A;  4XIP A;  2BU8 A;  2FL4 A;  2Q68 A;  3P3N A;  3I55 V;  1W0J G;  4ZIB A;  4DV0 B;  2XHX A;  2LW7 A;  4DV4 B;  3ZN0 A;  1H2S B;  1SZT A;  2QTO A;  5IWA O;  1UYL A;  3RLP A;  1QR9 A;  5FPR A;  4UUJ C;  4WBN B;  5CBH A;  1YTF B;  4YJ2 B;  2HHH B;  1I59 A;  4W4L A;  5L3G A;  1NTM H;  1FKA O;  5LMN B;  4MPC A;  1XNQ O;  3S3W A;  2AW9 A;  2UWD A;  1JQ0 A;  2Q8G A;  4MVU A;  3RYI B;  1XHX A;  5JVD A;  3CYG A;  4JAS A;  4YY3 O;  2AHZ A;  4CS4 A;  3B28 A;  5H6Q A;  4XKO A;  4RAI A;  5EYP A;  2ARH A;  1G4Y B;  1F7Y A;  1JOY A;  2ESA A;  2ADQ B;  4J42 A;  2YI5 A;  1TVK B;  4P8O A;  2PTM A;  1UYE A;  3ETQ A;  2X6C A;  2IW5 A;  1JPX A;  1UYM A;  3RYF B;  3OWD A;  3X2Q B;  1UYH A;  4PA7 A;  1NBM G;  2OT5 A;  1XIL A;  4CE3 A;  3K06 A;  2Y0P A;  4B3M B;  4IIJ B;  3SDL A;  4DV4 O;  1OCC C;  4LWH A;  4JYA O;  3EHB B;  1YJ9 V;  1AVM A;  2YSU B;  4O4I B;  2ZIM A;  2ZIO A;  3B4S A;  3ASO C;  2P5O A;  3CC4 V;  2HEP A;  3ASN B;  2HJF C;  1MNG A;  3OEH G;  1B63 A;  1XRE A;  1X59 A;  3ABK C;  4D7T A;  2JGU A;  3JSN A;  4FLT A;  2PI5 A;  3JD1 A;  3L70 H;  3JD4 A;  1GAX A;  1SF9 A;  4GEE A;  3UM7 A;  3EHG A;  2H8P C;  4JI6 B;  2UUA B;  3STL C;  3LDC A;  1N36 B;  4QPJ A;  5CA0 B;  1VQN V;  3JD2 A;  2CGF A;  1O9H A;  3E86 A;  1UYK A;  4GT1 A;  5AG2 A;  3OGI B;  2CGN A;  3K9S A;  5LHH A;  5LA6 A;  2XAF A;  1SZX A;  2GTA A;  1QHT A;  4LF6 B;  4L93 A;  4NTX A;  3OUS A;  4FJC C;  2BZ5 A;  1FXK A;  2HJD A;  3JSL A;  4O04 A;  4TQD A;  4WCE V;  4JV5 B;  1ARO P;  4GYC B;  4X65 O;  3OTO O;  4X66 B;  1QZR A;  2YIC A;  3LUT B;  2IOP A;  4LC1 A;  1SQG A;  1VQP V;  2HHI A;  3DXR A;  5B66 Z;  4XDL A;  3CRL A;  4AI8 A;  4Z2W A;  4DV7 O;  4FLY A;  1S72 V;  4KFG A;  1Q5O A;  2A06 H;  3AG7 A;  1Q90 D;  2CE4 A;  2QKC A;  1B62 A;  5CTX A;  3AG3 C;  3GVM A;  4TT3 G;  3Q5J A;  2UUB O;  1U2O A;  1PM9 A;  4ZKI A;  1AR1 B;  3VOU A;  3N2G A;  2Q7E A;  4XTJ A;  2WAM A;  5IJ0 B;  1YEW A;  1G1X B;  4BQJ A;  3CP1 A;  3IC9 A;  1TC6 A;  3ZS8 C;  2QWQ B;  2YI8 A;  1VAR A;  1I7F A;  1Z5C A;  2IWU A;  2PNR A;  2R72 A;  2Q67 A;  4IT5 A;  5LOV A;  2F4V O;  4HBN A;  3JAS A;  4URN A;  3ZJZ A;  4JI4 B;  5B1A C;  5LXT B;  5LYJ A;  1ZXN A;  2EIJ C;  4O4H B;  5B1B C;  5JJJ B;  2HFE C;  3SR2 C;  1JFF A;  2LGQ A;  4PA4 A;  1L0N H;  2D2C B;  2JEU A;  2Y4T A;  4NH8 A;  5GTH Z;  3A0R A;  1UY7 A;  4PDL A;  3CMA V;  1KUQ A;  3TUH A;  1RM1 B;  5IN9 A;  1K33 A;  3R4M A;  3K0G A;  4NVP A;  1R3J C;  2XHT A;  1XOU A;  1IBK B;  1N0J A;  2ZNI A;  3CCQ V;  5KHJ A;  2V1D A;  5LYJ B;  1DK1 A;  1D2D A;  1YSZ A;  3B2E E;  3H1L H;  2YE3 A;  4UB6 Z;  4TWK A;  4EEQ A;  4RUE A;  3HKC A;  1AP5 A;  1Y8N A;  4N21 A;  3CGY A;  4FPP A;  3ZHR A;  3AG4 B;  3MNR P;  4JI0 O;  1MZF A;  1YZB A;  1TH8 A;  3H1K H;  3OR7 C;  1BXD A;  2IJK A;  3CME V;  1KB9 F;  2LP7 A;  1YVW A;  4X64 B;  3QTF A;  1M56 C;  2P90 A;  3B77 A;  1AB3 A;  3T1K A;  3JD3 A;  3M99 B;  3ICX A;  1WP8 A;  3FYE B;  2EXL A;  1OCZ C;  3OR6 C;  4DR2 B;  1GN2 A;  1QCE A;  4DV5 O;  1B3Q A;  4DR1 B;  4RUF A;  4PDR A;  2YE4 A;  3D3Q A;  2CH4 A;  3K99 A;  4AS9 A;  4F6R A;  2BTQ A;  1H7S A;  1S3J A;  3HPL C;  2YXH A;  5EZY A;  4R7C A;  4DR3 O;  1BE3 H;  4J9Z B;  1KQS U;  2XX5 A;  