4JB9H

Crystal structure of antibody vrc06 in complex with hiv-1 gp120 core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
232
structure length
225
Chain Sequence
EVQLVESGPVMRKPGSSMKISCATSGYNFRDFSIHWVRFNRRYGFEWIGWIKPMWGAVNYARQLQGRVSMSRLFSQDLYYPDRGTAYLEFSGLTSADTADYFCVRRGSSCPHCGDFHFEHWGQGTAVVVSAASTKGPSVFPLAPSSKALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Delineating antibody recognition in polyclonal sera from patterns of HIV-1 isolate neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
total genus 33
structure length 225
sequence length 232
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jb9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jb9H01
1NAMH 4MA7H 1HH6A 5CZKA 1YUHA 4P9MH 3T4AB 5I71B 4U1JB 1XCQA 3CFEA 3U4EA 1HH9B 2ARWA 1FFPB 4O2CB 4P48A 2ADGB 5EIVA 3PQYB 2YEZB 3HAEA 5IHUH 3RWIA 4ZUVB 3EIFA 4P2RA 4WGWB 1DL7H 4YHMH 5LAXB 2DM3A 3NCFB 3UBXI 1QLEH 1FNGB 2VDNH 1MHEA 3UBXG 4HWEH 2NY6C 4LLYB 3G04A 3MRNA 2EH7L 4JO2L 3JWDC 4HQQL 2FNBA 3NFSL 4QTIL 1RQ5A 3MC0A 1RV6X 4F7EB 5ITBH 3D87B 5DD1L 2K1MA 4NQEA 5JW5A 1KIRB 2V7HB 1KPVA 2P7TB 1SVZA 2CLZB 4FQIH 4LIQE 5IVZA 4K3DL 4HHAA 1P2CB 4Q9RL 2GK2A 1YQ2A 1H3TA 2W60A 4CADB 1Q9LB 2DJSA 2CK0H 3BE1H 4HIXL 2BJML 2AJZA 4R0LA 1NEZB 1P4BH 4JFFD 3DTXB 4HUVB 4J1UB 4LKXB 1MCWW 4S1QH 5DGRA 1DUZB 4XCEA 5C3TA 5FUZH 1G7JA 1LO2H 3MLUH 3CFIC 5K9OB 4XMPH 3P0YH 3PGDB 4M6AA 4WW2F 4IM8A 2NY5C 1LILA 4Z18A 1A3QA 4KRMB 3MGAA 4XTRD 3GIZH 5JW4R 1YYMH 3WNOA 5GRZA 4PJAB 1F4AA 4M3JA 1I1AD 1BZ9B 1IC7L 5K9QG 5JXAL 2ICEA 3DHJA 4G6JL 3QFJB 5D8JH 3WD5L 5MHSD 2YRZA 4LU5H 5L2KD 3DETD 4GMTH 1EUUA 1ZE3C 4CNIA 4M8QA 3O2DL 5DUMH 1FYHB 3BSZH 1D9KD 3ESVF 3VFWA 5DQ9B 5F93C 4L1DA 4BH8B 3FT4B 3NPSB 5CS7A 4XPTH 1MPAH 5KVGH 4LRNL 2BNUB 4ODTH 2AJZB 1AQDA 4X4XB 2GAZB 4HWUA 4P46A 3RWEB 3BP5A 3DIFA 4KUCD 2PYFB 4YDJB 2R0WH 1R24A 5T3ZL 2DJ4A 3JWNC 5DD0L 3BGAA 3C08H 4P46D 5IB2B 3CX5K 1KG0B 2IMNA 4OKVA 1X5IA 5TQ2H 1RZJL 4HCRH 1MFNA 2W65B 1JWSA 5A2KH 1IQWH 5JW4Q 1KIPB 1X5FA 2EDBA 3IDIB 3VWKD 4G42A 5JMRA 2DKSA 4NQEB 5JOPE 3QFJE 4J3UA 4R26H 4L3EB 1YJDL 3LMJH 1PLGH 2E9BA 2D9CA 2X41A 3FO1B 3OXSB 4RISL 2DYPB 1QPXA 4CNIB 4TVPE 3C6SB 1KCSH 4K3GA 3RIFK 4I4WA 1SMOA 2XQBH 1BX2A 3P40A 2R15A 3QO0B 4DVBA 3IVKA 5DQ9A 4OZHB 1T04B 1JHKH 2F8OA 1LO0H 5BRZA 1TXKA 4NUJB 3SEPA 1J0YA 1FHGA 3GIVB 4C54A 3UJJH 4LGSB 1WBXA 3ARFD 2A77L 4P9HH 4LLVA 4BUGA 2NPLX 1ZLVH 2I5YL 2X4PB 3MCLL 4LHJB 1T4KB 4JRXA 3NFPA 1UC6A 4OKVB 4X6DA 1LHZA 1U8KB 2NW3B 2WQRA 3E6HB 4EUPB 4MA3B 1JTOA 2DQEH 2ZPKL 3QG7H 1WVZA 4PRDA 5JORB 4JM4H 2YR3A 4PP1C 3GSVB 4NWTL 1CK0H 1CZ8H 3JTSB 4QCIB 3T0WA 3HC0B 2XY2A 3ARTA 3MJ8B 1QRKA 5GJSL 1HOCA 1KJ2B 4R4FL 1YEKL 3KPSD 4EN3D 1OSPL 4HD9A 4KI1A 4OUUB 5BRZE 2Y07L 2P1YA 3BKML 4MD0B 1FPTL 4D9QD 2GQHA 3UPRA 1EFXA 1C1EL 5E6IB 3VGDA 1D5XB 1QBMH 2ITDB 2EE3A 1U8IA 5MHSE 2ZOKA 1II4E 4I18A 1A1MB 1MJ7H 3QWRD 2I07A 2EXWD 5JXED 3WUWB 2Q3AA 5I16B 1N8ZA 2FD6H 3DROA 2Z4QA 1ULVA 2BSSB 2D0FA 2EDXA 3SKNB 3V8OA 4UT7H 1W72B 3MJ9L 4LVNC 4GOSA 3MZGB 4OLUH 3PWJA 5J1TC 3MLPA 1A7QL 3AAZB 1T0MB 4KV5E 1XH3A 4AT6B 1AQKL 2QEJA 4DK3A 1Y0LB 2MMXA 2GY7B 4X9BA 4ETQB 3GMNA 5DJ8B 3DPBA 4K3EH 3QCUH 4M6ML 1BF8A 1EFXB 1I9IH 2JJTA 1DCLA 1ZANH 2ICWA 4JANB 1IEHA 2WWMD 4JY6A 5E2WL 2VLKE 4XPFL 3MV8D 4MAUL 1G1CA 3ZSTA 8FABB 2OL3A 3CXHJ 4J4PD 3V5HB 3OL2A 1T21A 4N5ED 4ZFFA 3LV3B 2HVKA 2GK0A 3OQ3B 2IADA 4CMHC 4U0RC 3SGEH 4IOFC 3MRRB 4LLUB 1QR1B 1G9NL 5EIIA 5JHLH 1RU9H 5IK3A 2R1XA 1JVKA 4MMZC 1BEYH 4PJDB 1MFCH 1QRNB 4I77L 5BS0E 3E8UL 1YY8A 5F9WC 2HLAB 5ITFB 3OR7B 1XR8A 1BD2A 1FFNA 1MCJA 1S9WB 1U92B 1EV2E 1HI6B 3SKJH 1FFOA 1MIEH 4JZOA 2XKNB 2PF6A 1KC5L 4ORZC 4P23D 1YEKH 4YQXL 1K85A 5DS8B 1QFUH 4LCYB 4XNMA 4NKIL 3L95A 4NZDA 1J18A 1P69B 2MKLC 4LQ1A 1ZWIB 3QIUC 4P59L 3BOVA 4G6AD 3L5JA 2EKSB 1TJIL 2DQEL 1MFBL 1JPGB 1BFOA 3HR5A 3I02B 4EQ2A 4JFYB 3RIFF 1OARL 4LLDA 4BH7A 5CP3H 1HINH 3VJ6B 3FL7A 1BZQK 4GRLC 3TFKC 3LQZA 1R6VA 3KLAB 4KV5F 3ARSA 1J1PL 3L95B 1H0DA 1CLOH 4R8WH 3P9MB 2FHCA 1BM3L 4LNRB 3MV9E 3OPZH 3UTQA 2D0GA 2P5EA 4OLVH 4K7FA 4E0RB 