4JAUA

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
232
Chain Sequence
SKELERLKRIDRMKTEFIANISHELRTPLTVIKGYAEMIYNSLGELDLSTLKEFLETIIEQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Histidine kinase
total genus 76
structure length 232
sequence length 241
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jauA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4jauA02
2PNRA 4YKYA 1BKNA 3D2RA 1TC0A 4L8ZA 4LP0A 2YE4A 4LWIA 3T0HA 4EMVA 1Y4UA 4LWEA 3H4LA 1TH8A 2CCUA 2YI5A 5CTYA 2YE9A 4H85A 3T1KA 4E02A 5J71A 2FTKA 1PVGA 1NHJA 3TTZA 4EGHA 5FNDA 4I5SA 2CGFA 3LNUA 3R4NA 3T0ZA 3A0RA 4K4OA 2XK2A 2HKJA 2IWUA 4U7OA 3ZXQA 3PEJA 5M4PA 4YKZA 1B62A 5BOCA 4W7TA 4GEEA 2VCJA 4O0BA 3IEDA 3EKOA 3K97A 3A0YA 3RKZA 4HZ0A 4CWQA 3BMYA 1AH8A 4B6CA 4R1FA 4JYCA 2YE3A 1YT0A 3O2FA 1A4HA 1Z5CA 3TZ5A 1QZRA 2CH4A 2XD6A 4Q20A 1QY8A 2YJWA 4CWSA 2VW5A 2VWCA 4HYPA 4GT8A 4O07A 2FWZA 2IOQA 3ZRVA 3QDDA 1U0ZA 3P32A 1B3QA 5D7CA 4XC0A 4P7AA 3R91A 5F3KA 2YE5A 1YC1A 2YECA 4BIUA 3VADA 4URLA 3HZ5A 4EGKA 4XKOA 4PU9A 1Y4SA 2QM8A 5FNFA 4YKQA 3B28A 2YGAA 4PL9A 1YT1A 2EXLA 2IWXA 1AM1A 4MP2A 3VHCA 5M4EA 1UYMA 2ZKJA 4CE1A 2WI2A 3TK1A 1JM6A 2YGEA 3Q5JA 5IN9A 4KTNA 4LC1A 1YSZA 4E00A 2BREA 3U2DA 3HYZA 4EEHA 2BTZA 1H7UA 2H8MA 2WEQA 4MBCA 4ASGA 4U93A 2AKPA 1BYQA 1S14A 4MPNA 2Q8FA 3D0BA 4FCQA 4MB9A 1ZXNA 2QM7A 4CE2A 4WUCA 3CGZA 1Z59A 3Q5LA 4MPCA 4BXIA 4JAVA 3B25A 3NMQA 4AWOA 5GGZA 4EM7A 2Q8HA 4DZYA 4KFGA 2XDUA 4NH8A 3CRKA 1R62A 2WI3A 3K60A 2YI6A 1AMWA 4JQLA 1BXDA 3U67A 3BM9A 3CWVA 3A0WA 2FWYA 5D7RA 1TIDA 1Y8NA 3HZ1A 1L0OA 3R4OA 4L90A 1MX0A 2QF6A 2XX2A 2YEAA 4KSGA 4UROA 1S16A 1KZNA 3A0ZA 4AS9A 5BODA 1US7A 5M4HA 4V26A 3ZXOA 1YS3A 2VCIA 4JASA 4FMTA 4MTXA 4YKTA 3ZKDA 3OMUA 2E0AA 4XCJA 3O6OA 4XIPA 4MOTA 3HYYA 5IDMA 1QYEA 5CTUA 2YE8A 4PRXA 4AWPA 4EFUA 4I3HA 2BRCA 3B27A 4XCLA 2YKJA 2BYHA 2YEBA 3G75A 3JZ3A 4KP4A 4HYMA 4CWTA 4EFTA 1OSFA 2BU8A 1UYKA 4XD8A 1TC6A 1JOYA 1UYFA 4YKUA 3VHDA 2BU7A 3CGYA 2YK2A 4JYBA 4CE3A 4URNA 2WI5A 4KQVA 4AWQA 1GKZA 2YKCA 2Q8GA 4HXZA 4P8OA 2CCSA 2K5BA 1YC3A 3HHUA 1H7SA 2YJXA 2XABA 2IWSA 2XHRA 2XJGA 3A0TA 3EKRA 3G7EA 2O1UA 2WERA 1Y8OA 4H7QA 4URMA 2IORA 1UYCA 5B1NA 4NH7A 4O04A 3INXA 3OW6A 3C11A 4HZ5A 2GQPA 4LPBA 4B7PA 4CWNA 4O05A 1GKXA 4CWFA 3ZRWA 2BU5A 2YKIA 1Z5BA 4YKWA 2O1WA 3MD0A 1UYDA 3EHHA 2YEGA 1ZW9A 2Q8IA 1Z5AA 2YI0A 2QG2A 3LPSA 4CWPA 4R3MA 2HCHA 1GJVA 2WEPA 1I5DA 2YEIA 1YC4A 3GIGA 4XIQA 3WQ9A 3R4MA 3FV5A 3RLQA 4CWRA 2YK9A 2YI7A 1YETA 3WHAA 2ZBKB 1I5BA 1BGQA 5D7DA 4E01A 1UY8A 5D6PA 2LFSA 2ZDYA 4XE2A 4LWHA 4GCZA 2JKIA 4YKXA 1Y8PA 4FCPA 1KIJA 3QTFA 2WI7A 2XJXA 3Q5KA 3OPDA 3KE6A 4GGLA 5FNCA 1TILA 4XKAA 4EGIA 1UYGA 2XHXA 2BU2A 1TBWA 4WUBA 2YEJA 2YEEA 3OWBA 3VHAA 4FPPA 2YGFA 4XITA 2YEHA 2YEDA 3EHFA 4PRVA 2XHTA 3U2KA 2XJJA 5J6AA 3ZM7A 3TZ2A 1ID0A 1UY7A 2GFDA 4V25A 2P67A 1B63A 4CWOA 3K99A 4JAUA 1UYIA 2JJCA 4YKRA 4ZVIA 1MU5A 5CF0A 4XIRA 4QPKA 2XDKA 2XDSA 5M4KA 4KSHA 5C93A 4LWGA 2XDXA 2UWDA 1THNA 2ZDXA 5F5RA 1ZWHA 3DGEA 3D36A 2WWWA 1I58A 3C0EA 4BAEA 2XCMA 4ASAA 2QG0A 2BT0A 4XTJA 3TZ0A 2LFRA 1YESA 1F51A 3ZRXA 4HY1A 3K98A 3EHGA 3FT5A 1YERA 1UYEA 4L93A 3CRLA 4GT1A 4GQTA 5CTWA 2FYPA 5CTXA 2HG1A 3H80A 2XX4A 4L91A 4LWFA 1NHIA 2YE2A 2CG9A 5M4MA 3G7BA 4MT8A 1YSRA 4FCRA 4NH9A 3RLPA 3INWA 5IDJA 2YKBA 2ESAA 4L94A 3B26A 1AH6A 1UY6A 5B1OA 2H55A 4GFNA 4QPJA 1YT2A 2FXSA 2O1VA 3B24A 2WI6A 3HEKA 5FWKA 3T2SA 2BZ5A 1UYLA 3TUHA 1EI1A 4MP7A 2Q2EB 3ZRWB 2YEFA 3OWDA 2YE6A 3PEHA 2YE7A 2BYIA 3GIEA 4WUDA 3EHJA 5L3JA 1I5CA 2XX5A 3NXSA 4R3AA 4BQJA 3ZKBA 3GIGB 2IOPA 2XDLA 1U2OA 4BIZA 4O09A 1I59A 4XKKA 4ZKIA 3O0IA 4BQGA 4HY6A 1UY9A 4DUHA 2BSMA 4H81A 2WI4A 3R4PA 1IXMA 3R92A 3SL2A 1NHHA 4X9LA 1EA6A 4MPEA 3TZ4A 1UYHA 2YKEA 3RLRA 3FT8A 1I5AA 2CCTA 4ASFA 5M4NA 5CPHA 1AJ6A 4U7NA 2C2AA 4XDMA 5D6QA 4HXWA 3ZCCA 3GIFA 2QFOA 3A0XA 1ZXMA 4ASBA 2BU6A 3MNRP 2WI1A 3T10A
chains in the Genus database with same CATH superfamily
1YJWV 3D2RA 4DUYB 3K9AA 1WN7A 4LP0A 2ITDC 4PA3A 1DGSA 1Y4UA 2XT9A 2ZIMA 4QGPA 2YI5A 1BZKA 4YJ2B 2YE9A 3H01A 2Y69C 4E02A 1XOUA 3ZHQA 1IBKO 4LFAO 2R9RB 4I5SA 4DR4B 2Q6AA 2CGFA 3SYCA 5L3BA 5DECA 3JAWA 3VQWA 1MZEA 1WA8A 4DR5O 4XDKA 5M4PA 4PA7A 1QR9A 1NR7A 4O0BA 2K9PA 1MABG 3OMNB 1VQ9V 3D8CA 1SETA 4RO2A 2A79B 3KZIZ 4I9QA 1XDCA 1YT0A 1B04A 2XD6A 1R6TA 2RJZA 4LH6A 4Q20A 4X1KB 2VWCA 3OGIB 1Y76A 3P3NA 5KX5B 1NTZH 1VQOV 1TGOA 3S5TA 1K4DC 2YSUB 2M6YA 2XTAA 3VBBA 1YJ9V 4D7SA 4B3MO 4MVUA 3G67A 1Q81W 2EILC 2BTOA 4JI2O 1HNWO 2RQ6A 3RYHA 2CK3G 3N2KB 4PU9A 5LHHA 1Y4SA 4GKKB 4I7ZB 1NBMG 1S3JA 4PA6A 5JCOC 5KHJA 4YKQA 1K8AW 1XL4A 2AGAA 3FYEB 2YGAA 4JYAO 3ABMC 1WB7A 2IWXA 1IVSA 4FK5C 3AG4B 2ZDIA 2KKWA 1Q86W 4MP2A 3T1YO 2DYSC 1M93A 3BAAA 1R73A 1HW7A 3ICXA 3JCUZ 3QO7A 4G2KA 4UXNA 5CA0B 1N36O 1KC8W 5FL7G 4UCUA 5IN9A 1LUWA 1M5IA 4FFBB 2LQTA 4LC1A 3CCMV 4B3RO 3QVNA 2AW9A 1YSZA 4UCOA 4TUYB 3CCJV 1PNKA 4ASGA 4MBCA 4WCEV 1S14A 4MPNA 1YDXA 4WF9V 4FCQA 4JI6B 1I5XA 1WA8B 5LXTB 2EIJC 4WUCA 3CGZA 3DTUB 1Z59A 2QM4A 4BXIA 2EIMB 2OT5A 3TXQA 5A2QN 5EYPA 3CMAV 4EM7A 2RNBA 4X62B 3FB5C 4DZYA 4LF5B 3JAKA 2IU0A 2JRIA 3K0GA 4RWUA 1SZXA 3L72H 3CWVA 4PA4A 1X4TA 4ZBMA 4HZ3A 4X9QA 1AR1B 2P6JA 2YXLA 2YEAA 1S16A 2WA3A 1RPRA 3A0ZA 1XNQB 5KX5A 1US7A 3HKCB 2QKCA 1VF5B 3P3PA 4ZHQA 1VARA 5LXTA 2ZXWC 4DW1A 2VCIA 4JASA 3OMUA 5IYZB 2E0AA 1YSCA 1EBOA 5KHIA 1XMQO 1E79G 3UKMA 1H2KA 3HYYA 4N21A 1PV0A 3RYIA 5KHHA 2YE8A 4AWPA 3OEEG 1WPBA 2BYHA 3JZ3A 4KP4A 3C90A 1OZ0A 4NB5A 1SS3A 1JOYA 2QWNB 3Q4HA 2BU7A 4LBEC 4JI3B 2LJ2A 4CE3A 3ASNB 4CH3A 1V54C 2GHYA 3B8MA 5KHKA 2YKCA 2QEXV 1NH2B 4HXZA 4ZI7B 2K5BA 3HHUA 4WFAV 5IJ9A 2UUCO 2ZQMA 2F4VB 2WLIA 4FJCC 5LA6A 2P5OA 4AQYB 1N0NA 3C3TA 4H7QA 3GWOA 4URMA 3ABLB 3U11A 1UYCA 4NH7A 4LPBA 3CWBH 2HP8A 5L3EA 2XAHA 4GKJB 4CWNA 5IWAB 1OCOB 1ROPA 2A0LA 2EULA 4JYYA 3EVKA 5KMGB 4DV4O 3F7YC 1Z5VA 2ZCEA 2YKIA 1FS0G 2YEVB 4YKWA 1VEWA 1JCHA 4H37A 3ETQA 3I5DA 2Q67A 3MD0A 1UYDA 5EIBC 3HKEA 4JI7B 4K0KB 3OW2U 3LPSA 1ZUQA 4K8ZA 1GJVA 4TV9B 3GIGA 1OCZB 4YY3B 1PM9A 1JFFB 4GYCB 3ZHRA 4CWRA 2GTSA 4NXMB 1M4UA 2HFEC 4E01A 5KLVH 1UY8A 5D6PA 4Z2WA 5D5PA 1N34O 1I94O 2XAGA 1XNRB 1N4CA 2IH3C 3B2EE 4G28B 3WB1A 3QTFA 1V54B 3KE6A 2OWOA 2WLHA 1TILA 1UFIA 4NTYA 1U96A 1H2LA 1PL4A 1ZAUA 5FNVB 2BU2A 1N32B 1TBWA 3CE2A 3BRCA 4C7UA 1FJGB 2YEJA 4BR6A 3OWBA 4XITA 5EC2C 2YEDA 2UXDB 5LOVA 2XHTA 2EZPA 2IU3A 2XJJA 4TT3G 5J6AA 3ZM7A 1AP6A 5JJEB 5B1BB 2PYLA 5J2UB 1FXKC 2W0XA 1W0JG 1EN4A 4YKRA 1MU5A 1FXHA 1NU1H 2JGDA 4QPKA 5KUMA 5BR8B 4JI4B 4FM2A 1XBLA 1R6KA 3CYOA 2ZE6A 3N2GA 4YHHB 4X66O 5C93A 3H1JH 5B5EZ 3OUSA 4BAEA 5IJ0B 3THOA 4XTJA 1AROP 2LFRA 5JWPA 1YESA 3K98A 1CP9A 2EIKC 3EHGA 1YERA 2N04A 4EEQA 1I5YA 3OTOB 1UPGA 5CTXA 4EFEA 3T2MA 1V9PA 1SQFA 2XX4A 2W0FC 2Y4TA 2EINB 1GAXA 1R3KC 3CEIA 3BCCH 4CH5A 1KKCA 2CG9A 5M4MA 4IHJA 3UM7A 1SRYA 4FCRA 2LW7A 4X66B 3E8HA 3PJSK 4NH9A 3INWA 5L3DA 2K1EA 4L94A 4B7EA 1NTKH 3P30A 5B1OA 2R9AA 1OCCC 2H55A 1G6UA 2YDEA 4UB8Z 5A9GA 3ASOB 4GFNA 1BMFG 2FXSA 4X65B 1EFRG 1D2DA 3B24A 3RYIB 4DV1O 3JAMN 3HEKA 3L9DA 2N74A 3T2SA 2YUAA 2CTWA 4E4EA 1W59A 1UYLA 3G71V 2PI5A 3CRRA 4DR7B 3ZRWB 4FLZA 4R6ZA 2PUSA 4PD4F 3K04A 2IJKA 2BYIA 1I08A 2PYJA 4WUDA 1CXZB 3NXSA 5LMNB 3K9SA 2YXYA 5LBQA 1O9GA 3GIGB 4ZOLA 3BY6A 1YTFB 4UVBA 1N8RW 2XDLA 4A5UB 1NTMH 4O09A 2HVJC 3L74H 5H6RA 3O0IA 3HKEB 4HY6A 3B77A 1K7DA 3E86A 3R4PA 3KCYA 3SL2A 4X9LA 3FB6C 3CC7V 4JAAA 4NXNB 2UUBO 1H2MA 4U3JB 4JTCB 5KMGA 5JCOA 2BTQB 3KG2A 1P7GA 4W4KA 4HXWA 2X6CA 3ML0A 4K0KO 3A0XA 4MTOA 4LNUB 4U3FH 5LL6Y 4I0XB 3SYPA 1VF6A 1E1QG 4MVRA 3T10A 1GN6A 3C3SA 4PDLA 3ZMSA 3W7SA 5LMNO 2PNRA 4YKYA 2XOKG 1XEQA 2HEPA 3ABTA 3B40A 2YE4A 5DM6V 4B08A 4EMVA 4MTFA 1F4MA 1GKFA 4O4HA 4O4JB 4LWEA 3H4LA 1TH8A 1P7BA 4WFGA 1M1KW 4GKJO 2CCUA 4YJ3B 4OX9O 3CB2A 3ZN1A 4CS3A 3BA9A 2ZKOA 4X1IA 4EGHA 2DQ3A 3LNUA 1WP7A 3G6BA 3A0BZ 1MG1A 1KBHA 2IWUA 3PEJA 1BL8A 4YKZA 2VQEB 5KHGA 4IYHA 2F4VO 5LMUO 5BOCA 1MSWD 1YITV 3A0HZ 4TQFA 2VCJA 4JI0B 2GV9A 3EKOA 4J80A 4CBCA 1NS1A 3A0YA 3JSLA 3RYHB 4HZ0A 3JD3A 3BMYA 2E3CA 1AH8A 4TWKA 3ABKB 1NI8A 1SQVH 4R1FA 2YE3A 3H1HH 1JJOA 5IY5C 3TZ5A 1K33A 3SPJA 5F2VO 4WFFA 4LF6B 5EYPB 1OCCB 2VW5A 4HYPA 5B3SC 1JPXA 4UV9A 3E83A 1P84F 3WB0A 3OE7G 3P32A 3LMMA 5D7CA 1HNZO 5F3KA 1JR9A 2Y0IA 4LF4O 1YC1A 2XASA 1XQ8A 4TUYA 1L1FA 3VADA 4URLA 3HZ5A 3DC6A 