3S5T A;  3OE7 G;  4LWS B;  4TV9 A;  4JI3 B;  4NXM O;  4I55 A;  2OCC C;  1PV0 A;  3LSU A;  4BWA A;  4JI1 B;  2QM7 A;  1SQF A;  3CCM V;  1I5C A;  4PD4 F;  1HNW O;  4JV5 O;  4O2A A;  2P06 A;  5CA0 A;  1VQ8 V;  1KKC A;  1GN6 A;  2HLD G;  2P22 C;  2UUA O;  3BAB A;  3TXQ A;  2RDC A;  1RM1 C;  1TIL A;  1XMQ O;  4FIP C;  4E01 A;  4P7A A;  5EIB C;  2LQT A;  1SA0 B;  2BT0 A;  4WFE A;  4FM1 A;  3JAS B;  2QG2 A;  2GSM B;  2Q69 A;  2UXB B;  1FXK B;  3D2R A;  1BQZ A;  1OSF A;  4EGI A;  4BIZ A;  2EIK B;  2WLH A;  1UJW B;  1Q81 W;  4X1I B;  4ZHQ A;  1CPY A;  2PYJ A;  2EJR A;  5IYC O;  2YEI A;  3FT5 A;  4CWS A;  4E4E A;  4JI4 O;  1N8R W;  1L0O A;  3HKE B;  3L74 H;  1B6Q A;  3C3T A;  4TV8 A;  4BXI A;  4KUM A;  4PA9 A;  4CC5 A;  2GUZ A;  1NTZ H;  3F7Y C;  5JWP A;  1T5E A;  4MP7 A;  5LGU A;  5CA1 A;  2BYI A;  3JZ3 A;  3F7V C;  1B04 A;  4BR6 A;  1HR0 B;  1GKZ A;  4X1Y A;  1YT1 A;  1H8H G;  2YEH A;  3AG1 C;  1BGY H;  3FB6 C;  4B3S B;  1IUR A;  1HP8 A;  3CS5 A;  1QQC A;  4AQY B;  5GON A;  4PI2 A;  4JI0 B;  4GX2 A;  1XQ8 A;  1I5X A;  4CZZ A;  2Q0A A;  4L91 A;  3CXC U;  2IU3 A;  2BU2 A;  3RLR A;  2PZS A;  4URO A;  5J2U B;  2XAB A;  2IWX A;  1SQQ H;  4AIL C;  1UYD A;  4ZBM A;  1I94 B;  3AK1 A;  3HKD A;  1PNL A;  3CCV V;  1QVG U;  4L8J A;  2H94 A;  3K5N A;  1R3L C;  4DR4 B;  4FCP A;  5L3B A;  3A0X A;  1ZWH A;  1J5E O;  1QBZ A;  3S3X A;  1RFY A;  2B1G A;  4OX9 O;  4TSF G;  2WWW A;  5CB4 A;  5KA5 A;  2XTA A;  3WB0 A;  1UYG A;  1TAE A;  4JQL A;  2VWK A;  2C2A A;  2HG5 C;  4HYO A;  2GFD A;  5M4K A;  1MSW D;  3HB3 B;  1IXB A;  1OV9 A;  3THO A;  5JJE B;  2N74 A;  4IHJ A;  2V7Q G;  4I7Z B;  1P84 F;  4UXN A;  2LFS A;  4UCS A;  1AH8 A;  4B3M O;  1HNX O;  3ZKD A;  4Z1V A;  2ZIN A;  2E5L B;  2WLL B;  3D0B A;  1HWY A;  4GQT A;  3B26 A;  3RYH B;  1NHJ A;  1PNM A;  1S5J A;  1PP9 H;  3SPG A;  1GTO A;  2EZO A;  5ITZ A;  3ABM B;  2FXS A;  4NTY A;  1YT0 A;  2CCT A;  3EHJ A;  1CEZ A;  3WG7 C;  4PRV A;  1V9P A;  4L8Z A;  3ZCC A;  4CWR A;  1EM1 A;  3G71 V;  4F6E A;  3ZED A;  3CCE V;  4JAU A;  1KP3 A;  3FT8 A;  4XIQ A;  2E74 B;  4IL6 Z;  4DR5 O;  3CB2 A;  3UQ8 A;  5LHI A;  1XNR B;  1M57 B;  4YKT A;  4F4L A;  5ITZ B;  4LFC O;  4UVA A;  1VQ7 V;  1U96 A;  3J81 N;  2Q73 A;  3RBZ A;  2YKB A;  3QO7 A;  1VQ4 V;  4NTW A;  3OFN G;  1Y76 A;  5GW7 A;  2WI4 A;  4O4I A;  4TV8 B;  4NXN B;  1UYF A;  4PV1 B;  1VEW A;  4EFB A;  2QKS A;  4V25 A;  5BMV A;  2CAZ C;  3OTF A;  3UT5 A;  4HYP A;  3JCZ A;  1BCC H;  3FAV A;  3N2K A;  1Z5W A;  4XDJ A;  1HR0 O;  1O9G A;  3CXH F;  2WLK A;  4B6C A;  2ZNJ A;  5IYB O;  2WPD G;  1RSO B;  3TET A;  4GKK O;  1K7D A;  4YJ3 B;  4FLV A;  4LP0 A;  5JCO C;  2BYH A;  3ZHU A;  5D6P A;  2PF4 E;  5H9C A;  3APO A;  3T1Y B;  1I5A A;  2DQ0 A;  3PN1 A;  1Y4S A;  3CCR V;  2Q8I A;  4DR6 O;  2LO1 A;  2YIA A;  4EGK A;  1YS3 A;  2ITC C;  1ZTE A;  2IJI A;  4UV8 A;  4LFC B;  4PEL A;  3PEJ A;  2QE7 G;  1HDJ A;  3HYZ A;  2CUG A;  3ABL B;  3E2E A;  1N34 O;  1U0Z A;  3OW6 A;  1DTO A;  3G7B A;  4LH7 A;  5KX5 B;  3ZHS A;  2QDO A;  3CCL V;  3ABU A;  1FPO A;  3D36 A;  3EHF A;  4MOT A;  1QNM A;  2BU7 A;  2E0A A;  3FB8 C;  2KG7 B;  3R65 A;  3SGI A;  2BRC A;  1K34 A;  4FZ0 A;  5LP6 B;  3OEE G;  4DR3 B;  