4OCNC 3ZTNL 5DMKB 3MFFB 5CP7B 1T22B 3ARDB 4WEMB 3SKJL 4X6BB 1FJ1B 1GGIH 4CU6A 1UJ3A 1OGTA 2F54B 4PJ9A 4Y19D 3QRFM 3LQAC 1CGXA 1I1YA 5E9DD 5C9JA 4ODUA 3GSOB 4DEPB 3IKCA 3SQOL 1O7VA 4IHOA 4A6YH 3DVGA 3MBEA 3VXUA 1VEMA 4JY6B 4OD3H 2W91A 2VXQL 4HZLB 4KUZH 1N0XL 1RY7B 5GGVH 2VYRE 1ETZB 3BUTA 5EC2B 4HGMA 4FQJH 2ICES 2MPAH 4X5XA 3HC3L 4GRLB 3K7UA 4K94H 3UYRL 4DN3L 1BZ9A 3D6GA 2XTJB 3KPQB 2Z31A 4Y1AA 3V9FA 2YD4A 4KJYB 4D9QE 2COQA 2DM2A 1QR4A 3X17A 2A6JA 5J06A 1RIHL 4H1LG 1MCPL 3OX8B 2YRPA 4FFVD 5GGUB 1A1NB 3O3DB 1RJLB 4B7LA 3S8WA 2VE6A 4Z7WA 4M62L 3QCVH 4P3DA 3RGVC 1M6OB 4OFIA 4XC3L 3QIBB 5CGYC 3BPLB 5EC1A 3AY4C 4P5MB 1JGLH 4X9HA 5L9DH 2EXYC 4ALAH 1RZ7L 2R2EA 1J5OH 5IKCB 5SWSB 1T1ZA 4HK3N 4NJ9H 4XAKD 5BS0D 3X3FL 4K9EC 4U0RB 1JP5A 5HDLA 4MJ4A 4MDJA 1FIEA 4XMLL 5C0IA 4G9FD 1R3HB 3RZCB 2VR4A 4NO5A 5IQ9B 4JFPA 3Q2CA 4Y4HA 1MCCA 3EYUH 5CEZE 2AKRA 1C08A 3PGDA 4JY5L 2VO5A 2XQYK 3HE6C 3VXSD 2EYRA 2VLKD 1EIBA 5IV2A 5EZLA 1CFVL 5BXFA 1FZJA 1ZGLP 3BRFA 4LLMB 2DMBA 4WY7H 3GSXB 3RNKA 4Z7WB 5TDOB 1BBDL 2HKFL 5DMGC 4OCYH 3NH7H 4PPTA 3L7FA 1YMMD 5DO2D 4OT1H 3QIBA 1YEIH 3ULUD 1WIUA 4HULB 4UILL 5DJXA 3VRLF 3T8XB 1AGCA 5I74B 5KS9B 2C4XA 3EW3B 3S3SA 1LP9E 4M93B 1S9VA 3IS0X 2XQBL 3IVKB 3FMGL 2PW2A 5DD3L 1GOGA 1FFOB 3BD5A 4QTHB 1FO0H 3BN9D 5GZNC 3HRPA 5HHOA 5K9OA 4RAVB 3CJJA 1TJIH 5FCSH 2HMID 4LSVH 4DJMA 5EBMA 2K3TA 3AU1B 4XWOD 4QLRA 4Y5YB 4Z0XB 3QBTB 4D9LL 5BVJB 3M1BB 3O6FC 4O58L 1WITA 5ACLA 1JPSL 3GRWL 5I73B 1R5WB 1IEAA 3BEWB 1IAOA 3IXAA 2R4RH 3BPOB 5T5NF 3MJ9A 4FXKB 3T8XA 3N85H 4OUUA 5E03A 3CFDB 4JFDA 4QY8A 4MA1B 1DN2A 3SO5A 4OGYH 3FB8A 3BP5B 5I76B 3BESR 1OY3B 3SDDC 3BYYA 4LCUB 2LAAA 2R23B 3V79C 3FQNA 3BEVA 2BNQE 1WFOA 4XCFH 3U0PA 3QIWC 4Y4HC 5BRZD 3BXNA 3B2VL 2H32H 5IGXL 5C07E 4G9DB 3EOBA 1AO7B 4X98A 3BX7C 5DRXA 2VXVL 1MNUH 3L5XL 5LBSH 3F7YB 4XVUD 3IJHA 1E6JH 2F8VA 4HIJB 4J6RL 4OM0H 3SO3B 1C5CH 2NR6D 4ZFZA 3WJLC 3NPSC 4QXWA 5D71L 4NHCH 4UT7L 1U58A 2VLJA 1OWWA 3KYNB 1MHCA 1OT1A 4OCRL 5K9QI 3RGVD 3CC5A 1RUQH 4K7PH 3ECBB 5K59F 5EOQH 5JA9A 1AHWC 2BVUA 4XNQB 2LU4A 1HYSD 5JORA 5KSBB 4OCWH 4M00A 3NZHH 5E00A 4XNXH 1T7XA 1IZJA 2XZZA 3U7WL 1DQMH 5IM7A 2DIJA 5DTFB 2NZIA 2KH2B 3VWKB 4ZNEE 1FL6A 4NQDD 1U8OB 4PJBF 3V5HA 2YUXA 4WJ5A 2C1PB 3DV4A 3X13B 5F8RC 4RZCB 2GCYA 3TGXA 3F7RA 3RX7A 3L3HB 3WS3B 1LQSR 5D7JA 2QHRH 1IFHH 2DQFA 12E8H 3RWHB 1IC5H 2OTWA 3Q5YA 5IESH 2CJUL 1R5WA 1JYWA 1DN0B 4LSUH 4HV8A 2FEDC 5ADOH 4LASH 1Y0LA 4PRNA 2BSTB 4NM4H 1BVKB 3LHPL 1RUMH 1UWXH 5FGCB 1ZTXL 5IB5B 3MOQA 3BDYL 4YHML 4JQIL 1JF1B 3BGMB 1BQLH 4OTXL 2HWZH 4HEPG 1VPOL 1YNTB 3C6LD 2J2ZA 3AREB 5KSAC 1JK8B 1K2DA 2FX7H 3CXDL 3JWOC 1MOEA 4NN5B 3L3DB 1CGUA 4U3XA 1A22B 1FDLL 4IOIA 5DC9B 3GEWB 1JWSB 5CP3A 1S9KC 1ADQL 1UCBH 2UVFA 3GNMH 3IFNH 2O5ZH 5ANMA 4KK8D 3FN9A 3SDDD 1ZLSH 3ZKND 1JMXA 4MD4A 3UO1H 1PYWA 2NW2B 2G5RA 2WP3T 3DV6B 3GB7B 4QRPB 1L7TH 5DMIH 4F2MB 1MQKL 4JG0H 3SCMB 2R2BA 3HUJE 4L4VA 1P53A 5MERA 5B39G 2DL9A 2IC2A 4QOKA 4RGNB 3NBNA 4OZGE 3PWNA 4RRPA 5GRUH 3DVNB 5I1AB 2V2WA 1U93A 2X7LA 3NTCL 4PJ8B 4MA3A 5EPMB 3ZDXF 1WBZB 4QGTA 3QCUL 3EZ8A 1PY4A 4PJ9B 4XNMB 4ZS7L 4NPYA 4MJIE 1W8NA 1NC2D 3V6OA 1KXVC 4KHTL 5HY9A 4HKJB 3MGTA 1ONQB 2IH3B 5EZIH 1YDPB 5EU6B 2HFEB 2V5YA 4YXLH 1U6AH 3X14A 4J1UA 3DUSB 3MRRA 4LLUA 5C2BL 3G6JF 5EO1A 1ZGLM 3MRKB 5DD1H 1M05A 4WWKD 5ISZA 3UYPA 3BI9X 3U4BH 4YHZH 2HTLC 5CGYD 1AIFB 4PUBH 5D5MA 3I2CH 4OSUL 1KCRL 2WV3A 1HNGA 5KBNC 4K3JH 3HI1A 4I3RH 3PJSA 1QOKA 3DX8A 1P6AB 4U4BA 4U1HB 2E7CA 3EO1B 1U3HD 5BZWB 3CFCL 5D7KE 3TO4C 3VA2C 1IBGH 4JN2A 1A7OL 4XMKL 5GGTL 2FRGP 1KLGB 3BISA 3MV9D 4ISVB 1J0HA 2FYYB 2C3XA 3QUZA 3WFEH 4JPVH 2CRMA 1YNTA 3FOMB 3IKKA 4S1QL 1QRNA 3U30C 3AS0A 4WDIB 3ILQD 3HE6D 1DBBH 4WFHE 4GRLA 1CLZL 1NGWB 1YPZB 2NZ9C 1FO0A 3BMVA 4HS8H 2JTDA 5C2BH 1MCPH 1ED3A 2F54A 1KENH 2RQ8A 5D5MF 2IAMC 3EYOA 4EDXB 3N9GH 2OZ4L 1SJEB 3EHBD 1EVTC 4P0DA 3QO1A 4QRQA 2ZCKH 1X6NA 1NMBH 5DEGA 2EDWA 1OW0C 1R5IA 1S9VB 3LPFA 4DN3H 1T1XB 1BJ1H 5KG9A 5IFAH 1BZ7B 3BPNC 4QRSB 4M48H 5LG1A 4MD5B 3MLRL 2FX8H 3ME0A 1FO0L 2R1YA 3NH7L 4OZIE 3NGBB 5HYEA 