1S5LZ 3K79A 4K8XA 4DV5O 5FNFA 3ZHSA 3HKBB 1RM1B 3CS5A 3LDCA 3LDEA 3RT3C 2EXLA 5CBHA 1Q3EA 2ZT9B 3AG2C 2WLLB 3AK3A 4LP8A 1W0KG 1N33O 2ZKJA 2FYUH 3W7XA 1I0HA 4IHJB 1S5JA 4IYIA 2EJ7A 4AHCA 1K92A 3M99B 2LGWA 4P30A 1B6QA 2BREA 2EJRA 3MAQA 3CMEV 1DLBA 2WLJA 1HWYA 2H8MA 2WEQA 3JATB 4QNHB 1VF7A 5IYCO 3JASA 2AKPA 1BYQA 4U93A 4E2LA 3TGUH 3VQXA 4DV5B 4H33A 2KG7A 4UCTA 5H6QA 4MB9A 4J7KA 4CE2A 4MVMA 1HR0O 4DK1A 1BQZA 3H1IH 3O65A 4X64O 3Q5LA 4MPCA 4LF4B 3CCQV 5IJ0A 2AXTZ 3B25A 2WA4A 1AI4A 3CRAA 5GGZA 4X1KA 3IC9A 1HNZB 4KFGA 2XDUA 4NH8A 4DRXB 1GTOA 2WI3A 3K60A 3E2EA 1AMWA 4JQLA 4R7CA 2A7WA 1THZA 1N34B 3A0WA 4DR3B 4JF3A 2FWYA 1AVMA 3RW0A 4B7KA 1Y8NA 2MK3A 3R4OA 4L90A 4PDRA 3T1YB 4LWSB 4UROA 1BHBA 3BPZA 4AS9A 3AEIA 3OR7C 5BODA 3RVZA 4GKKO 4U3JA 1XMOO 4KUMA 3GB7C 5CB4A 4FMTA 1H2SB 1Q6UA 2JEXA 2Q7GA 4JTAB 4LFBO 2Q5ZA 3CCRV 4XCJA 3O6OA 4R50A 1BS3A 1TA8A 5BY1A 4GX1A 3EHBB 5CTUA 4I3HA 3UQ8A 1MSDA 4XCLA 5FNVA 2YKJA 1S72V 2YEBA 1JA8A 4PDVA 4HYMA 3ABLC 4LF9O 4EFTA 2O57A 2Z5UA 5KA5A 4GX2A 2FMLA 1NR1A 4XD8A 1UYFA 1PD3A 4YKUA 2CH7B 3CGYA 3ZMVA 4AQYO 1BSMA 4URNA 2RN9A 2WPDG 3T1HB 3HB3B 5E79Z 2WI5A 4LFCB 2UXCO 4KQVA 4AWQA 2UXXA 2Q8GA 1GN4A 2JS3A 1W2BU 2WLKA 3SPCA 1XMOB 4ZIBA 2XHRA 2MW2B 3L73H 4ZOLB 2XJGA 5EIBD 4OGQB 2O1UA 3I55V 3ZRSA 4DYLA 3ZMZA 4NXNO 2ZIOA 4ABMA 1Y8OA 1GM8A 4LH7A 3HKDA 3OW6A 1K73W 1YEWA 4FIPC 1OHHG 4X20A 4ASUG 4CZZA 5JH7B 4O05A 1GKXA 1S5HC 3ZRWA 2BU5A 2GTAA 1HP8A 3IC7A 3L75H 1WB8A 4X20B 4DUYO 2IJHA 3IFXA 1Z5BA 2GSMB 4EKWA 1HR0B 2OCCB 3SGIA 4DR1B 4AILC 1NQTA 4K3AA 2YIAA 1AILA 1YXBA 1QVGU 2WEPA 2YEIA 2PZSA 4XIQA 1FFTB 3RLQA 4DR7O 4OPAA 2YI7A 1GH6A 2ZBKB 2BSKA 2OIEA 5D7DA 1SC5B 3SPGA 3AG7A 2CDYA 1FYJA 5LGTA 4X65O 2AHZA 4GCZA 1Y8PA 1QVFU 3Q5KA 1BT8A 1SKVA 3E89A 4HAMA 3AK2A 3L71H 4EGIA 3LSSA 2XHXA 3E35A 5EC1C 1R1BA 1K34A 1F4NA 4WUBA 3VHAA 1ZX3A 5C8YA 1R3LC 3G4SV 3FB7C 3BEHA 3EHFA 4H44B 4HYOA 1DK1A 2QWOB 3QTCA 5IYZA 5H9CA 3OD4A 5B1AB 1F23A 1S0VA 1ID0A 1UY7A 3JATA 3SJQC 2P67A 4HNAA 2AHYA 2DYSB 4JAUA 4JI1O 1UYIA 2JJCA 1QLEC 1M56C 2CE4A 2OIGA 4LF6O 1N33B 5CF0A 3ZMTA 3H1LH 1M56B 1EM1A 2YIBA 2XDSA 1GK9A 4I50A 3LSUA 4JPRA 4K35A 1NVPD 3ETEA 4YHHO 1BE3H 3AG1B 3OTFA 4O4IB 1FFXB 4JI4O 2UWDA 2ZDXA 1OCRB 5LOVB 1K5QA 2XCMA 4YJ2A 2QG0A 2OYQA 1CEZA 2OCHA 4HY1A 4D6TH 3AK1A 2DWEC 3FT5A 2GDSA 3HKBA 4L93A 3A8TA 4GT1A 4GQTA 4QJFB 1SF9A 3LUTB 1YTFD 4OX9B 5B1AC 3APQA 1XHZA 2FYPA 2KQXA 4LF8O 1AR4A 4L8JA 3QNEA 1NHIA 4DXWA 1S76D 1BGYH 3RYCA 1WLEA 3G7BA 4MT8A 1YVWA 3X2QC 4J7JA 3J80N 1YSRA 3CRQA 4CH4A 2V1DA 1UJWB 1VQ6V 5IDJA 2HKOA 5EZYB 2XAQA 1JMKC 1AH6A 3HKCA 1GM9A 2H8PC 2JK5C 1IBMB 3J7AU 2A9HA 1M9NA 2X0LA 4EB6B 1Y74B 2X7RB 3WU2Z 5IJ9B 3A2FA 4NXMO 2BZ5A 2PTMA 2YEVA 3E22A 3K08A 4LCUC 3CCLV 4BW5A 4PELA 1EI1A 4QE9A 4MP7A 2Q2EB 4I55A 2FL4A 2YEFA 4DK0A 1MNGA 4F6RA 4DRXA 5EBWC 1FAFA 4YJ3A 1FJGO 2EIJB 2ZR2A 5EZYA 2PI4A 2IJJA 2NLJC 4X88A 2Q0AA 2XX5A 3FAVA 3QO8A 4R3AA 4I9WA 5L3CA 1MMMA 3EFFK 3ZKBA 2YIBD 2QKAA 4JI8O 1TUBA 2N05A 1SESA 4J11A 5CN0A 1I94B 2XNDG 1BQ0A 4ZKIA 2F95B 4DUHA 5IT9N 4LNUA 3JD0A 3MHHC 1TVKA 3ZHTA 5B3SB 1NHHA 2UUBB 2ZDIC 1EA6A 1LNQA 4PI2A 2ZNIA 1Z2GA 2YKEA 1HDJA 5JH7A 1H38A 2P06A 5CB4B 1XI1A 5J2TA 4ASFA 5M4NA 3ABMB 1HNXO 4U7NA 4RQEA 2C2AA 1SQBH 4IL6Z 2E74B 2Q8VA 4ASBA 2HR3A 4FLUA 5JQGA 1WPXA 1SZTA 3NR7A 4LFCO 2UXCB 1KU9A 1M57C 3SR2C 4KHPO 2EILB 4O4JA 1H8HG 1TC0A 2P90A 4RUFA 3FFQA 4LWIA 2QTOA 4NTWA 3DC5A 4LF8B 3TETA 5JVDB 2JDIG 5BXZA 3T1KA 3OTOO 2FTKA 1PVGA 1YJNV 1S77D 3TTZA 5FNDA 2UXBB 4JZ2A 5JVDA 3A0RA 5H2FZ 4K4OA 2BTQA 4DV1B 4U7OA 2F93B 1B62A 2F43G 4W7TA 4GEEA 2UUCB 1VQPV 1NKDA 4J41A 4DO2A 3ZHUA 2QDOA 3RKZA 4B3SB 4CWQA 5LGNA 5J2UA 2ZE5A 3H9VA 4JGSA 5BR8O 5FPRA 4JYCA 3QO5A 1A4HA 1QZRA 2CH4A 2GUZA 2PF4E 1MOFA 5B66Z 2YJWA 4CWSA 5CA1A 1WNSA 1WAZA 4O07A 2IOQA 5JJNB 3QDDA 3O9OA 1U0ZA 5EK0A 3ZMUA 2DYRC 1B3QA 4H13B 4G27B 4PA9A 4LF5O 4XC0A 4O2AA 2CTQA 3JARA 1XMQB 3G80A 2YE5A 3TCUA 4X64B 2UXDO 4BIUA 3SPIA 2JIZG 4XKOA 3S3WA 3ZS8C 2QR4A 1H8EG 2HLDG 4J42A 4DW0A 2C1GA 3B28A 2XAJA 2IM9A 3BA8A 4LR3A 4FFKA 3K5NA 5H5NA 4BW9A 2NR5A 1RM1C 3VHCA 1FFXA 5M4EA 1XNRO 4CE1A 2WI2A 3TK1A 1JM6A 2JS5A 2OCCC 3FD9A 4YIOA 2WLMA 1K5SA 3RYFA 1OCZC 1OJHA 2WLNA 3ASOC 1R6NA 4LWSA 4JYAB 1FD9A 3VQYA 4YY3O 3U2DA 3HYZA 4EEHA 1H7UA 4ICGA 3ZX6A 2Q8FA 3D0BA 1ZXNA 2QM7A 2HJDA 1SQQH 1N32O 4UVCA 3EXAA 1JVMA 3KCXA 4AWOA 1D5NA 5CA3A 2Q69A 3BHPA 3CRKA 4GZRB 4IT5A 4L87A 1R62A 4FZ1A 1L0NH 2ADPA 1N36B 1Y66A 3BM9A 1TIDA 3R65A 5KAFZ 3HZ1A 4MSWC 3JARB 1MX0A 2W6IG 1GN2A 1KQSU 2XX2A 1PP9H 4KSGA 1KZNA 1X59A 5IY5B 2QA4V 2X6BA 2G38A 1FPOA 1Y67A 4V26A 5CA1B 3ZXOA 2B1IA 4YXWG 5TISZ 4YKTA 3ZKDA 4JI0O 4RUEA 4DV3O 4JI2B 4I4TB 1KP2A 4NTXA 5LMUB 1KD1W 3T1HO 4P9OA 2LGQA 4I50B 4MTGA 2KB1A 1WJZA 3N2KA 3I56V 4PRXA 4EFUA 1VIBA 3K5LA 3B27A 5B1BC 2IJIA 2EBOA 3JD4A 3RFRA 1YHQV 3G75A 1AI6A 1EZJA 4LF9B 4CWTA 4OPHA 2ZD9A 4MS2A 1QQCA 1SA0A 3CCUV 1UYKA 1QHTA 1TC6A 2YXHA 3VHDA 1VQ8V 4TQDA 4KXRA 2C1IA 4JYBA 2RDCA 2ZINA 3ZN0A 1QLNA 4DV7O 2D3OW 4LFBB 1VF6C 2P4VA 2YIDA 3K03A 1GKZA 4PHZA 2CCSA 3FKSG 1KUQA 1YC3A 1Q7YW 2YI8A 1H7SA 1JFFA 1JQ0A 1QU7A 4DV0B 1VQKV 2HHHO 4DR5B 2M7WA 2DMXA 5FPOA 1AP5A 3B09A 1XNQO 2DW4A 4UCVA 4LFAB 2B5UA 2WLIB 2IORA 1CPYA 4Z1MG 1EN5A 1Q6HA 3INXA 1YZBA 4B7PA 2BOBC 1NH2D 3CHXA 4DR3O 3Q4HB 5J2TB 2Q0OC 2OTLV 2BOCC 1VQ5V 4CWFA 4X62O 1TVKB 4GUNA 2DE0X 2O1WA 3EHHA 1P4RA 1ZW9A 5E1AC 4JI6O 2QG2A 3CX5F 2DJVA 5HFMA 2BE3A 1ENVA 5IYBO 2RCVA 3WQ9A 3R4MA 1WP8A 4JV5B 3ZHVA 1NJIW 5IYDO 2DQ0A 1YETA 3CRCA 4KFMA 4B3RB 4I0XA 3WHAA 3CC2V 1I5BA 1BGQA 2CGNA 1B06A 5DN6G 3SPHA 4FLVA 5LP6B 3APOA 2NNUA 4LWHA 4YKXA 2Y48A 3WG7C 1KIJA 3F5TA 5FNCA 2FB5A 4FLWA 2WAMA 2XHBA 3RWRD 2EIKB 3JSNA 1LUVA 1Y74A 3PN1A 1COWG 5KAIZ 2YEEA 1PKXA 3TJTA 4FPPA 1Q8IA 2YGFA 4PJ0Z 3SYAA 3UO2A 1DTOA 2EINC 1AR5A 1V55C 3K06A 3H1KH 3JYCA 2DOSA 3TZ2A 2UXNA 4B3TO 4J7ZA 2F23A 4Z1VA 4ZHQB 2GBOA 4MW3A 4MVQA 3K99A 4MVOA 2JEUA 4ZVIA 4O4HB 4NKGB 1EZVH 3T1CA 4DV2O 3UCSC 2E5LB 4UUJC 4DR6O 2PGGA 2QKSA 5LA6B 1SQPH 4FLYA 5GW7A 1SQGA 5M4KA 1RSOB 2VWKA 3CJHB 3VQVA 3CSXA 3JAWB 4LWGA 2XDXA 4P9PA 2LW1A 3HR0A 5F5RA 4FZ0A 3DGEA 3D36A 2WWWA 1I58A 3C0EA 1G1XB 1HNWB 3K0DA 1Y6XA 2VQEO 3TZ0A 3ETGA 3E22B 1KYOF 1IBLB 4DR4O 1UYEA 4WFEA 3OUFA 3CRLA 3JD2A 2QGNA 2AZ0A 5CTWA 3FYIB 2Z0AA 4TSFG 4LWFA 2R70A 3U10A 2YE2A 3HPLC 3SJCC 5LYJB 2ARHA 2A06H 4FLXA 3IGAC 2YKBA 2ESAA 1UY6A 2VQFB 1PL0A 4J9YB 4DR6B 1YT2A 2O1VA 1GMGA 4DV2B 4WFHA 2KG7B 3CCSV 4J9ZB 3K59A 4J10A 4UB6Z 2JJ1G 3TUHA 4UCSA 2ZM6O 3TXSA 4ZI7A 1D5AA 1YCIA 1NZ6A 3OWDA 5JQGB 5EBMC 3N27A 5LP6A 3K3WA 1URFA 2CTRA 5L3JA 3M8AA 1E1RG 2XAFA 1M90W 3ETDA 5IE9A 4BQJA 4WBNA 2IH1C 4DV4B 3K5MA 3AG3C 1U2OA 4BIZA 5CBGA 4XKKA 2EX3A 4BIOA 1MA1A 1K3EA 4FFBA 1OCOC 4HNAB 4H81A 2WI4A 2F66C 3R66A 1MZFA 4MPEA 2DN9A 1AJNA 1Y4MA 3FT8A 1I5AA 2CCTA 1OV9A 1XILA 1AJ6A 1XHXA 4XDMA 5D6QA 3ZCCA 2PY5A 3GIFA 5CMUA 3W7UA 1QLEB 2BU6A 3MNRP 3CC4V 3OR6C 5LHIA 1BKNA 2QWPB 4JZGA 4L8ZA 3T4ZA 3ASNC 1H2NA 3OMAB 3T0HA 2CAZC 3F7VC 1KB9F 3RYFB 2P7TC 5CTYA 3U0ZA 4P2ZA 4H85A 5J71A 2ZM6B 2BSKB 2ZXWB 1NHJA 1VQLV 2P4KA 4JTDB 3R4NA 2UUAB 3T0ZA 1QBZA 2XK2A 3MHSC 2HKJA 3ZXQA 1AJQA 1Q43A 1IX9A 4UVAA 5JJJB 1RSOA 4DV0O 2VWJA 2FKXA 4RAIA 3IEDA 3K97A 2OTJV 1VQMV 2VQFO 2L6LA 1QR8A 4TOIA 1Q82W 3K57A 1TUBB 4DV7B 3AG2B 3W7WA 4B6CA 2DWDC 3O2FA 2EIMC 1Z5CA 4F6EA 3UT5B 1QY8A 4X89A 3CXHF 4GT8A 2FWZA 2V7QG 3OMIB 1KKDA 2X6AA 3ZRVA 1BCCH 4KL1A 3HKDB 2V4DA 3OAAG 5GONB 4CC5A 4I55B 4O4IA 4FM1A 4RQFA 4P7AA 4TV8B 3R91A 1DF5A 4BWAA 5BMVB 4O2BA 3E8FA 2YECA 2Z3YA 4DV3B 4EGKA 2L35A 2ATKC 2QM8A 1ORQC 5LHGA 1IDSA 3AG4C 4PL9A 1YT1A 1ZLZA 3DSQA 1J95A 1F7YA 4NYKA 1AM1A 2WSSG 1UYMA 1N0JA 3MDSA 2QWRB 4CS4A 3RYCB 2NN4A 5LYJA 4UV8A 1A32A 2YGEA 3Q5JA 4KTNA 1J5EO 5BMVA 3AG3B 3X2QB 4PDMA 4E00A 5GONA 1YI2V 3B8NA 2BTZA 1IURA 1QNMA 3IJ4A 2LP7A 3CYGA 1RP3B 1JX9A 4JI7O 1KECA 2E76B 2P22C 1YIJV 4JAVA 4WFBV 4DR2O 2VS0A 3NMQA 3DXRB 2Q7EA 3QF7A 3WG7B 2Q8HA 3BVOA 3GVMA 4R8CA 4O4LB 4QE7A 1SQXH 5LP6C 1XL6A 3JD1A 2ZE7A 2YI6A 1BXDA 5IWAO 3U67A 1O9HA 1Z5WA 4MVZA 5D7RA 3SJBC 3M7MX 1L0OA 2B1GA 5J9PC 2QF6A 3CCVV 5CBFA 4MVSA 4QIWF 1K4CC 4EFBA 5ITZB 2ITCC 5M4HA 4JI5O 1VQNV 5BZBA 2H3OA 4BAYA 4W4LA 4GLXA 1YS3A 2Y69B 4F6RB 3FAVB 4MTXA 5AG2A 3D3QA 3JASB 3FB8C 3IAYA 3WFVA 2YI9A 1TUEB 4F4LA 4XIPA 2R9IA 1ZL8B 4MOTA 1FKAO 