4JYA B;  3QNE A;  2DYR B;  3O2F A;  1YET A;  1RSO A;  1PVG A;  4X20 A;  5J71 A;  1TUB B;  2BSK A;  2GV9 A;  3P32 A;  1EBO A;  3KCY A;  1Q43 A;  4U7O A;  4BAY A;  3JCU Z;  3K57 A;  2A9H A;  3N27 A;  1TA8 A;  3VQX A;  1I08 A;  1VQL V;  2E5L O;  2XAH A;  5FNV B;  1ZAU A;  1IZ3 A;  3MHS C;  4O4L A;  4C7U A;  1A4H A;  5F3K A;  3CPW U;  1SES A;  2JRI A;  4GLX A;  3G4S V;  1SQX H;  1IXM A;  2VQE B;  2OTJ V;  3BA9 A;  4QE7 A;  3BPZ A;  1FAF A;  2XHR A;  3G7E A;  4U7N A;  2ZM6 O;  3DGE A;  3J7A U;  1E79 G;  1AMW A;  5A2Q N;  1N4C A;  3FB5 C;  2XDS A;  2YKE A;  4WUC A;  5GTI Z;  3TZ2 A;  3A0Z A;  1K4D C;  4JZ2 A;  1MX0 A;  2FYP A;  5L3D A;  4HXZ A;  3P3P A;  1BS3 A;  2UUC B;  2YEG A;  4U3F H;  2ILM A;  5D7R A;  4CWT A;  3TGU H;  2YEV B;  1L8D A;  3TJT A;  3B09 A;  1HW7 A;  1N0N A;  2ETN A;  4ASB A;  3ABL C;  3FX7 A;  2ODM A;  3RGB A;  3QVN A;  5LXT A;  3KCX A;  3WU2 Z;  2DYS B;  1AJQ A;  1D5N A;  2NNU A;  3PEH A;  3OUF A;  5IDJ A;  4E2L A;  5LL6 Y;  2Y69 B;  3C90 A;  4GUN A;  3T1C A;  4XIR A;  2VW5 A;  1VF7 A;  3ETD A;  1ZSP A;  2YEV A;  3CRA A;  3ZRX A;  2JGD A;  2A0L A;  4JAV A;  3U11 A;  4NR1 A;  1HNX B;  2Q6A A;  4MP2 A;  3ZXO A;  1NU1 H;  2YDE A;  2ZM6 B;  4KL1 A;  2BOB C;  5LMU O;  4URM A;  5JJN B;  2ZDX A;  4RO2 A;  3T2S A;  1KIJ A;  2WLI B;  5KHG A;  5LMN O;  1S5L Z;  4MTF A;  2QWP B;  5IY5 B;  4B7P A;  3E22 B;  4G27 B;  1XL6 A;  2IJJ A;  4CH3 A;  3CJH A;  2CGO A;  2BSM A;  4PHZ A;  4XC0 A;  1JMK C;  4XBF A;  5DN6 G;  2OWO A;  4CH5 A;  3FD9 A;  2YKI A;  2Q7G A;  5B5E Z;  4WFF A;  2O1U A;  2GTS A;  5IYZ A;  1BGQ A;  4HY1 A;  1N34 B;  1XNR O;  3VBB A;  1OCR B;  5LP6 A;  2JVD A;  2ZQM A;  2GHY A;  4U93 A;  2EIN B;  5CA3 A;  4CWP A;  1BMF G;  4X20 B;  4I4T A;  1JJ2 U;  3HZ5 A;  5B3S C;  5CBF A;  4GKJ B;  1DF5 A;  2QTS A;  2ZXW C;  3K79 A;  3K97 A;  4LFB O;  2IM9 A;  4CWN A;  3L73 H;  1NTK H;  4MVS A;  5EYP B;  4QIW F;  3DTU B;  4DR7 B;  4XE2 A;  1IBM B;  2F43 G;  2F1M A;  3ZMS A;  1NR7 A;  4J10 A;  1AI5 A;  1ROP A;  3ABM C;  3DC5 A;  1QYE A;  1FYJ A;  1U97 A;  3GWO A;  1QU7 A;  1D5A A;  2Q8V A;  4X89 A;  3CGZ A;  3B40 A;  4WFA V;  4V26 A;  5J9P C;  3CWV A;  2F95 B;  3ZIA G;  4EFU A;  3A2F A;  1YI2 V;  3VHD A;  2CTR A;  1SET A;  1S76 D;  3DSQ A;  1LR1 A;  2XAJ A;  4JI5 O;  2UXD B;  5D7D A;  4EM7 A;  1MA1 A;  1DLB A;  5IYZ B;  1J5E B;  2L6L A;  1H38 A;  1ZUQ A;  2XJG A;  2LW1 A;  1DF4 A;  4O4J B;  2XDX A;  1VP7 A;  1N33 B;  4WFG A;  4X1K A;  1TID A;  3RFR A;  4I4T B;  1MSD A;  1K8A W;  1VIB A;  3AK3 A;  4O0B A;  3D3I A;  4J7Z A;  4LWE A;  2EIL C;  3R4P A;  1R1B A;  2ZE6 A;  5F5R A;  5D5P A;  3OPD A;  3BCC H;  2ZDI A;  2JJ2 G;  5FWK A;  1YDX A;  4IGG A;  5D5Q A;  3RVZ A;  2JJC A;  4WBN A;  2YEC A;  2P7T C;  3CE2 A;  2YGE A;  5M4M A;  3WB2 A;  4I5S A;  4UB8 Z;  3U0Z A;  5CMU A;  1VMG A;  2XT9 A;  1ZWI C;  2BTZ A;  1JR9 A;  2CH7 A;  5CTU A;  4X1K B;  3A0Y A;  3QG5 A;  3LSS A;  1NH2 B;  4PDV A;  4WF9 V;  5FPO A;  4DV2 B;  3R4N A;  4CS3 A;  3K9A A;  1N32 B;  2G38 A;  2YGA A;  1PPJ H;  5BR8 O;  1E1R G;  1P7G A;  3UKM A;  2C1G A;  3E22 A;  3AG1 B;  3LNM B;  4LF8 B;  5GON B;  4JI5 B;  1XEQ A;  4LF4 O;  2ZKJ A;  1GM7 A;  5EIB D;  4PA3 A;  4R3M A;  2ZBK