4YDVA 2Y5TA 2WLYA 5ICYA 2VDLH 1OP3K 3SQOH 1FCGA 4KZDL 1MCIA 5HVWA 4NWUH 1A5FL 1FGNL 2EDHA 1I8MB 2CDEA 5SX4I 1X4ZA 4OQTA 3BT2H 4OGXH 35C8L 4KJWD 4WTWA 5A3ID 4WY7L 5IVXE 5SWZB 1FNHA 1AGBA 5GGRA 5C07A 5IG7B 2VITB 1F2XK 2YHGA 5F9OH 4NUGH 4G43A 4HDIB 3P0VH 1R5IB 4PGDB 3MA9L 2FGWL 2YUWA 5C86A 2BNQA 4ZYKA 3W9DB 1DLHA 3BIAX 5L8LB 2GI7A 4QRTB 3KJ6H 4IRSA 5SWZA 4ZO7A 1SYVB 1MRDH 1J8HA 5E56A 4NNXB 4AG4L 4F33B 4OF0A 1QBLH 4BM7A 4FG6D 3ARRA 1OP5K 4JZJA 1KSRA 4ZPVA 1N64L 2CH8A 4LSRL 2DQUL 1MJJB 2X1XR 4XPGL 2YKLH 3V6ZB 3HG1D 3KNBA 4UDTB 1MIEL 3BQUA 4S1RL 3SE8L 2L7JA 4UTBH 1KEGL 4LPCA 2C3VA 3O8XA 4CDHA 1RIUH 4DZBB 4YHZL 1ZS8B 4KHTH 4QKXB 4YFDB 4GMTL 1ZSDB 2ZSWA 1MH5B 2HFFA 3MLUL 2C3WA 4G8GD 5DJXB 5EORH 2RCSH 2MWCA 4G7YH 3S36X 1QFWI 4KZEH 4MNGE 2FGWH 5ACZB 1T04A 4QXUH 4KJPC 4F58L 3QUYD 4NBYB 4W6XB 1I1FA 2Y6SC 4OLYH 1T83C 4MAUH 4W4OA 4BSVB 2EE6A 2P45B 4QF1B 4WUUE 1S8DA 1I85A 3P9WB 4G3YH 1WWWX 2FEEI 2YBRA 1KELL 2VZ1A 1WT5C 5D7IA 4Y4KD 2J8UE 2YUVA 1KJMA 1B9ZA 4W4OC 4CMMB 4FQQA 3PQYE 4U1NA 4NN7B 3V6FB 1BPVA 1Z9OA 3T0XA 2OTWB 2WW8A 4WCYL 4N0CD 4CVWA 2LAGB 4LPWA 4TVSa 1E4KA 2ZUYA 1DVFD 5MI0B 1T1ZB 5D2NB 1DQTA 2YA2A 4JRYA 3EO9L 3BGFC 3NIGF 5KS9F 1U8OA 3O0RL 4ODBD 2VLJD 3RHWK 4Y5XA 4BKLA 3QDGD 2NY0D 3TH2T 4KJQD 4WFHD 3LKQB 4RWYL 5CJOL 3NFSH 4XHQA 4I3GA 4NDMA 2Z0BA 1Q1JL 4ZDHA 4NZUL 4WUUB 5DRWB 3RUGA 4Y8DC 5EFIB 4GBXA 3H9YA 1U8HB 3HUJB 4O2EA 4PP1D 1I8LC 2NQCA 2IBZX 1J11A 4LRNH 3S37X 4MNGA 4AQOA 5BZDB 4XC1L 3VFSA 4BZ2L 5JOFB 4PJCE 1IKFL 1B6DA 2L4OA 3MLVH 4I0PD 3QIWB 4BJLA 1QVOB 3LHPH 3HFMH 2YWZA 2PCPA 3QI9B 1RMFH 4WI3A 2GUOB 4MDJB 5GS0C 2KBGA 2CPCA 4ZD3H 3IB4A 2DI8A 1UJ3C 3V6FA 1G7IB 5HDOA 3STLB 1WUNT 1OAQH 4DQOH 4KVNH 3PDGA 4MA1C 4YJZL 1Q0YL 1MVFA 1S7UB 2QHRL 2XWBB 4U6VL 1J1XL 4BFEA 4G9DA 5HTSA 4OZHE 1IARB 1S7XA 4UIMA 5C0AA 3MREB 1FV1A 1ZMYA 3O3EA 4K2UL 4RX4A 4Z7UF 1CFNA 4YK4C 2ICWJ 2QSTA 5E0QA 1S5HA 1Q94A 5E2UL 3MCLH 1LDSA 3DSFH 5BQ7A 2GFBA 3CVIH 4DFIA 4R2GD 3QJFA 2R4SH 4PJ7A 3VFNB 4QCIA 5IMKA 3SGKA 3C5ZC 2V5TA 3KGRA 3MFFA 4P2OC 5GRYA 3RVVD 4PD4K 1AXTH 2I9LA 3FJTA 4HKZA 2XOTA 4PRHA 5C0EB 4YFLI 4MYWB 4POZC 4WFEE 2DQCH 3C8KB 5DK3A 4NRYA 1SEBB 5AYUL 1G7QB 5E00B 2WZPD 4R4BA 3OB0K 2J6EL 4HZLA 4GXUM 2QKIA 1JFQL 3MRGA 4U1HA 4RFNB 4NKDA 4EBQL 3F12A 4D0DB 5I73C 2WBKA 1FYTD 3DGCR 2IALA 4LBEA 4PTUB 3HRZB 4PJGE 1IQWL 4HUUA 3MREA 3O3EB 3FQWA 1MFAL 1EJOL 4RSVA 1NMAL 2C1OA 4ZFOL 3MRKA 1CG9B 5ALBL 3FFCE 4JPWH 3GHEH 4QEGA 1FGVL 3TC9A 4PJXE 3GMOB 1HHIB 4YR6B 4PRAA 2W0FB 4WDIA 2NNAB 4X99B 1OGAB 2AABL 5DTFA 3KG5A 5EUOE 5CILH 4YZFF 3MV9B 1AR2A 1OLLA 3GMQB 4XBPB 3QR2A 1WBZA 3IU3A 3L3HA 3SE4C 1J0ZA 4R97B 3WLWC 4WFFE 5DFTA 3RGHA 4ELKA 1SYSB 3LZFH 5I74C 1EVUA 1A6AA 4LKXA 4ZFOA 4JFEE 4Z7OE 4NT6B 3V7MA 2OL3B 3QDGA 4S2SA 2AGJL 2E9WA 4OCSL 4XBPA 4QRRD 4O02L 2R0LL 4NQDB 4QT5B 5KVEL 4J8RA 1DVFC 3BPLC 3O3BB 5DZNA 4QNPE 2ZPKH 5EO0B 5EU6D 1WZ1L 15C8L 1U8PB 1EZVX 3AY4A 1YEDB 1XH3B 3L3IA 5L7XH 1P4LB 5DI8B 5FCUL 3DECA 1YDPA 5JO5A 2UWEA 4UU9B 5DD5L 3JV5A 5ILTL 1M1SA 1BEYL 3KPPA 2E27L 1E4WH 2H9GB 4BFIA 5C7XL 4N0UE 5JHDE 4JKMA 1K8DB 5H2BA 1YEIL 4H0IA 3IDNB 5DMJB 1P6FA 2A6KB 3BQUD 3O11A 3EJJX 2QBWA 3CZJA 2VXTH 3DX7B 1AO7D 5I1LA 3VDCA 4HXAH 3HFML 4PG2C 3GMNB 3IDXH 5DJ8A 3QDJE 1NMBL 5E6IA 5HXMA 4J2XA 4QT5A 1NBYA 3I3DA 5DYOA 5T5FH 4XX1G 1KB5L 2N56A 5IHUL 3S96A 2HRPL 3HI1B 2R29L 4NQVA 4L3EE 3CSBA 3OGCA 1N4XL 4P59H 4JFFE 2P24B 1UA6L 1INQB 2VLRA 1QRNE 2EDJA 4PJFE 3GSUB 5ACMA 2YXFA 2RIKA 3VG9B 4MZ3A 1EMTL 4PJ5D 4C56D 3MNVB 5E1AB 5I1CL 3ARWA 3TBTA 1EK3A 1RZKC 1E4XL 3IKCB 2GKIA 4IRSB 5ICYB 5SX4H 1FVEB 5C0CD 5D6CB 1YYML 1TJGH 4PJAF 5EU5B 4A6YA 4ZXBD 1F3JB 3JWDL 4WV1B 4N90E 3V4VH 43CAA 4G6KL 1QSEA 3F5WB 2IPTL 4Z5RA 4I5BA 4TVPH 1INEH 3WIHH 4LU5L 5I1KH 5KG9B 3VA6A 4LAQH 1UG9A 3CLFH 4KUZL 4P2QA 2EXYD 3AC0A 3P9MA 3DX9A 2P47B 4WHCA 1DUYA 2FL5B 3MRCB 5F3BA 1UEMA 1H3XA 1AXSA 5C09D 5EZOL 3U0PB 2XKUA 1G7LA 1PKQB 3P0VL 3WE6B 2WM0A 3VRJB 3P9LA 3HS0B 3RKDD 1AO7A 3T1FA 2C26A 1S5IH 4F37F 5C0FB 5H37H 2VDQH 2G5BA 4YAQB 3O3DA 4JDZA 2W60B 3I02A 1TCMA 3SKMA 4HUWA 4I2XE 5FXCH 