4JI3O 5IDMA 1QYEA 3RN4A 3N2GB 5FLXN 2Y0PA 2BRCA 4GX0A 2Q9LA 3ZIAG 5GTHZ 1OSFA 2BU8A 1P49A 3BABA 1US6A 1AJPA 4EB6A 1FXVA 5KA6A 4FM0A 3OGCC 3SDLA 3E8BA 2YK2A 1GRJA 4FVMA 4UFZA 2DYRB 4X1IB 4XDJA 2HHHB 3CP1A 3S3XA 4B3SO 3JALB 3OM3B 5D5QA 2CUGA 3L70H 3D36C 4P8OA 1U97A 1TAEA 4H0LB 2YJXA 3G6EV 2XABA 2IWSA 3A0TA 3EKRA 3E8GA 4JI5B 3OFNG 3G7EA 2XUMA 1FXKA 4DV6B 2WERA 2ADQB 4O2AB 2UXBO 3K58A 2BCCH 3ZBHA 3JALA 2RMKB 3CCEV 5B1NA 1XUQA 2ZNJA 3UO3A 4O04A 4GX5A 5CA0A 4XDLA 3DXRA 2JJ2G 3C11A 4HZ5A 2GQPA 2IW5A 4WBNB 3WB2A 2Q7HA 2R72A 1YF2A 3LSQA 3GWKC 2AZ2A 2YEGA 2Q8IA 1IXBA 2YICA 3D3IA 1Z5AA 1LR1A 2YI0A 4NVPA 2YS8A 1ZL8A 2EZOA 2HJFC 4CS2A 4CWPA 4YIPA 4R3MA 2Q68A 2HCHA 1ZSPA 5LGUA 1I5DA 1YC4A 3FV5A 4PI0A 1M57B 2YK9A 3ABKC 1DF4A 4X1YA 4CH6A 1J5EB 2HVKC 4Q6GA 4MW8A 4HBNA 2IBZH 1K97A 5K1PA 2CH7A 2LFSA 2D2CB 2ZDYA 2QSAA 4XE2A 3CPWU 2JKIA 4DUZB 4FCPA 2WI7A 1GN3A 2XJXA 3OPDA 4GGLA 4XKAA 3JCZA 1G8MA 2QTSA 4DR2B 5C8YB 4X8AA 1UYGA 3LNNA 1R3JC 1ZWIC 5GTIZ 4TV8A 3OT7A 5DEDA 1PNMA 4OXSA 2A3QA 4LF7B 1Q90D 2YEHA 1Q5OA 4B3MB 4PRVA 4XBFA 3U2KA 2JVDA 2GUZB 2WLLA 4N23A 3RVYA 2YC0A 2W6JG 1L8DA 4PV1B 3CJHA 2GFDA 4V25A 4NR1A 1B63A 5L3FA 4CWOA 3F5WC 2ZE8A 1VP7A 3FX7A 1VMGA 4XIRA 4UCRA 5L3GA 1IBMO 2XDKA 2ZR3A 1K9MW 4E72A 1I7FA 4KSHA 2F1MA 3SYOA 1THNA 1Y76B 2H94A 1XREA 1ZWHA 1R3IC 1SERA 4FLTA 4IGGA 4ASAA 2BT0A 5EBLC 3T4DA 2HG5C 1F51A 3ZRXA 2JGUA 3ABUA 4O2BB 4B3TB 4TV9A 1IBLO 1RFYA 3SYQA 1IBKB 5HFLA 3QG5A 2JGDB 2HG1A 3H80A 4L91A 3ZJZA 5K1XA 3J81N 4LF7O 3CRMA 3ZEDA 2Q73A 3LDDA 4D7TA 3RLPA 2HHIA 3VOUA 3JAKB 1T5EA 2CGOA 3B26A 2B9ZA 3SJAC 2ETNA 4DUZO 1G4YB 2Y4UA 2QE7G 3CD6V 4QPJA 2E5LO 1OCRC 3UT5A 2WI6A 4JI1B 1AB3A 4IIJA 1VQ7V 3AG1C 5FWKA 2UUAO 1H2GA 3STZC 3RGBA 1KP3A 1PPJH 5KUKA 4IIJB 2UU9O 4JV5O 2QWQB 4O4LA 2E75B 2Q4PA 2YE6A 1V55B 3PEHA 2YE7A 1L0LH 2ILMA 3KKYA 3GIEA 3RBZA 1IZ3A 3EHJA 1GO3F 1I5CA 5JENA 4KHPB 3OEHG 3BFRA 4AI8A 3LNMB 2IOPA 1VQ4V 1NVPB 1I59A 1EN6A 1HNXB 4BQGA 1UY9A 2BSMA 1RPOA 2UU9B 1AI7A 3R92A 1KMIZ 1IXMA 1NT2B 4I4TA 1QCEA 3TZ4A 2KSDA 1UYHA 3RLRA 2QJ1A 4DV6O 2VRZA 1AI5A 5CPHA 1ZTEA 3B4SA 3W7TA 2CTPA 1JJ2U 2QFOA 5ITZA 1PNLA 1Q6IA 4JI8B 1BHAA 1ZXMA 4DR1O 4CC6A 4X1YB 1FXKB 1GM7A 2LO1A 3STLC 3CXCU 2WI1A 2ODMA 1SA0B 3K5OA
chains in the Genus database with same CATH topology
1M57C 3OR6C 4PDLA 3ZMSA 2EILB 5LHIA 1H8HG 3W7SA 2XOKG 1YJWV 3K9AA 1BKNA 2P90A 1TC0A 3D2RA 4L8ZA 3ABTA 4LP0A 4RUFA 2YE4A 2ITDC 3T4ZA 4LWIA 3ASNC 5DM6V 4PA3A 3OMAB 2QTOA 3T0HA 3F7VC 4MTFA 4EMVA 1F4MA 1GKFA 1Y4UA 4LWEA 3H4LA 1TH8A 3TETA 1P7BA 4WFGA 1M1KW 2P7TC 2CCUA 2YI5A 2JDIG 5CTYA 4P2ZA 2YE9A 4H85A 3T1KA 3H01A 2Y69C 3ZN1A 4E02A 2FTKA 5J71A 1PVGA 2ZXWB 1YJNV 1S77D 1NHJA 3TTZA 4EGHA 2DQ3A 2R9RB 4I5SA 1VQLV 2Q6AA 2CGFA 3LNUA 4JTDB 3R4NA 5FNDA 3A0RA 1QBZA 3SYCA 5L3BA 3MHSC 2XK2A 4K4OA 3T0ZA 2HKJA 1MG1A 4U7OA 1AJQA 2IWUA 3PEJA 4UVAA 1BL8A 4XDKA 4YKZA 1B62A 5M4PA 5BOCA 2F43G 4PA7A 1QR9A 1MSWD 4GEEA 1YITV 1NR7A 4W7TA 2VCJA 4O0BA 4RAIA 1MABG 3IEDA 1VQPV 3EKOA 3K97A 1NKDA 4CBCA 2OTJV 1VQMV 4DO2A 3A0YA 3OMNB 1VQ9V 1QR8A 3RKZA 1Q82W 4HZ0A 3JD3A 4CWQA 3BMYA 5LGNA 1SETA 3AG2B 3W7WA 1AH8A 4RO2A 2A79B 4TWKA 3ABKB 4B6CA 4JGSA 4R1FA 2DWDC 4JYCA 2YE3A 1YT0A 2EIMC 3QO5A 5IY5C 1A4HA 1QZRA 1Z5CA 1K33A 2CH4A 2XD6A 3TZ5A 4Q20A 1QY8A 3SPJA 1MOFA 4WFFA 4X89A 2YJWA 4CWSA 1OCCB 2VW5A 2VWCA 4GT8A 4HYPA 2FWZA 5B3SC 2IOQA 2V7QG 3OMIB 4O07A 1KKDA 1JPXA 2X6AA 4UV9A 3ZRVA 3E83A 3QDDA 1U0ZA 5EK0A 3OAAG 3ZMUA 3OE7G 1VQOV 2DYRC 3P32A 1B3QA 5D7CA 4G27B 1K4DC 2YSUB 4PA9A 3VBBA 4RQFA 4XC0A 1YJ9V 4P7AA 3R91A 1DF5A 5F3KA 2YE5A 1YC1A 3TCUA 4MVUA 2XASA 3E8FA 1Q81W 2EILC 1L1FA 4BIUA 2YECA 2Z3YA 3HZ5A 3VADA 4URLA 4EGKA 3SPIA 2JIZG 3K79A 2CK3G 4XKOA 1H8EG 2HLDG 4PU9A 5LHHA 2ATKC 2QM8A 1ORQC 1Y4SA 5LHGA 5FNFA 1NBMG 1S3JA 4PA6A 4YKQA 3B28A 1K8AW 1XL4A 3FYEB 2XAJA 3AG4C 1RM1B 2YGAA 4PL9A 1YT1A 3LDCA 3LDEA 3ABMC 2EXLA 2IWXA 5CBHA 3AG4B 1J95A 2ZDIA 3AG2C 4FK5C 2WLLB 1RM1C 1Q86W 2WSSG 1W0KG 4LP8A 1AM1A 4MP2A 3VHCA 5M4EA 1UYMA 2DYSC 2ZKJA 3W7XA 4CE1A 1R73A 3TK1A 2WI2A 3QO7A 4G2KA 4UV8A 4UXNA 1JM6A 1KC8W 5FL7G 2YGEA 2OCCC 3Q5JA 5IN9A 4KTNA 2WLMA 1K92A 3M99B 1K5SA 4P30A 1B6QA 1OCZC 4LC1A 3CCMV 3AG3B 2WLNA 3X2QB 3ASOC 1R6NA 4PDMA 1YSZA 4E00A 2BREA 2EJRA 1YI2V 3B8NA 3HYZA 3U2DA 3CMEV 2BTZA 4EEHA 3CCJV 1DLBA 1H7UA 2WLJA 1HWYA 1PNKA 2H8MA 2WEQA 4QNHB 4WCEV 4MBCA 4ASGA 5IYCO 4U93A 2LP7A 1BYQA 1S14A 2AKPA 4E2LA 4H33A 4MPNA 1JX9A 2Q8FA 4WF9V 5H6QA 3D0BA 1I5XA 4FCQA 1ZXNA 2QM7A 4MB9A 2EIJC 4CE2A 1KECA 4MVMA 4WUCA 4UVCA 3DTUB 3CGZA 1Z59A 3Q5LA 4MPCA 1YIJV 4BXIA 1JVMA 4JAVA 4WFBV 3CCQV 2EIMB 3B25A 1AI4A 2OT5A 3NMQA 3WG7B 5GGZA 4AWOA 3CMAV 5CA3A 2Q69A 2Q8HA 3FB5C 4R8CA 4DZYA 4EM7A 4KFGA 2IU0A 2XDUA 4NH8A 3CRKA 4QE7A 3K0GA 4L87A 1GTOA 1R62A 1XL6A 3JD1A 2WI3A 3K60A 3E2EA 1AMWA 2YI6A 4JQLA 4R7CA 1BXDA 3U67A 1THZA 1Y66A 3A0WA 2FWYA 4JF3A 4PA4A 3BM9A 4MVZA 3RW0A 1TIDA 4ZBMA 1Y8NA 5D7RA 3R65A 4HZ3A 3HZ1A 2MK3A 4MSWC 1L0OA 3R4OA 2B1GA 4PDRA 5J9PC 2W6IG 1KQSU 1MX0A 4L90A 2QF6A 1AR1B 2P6JA 5CBFA 3CCVV 1BHBA 2XX2A 2YEAA 1S16A 4KSGA 4UROA 4MVSA 1RPRA 1KZNA 4QIWF 1K4CC 3A0ZA 5IY5B 3AEIA 3OR7C 2ITCC 2QA4V 3RVZA 1US7A 4AS9A 5BODA 2X6BA 5M4HA 1VQNV 5BZBA 3R92A 4BAYA 4V26A 3ZXOA 2ZXWC 2B1IA 4YXWG 1YS3A 2Y69B 4KUMA 3GB7C 2VCIA 4JASA 4FMTA 4MTXA 4YKTA 3ZKDA 3OMUA 4RUEA 2JEXA 3FB8C 1KP2A 2E0AA 1YSCA 1EBOA 4JTAB 1KD1W 3WFVA 4P9OA 1TUEB 4MTGA 3CCRV 4XCJA 2KB1A 1E79G 4F4LA 3UKMA 2R9IA 3O6OA 4XIPA 4MOTA 4R50A 3HYYA 5IDMA 4N21A 4GX1A 3I56V 1QYEA 3EHBB 2YE8A 4PRXA 4AWPA 4EFUA 3ZXQA 3OEEG 5CTUA 4I3HA 2BRCA 3B27A 5B1BC 4XCLA 2IJIA 4GX0A 1S72V 2YKJA 2BYHA 2EBOA 3JD4A 1YHQV 2YEBA 4PDVA 3G75A 3JZ3A 1AI6A 1EZJA 4KP4A 4HYMA 1OZ0A 3ZIAG 3ABLC 4CWTA 2ZD9A 4EFTA 1OSFA 2BU8A 4MS2A 2Z5UA 5KA5A 4GX2A 1AJPA 1NR1A 3CCUV 1UYKA 4XD8A 1TC6A 1JOYA 1UYFA 1PD3A 4YKUA 3VHDA 1VQ8V 2BU7A 1FXVA 5KA6A 4LBEC 3OGCC 3CGYA 3E8BA 3ZMVA 2YK2A 4JYBA 4CE3A 3ASNB 4URNA 1V54C 2DYRB 3ZN0A 1QLNA 2GHYA 2WPDG 2D3OW 4XDJA 3CP1A 3B8MA 3HB3B 3OM3B 2WI5A 4KQVA 4AWQA 2UXXA 3K03A 1GKZA 2YKCA 2Q8GA 2QEXV 1NH2B 4HXZA 4P8OA 2CCSA 3FKSG 2K5BA 1W2BU 1YC3A 2WLKA 3SPCA 3HHUA 1Q7YW 4WFAV 1H7SA 2YJXA 1JQ0A 3G6EV 2XABA 2IWSA 2ZQMA 2XHRA 2XJGA 1VQKV 3E8GA 3A0TA 2WLIA 3EKRA 3OFNG 2M7WA 4FJCC 2O1UA 3G7EA 1FXKA 3I55V 2DW4A 2WERA 3ZRSA 3ZMZA 1Y8OA 4H7QA 3GWOA 1GM8A 3ABLB 2B5UA 2WLIB 1UYCA 3CCEV 1CPYA 5B1NA 4Z1MG 2IORA 4NH7A 4O04A 4GX5A 4XDLA 3INXA 3OW6A 2JJ2G 3C11A 4HZ5A 2GQPA 2IW5A 1K73W 4LPBA 5L3EA 2BOBC 2XAHA 1NH2D 4B7PA 4CWNA 4FIPC 1OHHG 4ASUG 4CZZA 1OCOB 1ROPA 2A0LA 4O05A 2OTLV 2BOCC 1S5HC 3F7YC 3ZRWA 3IC7A 1VQ5V 1GKXA 2BU5A 4CWFA 2YKIA 1FS0G 2IJHA 2YEVB 3IFXA 1Z5BA 4YKWA 3LSQA 2O1WA 1JCHA 2GSMB 4H37A 3MD0A 2Q67A 1UYDA 4EKWA 1P4RA 3EHHA 2YEGA 1ZW9A 2OCCB 2Q8IA 5E1AC 3D3IA 1Z5AA 2YI0A 1NQTA 2QG2A 2EZOA 2HJFC 5HFMA 3OW2U 3LPSA 4CWPA 4R3MA 1ENVA 2Q68A 5IYBO 2HCHA 1QVGU 1GJVA 2WEPA 5LGUA 1I5DA 2YEIA 1YC4A 3GIGA 1OCZB 4XIQA 1FFTB 3WQ9A 3R4MA 3FV5A 3RLQA 4CWRA 1NJIW 1M57B 5IYDO 2YK9A 2DQ0A 1YETA 3ABKC 1DF4A 4KFMA 2YI7A 3WHAA 2ZBKB 3CC2V 1I5BA 2HVKC 1BGQA 2HFEC 4MW8A 5DN6G 5D7DA 4E01A 1K97A 3SPHA 1UY8A 5D6PA 3SPGA 2LFSA 5LGTA 2ZDYA 4XE2A 2AHZA 2XAGA 3CPWU 2NNUA 4GCZA 2JKIA 4LWHA 2IH3C 4YKXA 4G28B 2Y48A 3WG7C 1QVFU 1Y8PA 1KIJA 3QTFA 1V54B 2WI7A 2XJXA 3Q5KA 4FCPA 3OPDA 3KE6A 4GGLA 2WLHA 5FNCA 1TILA 4XKAA 3JCZA 1G8MA 3E89A 4HAMA 4EGIA 2WAMA 4X8AA 1UYGA 3LSSA 1R3JC 1ZWIC 2XHXA 3E35A 5EC1C 2BU2A 2EIKB 1TBWA 1COWG 3O2FA 1K34A 1F4NA 4WUBA 2YEJA 2YEEA 1PNMA 1PKXA 4OXSA 3OWBA 3VHAA 1R3LC 4FPPA 3G4SV 2YGFA 2YEHA 4XITA 5EC2C 3FB7C 3BEHA 2YEDA 3EHFA 3SYAA 4HYOA 1DTOA 4PRVA 4XBFA 2XHTA 3U2KA 2EINC 2EZPA 2IU3A 4TT3G 1V55C 3K06A 5H9CA 2XJJA 2WLLA 4N23A 5J6AA 3JYCA 3RVYA 3TZ2A 3ZM7A 2W6JG 2PNRA 5B1AB 1F23A 2UXNA 1S0VA 1ID0A 1UY7A 2GFDA 4V25A 3SJQC 2P67A 2AHYA 1B63A 5L3FA 5B1BB 4CWOA 3F5WC 1FXKC 4MW3A 2DYSB 4MVQA 3K99A 4JAUA 4MVOA 1W0JG 2JEUA 1UYIA 2JJCA 1QLEC 1M56C 4YKRA 3T1CA 1MU5A 1FXHA 4ZVIA 4UUJC 5CF0A 3ZMTA 4XIRA 5L3GA 4BAEA 4QPKA 2QKSA 1M56B 2XDKA 2ZR3A 5KUMA 1GK9A 5GW7A 2XDSA 5M4KA 1K9MW 4JPRA 4KSHA 1NVPD 1R6KA 3ETEA 3CYOA 3SYOA 3AG1B 5C93A 4LWGA 2XDXA 4P9PA 2UWDA 1THNA 3OUSA 2ZDXA 5F5RA 1OCRB 2H94A 1ZWHA 3DGEA 3D36A 1R3IC 1K5QA 2WWWA 1SERA 1I58A 3C0EA 2XCMA 4ASAA 2QG0A 3K0DA 2BT0A 4XTJA 1CEZA 1AROP 