B;  1Y8P A;  3AG2 B;  2YED A;  2R70 A;  1KZN A;  3QO5 A;  4HYM A;  4FLU A;  1IX9 A;  2WLN A;  4H7Q A;  3CRC A;  2BE3 A;  2JKI A;  5CTY A;  2B5U A;  1I94 O;  4FK5 C;  3W7W A;  1ID0 A;  4F6R B;  2IJH A;  3U67 A;  5DEC A;  2JEX A;  4EEH A;  2EIK C;  3CRM A;  2VS0 A;  4IYI A;  1I5D A;  4LWG A;  4HZ3 A;  1FFT B;  4MTO A;  5IJ0 A;  4LFB B;  1OHH G;  2WLM A;  1P4R A;  2HP8 A;  1UY8 A;  2CH7 B;  4B3S O;  4IHJ B;  3O9O A;  2DOS A;  3ZKB A;  5KLV H;  4O05 A;  3KZI Z;  4CH4 A;  1AI6 A;  1VQK V;  3O6O A;  4ZVI A;  3OMN B;  3KKY A;  2WSS G;  1KC8 W;  2YGF A;  4LP8 A;  3JAT B;  4HZ5 A;  1AIL A;  2EZP A;  3MD0 A;  2W6J G;  4KFM A;  1WA8 A;  4O4H A;  3ZRW A;  4ASG A;  1S14 A;  4OGQ B;  3B25 A;  1WP7 A;  3CSX A;  4JF3 A;  4YKU A;  4EGH A;  3STZ C;  1IBL O;  1VQ6 V;  3R66 A;  1YER A;  1GM9 A;  3L75 H;  4XIT A;  3G80 A;  3CCJ V;  1YSC A;  5EC2 C;  1GM8 A;  2LGW A;  3FFQ A;  1Q82 W;  2YI0 A;  3A0W A;  4DV6 O;  2OCC B;  2HHH O;  3EVK A;  3KG2 A;  4LFA O;  4DW0 A;  2QGN A;  3SJQ C;  2RN9 A;  2EIN C;  4I9Q A;  3N2G B;  5IYD O;  4O2B A;  2ZE7 A;  1OCR C;  4WFH A;  1N36 O;  1HNZ B;  4U3J A;  5DED A;  1Z5B A;  5K1X A;  1GN3 A;  1NI8 A;  2C1I A;  4DR7 O;  3FV5 A;  5IJ9 B;  4LF5 B;  4J7J A;  1NH2 D;  4I3H A;  4DV1 B;  5D6Q A;  3Q5L A;  3ZM7 A;  3HYY A;  3OT7 A;  4ASA A;  1RPR A;  1EI1 A;  4FCQ A;  3JAM N;  4NXM B;  3LNU A;  4O2B B;  4WFB V;  1KBH A;  1H2K A;  3K5O A;  1FFX B;  1ZX3 A;  2ZR2 A;  2K5B A;  4O2A B;  2YEB A;  3AG4 C;  1K92 A;  1WN7 A;  2Q2E B;  4BW9 A;  4FMT A;  2RQ6 A;  4RQE A;  3T0H A;  3OTO B;  1P7B A;  4LF8 O;  2O1W A;  2DJV A;  3SPH A;  4O4J A;  2BCC H;  2OIG A;  2F93 B;  2XJJ A;  2WI1 A;  3ZN1 A;  1F4M A;  2P6J A;  1VF5 B;  2GUZ B;  2YS8 A;  2UXX A;  4GX1 A;  5A9G A;  1YC1 A;  3OW2 U;  3GIG A;  4LF4 B;  2XX4 A;  2WEP A;  3JAT A;  5C93 A;  2X0L A;  4YXW G;  2VCJ A;  1NJI W;  1UFI A;  4FM2 A;  3T4D A;  3UO3 A;  5FNC A;  2M6Y A;  5JH7 A;  2VQF B;  1EFR G;  1F4N A;  4QE9 A;  1S16 A;  1EZJ A;  1EN4 A;  2Q4P A;  4GCZ A;  2YKJ A;  4R1F A;  1WB8 A;  5J6A A;  1XHZ A;  3AEI A;  2YEJ A;  2DQ3 A;  3QDD A;  4GKJ O;  4KSH A;  2EIM B;  5H6R A;  4LH6 A;  1RP3 B;  1L0L H;  5FNF A;  3J80 N;  2BTQ B;  2E76 B;  4I0X A;  1LUV A;  2A7W A;  1EZV H;  1R3I C;  3H80 A;  1Z2G A;  4KQV A;  3A0T A;  1TGO A;  4ZHQ B;  3AG3 B;  3I56 V;  4B3T O;  4Z1M G;  1LNQ A;  2HKO A;  3OMI B;  4X65 B;  1ZXM A;  2IH1 C;  2AXT Z;  1YJW V;  3HKB A;  5LGN A;  1JA8 A;  4JI1 O;  5CN0 A;  4H44 B;  1OJH A;  1N32 O;  4BIU A;  3MDS A;  3ZMT A;  3MAQ A;  1AJN A;  4LWI A;  2M7W A;  1GKX A;  2DYR C;  3RW0 A;  5LP6 C;  2UXD O;  3BMY A;  3KE6 A;  4CC6 A;  4ZOL A;  2WEQ A;  3O65 A;  5L3F A;  1NVP D;  3HZ1 A;  4DR2 O;  3RVY A;  5HFM A;  1XBL A;  1JCH A;  2W0F C;  1AP6 A;  3JAR A;  3BM9 A;  5FL7 G;  2ZDI C;  2KB1 A;  1XMO O;  3RN4 A;  4K0K O;  1FXV A;  4R3A A;  3K59 A;  4YKW A;  3ZMU A;  2HG1 A;  1WPX A;  4QNH B;  5BZB A;  4K4O A;  3PJS K;  4JTC B;  3EKO A;  4K8X A;  4JI7 O;  4J7K A;  3K98 A;  4EKW A;  1H2G A;  5CPH A;  3VQW A;  4LF9 B;  2BU6 A;  4PI0 A;  1H2L A;  5M4P A;  1ORQ C;  3SYA A;  4L90 A;  2Q5Z A;  5JQG B;  4X9L A;  4ABM A;  4HNA A;  3A8T A;  1QVF U;  1XDC A;  4LR3 A;  2A79 B;  1GMG A;  1M1K W;  