4Z7VA 5IB3A 3MLZH 1LWRA 2KZWA 4EQ3A 3QEQD 5DGQA 1MCEA 4HUVA 3T2PA 3T3ME 3L3JB 5KVFH 3GSUA 4G7YL 4HPOH 1E6JL 1G6RL 2Y5TB 3QAZB 4NWTH 3U9PL 2IJ0C 3LKSB 1NCDL 1YA5A 2R69L 4LSQL 4LNVA 3H9HA 1K6QH 3LH2L 1EXUB 4JKLA 2V9TA 5E5RB 5MEOB 4BZYA 2R0KL 1SJHB 4ODSL 3CGTA 1GGIL 1DQQB 2E7LC 4GKNB 3VWJD 5E7FA 1T1XA 2N7AA 4GUPB 1YEJH 3HCVA 3MACL 5FGRA 1RVFL 1HIML 1AGDA 4TSBH 5F96H 3CMOL 3QISA 4GG8A 2CLVA 1BHGA 3MRLB 3OX8A 2EDFA 4Y5VB 5GGUA 4E41A 2Y36H 4OGAC 5FYKD 5CJQH 3TV3L 2C7UB 5FO7B 3OAZK 3IJSB 5K9JL 1ZKAA 4NP4L 3DBXA 4KK5D 3QUZD 1BJ8A 2YD6A 4MS8D 5E94B 4EUPH 3FO9A 4U7MA 2BY0A 5D96B 1KLGA 2PR4L 1LEIA 3OAUL 5GGRY 2PYEE 4X0KB 5C0BA 4OFYD 4OAWA 5EZJA 4H1LH 3RL2B 1CD1B 1MFEH 4L4TE 4E42A 1OOAA 4YDIH 1MJJA 3RDTB 2Q86B 3QDGE 3JZ7A 1OPGH 2KPNA 3QQ4A 1S3KL 4JZNA 2Q8AH 5K93A 3TT1H 1HXYA 3KJ4C 5I8EA 4EIGB 4QYOB 2EEBA 4LEOB 3OJ2C 3C2SA 1U36A 1IC4L 1P5VA 4FFZL 4H88L 3IDGA 4JFHE 4JFQA 3FZUD 3MLXL 1U8KA 3E6HA 2NW3A 1J8HE 5DFVD 2P4AB 1FV1B 5CKAA 1DQLH 5ITFA 4F8QA 5DQDL 4PJEA 4QXGL 2YPKB 4U49A 1F4YL 1A6TA 3MX0A 1T89A 3P30H 3LS5H 5CCKL 2JB6A 4MQ7A 3LY6A 2Z31D 4Y1AD 5I75B 4JFPB 2Y1VA 4NRXB 4NFDA 3ZLQC 4U1LA 4N0UA 1AGBB 2LV4A 3HZVB 1NDMB 1QSFD 4HUUB 4HS3B 2D4FA 2XWJA 4UTAH 4NZTH 5CEXB 5C09A 4BKLB 4TQEL 4O4YH 2CDEB 3QHFH 2D4DA 3JTSA 3OKYA 4JKPL 4NDMB 1DN0A 1J12A 3O2WL 1UKTA 2DWDA 5E8NA 1A2YA 1T3FB 3DSFL 1NDMA 3MODH 2XZAH 3EYFA 3I75A 5D93C 4R7NA 4NKOA 3MGOB 2FD6L 3SE4A 4M7ZB 3RZCD 3V0WH 4K3DH 3RHWF 3CZFA 1CCZA 4YXHH 3RA7H 4JFZL 4NUJA 5FK9B 4JO3H 3C6LA 2FH6A 5IMKB 4P9HC 2V6HA 1BREA 4FQXA 3IXAB 2RB8A 2DQIH 4I9WD 2MOVA 3KYOA 3RWIB 4O00A 3HNTH 1CZ8L 5AAWA 1ZXQA 4X5WB 2ZOLB 4HQQH 1ND0A 3CDYA 3MZTA 5JXEC 2ED9A 5FYKE 1CDYA 1UB5A 5FUCE 3H7BA 4EZMA 1JWMB 3D85B 1T0PB 1GVIA 1I3UA 3FFCA 3GIZL 1NCAH 3QNXA 3LKSA 3QUXA 4LSUL 3DUHA 3BPCA 1QFUL 2IG2L 1IEBB 2CO6B 1IGIL 3VFVA 1N7ML 3O41B 1JNNH 4NJAH 4XXCC 3TNMB 4NQDA 1WTLA 4DKEH 3L6FA 4GRWE 4NO3A 5EA0L 4YDKH 3LN5B 4Y4FD 3U9UB 1J9CT 4HPYH 1CGVA 4U2YA 1WCBA 5DDHA 5FGBA 3N06B 1FLTX 4Q58C 4RQQA 3KLSA 4YH6A 5TE4L 3WUWA 4F7PB 5I75C 1OGAE 4X6DB 4Y4KA 4PJGF 2CLVB 2VL5A 3KPRE 2A0LC 1BVLA 4XNXL 1AFVH 1LDPH 1F4XL 4YX2H 1JGEB 1Y6KR 4OCWL 2XWJB 5CBEA 1S9XB 2M26A 4Z7NE 2NR6C 3F58L 3QEUA 1WWAX 5T3ZH 1IILE 1IGYA 3BKCL 4JFFA 4XVUC 2R0LH 1CDBA 3VGFA 5J4MA 4YR6A 3CDCA 5BOPA 3G6DH 4PJ8A 1S9WA 2GCYB 3JVGA 1F3DJ 4MVBC 1TMCB 2BOCB 3PHQA 1QKZH 4GAYA 1FNEA 4YC2B 1ZV5A 3SOBL 4NKMB 1OAKL 2W92A 1GGCH 2MFNA 1RFDL 3X12B 3MJ8A 1AH1A 4GS7B 3WNLA 1P7QD 2QKIB 3RX8A 1YUHB 1DDHB 1F00I 3SDXF 4LSRH 3LKOA 4R90L 1KG0A 1UM4H 4QRRE 2BMKB 4E5XB 1WC7B 3TZVA 1J05A 5TDNB 5F3BB 3GSRB 4P23B 1EAPB 1H9VA 3IXTA 4L8SB 2Z91B 1VFBA 4XBEL 5FYKL 4NZRL 5I71C 3MV7A 3QNYA 3GMOA 3L3DA 1KCKA 1XR8B 3O6FD 1KEML 1XGQA 3KPQA 1QEWA 3MV7D 1TJGL 1RI8A 3U1SL 3NAAL 3V52H 4RA3A 4ODUB 1OSPH 4PBXA 1MI5D 3VD5A 4Z76B 3NFNB 1NJ9B 2O26U 4XVJL 2ADJA 4YIQB 2H3NA 5DD6A 3U7YL 3VMNA 5F1SA 3K8MA 4XNZB 1AE6L 3Q5TA 1V7NH 3MRFA 4M6OL 4YGAB 2ERJC 1EO8H 1NAKH 2V7NA 4WJ5B 3B2UC 4FXKA 3C09C 3VXQA 2I60L 2UV3A 4OZFB 5ESQB 3WFCL 4HWZB 4XCEB 3ULUC 4ORGA 4DW2H 3RGVB 4NYLA 3X11A 1KTLB 4ZG1A 5GGRB 5C07B 5C6PB 4GRWF 1MCHA 4L4VB 3TNNB 4X6CF 5IEHB 5JNYB 4PJXA 3KPRD 5T1LD 3DUSA 3VJ6A 3NCEB 4ZUUA 4FQLH 1D7FA 2XTLA 4GQPH 3QQNA 1FLRL 2UZIH 2VZ3A 1VFOA 3THMH 3KDMB 4BZ1H 3VFPB 2YN3A 3O6ML 4N0CC 3O4OC 1IGFL 2QV2A 4GBXD 1FL5A 4U6TA 1CU4L 4WHYH 4C57C 1PEZA 3F8UB 4WV1A 1OF2A 3QUXB 4MA7L 3QQ9C 4PJDF 5T3XE 1IMHC 1JGDA 5FM5O 4ZUUB 5HPMA 3W82A 4HLZH 4KMTH 1Q0XH 1IGJA 4IBLT 2EICA 3L3OA 4WNQA 3VFPA 3FZUC 4MNGB 3D25B 2O61B 5EU5A 3UBXA 3WFBH 2GSIA 3KPSB 4LIQH 1AD0A 1YZZA 4J3XA 4JO4H 1NFDB 1MUJA 3UX9B 4QRRA 4TOYH 5E4EB 2ZG3A 1U3JA 3WKML 3ZDYF 5B38B 5CJBA 5AD0B 1YNKH 5HYSB 5TPWH 1ED3B 3HZMA 3RWDB 2J8HA 1XFPA 1TZHB 5F89B 5GSVB 4BZ1L 3HZYA 5DWUH 1RUAH 4HWNA 1RAMA 4ODXA 1YQVL 3INUL 4MS8C 1KTKE 2G75A 3S98A 2ZCLH 3O6LL 1HKFA 2JLLA 3H3KA 5JW5B 5BRZB 5AZ2H 5I66A 3DBXB 3DNKA 2H6PB 2R0ZH 4Y16C 3KLDA 1KIUA 1M05B 1CLCA 3L3OB 4ZUVA 2FIKA 4DTGL 1J8HB 3IDNA 4FQHA 5E1HB 4IRJC 2EDKA 4G8GA 4Y5VA 4AH2B 3MNZB 3PABB 1TNMA 