5EBLC 3TZ0A 3ETGA 2LFRA 3T4DA 2HG5C 1YESA 1F51A 3ZRXA 4HY1A 3K98A 1CP9A 2DWEC 2EIKC 3EHGA 3FT5A 1YERA 1UYEA 3ABUA 4WFEA 3SYQA 4L93A 5HFLA 3OUFA 3CRLA 4GT1A 3JD2A 4GQTA 1I5YA 4QJFB 3LUTB 1YTFD 5B1AC 5CTWA 3FYIB 2FYPA 5CTXA 2HG1A 3T2MA 3H80A 4TSFG 2XX4A 4L91A 2W0FC 4LWFA 2EINB 3QNEA 3ZJZA 1NHIA 2YE2A 3HPLC 1R3KC 4DXWA 1S76D 2CG9A 5M4MA 1WLEA 3LDDA 3G7BA 4MT8A 1YSRA 3X2QC 3CWVA 3UM7A 1SRYA 4FCRA 3IGAC 3E8HA 3PJSK 2V1DA 1UJWB 3INWA 1VQ6V 4NH9A 5IDJA 3VOUA 2YKBA 3RLPA 2HKOA 2ESAA 5L3DA 2K1EA 2XAQA 4L94A 3B26A 1AH6A 3P30A 1UY6A 5B1OA 3CC4V 1GM9A 1OCCC 1PL0A 2H55A 2H8PC 2JK5C 1G4YB 2A9HA 3ASOB 4J9YB 2QE7G 4GFNA 1M9NA 3CD6V 4QPJA 1BMFG 1YT2A 2X0LA 1EFRG 2FXSA 2O1VA 1GMGA 3B24A 1OCRC 2WI6A 2X7RB 4WFHA 1VQ7V 3CCSV 3AG1C 4J9ZB 3HEKA 5FWKA 1H2GA 3STZC 2BZ5A 3T2SA 1KP3A 2JJ1G 2YEVA 3G71V 1UYLA 5KUKA 3K08A 4LCUC 2PI5A 3CCLV 3TUHA 4BW5A 4PELA 1EI1A 4QE9A 4MP7A 2Q2EB 3ZRWB 2YEFA 3OWDA 4R6ZA 3K04A 5EBWC 1V55B 5EBMC 2YE6A 3PEHA 2IJKA 2YE7A 2BYIA 3K3WA 3GIEA 4WUDA 3RBZA 2EIJB 2ZR2A 3EHJA 5L3JA 1E1RG 1GO3F 2IJJA 2NLJC 4X88A 2XAFA 3NXSA 3QO8A 1M90W 2PI4A 1I5CA 2XX5A 4R3AA 3OEHG 3ETDA 4I9WA 5L3CA 4BQJA 3EFFK 5LBQA 3ZKBA 3LNMB 3GIGB 2IOPA 2IH1C 4YKYA 3BY6A 1YTFB 1VQ4V 4UVBA 1N8RW 3AG3C 1U2OA 4BIZA 1NVPB 2XDLA 1I59A 4O09A 5CBGA 1SESA 5CN0A 2HVJC 4XKKA 2XNDG 5H6RA 4ZKIA 3O0IA 4BQGA 4HY6A 4URMA 1UY9A 1K3EA 2BSMA 4DUHA 1RPOA 3JD0A 1OCOC 1AI7A 3B77A 3MHHC 4H81A 1K7DA 3E86A 1IXMA 2WI4A 3R4PA 5B3SB 1NHHA 4X9LA 3FB6C 3SL2A 2ZDIC 3CC7V 1EA6A 4MPEA 1QCEA 1AJNA 1Y4MA 3TZ4A 1LNQA 1UYHA 2YKEA 3RLRA 3FT8A 1I5AA 1H38A 2CCTA 4JTCB 4ASFA 5M4NA 1AI5A 3ABMB 5CPHA 1AJ6A 4U7NA 3KG2A 4RQEA 2C2AA 4XDMA 3W7TA 5D6QA 4HXWA 3ZCCA 1JJ2U 2X6CA 2QFOA 5CMUA 3GIFA 3ML0A 3A0XA 1PNLA 4MTOA 2HR3A 1QLEB 3W7UA 1BHAA 1ZXMA 4ASBA 1WPXA 2BU6A 1SZTA 1FXKB 1GM7A 3SYPA 3STLC 3CXCU 2WI1A 3MNRP 1E1QG 4MVRA 3T10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNR A;  4YKY A;  1BKN A;  3D2R A;  1TC0 A;  4L8Z A;  4LP0 A;  2YE4 A;  4LWI A;  3T0H A;  4EMV A;  1Y4U A;  4LWE A;  3H4L A;  1TH8 A;  2CCU A;  2YI5 A;  5CTY A;  2YE9 A;  4H85 A;  3T1K A;  4E02 A;  5J71 A;  2FTK A;  1PVG A;  1NHJ A;  3TTZ A;  4EGH A;  5FND A;  4I5S A;  2CGF A;  3LNU A;  3R4N A;  3T0Z A;  3A0R A;  4K4O A;  2XK2 A;  2HKJ A;  2IWU A;  4U7O A;  3ZXQ A;  3PEJ A;  5M4P A;  4YKZ A;  1B62 A;  5BOC A;  4W7T A;  4GEE A;  2VCJ A;  4O0B A;  3IED A;  3EKO A;  3K97 A;  3A0Y A;  3RKZ A;  4HZ0 A;  4CWQ A;  3BMY A;  1AH8 A;  4B6C A;  4R1F A;  4JYC A;  2YE3 A;  1YT0 A;  3O2F A;  1A4H A;  1Z5C A;  3TZ5 A;  1QZR A;  2CH4 A;  2XD6 A;  4Q20 A;  1QY8 A;  2YJW A;  4CWS A;  2VW5 A;  2VWC A;  4HYP A;  4GT8 A;  4O07 A;  2FWZ A;  2IOQ A;  3ZRV A;  3QDD A;  1U0Z A;  3P32 A;  1B3Q A;  5D7C A;  4XC0 A;  4P7A A;  3R91 A;  5F3K A;  2YE5 A;  1YC1 A;  2YEC A;  4BIU A;  3VAD A;  4URL A;  3HZ5 A;  4EGK A;  4XKO A;  4PU9 A;  1Y4S A;  2QM8 A;  5FNF A;  4YKQ A;  3B28 A;  2YGA A;  4PL9 A;  1YT1 A;  2EXL A;  2IWX A;  1AM1 A;  4MP2 A;  3VHC A;  5M4E A;  1UYM A;  2ZKJ A;  4CE1 A;  2WI2 A;  3TK1 A;  1JM6 A;  2YGE A;  3Q5J A;  5IN9 A;  4KTN A;  4LC1 A;  1YSZ A;  4E00 A;  2BRE A;  3U2D A;  3HYZ A;  4EEH A;  2BTZ A;  1H7U A;  2H8M A;  2WEQ A;  4MBC A;  4ASG A;  4U93 A;  2AKP A;  1BYQ A;  1S14 A;  4MPN A;  2Q8F A;  3D0B A;  4FCQ A;  4MB9 A;  1ZXN A;  2QM7 A;  4CE2 A;  4WUC A;  3CGZ A;  1Z59 A;  3Q5L A;  4MPC A;  4BXI A;  4JAV A;  3B25 A;  3NMQ A;  4AWO A;  5GGZ A;  4EM7 A;  2Q8H A;  4DZY A;  4KFG A;  2XDU A;  4NH8 A;  3CRK A;  1R62 A;  2WI3 A;  3K60 A;  2YI6 A;  1AMW A;  4JQL A;  1BXD A;  3U67 A;  3BM9 A;  3CWV A;  3A0W A;  2FWY A;  5D7R A;  1TID A;  1Y8N A;  3HZ1 A;  1L0O A;  3R4O A;  4L90 A;  1MX0 A;  2QF6 A;  2XX2 A;  2YEA A;  4KSG A;  4URO A;  1S16 A;  1KZN A;  3A0Z A;  4AS9 A;  5BOD A;  1US7 A;  5M4H A;  4V26 A;  3ZXO A;  1YS3 A;  2VCI A;  4JAS A;  4FMT A;  4MTX A;  4YKT A;  3ZKD A;  3OMU A;  2E0A A;  4XCJ A;  3O6O A;  4XIP A;  4MOT A;  3HYY A;  5IDM A;  1QYE A;  5CTU A;  2YE8 A;  4PRX A;  4AWP A;  4EFU A;  4I3H A;  2BRC A;  3B27 A;  4XCL A;  2YKJ A;  2BYH A;  2YEB A;  3G75 A;  3JZ3 A;  4KP4 A;  4HYM A;  4CWT A;  4EFT A;  1OSF A;  2BU8 A;  1UYK A;  4XD8 A;  1TC6 A;  1JOY A;  1UYF A;  4YKU A;  3VHD A;  2BU7 A;  3CGY A;  2YK2 A;  4JYB A;  4CE3 A;  4URN A;  2WI5 A;  4KQV A;  4AWQ A;  1GKZ A;  2YKC A;  2Q8G A;  4HXZ A;  4P8O A;  2CCS A;  2K5B A;  1YC3 A;  3HHU A;  1H7S A;  2YJX A;  2XAB A;  2IWS A;  2XHR A;  2XJG A;  3A0T A;  3EKR A;  3G7E A;  2O1U A;  2WER A;  1Y8O A;  4H7Q A;  4URM A;  2IOR A;  1UYC A;  5B1N A;  4NH7 A;  4O04 A;  3INX A;  3OW6 A;  3C11 A;  4HZ5 A;  2GQP A;  4LPB A;  4B7P A;  4CWN A;  4O05 A;  1GKX A;  4CWF A;  3ZRW A;  2BU5 A;  2YKI A;  1Z5B A;  4YKW A;  2O1W A;  3MD0 A;  1UYD A;  3EHH A;  2YEG A;  1ZW9 A;  2Q8I A;  1Z5A A;  2YI0 A;  2QG2 A;  3LPS A;  4CWP A;  4R3M A;  2HCH A;  1GJV A;  2WEP A;  1I5D A;  2YEI A;  1YC4 A;  3GIG A;  4XIQ A;  3WQ9 A;  3R4M A;  3FV5 A;  3RLQ A;  4CWR A;  2YK9 A;  2YI7 A;  1YET A;  3WHA A;  2ZBK B;  1I5B A;  1BGQ A;  5D7D A;  4E01 A;  1UY8 A;  5D6P A;  2LFS A;  2ZDY A;  4XE2 A;  4LWH A;  4GCZ A;  2JKI A;  4YKX A;  1Y8P A;  4FCP A;  1KIJ A;  3QTF A;  2WI7 A;  2XJX A;  3Q5K A;  3OPD A;  3KE6 A;  4GGL A;  5FNC A;  1TIL A;  4XKA A;  4EGI A;  1UYG A;  2XHX A;  2BU2 A;  1TBW A;  4WUB A;  2YEJ A;  2YEE A;  3OWB A;  3VHA A;  4FPP A;  2YGF A;  4XIT A;  2YEH A;  2YED A;  3EHF A;  4PRV A;  2XHT A;  3U2K A;  2XJJ A;  5J6A A;  3ZM7 A;  3TZ2 A;  1ID0 A;  1UY7 A;  2GFD A;  4V25 A;  2P67 A;  1B63 A;  4CWO A;  3K99 A;  4JAU A;  1UYI A;  2JJC A;  4YKR A;  4ZVI A;  1MU5 A;  5CF0 A;  4XIR A;  4QPK A;  2XDK A;  2XDS A;  5M4K A;  4KSH A;  5C93 A;  4LWG A;  2XDX A;  2UWD A;  1THN A;  2ZDX A;  5F5R A;  1ZWH A;  3DGE A;  3D36 A;  2WWW A;  1I58 A;  3C0E A;  4BAE A;  2XCM A;  4ASA A;  2QG0 A;  2BT0 A;  4XTJ A;  3TZ0 A;  2LFR A;  1YES A;  1F51 A;  3ZRX A;  4HY1 A;  3K98 A;  3EHG A;  3FT5 A;  1YER A;  1UYE A;  4L93 A;  3CRL A;  4GT1 A;  4GQT A;  5CTW A;  2FYP A;  5CTX A;  2HG1 A;  3H80 A;  2XX4 A;  4L91 A;  4LWF A;  1NHI A;  2YE2 A;  2CG9 A;  5M4M A;  3G7B A;  4MT8 A;  1YSR A;  4FCR A;  4NH9 A;  3RLP A;  3INW A;  5IDJ A;  2YKB A;  2ESA A;  4L94 A;  3B26 A;  1AH6 A;  1UY6 A;  5B1O A;  2H55 A;  4GFN A;  4QPJ A;  1YT2 A;  2FXS A;  2O1V A;  3B24 A;  2WI6 A;  3HEK A;  5FWK A;  3T2S A;  2BZ5 A;  1UYL A;  3TUH A;  1EI1 A;  4MP7 A;  2Q2E B;  3ZRW B;  2YEF A;  3OWD A;  2YE6 A;  3PEH A;  2YE7 A;  2BYI A;  3GIE A;  4WUD A;  3EHJ A;  5L3J A;  1I5C A;  2XX5 A;  3NXS A;  4R3A A;  4BQJ A;  3ZKB A;  3GIG B;  2IOP A;  2XDL A;  1U2O A;  4BIZ A;  4O09 A;  1I59 A;  4XKK A;  4ZKI A;  3O0I A;  4BQG A;  4HY6 A;  1UY9 A;  4DUH A;  2BSM A;  4H81 A;  2WI4 A;  3R4P A;  1IXM A;  3R92 A;  3SL2 A;  1NHH A;  4X9L A;  1EA6 A;  4MPE A;  3TZ4 A;  1UYH A;  2YKE A;  3RLR A;  3FT8 A;  1I5A A;  2CCT A;  4ASF A;  5M4N A;  5CPH A;  1AJ6 A;  4U7N A;  2C2A A;  4XDM A;  5D6Q A;  4HXW A;  3ZCC A;  3GIF A;  2QFO A;  3A0X A;  1ZXM A;  4ASB A;  2BU6 A;  3MNR P;  2WI1 A;  3T10 A; 
#chains in the Genus database with same CATH topology