3OMU A;  4X1I A;  3EHH A;  5B1N A;  5D7C A;  3I5D A;  3EKR A;  5H2F Z;  1HNZ O;  4LF7 O;  1I58 A;  3X2Q C;  1K4C C;  3CD6 V;  3H9V A;  1CP9 A;  4HNA B;  2YC0 A;  3CJH B;  1YF2 A;  3IC7 A;  3B24 A;  2F66 C;  1H7U A;  3LDE A;  4DUH A;  2KSD A;  3CCU V;  4JZG A;  3CEI A;  3TZ5 A;  5CB4 B;  3H4L A;  1JVM A;  4H0L B;  4DUZ B;  2X6A A;  2ZR3 A;  5M4H A;  2LFR A;  4PA6 A;  3M7M X;  3SJB C;  1Y76 B;  2YXY A;  2EBO A;  4DV0 O;  4D6T H;  4XKA A;  3TK1 A;  2PI4 A;  4OPA A;  3FYI B;  2Z0A A;  3AG2 C;  3RKZ A;  3CC2 V;  1JM6 A;  3E8G A;  2RNB A;  4Q20 A;  1M5I A;  3GIG B;  1MG1 A;  5EK0 A;  3CHX A;  4DK0 A;  4EB6 A;  1ZL8 B;  2UXN A;  3TTZ A;  1Q6H A;  1S77 D;  1UYI A;  1AJ6 A;  1YT2 A;  5GGZ A;  3UT5 B;  3CC7 V;  2Y0I A;  4UCU A;  4NKG B;  3ABT A;  4FLZ A;  1VQO V;  4UCO A;  3P30 A;  1MAB G;  2YUA A;  1AH6 A;  4AWQ A;  2D3O W;  2IWS A;  3VHC A;  4EFT A;  2QKA A;  5TIS Z;  2Z5U A;  2UU9 B;  4RQF A;  5BY1 A;  3W7T A;  2HKJ A;  5KX5 A;  1QLN A;  2EX3 A;  2OTL V;  3E83 A;  2YK2 A;  2DN9 A;  1SQV H;  4MW3 A;  4H13 B;  4K0K B;  3NXS A;  3U10 A;  5IT9 N;  2NLJ C;  4KHP O;  4DUZ O;  1BHB A;  5EBL C;  1LUW A;  3OMA B;  3RT3 C;  4I50 A; 
#chains in the Genus database with same CATH homology
 4RUF A;  5J9P C;  2ITD C;  4PDR A;  1UYC A;  2YE4 A;  3ZIA G;  4P9O A;  5LBQ A;  2CH4 A;  3K99 A;  4GT8 A;  3R92 A;  1RPO A;  3C11 A;  4AS9 A;  4EFU A;  4PDM A;  2XOK G;  1H7S A;  1UY9 A;  1S3J A;  3HPL C;  2W6I G;  3SYP A;  1VQM V;  1YI2 V;  3C0E A;  3VHD A;  3VHA A;  4R7C A;  1SET A;  1S76 D;  2YEA A;  1I5Y A;  1QY8 A;  4J9Z B;  1KQS U;  2ZXW B;  2XX5 A;  1M90 W;  2XAJ A;  3OE7 G;  2YE8 A;  1BYQ A;  3Q5K A;  3CRK A;  5D7D A;  3B8M A;  5B3S B;  4EM7 A;  2VWC A;  2XCM A;  2OCC C;  2YJX A;  1DLB A;  3OGC C;  5EBM C;  5BOD A;  2QM7 A;  1H38 A;  3CCM V;  2XJG A;  3G6E V;  1I5C A;  1DF4 A;  5E1A C;  4ASF A;  4UVB A;  2XDX A;  4JTA B;  4WFG A;  1OZ0 A;  1TID A;  3NMQ A;  1K8A W;  2FWZ A;  1VQ8 V;  1GO3 F;  1QLE B;  2X7R B;  2QA4 V;  4MBC A;  4O0B A;  1Y4U A;  4XKK A;  2HLD G;  2WLI A;  3D3I A;  2JIZ G;  4LWE A;  2EIL C;  2WER A;  3R4P A;  1J95 A;  3T0Z A;  4HXW A;  3T4Z A;  3GB7 C;  2Z3Y A;  5F5R A;  1RM1 C;  3E8F A;  1VQ9 V;  3OPD A;  1TIL A;  3K03 A;  1M56 B;  2JJ2 G;  2ZDI A;  4FIP C;  3T2M A;  4E01 A;  3OAA G;  3CWV A;  2JJC A;  5FWK A;  1F51 A;  3RVZ A;  2YEC A;  5IY5 C;  4P7A A;  2P7T C;  3ETE A;  2YGE A;  3R91 A;  3B27 A;  5M4M A;  4I5S A;  3W7S A;  2Y48 A;  5CMU A;  2YE5 A;  2BT0 A;  1TBW A;  3FB7 C;  1ZWI C;  4WFE A;  2BTZ A;  2QG2 A;  2ATK C;  5CTU A;  2GSM B;  2Q69 A;  4H33 A;  3A0Y A;  1FXK B;  1NHI A;  3D2R A;  5CTW A;  3LSS A;  1NH2 B;  4PDV A;  4WF9 V;  4H85 A;  1OSF A;  4EGI A;  4BIZ A;  2CCU A;  3W7X A;  1XL4 A;  3R4N A;  4YKY A;  2EIK B;  2WLH A;  3K9A A;  1UJW B;  1Q81 W;  2Q8F A;  4UV9 A;  3OM3 B;  1K73 W;  1NQT A;  2YGA A;  1CPY A;  2EJR A;  5IYC O;  1E1R G;  2YEI A;  3FT5 A;  4CWS A;  3UKM A;  3AG1 B;  2Y69 C;  1N8R W;  3LNM B;  1YTF D;  3SYO A;  1L0O A;  4CE2 A;  3ETG A;  2FTK A;  1B6Q A;  2R9I A;  5KUK A;  1GM7 A;  2ZKJ A;  2DYS C;  4PA3 A;  4R3M A;  3WFV A;  1Y8P A;  3AG2 B;  4KUM A;  4PA9 A;  1AI7 A;  2JK5 C;  2QEX V;  2H8M A;  2YED A;  1KZN A;  2Q8H