4TRPL 2Y4SA 1RSFA 5DD0H 4HF5L 4UINL 4BYHA 2YPLD 3B3IB 3U7YH 2YN5A 1F90H 3V4UL 4GSDL 4I3SH 5JZ7C 1JHLL 1VFBB 4HIHA 5D6CA 1JZ3A 1MI5A 1XMWA 1VGEL 4IRZH 3TA3B 2YPLA 3B9KC 1A9BA 3MLSH 1MFDL 3GSWB 5IJKA 3MR9B 3KPNA 3NCCB 5IW1B 3UTSA 4BH7B 2LE9A 1U3HC 2GTZA 1INQA 2VLRB 3KJ6L 3B5GA 5TDOA 3TM6A 3F7QA 2M8XA 2VDRL 4K71C 3MLYL 4LHUA 4UV7H 1MY5A 5D7IF 4YBQC 4XBEH 1ZTXH 5F1KC 2BVPA 3VFWB 1S7XB 3RDTA 4NUGL 2B1HH 3VGHA 3MR9A 3PV6B 4HUKB 5CP7A 4DN4H 2F58H 3HHRB 3WXWH 2HFGL 4X7SL 5MP6H 4LVNB 3MOAL 4RFNC 3EHBC 4OFPA 1A7PL 4OLEA 3UTSE 3TBWB 2X4OB 3VGGA 2R8SH 4JM4L 1M7XA 1MWAL 3L5WA 3SGJC 2VE6B 1LVEA 5IFHH 3HC4L 3FQRA 3FOLA 1AR1D 1FZOB 4R4BB 3E6FB 2A77H 1ZEAL 1HQRA 4P9HL 3ABZA 4LLAA 5J3HC 5DEFB 1IZKA 2D7OA 3DUUB 2H2SD 2IFGA 3HMXA 3UTZA 1V3KA 1WZ1H 5E6IC 3WNNA 2GITA 3GMLB 1PW3A 2Y25A 1IT9H 1CVSC 5C0BD 1DQJA 1QFWL 1JZ6A 2Z8WC 4YHKL 4G8GE 6FABL 3BAEL 3O45A 2Z92A 4JGJA 1CICA 3RU8L 1EXUA 1C16B 5I8CA 5GS0L 1XF2B 2P44B 1Z9MA 5DJ2B 4CVZB 2DLGA 3EDEA 3IFLH 3PE9A 1AP2A 2VC2H 3VFNA 1BFVL 1IKNC 5FF6B 1ZVSA 4Z8FL 2AK1L 4PRIA 2CDGB 4HIIB 3S88L 2DIBA 3I6KA 5LGKA 5DMYA 1F45A 1OGAD 4FQ2H 5IV2B 5C0RH 2V2TB 4DKEL 1I7UA 3QEQE 4ZSOB 4DVRH 1CL7I 1HCVA 4RGOH 5EBMB 1KN4H 3LKRA 1BAFL 2M1KA 3UJTL 5CWSA 5CHNB 4QGYA 3NVQA 2QLVB 3R1GH 3KPOA 2R0WL 3MYZA 1TPXC 2XKSA 3VXOA 3BYTA 4PJAE 4Y2DB 3U79A 4YUEL 1EEZB 1U3HA 3OZ9L 4ZODA 3NCYS 3WO4B 2ZUWA 3VWJC 3MLYH 1JZ8A 4KGLA 3TYFB 4FP8L 5DR5H 5D2LA 1H0DB 5A3IC 5FYJH 5ISZD 3IJYA 5F88A 3GMRA 1KYOK 3DHMA 4DZ8B 5EUKA 3MLSL 5EOCL 3WD5H 2XV6B 4DCQB 4JJ5A 3KPSE 2R2BB 4GBXB 4Y19B 1KACB 3WJJC 1IKNA 3K46A 2Z4QB 5EBGA 2ED8A 5I15H 1B0RB 4UT6H 4EOWH 1T5WA 1DUYB 4RMUA 4NO3B 5J12C 4ELKB 3P4NB 3ARFC 4JPKL 5FKPB 4N1EA 3HE7A 3HG1B 3W9DA 1FAIL 4LCWB 2ZKHH 4XGZA 1ZOXA 3BDBA 3DVIA 3ZO0A 5HHXH 4TPRL 2OS7A 2VLLA 3L1OH 1UWXK 1TZGL 1D6EB 1GGYA 4NQXB 1CWVA 4L4TA 4M9OA 2XXMB 3ZE1F 2XPGA 1G9ML 4HFWB 1RZ8A 1GHFH 3VCLB 4DVBB 2ZNWA 3CK0L 2NY2C 4TTDD 4MNHA 5D1ZD 3IFOB 2OCFD 4JFHD 3QIWD 3S5LB 4M1CC 2VLLB 3IS1X 1LO4H 1FGNH 4LOUD 4QHLA 4Y8AA 3VH8G 4MNQB 3A67H 1FO0B 4P3DB 4U6YB 1VERA 4TUJA 1H5BB 2F19H 1E27A 3MUJA 4KKAC 4QTIH 2AQ3A 1J05B 5CIPH 5T1KB 5DVOA 5IOPB 2OL3L 5KTEL 4RAUB 5J1AA 5HDBF 1NGZA 1C7TA 2ED7A 4BELD 2QSQA 5C0GB 4G9FA 5H37G 4YGVA 3QZWG 4Z9KB 1BIHA 1CGWA 1JF6A 1AY1L 2WMPA 1OSZA 3HPJA 3UZEA 1FQ9C 4GAJH 5FV2A 4PJIB 1NFIB 4LSTL 1FNEB 4XWOC 4YZFE 4PV9A 1XF5A 4LSPL 5DC0A 5ISZB 3QH3A 3RGVA 3FFCD 3MRIB 2P48B 2FB4L 3GBLA 2ICEB 3L5IA 1FZJB 2VN7A 3V2AR 2HRLA 3QXAA 5DUML 1YY8B 1JPTL 4FA8A 3WS6A 1LD9B 5E8PA 5HGHA 3OGOE 1S7TB 5F21B 2O93L 4YHPB 1QNZH 3KLAA 2Y36L 5M7QA 1ZHBB 3KPLA 4JHAL 1N5YL 1UWGL 1L0XA 5EU4A 4G8IA 1LK3H 1ZHKB 2NTFB 2F53E 2FHBA 3KPRA 4Q6IA 1IAIL 3HC0A 3QA3A 5FYLE 3U36B 1QSFE 2R56H 4WUUA 3RUGB 3C60D 1KF9B 1TQCC 4JFED 4XCCH 3EYVA 1XGTA 3JV4B 3LEVH 1KIQA 5E8OB 4NT6A 3RY4A 2PN5A 4FTVE 5BZDA 3EKCA 3PWNB 4NOFA 3T09A 4LLDB 1KN4L 4PJDE 3UJTH 1DBAL 5BS0B 5HHXL 4JM2B 3B3IA 2PKDA 3BW9A 3Q6GH 5DHYB 2ESVE 3C60C 5AG8A 1G0DA 2Y9RT 5D2NE 3SDAD 3S4SB 4ESKA 1LO3H 3ULSA 1GZPA 2DDQL 5J8OA 5AUMA 4W68A 4EOWL 1N5AB 3BVNB 3AM8C 5D72L 3HZKA 4JVPA 1HXMB 2VISA 5JQ6H 4RWHA 3NA4A 4HJ0D 4E5XA 4LVHC 3WXVH 3C9NB 1KNOB 1S7TA 5DA4A 5KOMC 4NQED 4J7RA 4OIIH 1ZLWH 2FEEL 2NY4C 1WZLA 3RTQB 4H20H 4O9HL 4JPIA 1KJ3L 4JFOA 1JRHL 4PS4H 4WW2C 1W2KT 3SDCD 5I1JL 3T0EB 5F7EH 2YXMA 5FGCE 3BPNB 1A14L 4EI5C 2OQJA 3IU4H 1UYWL 2KQMA 3H42H 3IDYC 1KB5A 2BNQD 1FYTA 5DVKA 4BA8A 2P24A 2J4WL 2AJXH 2A38A 4GAFB 5ID0A 1RZIA 1OTSC 2NLJA 5F6HJ 1JNJA 3GHBH 4YPGA 4MX7A 5GIRA 4L8SA 4UMGA 1JYVA 1OAXL 3GK8L 2VTFA 3ULSB 5C2UB 2OXGA 1E6OL 2B1AH 2J8OA 1KT2A 4NC1E 4ZPTA 3ZE1E 5GGVY 3SPVB 4OBSA 3ARFA 2LU3A 4YO0A 1WK0A 3O6KL 5CIPB 2PTTA 3LB6D 2YEZA 3HAEB 5FYJU 4Y2DD 2W38A 1G7LB 1PKQA 5GHWH 4PJIF 2UZYB 1F4WH 4JPIB 3T08A 5F7FA 1JGUL 2GSIB 4LARL 3OB8A 1MAMH 4CU8A 5SWSE 3BAEH 1URLA 4PJ9C 2APFA 3REVB 4K94C 4LLQB 4M03A 2A6IB 4OF8A 4WO4A 1NAMB 4OT1L 5ERWA 1BIIB 1MWAB 1MAKA 4LRIA 5TFSH 3VXSA 1QO3B 4HW6A 4QHMA 1CT8B 4PJGB 1AJ7L 4MLIA 4Y4HD 4LKCB 4PRID 4PJCF 2GJ6A 2CXGA 3GSWA 5KVFL 1U8LB 1QRND 