 1YJW V;  3D2R A;  4DUY B;  3K9A A;  1WN7 A;  4LP0 A;  2ITD C;  4PA3 A;  1DGS A;  1Y4U A;  2XT9 A;  2ZIM A;  4QGP A;  2YI5 A;  1BZK A;  4YJ2 B;  2YE9 A;  3H01 A;  2Y69 C;  4E02 A;  1XOU A;  3ZHQ A;  1IBK O;  4LFA O;  2R9R B;  4I5S A;  4DR4 B;  2Q6A A;  2CGF A;  3SYC A;  5L3B A;  5DEC A;  3JAW A;  3VQW A;  1MZE A;  1WA8 A;  4DR5 O;  4XDK A;  5M4P A;  4PA7 A;  1QR9 A;  1NR7 A;  4O0B A;  2K9P A;  1MAB G;  3OMN B;  1VQ9 V;  3D8C A;  1SET A;  4RO2 A;  2A79 B;  3KZI Z;  4I9Q A;  1XDC A;  1YT0 A;  1B04 A;  2XD6 A;  1R6T A;  2RJZ A;  4LH6 A;  4Q20 A;  4X1K B;  2VWC A;  3OGI B;  1Y76 A;  3P3N A;  5KX5 B;  1NTZ H;  1VQO V;  1TGO A;  3S5T A;  1K4D C;  2YSU B;  2M6Y A;  2XTA A;  3VBB A;  1YJ9 V;  4D7S A;  4B3M O;  4MVU A;  3G67 A;  1Q81 W;  2EIL C;  2BTO A;  4JI2 O;  1HNW O;  2RQ6 A;  3RYH A;  2CK3 G;  3N2K B;  4PU9 A;  5LHH A;  1Y4S A;  4GKK B;  4I7Z B;  1NBM G;  1S3J A;  4PA6 A;  5JCO C;  5KHJ A;  4YKQ A;  1K8A W;  1XL4 A;  2AGA A;  3FYE B;  2YGA A;  4JYA O;  3ABM C;  1WB7 A;  2IWX A;  1IVS A;  4FK5 C;  3AG4 B;  2ZDI A;  2KKW A;  1Q86 W;  4MP2 A;  3T1Y O;  2DYS C;  1M93 A;  3BAA A;  1R73 A;  1HW7 A;  3ICX A;  3JCU Z;  3QO7 A;  4G2K A;  4UXN A;  5CA0 B;  1N36 O;  1KC8 W;  5FL7 G;  4UCU A;  5IN9 A;  1LUW A;  1M5I A;  4FFB B;  2LQT A;  4LC1 A;  3CCM V;  4B3R O;  3QVN A;  2AW9 A;  1YSZ A;  4UCO A;  4TUY B;  3CCJ V;  1PNK A;  4ASG A;  4MBC A;  4WCE V;  1S14 A;  4MPN A;  1YDX A;  4WF9 V;  4FCQ A;  4JI6 B;  1I5X A;  1WA8 B;  5LXT B;  2EIJ C;  4WUC A;  3CGZ A;  3DTU B;  1Z59 A;  2QM4 A;  4BXI A;  2EIM B;  2OT5 A;  3TXQ A;  5A2Q N;  5EYP A;  3CMA V;  4EM7 A;  2RNB A;  4X62 B;  3FB5 C;  4DZY A;  4LF5 B;  3JAK A;  2IU0 A;  2JRI A;  3K0G A;  4RWU A;  1SZX A;  3L72 H;  3CWV A;  4PA4 A;  1X4T A;  4ZBM A;  4HZ3 A;  4X9Q A;  1AR1 B;  2P6J A;  2YXL A;  2YEA A;  1S16 A;  2WA3 A;  1RPR A;  3A0Z A;  1XNQ B;  5KX5 A;  1US7 A;  3HKC B;  2QKC A;  1VF5 B;  3P3P A;  4ZHQ A;  1VAR A;  5LXT A;  2ZXW C;  4DW1 A;  2VCI A;  4JAS A;  3OMU A;  5IYZ B;  2E0A A;  1YSC A;  1EBO A;  5KHI A;  1XMQ O;  1E79 G;  3UKM A;  1H2K A;  3HYY A;  4N21 A;  1PV0 A;  3RYI A;  5KHH A;  2YE8 A;  4AWP A;  3OEE G;  1WPB A;  2BYH A;  3JZ3 A;  4KP4 A;  3C90 A;  1OZ0 A;  4NB5 A;  1SS3 A;  1JOY A;  2QWN B;  3Q4H A;  2BU7 A;  4LBE C;  4JI3 B;  2LJ2 A;  4CE3 A;  3ASN B;  4CH3 A;  1V54 C;  2GHY A;  3B8M A;  5KHK A;  2YKC A;  2QEX V;  1NH2 B;  4HXZ A;  4ZI7 B;  2K5B A;  3HHU A;  4WFA V;  5IJ9 A;  2UUC O;  2ZQM A;  2F4V B;  2WLI A;  4FJC C;  5LA6 A;  2P5O A;  4AQY B;  1N0N A;  3C3T A;  4H7Q A;  3GWO A;  4URM A;  3ABL B;  3U11 A;  1UYC A;  4NH7 A;  4LPB A;  3CWB H;  2HP8 A;  5L3E A;  2XAH A;  4GKJ B;  4CWN A;  5IWA B;  1OCO B;  1ROP A;  2A0L A;  2EUL A;  4JYY A;  3EVK A;  5KMG B;  4DV4 O;  3F7Y C;  1Z5V A;  2ZCE A;  2YKI A;  1FS0 G;  2YEV B;  4YKW A;  1VEW A;  1JCH A;  4H37 A;  3ETQ A;  3I5D A;  2Q67 A;  3MD0 A;  1UYD A;  5EIB C;  3HKE A;  4JI7 B;  4K0K B;  3OW2 U;  3LPS A;  1ZUQ A;  4K8Z A;  1GJV A;  4TV9 B;  3GIG A;  1OCZ B;  4YY3 B;  1PM9 A;  1JFF B;  4GYC B;  3ZHR A;  4CWR A;  2GTS A;  4NXM B;  1M4U A;  2HFE C;  4E01 A;  5KLV H;  1UY8 A;  5D6P A;  4Z2W A;  5D5P A;  1N34 O;  1I94 O;  2XAG A;  1XNR B;  1N4C A;  2IH3 C;  3B2E E;  4G28 B;  3WB1 A;  3QTF A;  1V54 B;  3KE6 A;  2OWO A;  2WLH A;  1TIL A;  1UFI A;  4NTY A;  1U96 A;  1H2L A;  1PL4 A;  1ZAU A;  5FNV B;  2BU2 A;  1N32 B;  1TBW A;  3CE2 A;  3BRC A;  4C7U A;  1FJG B;  2YEJ A;  4BR6 A;  3OWB A;  4XIT A;  5EC2 C;  2YED A;  2UXD B;  5LOV A;  2XHT A;  2EZP A;  2IU3 A;  2XJJ A;  4TT3 G;  5J6A A;  3ZM7 A;  1AP6 A;  5JJE B;  5B1B B;  2PYL A;  5J2U B;  1FXK C;  2W0X A;  1W0J G;  1EN4 A;  4YKR A;  1MU5 A;  1FXH A;  1NU1 H;  2JGD A;  4QPK A;  5KUM A;  5BR8 B;  4JI4 B;  4FM2 A;  1XBL A;  1R6K A;  3CYO A;  2ZE6 A;  3N2G A;  4YHH B;  4X66 O;  5C93 A;  3H1J H;  5B5E Z;  3OUS A;  4BAE A;  5IJ0 B;  3THO A;  4XTJ A;  1ARO P;  2LFR A;  5JWP A;  1YES A;  3K98 A;  1CP9 A;  2EIK C;  3EHG A;  1YER A;  2N04 A;  4EEQ A;  1I5Y A;  3OTO B;  1UPG A;  5CTX A;  4EFE A;  3T2M A;  1V9P A;  1SQF A;  2XX4 A;  2W0F C;  2Y4T A;  2EIN B;  1GAX A;  1R3K C;  3CEI A;  3BCC H;  4CH5 A;  1KKC A;  2CG9 A;  5M4M A;  4IHJ A;  3UM7 A;  1SRY A;  4FCR A;  2LW7 A;  4X66 B;  3E8H A;  3PJS K;  4NH9 A;  3INW A;  5L3D A;  2K1E A;  4L94 A;  4B7E A;  1NTK H;  3P30 A;  5B1O A;  2R9A A;  1OCC C;  2H55 A;  1G6U A;  2YDE A;  4UB8 Z;  5A9G A;  3ASO B;  4GFN A;  1BMF G;  2FXS A;  4X65 B;  1EFR G;  1D2D A;  3B24 A;  3RYI B;  4DV1 O;  3JAM N;  3HEK A;  3L9D A;  2N74 A;  3T2S A;  2YUA A;  2CTW A;  4E4E A;  1W59 A;  1UYL A;  3G71 V;  2PI5 A;  3CRR A;  4DR7 B;  3ZRW B;  4FLZ A;  4R6Z A;  2PUS A;  4PD4 F;  3K04 A;  2IJK A;  2BYI A;  1I08 A;  2PYJ A;  4WUD A;  1CXZ B;  3NXS A;  5LMN B;  3K9S A;  2YXY A;  5LBQ A;  1O9G A;  3GIG B;  4ZOL A;  3BY6 A;  1YTF B;  4UVB A;  1N8R W;  2XDL A;  4A5U B;  1NTM H;  4O09 A;  2HVJ C;  3L74 H;  5H6R A;  3O0I A;  3HKE B;  4HY6 A;  3B77 A;  1K7D A;  3E86 A;  3R4P A;  3KCY A;  3SL2 A;  4X9L A;  3FB6 C;  3CC7 V;  4JAA A;  4NXN B;  2UUB O;  1H2M A;  4U3J B;  4JTC B;  5KMG A;  5JCO A;  2BTQ B;  3KG2 A;  1P7G A;  4W4K A;  4HXW A;  2X6C A;  3ML0 A;  4K0K O;  3A0X A;  4MTO A;  4LNU B;  4U3F H;  5LL6 Y;  4I0X B;  3SYP A;  1VF6 A;  1E1Q G;  4MVR A;  3T10 A;  1GN6 A;  3C3S A;  4PDL A;  3ZMS A;  3W7S A;  5LMN O;  2PNR A;  4YKY A;  2XOK G;  1XEQ A;  2HEP A;  3ABT A;  3B40 A;  2YE4 A;  5DM6 V;  4B08 A;  4EMV A;  4MTF A;  1F4M A;  1GKF A;  4O4H A;  4O4J B;  4LWE A;  3H4L A;  1TH8 A;  1P7B A;  4WFG A;  1M1K W;  4GKJ O;  2CCU A;  4YJ3 B;  4OX9 O;  3CB2 A;  3ZN1 A;  4CS3 A;  3BA9 A;  2ZKO A;  4X1I A;  4EGH A;  2DQ3 A;  3LNU A;  1WP7 A;  3G6B A;  3A0B Z;  1MG1 A;  1KBH A;  2IWU A;  3PEJ A;  1BL8 A;  4YKZ A;  2VQE B;  5KHG A;  4IYH A;  2F4V O;  5LMU O;  5BOC A;  1MSW D;  1YIT V;  3A0H Z;  4TQF A;  2VCJ A;  4JI0 B;  2GV9 A;  3EKO A;  4J80 A;  4CBC A;  1NS1 A;  3A0Y A;  3JSL A;  3RYH B;  4HZ0 A;  3JD3 A;  3BMY A;  2E3C A;  1AH8 A;  4TWK A;  3ABK B;  1NI8 A;  1SQV H;  4R1F A;  2YE3 A;  3H1H H;  1JJO A;  5IY5 C;  3TZ5 A;  1K33 A;  3SPJ A;  5F2V O;  4WFF A;  4LF6 B;  5EYP B;  1OCC B;  2VW5 A;  4HYP A;  5B3S C;  1JPX A;  4UV9 A;  3E83 A;  1P84 F;  3WB0 A;  3OE7 G;  3P32 A;  3LMM A;  5D7C A;  1HNZ O;  5F3K A;  1JR9 A;  2Y0I A;  4LF4 O;  1YC1 A;  2XAS A;  1XQ8 A;  4TUY A;  1L1F A;  3VAD A;  4URL A;  3HZ5 A;  3DC6 A;  1S5L Z;  3K79 A;  4K8X A;  4DV5 O;  5FNF A;  3ZHS A;  3HKB B;  1RM1 B;  3CS5 A;  3LDC A;  3LDE A;  3RT3 C;  2EXL A;  5CBH A;  1Q3E A;  2ZT9 B;  3AG2 C;  2WLL B;  3AK3 A;  4LP8 A;  1W0K G;  1N33 O;  2ZKJ A;  2FYU H;  3W7X A;  1I0H A;  4IHJ B;  1S5J A;  4IYI A;  2EJ7 A;  4AHC A;  1K92 A;  3M99 B;  2LGW A;  4P30 A;  1B6Q A;  2BRE A;  2EJR A;  3MAQ A;  3CME V;  1DLB A;  2WLJ A;  1HWY A;  2H8M A;  2WEQ A;  3JAT B;  4QNH B;  1VF7 A;  5IYC O;  3JAS A;  2AKP A;  1BYQ A;  4U93 A;  4E2L A;  3TGU H;  3VQX A;  4DV5 B;  4H33 A;  2KG7 A;  4UCT A;  5H6Q A;  4MB9 A;  4J7K A;  4CE2 A;  4MVM A;  1HR0 O;  4DK1 A;  1BQZ A;  3H1I H;  3O65 A;  4X64 O;  3Q5L A;  4MPC A;  4LF4 B;  3CCQ V;  5IJ0 A;  2AXT Z;  3B25 A;  2WA4 A;  1AI4 A;  3CRA A;  5GGZ A;  4X1K A;  3IC9 A;  1HNZ B;  4KFG A;  2XDU A;  4NH8 A;  4DRX B;  1GTO A;  2WI3 A;  3K60 A;  3E2E A;  1AMW A;  4JQL A;  4R7C A;  2A7W A;  1THZ A;  1N34 B;  3A0W A;  4DR3 B;  4JF3 A;  2FWY A;  1AVM A;  3RW0 A;  4B7K A;  1Y8N A;  2MK3 A;  3R4O A;  4L90 A;  4PDR A;  3T1Y B;  4LWS B;  4URO A;  1BHB A;  3BPZ A;  4AS9 A;  3AEI A;  3OR7 C;  5BOD A;  3RVZ A;  4GKK O;  4U3J A;  1XMO O;  4KUM A;  3GB7 C;  5CB4 A;  4FMT A;  1H2S B;  1Q6U A;  2JEX A;  2Q7G A;  4JTA B;  4LFB O;  2Q5Z A;  3CCR V;  4XCJ A;  3O6O A;  4R50 A;  1BS3 A;  1TA8 A;  5BY1 A;  4GX1 A;  3EHB B;  5CTU A;  4I3H A;  3UQ8 A;  1MSD A;  4XCL A;  5FNV A;  2YKJ A;  1S72 V;  2YEB A;  1JA8 A;  4PDV A;  4HYM A;  3ABL C;  4LF9 O;  4EFT A;  2O57 A;  2Z5U A;  5KA5 A;  4GX2 A;  2FML A;  1NR1 A;  4XD8 A;  1UYF A;  1PD3 A;  4YKU A;  2CH7 B;  3CGY A;  3ZMV A;  4AQY O;  1BSM A;  4URN A;  2RN9 A;  2WPD G;  3T1H B;  3HB3 B;  5E79 Z;  2WI5 A;  4LFC B;  2UXC O;  4KQV A;  4AWQ A;  2UXX A;  2Q8G A;  1GN4 A;  2JS3 A;  1W2B U;  2WLK A;  3SPC A;  1XMO B;  4ZIB A;  2XHR A;  2MW2 B;  3L73 H;  4ZOL B;  2XJG A;  5EIB D;  4OGQ B;  2O1U A;  3I55 V;  3ZRS A;  4DYL A;  3ZMZ A;  4NXN O;  2ZIO A;  4ABM A;  1Y8O A;  1GM8 A;  4LH7 A;  3HKD A;  3OW6 A;  1K73 W;  1YEW A;  4FIP C;  1OHH G;  4X20 A;  4ASU G;  4CZZ A;  5JH7 B;  4O05 A;  1GKX A;  1S5H C;  3ZRW A;  2BU5 A;  2GTA A;  1HP8 A;  3IC7 A;  3L75 H;  1WB8 A;  4X20 B;  4DUY O;  2IJH A;  3IFX A;  1Z5B A;  2GSM B;  4EKW A;  1HR0 B;  2OCC B;  3SGI A;  4DR1 B;  4AIL C;  1NQT A;  4K3A A;  2YIA A;  1AIL A;  1YXB A;  1QVG U;  2WEP A;  2YEI A;  2PZS A;  4XIQ A;  1FFT B;  3RLQ A;  4DR7 O;  4OPA A;  2YI7 A;  1GH6 A;  2ZBK B;  2BSK A;  2OIE A;  5D7D A;  1SC5 B;  3SPG A;  3AG7 A;  2CDY A;  1FYJ A;  5LGT A;  4X65 O;  2AHZ A;  4GCZ A;  1Y8P A;  1QVF U;  3Q5K A;  1BT8 A;  1SKV A;  3E89 A;  4HAM A;  3AK2 A;  3L71 H;  4EGI A;  3LSS A;  2XHX A;  3E35 A;  5EC1 C;  1R1B A;  1K34 A;  1F4N A;  4WUB A;  3VHA A;  1ZX3 A;  5C8Y A;  1R3L C;  3G4S V;  3FB7 C;  3BEH A;  3EHF A;  4H44 