A;  3F7Y C;  3VAD A;  4P30 A;  3QO5 A;  4HYM A;  2IOR A;  4MP7 A;  5LGU A;  2BYI A;  2WI2 A;  2WLN A;  2WI5 A;  4N23 A;  3JZ3 A;  1GK9 A;  3F7V C;  4JPR A;  1THN A;  4H7Q A;  2DWE C;  4O09 A;  1K97 A;  4XDK A;  1YHQ V;  2JKI A;  1GKZ A;  1YT1 A;  1H8H G;  2EIJ B;  5CTY A;  2YEH A;  3AG1 C;  1EA6 A;  3FB6 C;  1UY6 A;  4EMV A;  1JX9 A;  1Y4M A;  2B5U A;  3ML0 A;  1R73 A;  4FK5 C;  2IU0 A;  3W7W A;  1SER A;  1ID0 A;  2CCS A;  4PRX A;  2XAQ A;  2IJH A;  3U67 A;  2JEX A;  4L87 A;  5L3E A;  4EEH A;  1US7 A;  2EIK C;  4GX2 A;  3K08 A;  4MB9 A;  4CZZ A;  1I5X A;  2YE9 A;  1I5D A;  2XK2 A;  4L91 A;  4LWG A;  4LWF A;  4HZ3 A;  2BOC C;  1FFT B;  4MTO A;  3CXC U;  2IU3 A;  2BU2 A;  3RLR A;  1OHH G;  1G8M A;  2HR3 A;  1GJV A;  4URO A;  2WLM A;  4PU9 A;  2XAB A;  4X8A A;  3H01 A;  1FXH A;  2IWX A;  1P4R A;  1UYD A;  1UY8 A;  4ZBM A;  2YE6 A;  3CCV V;  1PNL A;  1TUE B;  3SYC A;  1QVG U;  4H81 A;  3ZKB A;  2H94 A;  1R3L C;  4KP4 A;  4FCP A;  4MPE A;  3SYQ A;  4O05 A;  5L3B A;  1AI6 A;  1VQK V;  1ZWH A;  3A0X A;  3O6O A;  4ZVI A;  3OMN B;  3T10 A;  1QBZ A;  4LPB A;  4LCU C;  2WSS G;  1KC8 W;  2YGF A;  2B1G A;  4G2K A;  4LP8 A;  4HZ5 A;  4TSF G;  2WWW A;  2EZP A;  2P67 A;  1OCZ B;  4MVR A;  2YJW A;  4YKZ A;  3MD0 A;  3MHH C;  3GIF A;  1L1F A;  5KA5 A;  2W6J G;  4KFM A;  2YE7 A;  4E00 A;  1M9N A;  1UYG A;  3ZRW A;  4JQL A;  4W7T A;  1NVP B;  1QLE C;  2C2A A;  4ASG A;  4GX5 A;  1S14 A;  2HG5 C;  4HYO A;  4R50 A;  3B25 A;  2GFD A;  4JF3 A;  5M4K A;  1MSW D;  3HB3 B;  4YKU A;  4EGH A;  3STZ C;  1VQ6 V;  1YER A;  1YIJ V;  1GM9 A;  4GFN A;  3IGA C;  1R3K C;  5DM6 V;  2X6B A;  2QM8 A;  2CK3 G;  1Z5A A;  1NR1 A;  2V7Q G;  3CCJ V;  2IOQ A;  4XIT A;  5M4N A;  1YSC A;  3FKS G;  1GM8 A;  5EC2 C;  1Q82 W;  2YI0 A;  3A0W A;  4UXN A;  2LFS A;  2WI6 A;  1AJP A;  2OCC B;  2XAS A;  3KG2 A;  3U2D A;  2YI6 A;  1AH8 A;  3SJQ C;  2EIN C;  2YI7 A;  3ZKD A;  5EBW C;  2WLL B;  4NH7 A;  4CWF A;  2MK3 A;  1YIT V;  5IYD O;  3D0B A;  1PNK A;  3SL2 A;  3W7U A;  1OCR C;  1HWY A;  4GQT A;  2WLJ A;  1YES A;  4WFH A;  3B26 A;  4NH9 A;  2O1W A;  4DZY A;  1NHJ A;  4WUB A;  4WUD A;  1AM1 A;  1PNM A;  3BY6 A;  4YKX A;  4R6Z A;  1KP2 A;  1Z5B A;  5KUM A;  3SPG A;  1GTO A;  1S5H C;  2EZO A;  3ABM B;  3LSQ A;  2CCT A;  2DW4 A;  3CYO A;  1YT0 A;  2FXS A;  3EHJ A;  1CEZ A;  3FV5 A;  3WG7 C;  5L3C A;  4GGL A;  4PRV A;  1NH2 D;  4JYB A;  2QG0 A;  3BEH A;  4L8Z A;  4I3H A;  1K9M W;  3ZCC A;  4CWR A;  3G71 V;  5HFL A;  3Q5L A;  4XD8 A;  5D6Q A;  2QF6 A;  2DWD C;  3CCE V;  4JAU A;  1KP3 A;  3HYY A;  1RPR A;  1EI1 A;  4LBE C;  2EIM C;  2XD6 A;  4ASA A;  3FT8 A;  4FCQ A;  3JYC A;  4XIQ A;  4L94 A;  1YSR A;  3LNU A;  2ZD9 A;  5B1B B;  4WFB V;  1KD1 W;  2K1E A;  1R6K A;  1THZ A;  1VQ5 V;  3INX A;  2ZR2 A;  2K5B A;  4X88 A;  4AWO A;  2B1I A;  4XIP A;  4ASU G;  1Z59 A;  1R6N A;  2BU8 A;  2YKC A;  2Q68 A;  5B1A B;  2YEB A;  5LHI A;  1M57 B;  4G28 B;  4YKT A;  3AG4 C;  1K92 A;  4F4L A;  2XAG A;  1W0J G;  3I55 V;  3HEK A;  4AWP A;  2XHX A;  2Q2E B;  4UVA A;  1VQ7 V;  3WQ9 A;  4JTD B;  4FMT A;  3RBZ A;  4RQE A;  2YKB A;  3T0H A;  1KKD A;  1P7B A;  3QO7 A;  3SPJ A;  1SZT A;  2QTO A;  3ZN0 A;  1VQ4 V;  3SPH A;  1UYL