4D2NA 4GXVL 1CL7L 3PWUA 2R23A 2BVYA 1KPUB 3ULUE 2E3VA 4QHKI 3CVHH 3S36H 1NUNB 5C0BE 3LEVL 3I6KB 3LKNA 4WUKH 3RVTC 1H5BC 4Z7NF 2P8MB 4LMQE 3VRIB 2XT1B 4H5SB 1RK1B 3OKLA 1X5GA 2PUQT 1YC8A 1MCDA 4OZHA 5C0IB 3SCMC 1DANT 2AGJH 3IJSA 4MCZA 4JHAH 4I3RL 1DBMH 1EGJH 4M1GL 4PGCB 3BDXA 4NQEE 4NZRH 3LS5L 1NANI 3FO9B 1FNAA 3FAXA 4N68A 1XCTA 1EFXD 2DYPA 2OSLB 2F5AH 2MCPH 5KSBF 4D9RE 3WS6C 4RAHA 4R90H 1RZFH 3KPMB 3AREC 5KSAB 4AZ8A 2IMMA 4YNYA 3OZ9H 1I1FB 1HHJB 3PXHA 4PJAA 1JE6A 2RBLA 5D7SL 3OR6B 1EEYB 5JPMB 4P4RA 3FTGB 3VFMB 4MJID 1FBIL 5D7LB 3SOBH 3ZYZA 3CAFA 3CUPA 4ZAKC 4L9LA 3RX5A 3X13A 3DI3B 2VITA 1XZ0A 5E70A 4R7NB 1T2QH 1TETH 3TO4D 1YYLL 2W0PA 1ZHNB 3TVMB 4HWBA 4HAGA 5B21A 1DQDH 1PAMA 5C0DA 4XCNA 1ZLVK 2XA8H 1GAFH 1HXYB 5J3HD 1I9JL 4HS3A 2N7BA 3FT4A 5TE7L 5C0NC 4GW4B 4P2QE 5TDPA 4YHKH 6FABH 1E0OB 2XTJE 4XNYH 3LEYH 5HYSG 5HHOE 4BUHA 1FJ1A 2PCPB 1QLRB 4RBPK 3FN0L 5DUPL 3KLHD 2FL5A 2C5DC 2C4FU 2CLRA 4FFZH 4H88H 2VL5B 3RJDA 1JV5B 3BDYH 2HJKB 4HCRL 1BX2B 4PRPD 1A4JB 2L0DA 2Y5EA 3SO3C 2IEPA 3QH3B 5FM4A 3MXVL 5KVEH 3D0VB 3QXTA 3FO1A 3OXSA 4YLQT 4N8CL 5KSVB 2VXUH 3WO4C 4CL7A 1DE4A 5DRWA 1V3MA 4HV8B 4AL8H 4HMEA 3CSPA 3MLTB 4HBQA 4NKDB 1BJ1J 2NY7L 5FA3A 5FFLA 4MB3A 2X89A 4K8RH 5D2LB 4DUWA 3ZE2F 2RR3A 1U2CA 3RBSA 3P77A 5F3HA 1NCTA 5HHME 2YD9A 3OAZH 4Q9QH 2MHAA 4BZ2H 1CD9B 3QDHA 1SEBA 4OZIF 2OTPA 4FXLA 4FQLL 3BP7B 4OI8A 3QNXB 4X99A 4NHUA 1T0NB 3PG2A 3BIBX 1J1OH 4C59B 1S8DB 2B4CC 3CUPB 4JRWA 4N0YL 1P7QB 4RWYH 3TIEB 1DFBH 1EBPA 3FRUB 5B22A 4E41B 3RWDA 3VGBA 1UM4L 4NQCA 3FO0L 3SKNA 2XWTB 2EEDA 3U6RA 3GSNL 1VGEH 5MENE 4IRZL 2XRAH 4W6YB 1E4XH 4OFVA 4JLRB 1JF1A 3BGMA 5TE6H 2VSCA 3QFDB 3NACH 4XC3H 1J0KA 1UT9A 5JXEA 1HXMA 1UGNA 2ZOKB 5BVPL 2WBWB 3JWOH 4KHXL 4ERSH 1N6UA 4TSCL 1H8NA 3FN3A 1L4IA 4TRPH 3ZE0E 1MRFH 3LQZB 2P8MA 5ETUB 4J8RB 4K07A 5SWZE 1XGYH 2V17L 1UACH 4WI6A 1RZKH 1NGXA 3MJ9H 2VZOA 2BDNH 3CH1A 3SHSA 4P46C 4YE4H 4IS6B 2Q6WB 4Y19E 1GZPB 3VXRE 2O5XL 1FL5B 3LPGA 2A83A 1BJMA 3WLBB 1FORH 1PZUB 5J6GA 1LK2A 4ZFOB 4MXWL 5T3XH 4D0BA 1BOGB 2XFXB 5EN2A 5GRWA 1FE8L 5JHDB 1YEGH 1MJ7L 4PB0H 4Y4FB 1VACB 2D0HA 1OB1A 3WNMA 1IL1A 3RWFB 1NC2A 2XTJD 3G9VA 3WE6A 5EU7E 2PYEB 2AQ2A 2VN4A 4Z95L 5IFHL 3KPSA 3QUKB 4JQXC 1C1EH 3C8DA 1KFAH 1U8IB 2J88H 3Q5OA 4N90D 3SDCC 3QWQB 4V1DA 4M3KB 5DMKA 4PJHF 3IRZA 5DJYA 4I5BB 4APQC 3QG6B 2AEQL 5CD3A 1ADQH 1ZT1B 3ARVA 5E8PB 5HGHB 3FONB 4HJJL 3D85D 3DMMD 4PV9B 3VXQB 1MVUA 3IDMB 3NOIA 3HLAA 1GGCL 2ZUXA 3G5VB 3B9KB 3WHXA 3DMMB 1QR1A 1F5WA 2EDQA 4ZO8A 3W9EB 2W1NA 1K5NB 4R3SB 5ADPL 2NZ9D 5EO9B 4LQFH 4FQCL 1CQKA 2F5BH 5E5MA 2IALB 3CU1A 4KPHL 2G9HB 2HP4A 3OXRA 4CBPA 4OM1H 5HGAA 5FOJA 4KJYA 4LCYA 4I0KA 5GISH 2M2DA 1NBYB 1MF2H 1FLRH 5CLWA 2FATL 4LK4A 4PJHB 4L5FH 2XY1A 3A6CL 3PIQA 2YC1B 1F6AA 4JFEA 3DX7A 2LTQC 5E5MB 2D7NA 1P7KB 5BS0A 1I85C 4LLWB 5D6DC 1A6VL 4IIQA 2BSSA 4MA8H 1HN1A 1QPPA 4WHYG 3MNVA 4OCXL 3HLAB 4MHHG 1DQML 3PL6D 2HMIC 1X5XA 2V5RA 3V5KB 1UJTA 3I6LE 1I1AC 4LHQB 3PWPB 5DVLA 3NMEA 1XEDA 2X4RA 4O4YL 5B8CB 1K9TA 3O2VL 3T3PE 1FVCA 5IBTH 1MCLA 4P5TA 5EOQL 4YDLC 2Q7NA 1UXWB 1RHHB 4X9GA 3MA7B 4OBRA 4U3CA 4DW2L 4Y7MA 4XVJH 4OB5L 4J6RH 5DRNB 4P4KC 1DZBA 5I1HH 2P8PA 2ZUVA 3BVNA 5D5MB 4AQ1B 4FQ1H 1CFSB 5IM7B 3OBAA 1Q72H 4HS8L 3BSZL 1EO8L 25C8L 5H35B 1AE6H 1I3RA 5LGHL 3ULVF 3V7AE 4F57L 1H3PH 4PB9L 4PTTA 4KTDL 4TUOA 1K8DA 3L7FB 5B8CC 2A9MH 4I0PB 3C09B 5DRNA 1OVZA 2BK8A 4I3SL 3WLWD 1OTTC 1G1YA 1UM5H 5J6HB 5HY9B 4XNZC 4NRZA 1CGTA 3MSPA 3RWJB 5IVNA 3HC3H 2Z31B 4Y1AB 1Q8MA 5T1KD 1Q0XL 3DMMC 5CUSH 2ZSVA 5DSCA 2YPVH 1NGYB 1I9RH 2IADB 4U7SA 3OKOA 4X7EC 1MCSA 1OW0A 4MAYD 1HZHH 1HHHB 3HAEG 5C8JB 4HGWB 4KDTC 3OB0H 1NEZA 2VH5H 4D94A 4U2ZA 5GS3A 1VKXA 4NNPH 3O4LA 5HI4D 2NY3B 3ZKXB 5FF6A 1CN4A 3MPCA 3N1PC 2ERJB 1IGCL 1OTTD 1TZIB 1ZVYA 5GPRA 1SBBA 4H25B 1OAKH 4R4NC 5I17A 4GG6A 2NXYC 4Y4FC 3W0WD 1E4WL 5C7XH 5FDYA 3TH4T 2IQAA 2VKXA 5C71A 1MH5A 2FWOA 2KQNA 4DOHE 1K3ZA 3I75B 4XP4H 3X3GH 3LAFA 1EDQA 4Y2OA 3NTCH 4GS7C 1P7HL 3TO2A 1R3JB 2YMXH 5E2VH 1CLYH 5T1DL 5I1GH 2H8PB 4X6DF 5DUBA 1DE4B 2ZG1A 4YC2C 4ZFGL 1S7WA 1BGXH 