B;  4HYO A;  1DK1 A;  2QWO B;  3QTC A;  5IYZ A;  5H9C A;  3OD4 A;  5B1A B;  1F23 A;  1S0V A;  1ID0 A;  1UY7 A;  3JAT A;  3SJQ C;  2P67 A;  4HNA A;  2AHY A;  2DYS B;  4JAU A;  4JI1 O;  1UYI A;  2JJC A;  1QLE C;  1M56 C;  2CE4 A;  2OIG A;  4LF6 O;  1N33 B;  5CF0 A;  3ZMT A;  3H1L H;  1M56 B;  1EM1 A;  2YIB A;  2XDS A;  1GK9 A;  4I50 A;  3LSU A;  4JPR A;  4K35 A;  1NVP D;  3ETE A;  4YHH O;  1BE3 H;  3AG1 B;  3OTF A;  4O4I B;  1FFX B;  4JI4 O;  2UWD A;  2ZDX A;  1OCR B;  5LOV B;  1K5Q A;  2XCM A;  4YJ2 A;  2QG0 A;  2OYQ A;  1CEZ A;  2OCH A;  4HY1 A;  4D6T H;  3AK1 A;  2DWE C;  3FT5 A;  2GDS A;  3HKB A;  4L93 A;  3A8T A;  4GT1 A;  4GQT A;  4QJF B;  1SF9 A;  3LUT B;  1YTF D;  4OX9 B;  5B1A C;  3APQ A;  1XHZ A;  2FYP A;  2KQX A;  4LF8 O;  1AR4 A;  4L8J A;  3QNE A;  1NHI A;  4DXW A;  1S76 D;  1BGY H;  3RYC A;  1WLE A;  3G7B A;  4MT8 A;  1YVW A;  3X2Q C;  4J7J A;  3J80 N;  1YSR A;  3CRQ A;  4CH4 A;  2V1D A;  1UJW B;  1VQ6 V;  5IDJ A;  2HKO A;  5EZY B;  2XAQ A;  1JMK C;  1AH6 A;  3HKC A;  1GM9 A;  2H8P C;  2JK5 C;  1IBM B;  3J7A U;  2A9H A;  1M9N A;  2X0L A;  4EB6 B;  1Y74 B;  2X7R B;  3WU2 Z;  5IJ9 B;  3A2F A;  4NXM O;  2BZ5 A;  2PTM A;  2YEV A;  3E22 A;  3K08 A;  4LCU C;  3CCL V;  4BW5 A;  4PEL A;  1EI1 A;  4QE9 A;  4MP7 A;  2Q2E B;  4I55 A;  2FL4 A;  2YEF A;  4DK0 A;  1MNG A;  4F6R A;  4DRX A;  5EBW C;  1FAF A;  4YJ3 A;  1FJG O;  2EIJ B;  2ZR2 A;  5EZY A;  2PI4 A;  2IJJ A;  2NLJ C;  4X88 A;  2Q0A A;  2XX5 A;  3FAV A;  3QO8 A;  4R3A A;  4I9W A;  5L3C A;  1MMM A;  3EFF K;  3ZKB A;  2YIB D;  2QKA A;  4JI8 O;  1TUB A;  2N05 A;  1SES A;  4J11 A;  5CN0 A;  1I94 B;  2XND G;  1BQ0 A;  4ZKI A;  2F95 B;  4DUH A;  5IT9 N;  4LNU A;  3JD0 A;  3MHH C;  1TVK A;  3ZHT A;  5B3S B;  1NHH A;  2UUB B;  2ZDI C;  1EA6 A;  1LNQ A;  4PI2 A;  2ZNI A;  1Z2G A;  2YKE A;  1HDJ A;  5JH7 A;  1H38 A;  2P06 A;  5CB4 B;  1XI1 A;  5J2T A;  4ASF A;  5M4N A;  3ABM B;  1HNX O;  4U7N A;  4RQE A;  2C2A A;  1SQB H;  4IL6 Z;  2E74 B;  2Q8V A;  4ASB A;  2HR3 A;  4FLU A;  5JQG A;  1WPX A;  1SZT A;  3NR7 A;  4LFC O;  2UXC B;  1KU9 A;  1M57 C;  3SR2 C;  4KHP O;  2EIL B;  4O4J A;  1H8H G;  1TC0 A;  2P90 A;  4RUF A;  3FFQ A;  4LWI A;  2QTO A;  4NTW A;  3DC5 A;  4LF8 B;  3TET A;  5JVD B;  2JDI G;  5BXZ A;  3T1K A;  3OTO O;  2FTK A;  1PVG A;  1YJN V;  1S77 D;  3TTZ A;  5FND A;  2UXB B;  4JZ2 A;  5JVD A;  3A0R A;  5H2F Z;  4K4O A;  2BTQ A;  4DV1 B;  4U7O A;  2F93 B;  1B62 A;  2F43 G;  4W7T A;  4GEE A;  2UUC B;  1VQP V;  1NKD A;  4J41 A;  4DO2 A;  3ZHU A;  2QDO A;  3RKZ A;  4B3S B;  4CWQ A;  5LGN A;  5J2U A;  2ZE5 A;  3H9V A;  4JGS A;  5BR8 O;  5FPR A;  4JYC A;  3QO5 A;  1A4H A;  1QZR A;  2CH4 A;  2GUZ A;  2PF4 E;  1MOF A;  5B66 Z;  2YJW A;  4CWS A;  5CA1 A;  1WNS A;  1WAZ A;  4O07 A;  2IOQ A;  5JJN B;  3QDD A;  3O9O A;  1U0Z A;  5EK0 A;  3ZMU A;  2DYR C;  1B3Q A;  4H13 B;  4G27 B;  4PA9 A;  4LF5 O;  4XC0 A;  4O2A A;  2CTQ A;  3JAR A;  1XMQ B;  3G80 A;  2YE5 A;  3TCU A;  4X64 B;  2UXD O;  4BIU A;  3SPI A;  2JIZ G;  4XKO A;  3S3W A;  3ZS8 C;  2QR4 A;  1H8E G;  2HLD G;  4J42 A;  4DW0 A;  2C1G A;  3B28 A;  2XAJ A;  2IM9 A;  3BA8 A;  4LR3 A;  4FFK A;  3K5N A;  5H5N A;  4BW9 A;  2NR5 A;  1RM1 C;  3VHC A;  1FFX A;  5M4E A;  1XNR O;  4CE1 A;  2WI2 A;  3TK1 A;  1JM6 A;  2JS5 A;  2OCC C;  3FD9 A;  4YIO A;  2WLM A;  1K5S A;  3RYF A;  1OCZ C;  1OJH A;  2WLN A;  3ASO C;  1R6N A;  4LWS A;  4JYA B;  1FD9 A;  3VQY A;  4YY3 O;  3U2D A;  3HYZ A;  4EEH A;  1H7U A;  4ICG A;  3ZX6 A;  2Q8F A;  3D0B A;  1ZXN A;  2QM7 A;  2HJD A;  1SQQ H;  1N32 O;  4UVC A;  3EXA A;  1JVM A;  3KCX A;  4AWO A;  1D5N A;  5CA3 A;  2Q69 A;  3BHP A;  3CRK A;  4GZR B;  4IT5 A;  4L87 A;  1R62 A;  4FZ1 A;  1L0N H;  2ADP A;  1N36 B;  1Y66 A;  3BM9 A;  1TID A;  3R65 A;  5KAF Z;  3HZ1 A;  4MSW C;  3JAR B;  1MX0 A;  2W6I G;  1GN2 A;  1KQS U;  2XX2 A;  1PP9 H;  4KSG A;  1KZN A;  1X59 A;  5IY5 B;  2QA4 V;  2X6B A;  2G38 A;  1FPO A;  1Y67 A;  4V26 A;  5CA1 B;  3ZXO A;  2B1I A;  4YXW G;  5TIS Z;  4YKT A;  3ZKD A;  4JI0 O;  4RUE A;  4DV3 O;  4JI2 B;  4I4T B;  1KP2 A;  4NTX A;  5LMU B;  1KD1 W;  3T1H O;  4P9O A;  2LGQ A;  4I50 B;  4MTG A;  2KB1 A;  1WJZ A;  3N2K A;  3I56 V;  4PRX A;  4EFU A;  1VIB A;  3K5L A;  3B27 A;  5B1B C;  2IJI A;  2EBO A;  3JD4 A;  3RFR A;  1YHQ V;  3G75 A;  1AI6 A;  1EZJ A;  4LF9 B;  4CWT A;  4OPH A;  2ZD9 A;  4MS2 A;  1QQC A;  1SA0 A;  3CCU V;  1UYK A;  1QHT A;  1TC6 A;  2YXH A;  3VHD A;  1VQ8 V;  4TQD A;  4KXR A;  2C1I A;  4JYB A;  2RDC A;  2ZIN A;  3ZN0 A;  1QLN A;  4DV7 O;  2D3O W;  4LFB B;  1VF6 C;  2P4V A;  2YID A;  3K03 A;  1GKZ A;  4PHZ A;  2CCS A;  3FKS G;  1KUQ A;  1YC3 A;  1Q7Y W;  2YI8 A;  1H7S A;  1JFF A;  1JQ0 A;  1QU7 A;  4DV0 B;  1VQK V;  2HHH O;  4DR5 B;  2M7W A;  2DMX A;  5FPO A;  1AP5 A;  3B09 A;  1XNQ O;  2DW4 A;  4UCV A;  4LFA B;  2B5U A;  2WLI B;  2IOR A;  1CPY A;  4Z1M G;  1EN5 A;  1Q6H A;  3INX A;  1YZB A;  4B7P A;  2BOB C;  1NH2 D;  3CHX A;  4DR3 O;  3Q4H B;  5J2T B;  2Q0O C;  2OTL V;  2BOC C;  1VQ5 V;  4CWF A;  4X62 O;  1TVK B;  4GUN A;  2DE0 X;  2O1W A;  3EHH A;  1P4R A;  1ZW9 A;  5E1A C;  4JI6 O;  2QG2 A;  3CX5 F;  2DJV A;  5HFM A;  2BE3 A;  1ENV A;  5IYB O;  2RCV A;  3WQ9 A;  3R4M A;  1WP8 A;  4JV5 B;  3ZHV A;  1NJI W;  5IYD O;  2DQ0 A;  1YET A;  3CRC A;  4KFM A;  4B3R B;  4I0X A;  3WHA A;  3CC2 V;  1I5B A;  1BGQ A;  2CGN A;  1B06 A;  5DN6 G;  3SPH A;  4FLV A;  5LP6 B;  3APO A;  2NNU A;  4LWH A;  4YKX A;  2Y48 A;  3WG7 C;  1KIJ A;  3F5T A;  5FNC A;  2FB5 A;  4FLW A;  2WAM A;  2XHB A;  3RWR D;  2EIK B;  3JSN A;  1LUV A;  1Y74 A;  3PN1 A;  1COW G;  5KAI Z;  2YEE A;  1PKX A;  3TJT A;  4FPP A;  1Q8I A;  2YGF A;  4PJ0 Z;  3SYA A;  3UO2 A;  1DTO A;  2EIN C;  1AR5 A;  1V55 C;  3K06 A;  3H1K H;  3JYC A;  2DOS A;  3TZ2 A;  2UXN A;  4B3T O;  4J7Z A;  2F23 A;  4Z1V A;  4ZHQ B;  2GBO A;  4MW3 A;  4MVQ A;  3K99 A;  4MVO A;  2JEU A;  4ZVI A;  4O4H B;  4NKG B;  1EZV H;  3T1C A;  4DV2 O;  3UCS C;  2E5L B;  4UUJ C;  4DR6 O;  2PGG A;  2QKS A;  5LA6 B;  1SQP H;  4FLY A;  5GW7 A;  1SQG A;  5M4K A;  1RSO B;  2VWK A;  3CJH B;  3VQV A;  3CSX A;  3JAW B;  4LWG A;  2XDX A;  4P9P A;  2LW1 A;  3HR0 A;  5F5R A;  4FZ0 A;  3DGE A;  3D36 A;  2WWW A;  1I58 A;  3C0E A;  1G1X B;  1HNW B;  3K0D A;  1Y6X A;  2VQE O;  3TZ0 A;  3ETG A;  3E22 B;  1KYO F;  1IBL B;  4DR4 O;  1UYE A;  4WFE A;  3OUF A;  3CRL A;  3JD2 A;  2QGN A;  2AZ0 A;  5CTW A;  3FYI B;  2Z0A A;  4TSF G;  4LWF A;  2R70 A;  3U10 A;  2YE2 A;  3HPL C;  3SJC C;  5LYJ B;  2ARH A;  2A06 H;  4FLX A;  3IGA C;  2YKB A;  2ESA A;  1UY6 A;  2VQF B;  1PL0 A;  4J9Y B;  4DR6 B;  1YT2 A;  2O1V A;  1GMG A;  4DV2 B;  4WFH A;  2KG7 B;  3CCS V;  4J9Z B;  3K59 A;  4J10 A;  4UB6 Z;  2JJ1 G;  3TUH A;  4UCS A;  2ZM6 O;  3TXS A;  4ZI7 A;  1D5A A;  1YCI A;  1NZ6 A;  3OWD A;  5JQG B;  5EBM C;  3N27 A;  5LP6 A;  3K3W A;  1URF A;  2CTR A;  5L3J A;  3M8A A;  1E1R G;  2XAF A;  1M90 W;  3ETD A;  5IE9 A;  4BQJ A;  4WBN A;  2IH1 C;  4DV4 B;  3K5M A;  3AG3 C;  1U2O A;  4BIZ A;  5CBG A;  4XKK A;  2EX3 A;  4BIO A;  1MA1 A;  1K3E A;  4FFB A;  1OCO C;  4HNA B;  4H81 A;  2WI4 A;  2F66 C;  3R66 A;  1MZF A;  4MPE A;  2DN9 A;  1AJN A;  1Y4M A;  3FT8 A;  1I5A A;  2CCT A;  1OV9 A;  1XIL A;  1AJ6 A;  1XHX A;  4XDM A;  5D6Q A;  3ZCC A;  2PY5 A;  3GIF A;  5CMU A;  3W7U A;  1QLE B;  2BU6 A;  3MNR P;  3CC4 V;  3OR6 C;  5LHI A;  1BKN A;  2QWP B;  4JZG A;  4L8Z A;  3T4Z A;  3ASN C;  1H2N A;  3OMA B;  3T0H A;  2CAZ C;  3F7V C;  1KB9 F;  3RYF B;  2P7T C;  5CTY A;  3U0Z A;  4P2Z A;  4H85 A;  5J71 A;  2ZM6 B;  2BSK B;  2ZXW B;  1NHJ A;  1VQL V;  2P4K A;  4JTD B;  3R4N A;  2UUA B;  3T0Z A;  1QBZ A;  2XK2 A;  3MHS C;  2HKJ A;  3ZXQ A;  1AJQ A;  1Q43 A;  1IX9 A;  4UVA A;  5JJJ B;  1RSO A;  4DV0 O;  2VWJ A;  2FKX A;  4RAI A;  3IED A;  3K97 A;  2OTJ V;  1VQM V;  2VQF O;  2L6L A;  1QR8 A;  4TOI A;  1Q82 W;  3K57 A;  1TUB B;  4DV7 B;  3AG2 B;  3W7W A;  4B6C A;  2DWD C;  3O2F A;  2EIM C;  1Z5C A;  4F6E A;  3UT5 B;  1QY8 A;  4X89 A;  3CXH F;  4GT8 A;  2FWZ A;  2V7Q G;  3OMI B;  1KKD A;  2X6A A;  3ZRV A;  1BCC H;  4KL1 A;  3HKD B;  2V4D A;  3OAA G;  5GON B;  4CC5 A;  4I55 