A;  4FCR A;  3RLP A;  1W0K G;  3OFN G;  4BXI A;  5GW7 A;  3E89 A;  1QR9 A;  2WI4 A;  4UUJ C;  4DO2 A;  5CBH A;  4H37 A;  2WI1 A;  3ZN1 A;  1F4M A;  2P6J A;  3K0D A;  1YTF B;  1UYF A;  3QO8 A;  2XJJ A;  1I59 A;  2QKS A;  5L3G A;  4V25 A;  2UXX A;  1WLE A;  4GX1 A;  4MPN A;  4MPC A;  4HYP A;  3JCZ A;  5IDM A;  1Y8O A;  1YC1 A;  3O0I A;  2UWD A;  1JQ0 A;  1MOF A;  3IFX A;  4MVU A;  4XDJ A;  3OW2 U;  2WI3 A;  2Q8G A;  4DXW A;  3GIG A;  2XX4 A;  5B1O A;  2WEP A;  5C93 A;  2X0L A;  2WLK A;  4B6C A;  4YXW G;  3ZMZ A;  5IYB O;  4JAS A;  2VCJ A;  2AHZ A;  3B28 A;  1NJI W;  2WPD G;  5H6Q A;  3T4D A;  4XKO A;  4P2Z A;  3ZRS A;  3TET A;  5FNC A;  1K7D A;  4RAI A;  1F23 A;  1EFR G;  4LP0 A;  2BYH A;  1G4Y B;  1F4N A;  5D6P A;  4QE9 A;  1S16 A;  1EZJ A;  2BRE A;  1BKN A;  4KTN A;  2YEE A;  5H9C A;  1JOY A;  2ESA A;  5CBG A;  4GCZ A;  2YI5 A;  2YKJ A;  4P8O A;  2JJ1 G;  2DQ0 A;  1I5A A;  1UYE A;  4R1F A;  2R9R B;  1Y4S A;  3CCR V;  5J6A A;  2X6C A;  2IW5 A;  4MVQ A;  1JPX A;  3AEI A;  2YEJ A;  2ZDY A;  2Q8I A;  1UYM A;  3WHA A;  2DQ3 A;  3G75 A;  3QDD A;  4KSH A;  2EIM B;  5H6R A;  4EGK A;  3OWD A;  1YS3 A;  5FNF A;  3X2Q B;  1UYH A;  4PA7 A;  1NBM G;  2OT5 A;  5FND A;  4CE3 A;  3K06 A;  2HVK C;  2FWY A;  5CF0 A;  1YC4 A;  2ITC C;  1V55 C;  2IJI A;  4UV8 A;  4PEL A;  1OCO B;  1R3I C;  3H80 A;  3K3W A;  3PEJ A;  3INW A;  3GIE A;  4KQV A;  2QE7 G;  4JGS A;  3HYZ A;  3ABL B;  1K5Q A;  3A0T A;  3E2E A;  1OCC C;  4CWQ A;  1SRY A;  3AG3 B;  1U0Z A;  3OW6 A;  1DTO A;  3I56 V;  4LWH A;  3G7B A;  3EHB B;  4Z1M G;  1YJ9 V;  1YC3 A;  2YSU B;  3JD0 A;  3ASO C;  1LNQ A;  2HKO A;  3CCL V;  3CC4 V;  1V54 C;  3ABU A;  3OMI B;  3D36 A;  1ZXM A;  3EHF A;  2IH1 C;  3ASN B;  1YJW V;  2HJF C;  4MOT A;  2BU7 A;  2E0A A;  3OEH G;  1NKD A;  5LGN A;  3FB8 C;  1W2B U;  1B63 A;  3ZXQ A;  5CN0 A;  3ABK C;  1ZW9 A;  3R65 A;  2BRC A;  1S0V A;  3CCS V;  1K34 A;  2PI5 A;  1M57 C;  3JD1 A;  4BIU A;  2YK9 A;  3ZMT A;  4XCL A;  3OEE G;  3JD4 A;  1AJN A;  3QNE A;  4LWI A;  2DYR B;  2M7W A;  3O2F A;  1GKX A;  4GEE A;  3UM7 A;  2DYR C;  1YET A;  3RW0 A;  3EHG A;  3E35 A;  1PVG A;  5BOC A;  2H8P C;  3BMY A;  5J71 A;  3KE6 A;  4JYC A;  3P32 A;  3STL C;  3OWB A;  1EBO A;  3LDC A;  2WEQ A;  4MTX A;  4U7O A;  3ABK B;  4BAY A;  2GQP A;  5L3F A;  4E02 A;  2A9H A;  4QPJ A;  1NVP D;  1VQN V;  3JD2 A;  3ASN C;  3HZ1 A;  3RVY A;  1VQL V;  2CGF A;  1YJN V;  5HFM A;  3WG7 B;  2XAH A;  3E86 A;  4MVZ A;  1JCH A;  1E1Q G;  2W0F C;  3ASO B;  2VCI A;  2XDL A;  2YE2 A;  3BM9 A;  4QPK A;  3MHS C;  5FL7 G;  5L3J A;  2ZDI C;  1A4H A;  1UYK A;  4OXS A;  5F3K A;  4GT1 A;  3CPW U;  1OCC B;  1KEC A;  1SES A;  2KB1 A;  2XDU A;  4MVM A;  2BU5 A;  3G4S V;  1FXV A;  1IXM A;  2OTJ V;  5LHH A;  4HZ0 A;  4R3A A;  2XAF A;  4QE7 A;  4YKW A;  5EC1 C;  3ZMU A;  1WPX A;  2HG1 A;  2XHR A;  4U7N A;  3ZRW B;  3G7E A;  4HY6 A;  4QNH B;  4PL9 A;  3DGE A;  5BZB A;  4CBC A;  3K04 A;  4K4O A;  3PJS K;  4JTC B;  3EKO A;  1H8E G;  1E79 G;  1AMW A;  4L93 A;  3OUS A;  4FJC C;  3R4O A;  1COW G;  1FXK A;  2BZ5 A;  4BW5 A;  3FB5 C;  2XDS A;  4J9Y B;  2YKE A;  3K98 A;  1R62 A;  3LPS A;  4WUC A;  4EKW A;  2XND G;  3TZ2 A;  1H2G A;  2WI7 A;  