3MJ7B 2WBJC 4XNYL 3AS2A 3QO1B 1LK3L 2FH8A 3DJ9A 1MUJB 4K8RD 4J3VA 4RX4D 4PRPB 2IG2H 3TZVD 5IFJB 5FHAH 1C8PA 5C09B 1CXFA 4Q9QL 2WIIB 1OM3H 4HEME 2JJTC 1M7IA 1MLBA 2FJFA 4K23H 1CFTA 2QADB 4KC3B 3WNPA 1WISA 1G7HB 1T0NA 2YK1L 4AEEA 4QRTA 1DBBL 3GSNA 4JQVC 1N59A 4H8WH 1ZLWK 1CFBA 4LVOC 5DJDA 2CUHA 3MOAH 3QHTC 3WS3A 1UYWH 32C2A 5CWSB 4WRLA 2HFGH 3ALXA 3TFKD 1INEL 3VRLE 3P4NA 5FKPA 4G6KH 1AD9A 1IBGL 2BHZA 2GTZB 2VIRB 4FN0A 5LCVL 4NJ9L 2X70B 2MQCA 3BZEA 4BSVA 4S1DD 5HBBA 4QHMB 3WXVL 5C6TL 2OL3H 2VLKA 3KWWA 5I1CH 4LCCA 4OQTH 4U05A 5IWLC 4Q97A 1BLNB 1NH6A 3BRGC 3A0OA 1X4XA 5I1JH 2HKHL 5EU4B 1EEQA 3I50H 2Q6WA 2EYTA 1QA9A 1RHHA 2HRPH 4PJFB 4XPAH 4ONGH 4WO4B 3QHZL 3WFHB 5L0QC 4WWKA 3CFJA 1G7HA 3H6JA 4MCYA 4U1MA 4RMWA 1OP5H 4KVCL 5GS0H 3KR3L 3V52L 3BKCH 4IOFD 1HEZB 4LLYA 4PG9B 4S0SD 2XZCL 3OTTA 4MB4A 3O2DA 4TSCH 5DFVC 5IHZB 3H0TB 3FB8B 4C56B 4L29B 1HYRC 1J1OL 1T5XA 4Z6AT 3BN9C 3VWJA 1A6PA 1W0WB 2XA3A 4WWKB 2ZKHL 3QZWB 4U1KB 1B3JA 1PJ9A 1GSMA 1X5JA 3UROR 1F4YH 2XN9D 4KZDH 4EEEA 2ESVB 3OF6D 3O45B 3WBDA 5I18L 5I15L 4PP2A 5KW9H 4AMKH 2DQFB 5IBLD 1SY6L 1TVDA 1EAPA 5IW3A 1AQDB 1TJHH 4X4XA 5EWIL 1N64H 1U91B 4M48L 4PB9H 5D7LA 3GSQA 1MELA 2QQNL 4Z7VE 1L9NA 4POYA 2JE8A 1FH5H 4UIMB 1BWMA 1FNFA 3MROB 1OQOA 1LEGA 3ECBA 4Z0XA 2AI0H 3MCG1 2J7LA 2GFBB 2FBJL 5GXBB 3FT3A 1IAIM 2HLFC 2HT3C 1BFSA 2FCBA 5AYQA 5FUOL 5TJWK 4TTDC 1CGYA 1TVHB 5JTWA 5TGBA 5LKNA 1D5ZA 3I85A 5CEYA 4HSQA 3WJLA 5E6YA 4U1IA 4S0TD 3FRPA 5IT2L 7FABH 2OP4H 2NXZD 4X7TB 3A6OA 2D3VA 2YS4A 3RA7L 1S7VA 3OAUH 3GSRA 4P23A 2F54E 2AXHA 3KJ4B 4HLZG 1IFHL 5JQHC 1UKSA 2WUCH 3ORJA 4TSBL 1CDIA 2H2PC 4EN3C 1BGXL 5D1QD 4I77H 4ZAKB 1D5ZB 4YFLF 3BO8A 1N0LA 1T89C 5C08E 5H8DA 3WEXB 5KJRH 1U8HA 3HUJA 3ZTJH 1NMAH 3HG1E 3OGCB 5F7HA 2VNCA 3EJZC 1LK2B 5DD5H 1E4XI 3DX6A 2X4QB 3EDFA 1HWGB 5D96C 4X5LA 5A1AA 1T4KA 4JRXB 5EDXA 4DTGH 1RZJH 3IGAA 1AKJB 2WIMA 1O7SA 5EBLA 4OLYL 1B0GB 4OIBA 2FYYA 1HHIA 2K7PA 3LRGA 3MBXL 5FYLH 2AK4B 2GJ6D 4OCRH 4KPHH 2Q3ZA 1CFQA 3QWOA 4OCYL 4PJFF 4NSKB 1MPAL 4XPAL 5EORL 4LBEB 1XT5A 1S5HB 2P5EE 4R2GB 1W72A 2YRLA 5INDB 4XHJD 2C1OB 3BP4A 5DHVB 1IQDA 1XIWB 4IMKA 5KVMC 5I1KL 3CFBB 1NEUA 2R56L 2AV7B 1MIMH 4ZQKA 5DJ2A 2GJJA 3MODL 5A40E 3O3BA 2R1YB 4ISVA 4QNPF 1A47A 4KXZH 5D9SA 1G7MB 1W0VA 3PF2A 5IVXB 1OHQA 4MQTB 2A9ML 3KS0J 1A6ZB 3AXLA 1YEDA 3L3IB 5FDWB 4PJFA 3WFHA 5L2KE 4P57B 1H3PL 1T6WA 1MJUL 4U1GC 1RJZA 2F54D 1MCOH 3BKJL 4GT7A 4KK6D 2EDDA 5K33A 4X80H 5BV7B 3T4YB 1M4KA 1Q9OA 2IPTH 1J0IA 3R06A 2DOCA 2AEPL 2C1PA 3DV4B 1RULL 1HSBA 4OZ4B 2QSVA 3E0GA 5D70L 1BQLL 4OTXH 1F3DH 3KPRB 3MBEB 3RUGF 4MNHB 3FB6A 5DK2B 3VGEA 3HS0A 1XGUB 2E7BA 3V4UH 3FQXA 3M17A 4OLZL 5I0ZA 5JMOC 2P42B 3IDXL 5JW3H 3E2HB 1OTUC 1JNLH 3UDWA 5IHBA 3SGJA 2MPAL 3ZL4L 3QG7L 4B0MM 3Q6GL 4FZ8H 4IRSC 1Z0MA 2PXYD 4GG6F 5GRJH 2VDLL 4I8DA 5I1DA 2DRUA 3D2UB 1V5JA 3BIKB 1Z9LA 4KQ3H 4RMQA 5AUMB 2PXYA 3P4OB 3CH8A 2WANA 4F9PC 4KMLB 5GS1A 5DJ6A 4OUOA 2V2WB 4FTVD 2B1AL 5EUOF 4HLJA 2E7LA 4UV4H 4PJIA 1ZEAH 5KSBE 3C60B 1BQHB 3D1MC 1NLDH 4O2FB 4RNRB 4X7CC 4OI7A 4MD4B 1P84K 1FSKB 2NY1B 4Q0XH 4EDWL 4YEFA 1JV5A 3B83A 4YDVB 3ZDYE 2HYMA 3BUYB 4ODXB 2HFEA 2NY4B 4K7PX 2DQDL 4XP9L 3QEGL 4U1NB 1HINL 2BVOB 4IMKC 5FYJE 1I3VA 4NO5B 1BD2E 4FRWA 1MREH 2AW2A 2CR6A 4GJTB 2F9BT 5KSUB 1EZVY 1A6WL 4NPYB 5F7DA 1JJUA 2X9WA 4NNXA 4F33A 1YNLL 1CI5A 4ELMA 3AROA 3ARBA 3G04B 3MRNB 4IDJH 3F65A 1CDUA 4LDLB 2VR5A 1QQDB 12E8L 4WFGD 3TZVC 2EKJA 5I66B 3SDXE 1F4HA 5HVHB 5DSCB 4NCC1 1VENA 2HH0L 2NY1D 2R0KH 3LZFL 1M7DB 4R7DB 2PO6A 2Z8RA 1KJ3H 5ALBH 1RK0A 2D03H 3QPXL 4G8FB 4WEBH 5B3JE 4F7CA 1BECA 3WFDH 4UAOC 5J6HA 1WTGT 4JRXE 1I1AA 4L8DB 3MRBB 4DKDC 4MNQD 3RWJA 2BVQA 5I1IH 5CEZH 4FABL 1M71B 4P5TC 1N26A 4L3CA 4X4ZA 3VD4A 1INDH 2EO9A 4P2OD 3HNVL 1G9MH 5CIPA 1SYVA 3D0LA 4O5LH 4L8BB 1SJVA 3TEUA 1ZA3A 2AAVA 2GTWB 4E41E 1AD0B 3MRLA 2PXYB 3P4OA 1SY6A 3OKKA 1QSZA 3H9SE 2DTML 3QCTH 2G2RA 4FQ2L 5F88B 4UTAL 1JGDB 1MQKH 2J6EH 1UXWA 1V7ML 1L7TL 2VZUA 3KPOB 5DMIL 5GZOC 3MBED 4G8IB 4LCWD 1CFTB 4UTBL 1KEGH 4XHJC 3IFLL 1A6UL 2R2EB 4A2LA 3WKNA 4JCLA 15C8H 