B;  4O4I A;  4FM1 A;  4RQF A;  4P7A A;  4TV8 B;  3R91 A;  1DF5 A;  4BWA A;  5BMV B;  4O2B A;  3E8F A;  2YEC A;  2Z3Y A;  4DV3 B;  4EGK A;  2L35 A;  2ATK C;  2QM8 A;  1ORQ C;  5LHG A;  1IDS A;  3AG4 C;  4PL9 A;  1YT1 A;  1ZLZ A;  3DSQ A;  1J95 A;  1F7Y A;  4NYK A;  1AM1 A;  2WSS G;  1UYM A;  1N0J A;  3MDS A;  2QWR B;  4CS4 A;  3RYC B;  2NN4 A;  5LYJ A;  4UV8 A;  1A32 A;  2YGE A;  3Q5J A;  4KTN A;  1J5E O;  5BMV A;  3AG3 B;  3X2Q B;  4PDM A;  4E00 A;  5GON A;  1YI2 V;  3B8N A;  2BTZ A;  1IUR A;  1QNM A;  3IJ4 A;  2LP7 A;  3CYG A;  1RP3 B;  1JX9 A;  4JI7 O;  1KEC A;  2E76 B;  2P22 C;  1YIJ V;  4JAV A;  4WFB V;  4DR2 O;  2VS0 A;  3NMQ A;  3DXR B;  2Q7E A;  3QF7 A;  3WG7 B;  2Q8H A;  3BVO A;  3GVM A;  4R8C A;  4O4L B;  4QE7 A;  1SQX H;  5LP6 C;  1XL6 A;  3JD1 A;  2ZE7 A;  2YI6 A;  1BXD A;  5IWA O;  3U67 A;  1O9H A;  1Z5W A;  4MVZ A;  5D7R A;  3SJB C;  3M7M X;  1L0O A;  2B1G A;  5J9P C;  2QF6 A;  3CCV V;  5CBF A;  4MVS A;  4QIW F;  1K4C C;  4EFB A;  5ITZ B;  2ITC C;  5M4H A;  4JI5 O;  1VQN V;  5BZB A;  2H3O A;  4BAY A;  4W4L A;  4GLX A;  1YS3 A;  2Y69 B;  4F6R B;  3FAV B;  4MTX A;  5AG2 A;  3D3Q A;  3JAS B;  3FB8 C;  3IAY A;  3WFV A;  2YI9 A;  1TUE B;  4F4L A;  4XIP A;  2R9I A;  1ZL8 B;  4MOT A;  1FKA O;  4JI3 O;  5IDM A;  1QYE A;  3RN4 A;  3N2G B;  5FLX N;  2Y0P A;  2BRC A;  4GX0 A;  2Q9L A;  3ZIA G;  5GTH Z;  1OSF A;  2BU8 A;  1P49 A;  3BAB A;  1US6 A;  1AJP A;  4EB6 A;  1FXV A;  5KA6 A;  4FM0 A;  3OGC C;  3SDL A;  3E8B A;  2YK2 A;  1GRJ A;  4FVM A;  4UFZ A;  2DYR B;  4X1I B;  4XDJ A;  2HHH B;  3CP1 A;  3S3X A;  4B3S O;  3JAL B;  3OM3 B;  5D5Q A;  2CUG A;  3L70 H;  3D36 C;  4P8O A;  1U97 A;  1TAE A;  4H0L B;  2YJX A;  3G6E V;  2XAB A;  2IWS A;  3A0T A;  3EKR A;  3E8G A;  4JI5 B;  3OFN G;  3G7E A;  2XUM A;  1FXK A;  4DV6 B;  2WER A;  2ADQ B;  4O2A B;  2UXB O;  3K58 A;  2BCC H;  3ZBH A;  3JAL A;  2RMK B;  3CCE V;  5B1N A;  1XUQ A;  2ZNJ A;  3UO3 A;  4O04 A;  4GX5 A;  5CA0 A;  4XDL A;  3DXR A;  2JJ2 G;  3C11 A;  4HZ5 A;  2GQP A;  2IW5 A;  4WBN B;  3WB2 A;  2Q7H A;  2R72 A;  1YF2 A;  3LSQ A;  3GWK C;  2AZ2 A;  2YEG A;  2Q8I A;  1IXB A;  2YIC A;  3D3I A;  1Z5A A;  1LR1 A;  2YI0 A;  4NVP A;  2YS8 A;  1ZL8 A;  2EZO A;  2HJF C;  4CS2 A;  4CWP A;  4YIP A;  4R3M A;  2Q68 A;  2HCH A;  1ZSP A;  5LGU A;  1I5D A;  1YC4 A;  3FV5 A;  4PI0 A;  1M57 B;  2YK9 A;  3ABK C;  1DF4 A;  4X1Y A;  4CH6 A;  1J5E B;  2HVK C;  4Q6G A;  4MW8 A;  4HBN A;  2IBZ H;  1K97 A;  5K1P A;  2CH7 A;  2LFS A;  2D2C B;  2ZDY A;  2QSA A;  4XE2 A;  3CPW U;  2JKI A;  4DUZ B;  4FCP A;  2WI7 A;  1GN3 A;  2XJX A;  3OPD A;  4GGL A;  4XKA A;  3JCZ A;  1G8M A;  2QTS A;  4DR2 B;  5C8Y B;  4X8A A;  1UYG A;  3LNN A;  1R3J C;  1ZWI C;  5GTI Z;  4TV8 A;  3OT7 A;  5DED A;  1PNM A;  4OXS A;  2A3Q A;  4LF7 B;  1Q90 D;  2YEH A;  1Q5O A;  4B3M B;  4PRV A;  4XBF A;  3U2K A;  2JVD A;  2GUZ B;  2WLL A;  4N23 A;  3RVY A;  2YC0 A;  2W6J G;  1L8D A;  4PV1 B;  3CJH A;  2GFD A;  4V25 A;  4NR1 A;  1B63 A;  5L3F A;  4CWO A;  3F5W C;  2ZE8 A;  1VP7 A;  3FX7 A;  1VMG A;  4XIR A;  4UCR A;  5L3G A;  1IBM O;  2XDK A;  2ZR3 A;  1K9M W;  4E72 A;  1I7F A;  4KSH A;  2F1M A;  3SYO A;  1THN A;  1Y76 B;  2H94 A;  1XRE A;  1ZWH A;  1R3I C;  1SER A;  4FLT A;  4IGG A;  4ASA A;  2BT0 A;  5EBL C;  3T4D A;  2HG5 C;  1F51 A;  3ZRX A;  2JGU A;  3ABU A;  4O2B B;  4B3T B;  4TV9 A;  1IBL O;  1RFY A;  3SYQ A;  1IBK B;  5HFL A;  3QG5 A;  2JGD B;  2HG1 A;  3H80 A;  4L91 A;  3ZJZ A;  5K1X A;  3J81 N;  4LF7 O;  3CRM A;  3ZED A;  2Q73 A;  3LDD A;  4D7T A;  3RLP A;  2HHI A;  3VOU A;  3JAK B;  1T5E A;  2CGO A;  3B26 A;  2B9Z A;  3SJA C;  2ETN A;  4DUZ O;  1G4Y B;  2Y4U A;  2QE7 G;  3CD6 V;  4QPJ A;  2E5L O;  1OCR C;  3UT5 A;  2WI6 A;  4JI1 B;  1AB3 A;  4IIJ A;  1VQ7 V;  3AG1 C;  5FWK A;  2UUA O;  1H2G A;  3STZ C;  3RGB A;  1KP3 A;  1PPJ H;  5KUK A;  4IIJ B;  2UU9 O;  4JV5 O;  2QWQ B;  4O4L A;  2E75 B;  2Q4P A;  2YE6 A;  1V55 B;  3PEH A;  2YE7 A;  1L0L H;  2ILM A;  3KKY A;  3GIE A;  3RBZ A;  1IZ3 A;  3EHJ A;  1GO3 F;  1I5C A;  5JEN A;  4KHP B;  3OEH G;  3BFR A;  4AI8 A;  3LNM B;  2IOP A;  1VQ4 V;  1NVP B;  1I59 A;  1EN6 A;  1HNX B;  4BQG A;  1UY9 A;  2BSM A;  1RPO A;  2UU9 B;  1AI7 A;  3R92 A;  1KMI Z;  1IXM A;  1NT2 B;  4I4T A;  1QCE A;  3TZ4 A;  2KSD A;  1UYH A;  3RLR A;  2QJ1 A;  4DV6 O;  2VRZ A;  1AI5 A;  5CPH A;  1ZTE A;  3B4S A;  3W7T A;  2CTP A;  1JJ2 U;  2QFO A;  5ITZ A;  1PNL A;  1Q6I A;  4JI8 B;  1BHA A;  1ZXM A;  4DR1 O;  4CC6 A;  4X1Y B;  1FXK B;  1GM7 A;  2LO1 A;  3STL C;  3CXC U;  2WI1 A;  2ODM A;  1SA0 B;  3K5O A; 
#chains in the Genus database with same CATH homology
 1M57 C;  3OR6 C;  4PDL A;  3ZMS A;  2EIL B;  5LHI A;  1H8H G;  3W7S A;  2XOK G;  1YJW V;  3K9A A;  1BKN A;  2P90 A;  1TC0 A;  3D2R A;  4L8Z A;  3ABT A;  4LP0 A;  4RUF A;  2YE4 A;  2ITD C;  3T4Z A;  4LWI A;  3ASN C;  5DM6 V;  4PA3 A;  3OMA B;  2QTO A;  3T0H A;  3F7V C;  4MTF A;  4EMV A;  1F4M A;  1GKF A;  1Y4U A;  4LWE A;  3H4L A;  1TH8 A;  3TET A;  1P7B A;  4WFG A;  1M1K W;  2P7T C;  2CCU A;  2YI5 A;  2JDI G;  5CTY A;  4P2Z A;  2YE9 A;  4H85 A;  3T1K A;  3H01 A;  2Y69 C;  3ZN1 A;  4E02 A;  2FTK A;  5J71 A;  1PVG A;  2ZXW B;  1YJN V;  1S77 D;  1NHJ A;  3TTZ A;  4EGH A;  2DQ3 A;  2R9R B;  4I5S A;  1VQL V;  2Q6A A;  2CGF A;  3LNU A;  4JTD B;  3R4N A;  5FND A;  3A0R A;  1QBZ A;  3SYC A;  5L3B A;  3MHS C;  2XK2 A;  4K4O A;  3T0Z A;  2HKJ A;  1MG1 A;  4U7O A;  1AJQ A;  2IWU A;  3PEJ A;  4UVA A;  1BL8 A;  4XDK A;  4YKZ A;  1B62 A;  5M4P A;  5BOC A;  2F43 G;  4PA7 A;  1QR9 A;  1MSW D;  4GEE A;  1YIT V;  1NR7 A;  4W7T A;  2VCJ A;  4O0B A;  4RAI A;  1MAB G;  3IED A;  1VQP V;  3EKO A;  3K97 A;  1NKD A;  4CBC A;  2OTJ V;  1VQM V;  4DO2 A;  3A0Y A;  3OMN B;  1VQ9 V;  1QR8 A;  3RKZ A;  1Q82 W;  4HZ0 A;  3JD3 A;  4CWQ A;  3BMY A;  5LGN A;  1SET A;  3AG2 B;  3W7W A;  1AH8 A;  4RO2 A;  2A79 B;  4TWK A;  3ABK B;  4B6C A;  4JGS A;  4R1F A;  2DWD C;  4JYC A;  2YE3 A;  1YT0 A;  2EIM C;  3QO5 A;  5IY5 C;  1A4H A;  1QZR A;  1Z5C A;  1K33 A;  2CH4 A;  2XD6 A;  3TZ5 A;  4Q20 A;  1QY8 A;  3SPJ A;  1MOF A;  4WFF A;  4X89 A;  2YJW A;  4CWS A;  1OCC B;  2VW5 A;  2VWC A;  4GT8 A;  4HYP A;  2FWZ A;  5B3S C;  2IOQ A;  2V7Q G;  3OMI B;  4O07 A;  1KKD A;  1JPX A;  2X6A A;  4UV9 A;  3ZRV A;  3E83 A;  3QDD A;  1U0Z A;  5EK0 A;  3OAA G;  3ZMU A;  3OE7 G;  1VQO V;  2DYR C;  3P32 A;  1B3Q A;  5D7C A;  4G27 B;  1K4D C;  2YSU B;  4PA9 A;  3VBB A;  4RQF A;  4XC0 A;  1YJ9 V;  4P7A A;  3R91 A;  1DF5 A;  5F3K A;  2YE5 A;  1YC1 A;  3TCU A;  4MVU A;  2XAS A;  3E8F A;  1Q81 W;  2EIL C;  1L1F A;  4BIU A;  2YEC A;  2Z3Y A;  3HZ5 A;  3VAD A;  4URL A;  4EGK A;  3SPI A;  2JIZ G;  3K79 A;  2CK3 G;  4XKO A;  1H8E G;  2HLD G;  4PU9 A;  5LHH A;  2ATK C;  2QM8 A;  1ORQ C;  1Y4S A;  5LHG A;  5FNF A;  1NBM G;  1S3J A;  4PA6 A;  4YKQ A;  3B28 A;  1K8A W;  1XL4 A;  3FYE B;  2XAJ A;  3AG4 C;  1RM1 B;  2YGA A;  4PL9 A;  1YT1 A;  3LDC A;  3LDE A;  3ABM C;  2EXL A;  2IWX A;  5CBH A;  3AG4 B;  1J95 A;  2ZDI A;  3AG2 C;  4FK5 C;  2WLL B;  1RM1 C;  1Q86 W;  2WSS G;  1W0K G;  4LP8 A;  1AM1 A;  4MP2 A;  3VHC A;  5M4E A;  1UYM A;  2DYS C;  2ZKJ A;  3W7X A;  4CE1 A;  1R73 A;  3TK1 A;  2WI2 A;  3QO7 A;  4G2K A;  4UV8 A;  4UXN A;  1JM6 A;  1KC8 W;  5FL7 G;  2YGE A;  2OCC C;  3Q5J A;  5IN9 A;  4KTN A;  2WLM A;  1K92 A;  3M99 B;  1K5S A;  4P30 A;  1B6Q A;  1OCZ C;  4LC1 A;  3CCM V;  3AG3 B;  2WLN A;  3X2Q B;  3ASO C;  1R6N A;  4PDM A;  1YSZ A;  4E00 A;  2BRE A;  2EJR A;  1YI2 V;  3B8N A;  3HYZ A;  3U2D A;  3CME V;  2BTZ A;  4EEH A;  3CCJ V;  1DLB A;  1H7U A;  2WLJ A;  1HWY A;  1PNK A;  2H8M A;  2WEQ A;  4QNH B;  4WCE V;  4MBC A;  4ASG A;  5IYC O;  4U93 A;  2LP7 A;  1BYQ A;  1S14 A;  2AKP A;  4E2L A;  4H33 A;  4MPN A;  1JX9 A;  2Q8F A;  4WF9 V;  5H6Q A;  3D0B A;  1I5X A;  4FCQ A;  1ZXN A;  2QM7 A;  4MB9 A;  2EIJ C;  4CE2 A;  1KEC A;  4MVM A;  4WUC A;  4UVC A;  3DTU B;  3CGZ A;  1Z59 A;  3Q5L A;  4MPC A;  1YIJ V;  4BXI A;  1JVM A;  4JAV A;  4WFB V;  3CCQ V;  2EIM B;  3B25 A;  1AI4 A;  2OT5 A;  3NMQ A;  3WG7 B;  5GGZ A;  4AWO A;  3CMA V;  5CA3 A;  2Q69 A;  2Q8H A;  3FB5 C;  4R8C