1K4D C;  3A0Z A;  1PD3 A;  5CPH A;  1MX0 A;  2BU6 A;  2FYP A;  5L3D A;  4WCE V;  1ARO P;  4HXZ A;  4O04 A;  2AKP A;  5M4P A;  2ZBK B;  2YEG A;  5LGT A;  1ORQ C;  3SYA A;  1QZR A;  4L90 A;  2XDK A;  5D7R A;  3LUT B;  3HHU A;  2IOP A;  4LC1 A;  1K5S A;  4GX0 A;  1VQP V;  4CWT A;  4MT8 A;  4XDL A;  4X9L A;  2YEV B;  3CRL A;  1QVF U;  3ZM7 A;  2O1V A;  1S72 V;  1PKX A;  1V54 B;  3EFF K;  4KFG A;  4ASB A;  1K3E A;  3E8H A;  1PL0 A;  2XX2 A;  3E8B A;  2A79 B;  1GMG A;  1M1K W;  3OMU A;  3LDD A;  4MVO A;  1B62 A;  3EHH A;  3AG3 C;  5B1N A;  3EKR A;  5CTX A;  5D7C A;  3ABL C;  4MTG A;  4BQG A;  4TT3 G;  3Q5J A;  1OCO C;  1U2O A;  4R8C A;  1V55 B;  4ZKI A;  1AR1 B;  2DYS B;  3VOU A;  4XTJ A;  1AJQ A;  2WAM A;  1I58 A;  2NNU A;  4HAM A;  3PEH A;  3OUF A;  1FS0 G;  3X2Q C;  4E2L A;  5IDJ A;  5LHG A;  1ENV A;  4BQJ A;  1K4C C;  4QJF B;  3CD6 V;  3CP1 A;  2Y69 B;  1TC6 A;  3ZRV A;  3T1C A;  4XIR A;  2VW5 A;  4KSG A;  1BL8 A;  2JDI G;  1CP9 A;  3ETD A;  4I9W A;  2YEV A;  1GKF A;  4XDM A;  3IC7 A;  3RLQ A;  3ZRX A;  1Z5C A;  4UVC A;  3ZMV A;  2IWU A;  2Q67 A;  2PNR A;  2A0L A;  4JAV A;  3B24 A;  3TZ0 A;  2Q6A A;  3F5W C;  4MP2 A;  3ZXO A;  1H7U A;  4URN A;  4CWO A;  3ZJZ A;  3LDE A;  4DUH A;  3CCU V;  2BOB C;  4URM A;  5B1A C;  3TZ5 A;  1AI4 A;  3H4L A;  1JVM A;  1ZXN A;  2ZDX A;  2X6A A;  2EIJ C;  2ZR3 A;  4RO2 A;  5B1B C;  2LFR A;  4PA6 A;  1KIJ A;  3T2S A;  5M4H A;  2HFE C;  2WLI B;  4PA4 A;  2JEU A;  4NH8 A;  2YEF A;  2HVJ C;  2EBO A;  4MTF A;  2CG9 A;  2IH3 C;  5IY5 B;  4B7P A;  4G27 B;  4XKA A;  3A0R A;  1UY7 A;  1XL6 A;  3TK1 A;  2IJJ A;  4PDL A;  2PI4 A;  1TC0 A;  3FYI B;  3CMA V;  2BSM A;  2QFO A;  1RM1 B;  3AG2 C;  3TUH A;  4YKR A;  3RKZ A;  3CC2 V;  4XC0 A;  1JM6 A;  3E8G A;  5IN9 A;  1K33 A;  2H55 A;  4XBF A;  4Q20 A;  2EIL B;  3K60 A;  3R4M A;  4YKQ A;  3U2K A;  4MS2 A;  5DN6 G;  3K0G A;  1R3J C;  3GIG B;  1MG1 A;  2XHT A;  5EK0 A;  2YKI A;  4O07 A;  1MU5 A;  2UXN A;  4WFF A;  2O1U A;  3TTZ A;  4BAE A;  4CE1 A;  3CCQ V;  4MSW C;  1S77 D;  1BGQ A;  4HY1 A;  2V1D A;  3VBB A;  1UYI A;  4URL A;  2AHY A;  1OCR B;  1YSZ A;  1AJ6 A;  1YT2 A;  2YE3 A;  5GGZ A;  4TWK A;  4RUE A;  2XJX A;  2ZQM A;  1Y66 A;  2GHY A;  3CC7 V;  1Y8N A;  2EIN B;  4N21 A;  5CA3 A;  1Q86 W;  3CGY A;  4FPP A;  4U93 A;  4CWP A;  3ABT A;  1BMF G;  3AG4 B;  1JJ2 U;  3HZ5 A;  3MNR P;  3SPI A;  1VQO V;  5B3S C;  3TZ4 A;  1FXK C;  5CBF A;  2HCH A;  3P30 A;  3IED A;  1MAB G;  1AH6 A;  4AWQ A;  1DF5 A;  1TH8 A;  2D3O W;  1BXD A;  2ZXW C;  3K79 A;  3OR7 C;  1NHH A;  2IJK A;  2IWS A;  3K97 A;  3VHC A;  2Z5U A;  4EFT A;  3CGZ A;  4P9P A;  3CME V;  4CWN A;  2LP7 A;  4RQF A;  3W7T A;  2HKJ A;  4MVS A;  1BHA A;  4QIW F;  3DTU B;  3QTF A;  5KA6 A;  4XE2 A;  1QLN A;  2F43 G;  1M56 C;  3SPC A;  3E83 A;  2P90 A;  2OTL V;  2YK2 A;  3TCU A;  3B77 A;  3ZMS A;  5M4E A;  1NR7 A;  3T1K A;  1I5B A;  3JD3 A;  1AI5 A;  4MW3 A;  1ROP A;  1Q7Y W;  3ABM C;  3M99 B;  2WLL A;  3NXS A;  2NLJ C;  3FYE B;  1BHB A;  1QYE A;  1QR8 A;  1OCZ C;  2EXL A;  3OR6 C;  5EBL C;  4XCJ A;  3GWO A;  3OMA B;  3B8N A;  4MW8 A;  4X89 A;  1QCE A;  4WFA V;  1B3Q A;  4V26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...