A;  4DZY A;  4EM7 A;  4KFG A;  2IU0 A;  2XDU A;  4NH8 A;  3CRK A;  4QE7 A;  3K0G A;  4L87 A;  1GTO A;  1R62 A;  1XL6 A;  3JD1 A;  2WI3 A;  3K60 A;  3E2E A;  1AMW A;  2YI6 A;  4JQL A;  4R7C A;  1BXD A;  3U67 A;  1THZ A;  1Y66 A;  3A0W A;  2FWY A;  4JF3 A;  4PA4 A;  3BM9 A;  4MVZ A;  3RW0 A;  1TID A;  4ZBM A;  1Y8N A;  5D7R A;  3R65 A;  4HZ3 A;  3HZ1 A;  2MK3 A;  4MSW C;  1L0O A;  3R4O A;  2B1G A;  4PDR A;  5J9P C;  2W6I G;  1KQS U;  1MX0 A;  4L90 A;  2QF6 A;  1AR1 B;  2P6J A;  5CBF A;  3CCV V;  1BHB A;  2XX2 A;  2YEA A;  1S16 A;  4KSG A;  4URO A;  4MVS A;  1RPR A;  1KZN A;  4QIW F;  1K4C C;  3A0Z A;  5IY5 B;  3AEI A;  3OR7 C;  2ITC C;  2QA4 V;  3RVZ A;  1US7 A;  4AS9 A;  5BOD A;  2X6B A;  5M4H A;  1VQN V;  5BZB A;  3R92 A;  4BAY A;  4V26 A;  3ZXO A;  2ZXW C;  2B1I A;  4YXW G;  1YS3 A;  2Y69 B;  4KUM A;  3GB7 C;  2VCI A;  4JAS A;  4FMT A;  4MTX A;  4YKT A;  3ZKD A;  3OMU A;  4RUE A;  2JEX A;  3FB8 C;  1KP2 A;  2E0A A;  1YSC A;  1EBO A;  4JTA B;  1KD1 W;  3WFV A;  4P9O A;  1TUE B;  4MTG A;  3CCR V;  4XCJ A;  2KB1 A;  1E79 G;  4F4L A;  3UKM A;  2R9I A;  3O6O A;  4XIP A;  4MOT A;  4R50 A;  3HYY A;  5IDM A;  4N21 A;  4GX1 A;  3I56 V;  1QYE A;  3EHB B;  2YE8 A;  4PRX A;  4AWP A;  4EFU A;  3ZXQ A;  3OEE G;  5CTU A;  4I3H A;  2BRC A;  3B27 A;  5B1B C;  4XCL A;  2IJI A;  4GX0 A;  1S72 V;  2YKJ A;  2BYH A;  2EBO A;  3JD4 A;  1YHQ V;  2YEB A;  4PDV A;  3G75 A;  3JZ3 A;  1AI6 A;  1EZJ A;  4KP4 A;  4HYM A;  1OZ0 A;  3ZIA G;  3ABL C;  4CWT A;  2ZD9 A;  4EFT A;  1OSF A;  2BU8 A;  4MS2 A;  2Z5U A;  5KA5 A;  4GX2 A;  1AJP A;  1NR1 A;  3CCU V;  1UYK A;  4XD8 A;  1TC6 A;  1JOY A;  1UYF A;  1PD3 A;  4YKU A;  3VHD A;  1VQ8 V;  2BU7 A;  1FXV A;  5KA6 A;  4LBE C;  3OGC C;  3CGY A;  3E8B A;  3ZMV A;  2YK2 A;  4JYB A;  4CE3 A;  3ASN B;  4URN A;  1V54 C;  2DYR B;  3ZN0 A;  1QLN A;  2GHY A;  2WPD G;  2D3O W;  4XDJ A;  3CP1 A;  3B8M A;  3HB3 B;  3OM3 B;  2WI5 A;  4KQV A;  4AWQ A;  2UXX A;  3K03 A;  1GKZ A;  2YKC A;  2Q8G A;  2QEX V;  1NH2 B;  4HXZ A;  4P8O A;  2CCS A;  3FKS G;  2K5B A;  1W2B U;  1YC3 A;  2WLK A;  3SPC A;  3HHU A;  1Q7Y W;  4WFA V;  1H7S A;  2YJX A;  1JQ0 A;  3G6E V;  2XAB A;  2IWS A;  2ZQM A;  2XHR A;  2XJG A;  1VQK V;  3E8G A;  3A0T A;  2WLI A;  3EKR A;  3OFN G;  2M7W A;  4FJC C;  2O1U A;  3G7E A;  1FXK A;  3I55 V;  2DW4 A;  2WER A;  3ZRS A;  3ZMZ A;  1Y8O A;  4H7Q A;  3GWO A;  1GM8 A;  3ABL B;  2B5U A;  2WLI B;  1UYC A;  3CCE V;  1CPY A;  5B1N A;  4Z1M G;  2IOR A;  4NH7 A;  4O04 A;  4GX5 A;  4XDL A;  3INX A;  3OW6 A;  2JJ2 G;  3C11 A;  4HZ5 A;  2GQP A;  2IW5 A;  1K73 W;  4LPB A;  5L3E A;  2BOB C;  2XAH A;  1NH2 D;  4B7P A;  4CWN A;  4FIP C;  1OHH G;  4ASU G;  4CZZ A;  1OCO B;  1ROP A;  2A0L A;  4O05 A;  2OTL V;  2BOC C;  1S5H C;  3F7Y C;  3ZRW A;  3IC7 A;  1VQ5 V;  1GKX A;  2BU5 A;  4CWF A;  2YKI A;  1FS0 G;  2IJH A;  2YEV B;  3IFX A;  1Z5B A;  4YKW A;  3LSQ A;  2O1W A;  1JCH A;  2GSM B;  4H37 A;  3MD0 A;  2Q67 A;  1UYD A;  4EKW A;  1P4R A;  3EHH A;  2YEG A;  1ZW9 A;  2OCC B;  2Q8I A;  5E1A C;  3D3I A;  1Z5A A;  2YI0 A;  1NQT A;  2QG2 A;  2EZO A;  2HJF C;  5HFM A;  3OW2 U;  3LPS A;  4CWP A;  4R3M A;  1ENV A;  2Q68 A;  5IYB O;  2HCH A;  1QVG U;  1GJV A;  2WEP A;  5LGU A;  1I5D A;  2YEI A;  1YC4 A;  3GIG A;  1OCZ B;  4XIQ A;  1FFT B;  3WQ9 A;  3R4M A;  3FV5 A;  3RLQ A;  4CWR A;  1NJI W;  1M57 B;  5IYD O;  2YK9 A;  2DQ0 A;  1YET A;  3ABK C;  1DF4 A;  4KFM A;  2YI7 A;  3WHA A;  2ZBK B;  3CC2 V;  1I5B A;  2HVK C;  1BGQ A;  2HFE C;  4MW8 A;  5DN6 G;  5D7D A;  4E01 A;  1K97 A;  3SPH A;  1UY8 A;  5D6P A;  3SPG A;  2LFS A;  5LGT A;  2ZDY A;  4XE2 A;  2AHZ A;  2XAG A;  3CPW U;  2NNU A;  4GCZ A;  2JKI A;  4LWH A;  2IH3 C;  4YKX A;  4G28 B;  2Y48 A;  3WG7 C;  1QVF U;  1Y8P A;  1KIJ A;  3QTF A;  1V54 B;  2WI7 A;  2XJX A;  3Q5K A;  4FCP A;  3OPD A;  3KE6 A;  4GGL A;  2WLH A;  5FNC A;  1TIL A;  4XKA A;  3JCZ A;  1G8M A;  3E89 A;  4HAM A;  4EGI A;  2WAM A;  4X8A A;  1UYG A;  3LSS A;  1R3J C;  1ZWI C;  2XHX A;  3E35 A;  5EC1 C;  2BU2 A;  2EIK B;  1TBW A;  1COW G;  3O2F A;  1K34 A;  1F4N A;  4WUB A;  2YEJ A;  2YEE A;  1PNM A;  1PKX A;  4OXS A;  3OWB A;  3VHA A;  1R3L C;  4FPP A;  3G4S V;  2YGF A;  2YEH A;  4XIT A;  5EC2 C;  3FB7 C;  3BEH A;  2YED A;  3EHF A;  3SYA A;  4HYO A;  1DTO A;  4PRV A;  4XBF A;  2XHT A;  3U2K A;  2EIN C;  2EZP A;  2IU3 A;  4TT3 G;  1V55 C;  3K06 A;  5H9C A;  2XJJ A;  2WLL A;  4N23 A;  5J6A A;  3JYC A;  3RVY A;  3TZ2 A;  3ZM7 A;  2W6J G;  2PNR A;  5B1A B;  1F23 A;  2UXN A;  1S0V A;  1ID0 A;  1UY7 A;  2GFD A;  4V25 A;  3SJQ C;  2P67 A;  2AHY A;  1B63 A;  5L3F A;  5B1B B;  4CWO A;  3F5W C;  1FXK C;  4MW3 A;  2DYS B;  4MVQ A;  3K99 A;  4JAU A;  4MVO A;  1W0J G;  2JEU A;  1UYI A;  2JJC A;  1QLE C;  1M56 C;  4YKR A;  3T1C A;  1MU5 A;  1FXH A;  4ZVI A;  4UUJ C;  5CF0 A;  3ZMT A;  4XIR A;  5L3G A;  4BAE A;  4QPK A;  2QKS A;  1M56 B;  2XDK A;  2ZR3 A;  5KUM A;  1GK9 A;  5GW7 A;  2XDS A;  5M4K A;  1K9M W;  4JPR A;  4KSH A;  1NVP D;  1R6K A;  3ETE A;  3CYO A;  3SYO A;  3AG1 B;  5C93 A;  4LWG A;  2XDX A;  4P9P A;  2UWD A;  1THN A;  3OUS A;  2ZDX A;  5F5R A;  1OCR B;  2H94 A;  1ZWH A;  3DGE A;  3D36 A;  1R3I C;  1K5Q A;  2WWW A;  1SER A;  1I58 A;  3C0E A;  2XCM A;  4ASA A;  2QG0 A;  3K0D A;  2BT0 A;  4XTJ A;  1CEZ A;  1ARO P;  5EBL C;  3TZ0 A;  3ETG A;  2LFR A;  3T4D A;  2HG5 C;  1YES A;  1F51 A;  3ZRX A;  4HY1 A;  3K98 A;  1CP9 A;  2DWE C;  2EIK C;  3EHG A;  3FT5 A;  1YER A;  1UYE A;  3ABU A;  4WFE A;  3SYQ A;  4L93 A;  5HFL A;  3OUF A;  3CRL A;  4GT1 A;  3JD2 A;  4GQT A;  1I5Y A;  4QJF B;  3LUT B;  1YTF D;  5B1A C;  5CTW A;  3FYI B;  2FYP A;  5CTX A;  2HG1 A;  3T2M A;  3H80 A;  4TSF G;  2XX4 A;  4L91 A;  2W0F C;  4LWF A;  2EIN B;  3QNE A;  3ZJZ A;  1NHI A;  2YE2 A;  3HPL C;  1R3K C;  4DXW A;  1S76 D;  2CG9 A;  5M4M A;  1WLE A;  3LDD A;  3G7B A;  4MT8 A;  1YSR A;  3X2Q C;  3CWV A;  3UM7 A;  1SRY A;  4FCR A;  3IGA C;  3E8H A;  3PJS K;  2V1D A;  1UJW B;  3INW A;  1VQ6 V;  4NH9 A;  5IDJ A;  3VOU A;  2YKB A;  3RLP A;  2HKO A;  2ESA A;  5L3D A;  2K1E A;  2XAQ A;  4L94 A;  3B26 A;  1AH6 A;  3P30 A;  1UY6 A;  5B1O A;  3CC4 V;  1GM9 A;  1OCC C;  1PL0 A;  2H55 A;  2H8P C;  2JK5 C;  1G4Y B;  2A9H A;  3ASO B;  4J9Y B;  2QE7 G;  4GFN A;  1M9N A;  3CD6 V;  4QPJ A;  1BMF G;  1YT2 A;  2X0L A;  1EFR G;  2FXS A;  2O1V A;  1GMG A;  3B24 A;  1OCR C;  2WI6 A;  2X7R B;  4WFH A;  1VQ7 V;  3CCS V;  3AG1 C;  4J9Z B;  3HEK A;  5FWK A;  1H2G A;  3STZ C;  2BZ5 A;  3T2S A;  1KP3 A;  2JJ1 G;  2YEV A;  3G71 V;  1UYL A;  5KUK A;  3K08 A;  4LCU C;  2PI5 A;  3CCL V;  3TUH A;  4BW5 A;  4PEL A;  1EI1 A;  4QE9 A;  4MP7 A;  2Q2E B;  3ZRW B;  2YEF A;  3OWD A;  4R6Z A;  3K04 A;  5EBW C;  1V55 B;  5EBM C;  2YE6 A;  3PEH A;  2IJK A;  2YE7 A;  2BYI A;  3K3W A;  3GIE A;  4WUD A;  3RBZ A;  2EIJ B;  2ZR2 A;  3EHJ A;  5L3J A;  1E1R G;  1GO3 F;  2IJJ A;  2NLJ C;  4X88 A;  2XAF A;  3NXS A;  3QO8 A;  1M90 W;  2PI4 A;  1I5C A;  2XX5 A;  4R3A A;  3OEH G;  3ETD A;  4I9W A;  5L3C A;  4BQJ A;  3EFF K;  5LBQ A;  3ZKB A;  3LNM B;  3GIG B;  2IOP A;  2IH1 C;  4YKY A;  3BY6 A;  1YTF B;  1VQ4 V;  4UVB A;  1N8R W;  3AG3 C;  1U2O A;  4BIZ A;  1NVP B;  2XDL A;  1I59 A;  4O09 A;  5CBG A;  1SES A;  5CN0 A;  2HVJ C;  4XKK A;  2XND G;  5H6R A;  4ZKI A;  3O0I A;  4BQG A;  4HY6 A;  4URM A;  1UY9 A;  1K3E A;  2BSM A;  4DUH A;  1RPO A;  3JD0 A;  1OCO C;  1AI7 A;  3B77 A;  3MHH C;  4H81 A;  1K7D A;  3E86 A;  1IXM A;  2WI4 A;  3R4P A;  5B3S B;  1NHH A;  4X9L A;  3FB6 C;  3SL2 A;  2ZDI C;  3CC7 V;  1EA6 A;  4MPE A;  1QCE A;  1AJN A;  1Y4M A;  3TZ4 A;  1LNQ A;  1UYH A;  2YKE A;  3RLR A;  3FT8 A;  1I5A A;  1H38 A;  2CCT A;  4JTC B;  4ASF A;  5M4N A;  1AI5 A;  3ABM B;  5CPH A;  1AJ6 A;  4U7N A;  3KG2 A;  4RQE A;  2C2A A;  4XDM A;  3W7T A;  5D6Q A;  4HXW A;  3ZCC A;  1JJ2 U;  2X6C A;  2QFO A;  5CMU A;  3GIF A;  3ML0 A;  3A0X A;  1PNL A;  4MTO A;  2HR3 A;  1QLE B;  3W7U A;  1BHA A;  1ZXM A;  4ASB A;  1WPX A;  2BU6 A;  1SZT A;  1FXK B;  1GM7 A;  3SYP A;  3STL C;  3CXC U;  2WI1 A;  3MNR P;  1E1Q G;  4MVR A;  3T10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...