1BLNA 2DS4A 5IFJA 1L6XA 4IDJL 2YSSB 4V1DD 1MF2L 2BNRB 4Y5YA 1S3KH 3ROLA 4L8CB 4JZNB 3DV6A 4QRPA 2ATPB 3R8QA 3EYSL 4HZAA 4FTVB 2CSPA 3ARFB 1MQ8A 3HE7D 3CX2A 2X70A 1A21A 3LVEA 3SJVA 1AO7E 4LLVB 4LSTH 2A6JB 3QUMB 5DJ0A 1LEIB 3D2UD 1CFVH 3GJFH 4ONFH 2NY2B 4AYFA 4QHNB 2EYSB 4URTB 1EJ6A 1NLBL 4OZFG 2BSRB 1Q0YH 1VADB 2VXTL 4JAMB 3TV3H 3ZHDA 2AXJA 2A6IA 1P1ZA 3OJVC 4GW5A 3BH8B 5D7LE 1M7IB 1L0QA 5EU7C 5J7CC 1S7QB 43C9B 5D1QB 2IH1A 1QSFA 3FQTB 1CK0L 1MHEB 4PLJD 2XZQH 1H3UA 4GG8B 2ICWI 4C83A 1MJ8H 1HDMA 2DI9A 3MLVL 1CR9H 3ZE0F 1ND0B 4EKXA 3H3PL 4PTUA 4AEHH 4JRYE 2JCCB 5IB5A 4F15B 3EO9H 1X6LA 4NKMA 4UV7L 3ROLB 2NYYD 1TPXB 3OG6B 4B53A 1UJ3B 3GGWA 4HS6B 2OLDA 1Q1JH 2VLRE 4WW1A 5HGGS 3ZYIA 3U4BL 1K6QL 4NRXA 3QCVL 1GOFA 1P7QA 4JPKH 4KTYA 1U8MB 1OAYH 4IIQB 3FT2A 1CBVL 1F4XH 5ACZA 4M7LT 4ZTPH 1KCLA 4G3YL 4LCWA 3CFKA 2VDKL 5KSBA 3NIFE 2EC9T 2EZ0C 3BPOC 4PJ8D 1PLGL 2ZP0T 1T7YA 5MERB 2CKBL 4H26B 3NCJL 4R26L 2Z93A 1LP9B 2HJLA 4HJGB 3GJFK 1R3LA 4YDKL 5F9AC 4F7PA 1A7QH 5EZOH 4GKZB 5F97E 2D7QA 1KXTB 1YY9D 5HPMB 1PVHA 3EBAA 4JDVA 5IHZA 4LRIC 1AD9B 3EAKA 2LU7A 3KYMA 1YEHL 3TJHC 4LOUC 1B90A 3WLBA 2L7UA 1RIUL 3SDXA 1EEYA 5JPMA 2I07B 4FNLL 1XF4B 4C55A 5TGBB 1IGML 5LQBH 4X4YA 1RK0B 4G8FA 3GSNB 2FJGA 4MHHI 3ARED 3QULA 4LPYA 1I7TB 5IWLA 1HHGA 3FT3B 4KKCD 4PB0L 3FCTA 4GKSB 2V2XB 3KYMB 3QEHA 5C0RL 3QWRA 4R8WL 4OV5B 4M62H 5JOPD 5EH1A 3QUKA 5L8JB 3TH3T 3D3VB 4LPXA 3N1QC 4RQQB 3GSQB 1U8QB 2CXKA 3DVNA 1U6AL 2A0LD 3D39D 4HUXB 4ZSOA 3G08B 3SCMD 4UI2A 5IBUG 3SE9L 5CBAB 1WJ3A 4P5KB 4U6HA 2EIBA 3VDBA 2OJZH 4UOJA 3VFVB 1EH9A 3DURB 4RFEA 1VEPA 1ZVSB 4JJHA 4LDEB 5EBLB 3UC0H 3VDAA 4WTZA 3S35L 5J0BA 4V2BA 4U1KA 1U95A 5B39B 1YEJL 4MWFB 5E2VL 4TUJB 5ID0B 4LGRB 3C5JB 3O3UN 3MQIA 3K3QA 1QFWH 3W0WA 2H9GA 4BFIB 3QEQB 3U9PH 4R9HA 4ZSOE 4YNYB 4X83A 2V2XA 3EOTL 5FCUH 3DMMA 3ET9F 3SDYL 3BT2L 4HG4J 4LSSH 1UH2A 3WUWG 1XIWA 1CFSA 4I18B 3D18B 3V4PH 3D5OF 2J8UB 5IHLB 2E27H 3VXNA 1F13A 5HVHC 3TZVB 1DQLL 4MAYA 4RGND 2JIXD 1UM6L 4QXTB 3MLXH 5L88H 3SJVD 3KDMA 5JIIA 3N50A 2OZ4H 4MJIA 1CTNA 4RDQF 3S35H 4M43H 3C2AH 1K4CA 2FO1A 4PRIE 3PV6A 3UP1A 2APXA 4XP5H 4R0LB 4Y19A 3VWKA 2E6JA 1CXEA 4MD0A 4LDOB 2CQVA 3VE0A 4JR9L 5ADOL 4CVXB 4G6FB 4XCYA 1YPZF 4X6CB 2B7DT 5LJYH 2AJVH 2K7QA 3P4MB 2FSEA 3WHXB 1PGRB 3PGFL 5CILL 1SY6H 3WN5A 4EI6B 1U8JA 5BV7H 4JANA 3G9AB 4P57A 5EOCH 3TN0B 3E8UH 1OGAA 3ARDA 2GEEA 1F8TL 4X80L 3O6MH 3NN8B 4YHLL 1GPOH 4HH9A 4RMSA 1VA9A 1MCRA 1BD2D 1R3HA 2J6EA 5IQ9A 3HN3A 4G8EA 1RIHH 2IAMB 2WQ8A 3FQWB 4ZXBC 5EC1B 4QXTA 5HHPA 4JM2F 2MCG1 1FL3A 5JOEA 1SJEA 3KLHC 3T0AA 2APWA 1NUFA 1YJDC 2JIXB 3UAJC 4YXLL 4XPHH 1KNOA 4L9DA 4XNUH 3GM8A 1I3RB 4QRPE 5E1AA 3CX5J 3QDME 2VZTA 5D7IE 3ULVD 1S7WB 2ICWB 3BWAB 4KQ4H 5CZXD 3L5XH 3RAJH 1X5KA 2F53A 2C3HA 4F2MA 5J1AB 5MEOA 4G6FD 3QNYB 3MJGX 1GL4B 2DLFH 5INCB 3ZSSA 3ZKMC 4RGMC 3RBGA 3GBML 2GHWB 5IBUB 3W5MA 3L9RB 3G5YB 4IHOB 3QUZC 3B2UD 3T77B 4H25A 1RUPH 3RTQC 3FTGA 3VFMA 1QFOA 5GISL 4F7MB 5JLZB 3SJVB 1RIVL 3JVGC 4OM1L 3ILPB 2YBRB 2YD7A 3V7AG 3GRWA 4D9RD 3QNZB 2IPUK 2OQJB 4PJCB 2QSCL 2X89D 1QSEE 4RFOL 5KJRL 1T20B 3UCRA 3ARYA 3Q6FB 2ORBH 4XP6L 4GUPA 3PHQB 4DAGH 5D1QA 3EOAB 3KHOA 4K8RL 1JGVH 4OLWH 4X6EB 5ICXB 4NO0A 4GW4A 4NRZB 5TDPB 1T83A 1T5WB 3OKNA 4PGBB 2DWEA 1D5MB 1D6VH 4NM4L 2IANE 5ALCL 2AEIT 1NEZG 3AFLA 4ZOAA 4JM2A 4JPWL 4L3CB 5LGJA 3RFZC 4MXVF 2AJXL 1KPUA 3JUYA 5L9DL 2Z35B 4F7MA 5JLZA 1OCWH 2JJSC 5TFSL 3FMGH 4S11A 4KY1H 3I6LD 4M5ZL 2BY3A 3UJJL 5DJAB 4EBQH 5EZLB 1D5MA 3CMOH 1Q9LA 3O81A 4RCAA 5F7NC 1IE5A 4G9FE 3PWPD 5JZ7D 3MUY1 2VDPH 5I8OL 3MNWA 3LN9A 5CEZD 1MWAA 1QUNA 3ESUF 1MLCA 2NY2D 1XGYL 2V17H 3MUGA 3WSQL 4Q2ZB 5E5UB 4OZIA 4R6UA 3LDBB 3RJQB 1JTPA 4L8SC 5DFWH 3EO0A 5C8JA 3SN6N 4MAYC 4X98B 5J56B 3DO7B 1PQZB 3O2WH 1E28A 4YBLC 5FO9A 5EUOA 4XPBH 5FIEA 4PJ5E 4KDTA 5DK0A 4PBVC 4XPHL 1OAXH 2ADGA 2BVTA 1QTYT 1YMMB 2SEBB 4JKKA 5LBSL 3SE3A 1HHKA 2VRAA 1R0AL 4C83B 3FB5A 2HFTA 4GO6B 2NCMA 3VWKC 4M7JH 1CD1A 4P5TD 4X6CE 1XZ0B 2HAZA 4LGPB 2B4CH 3OKLB 2PW1B 1ACYH 5F6IB 4F80A 1ETZA 4S1RH 5EC2A 3SE8H 3TO2B 2MHAB 4H1LA 4XPTL 4LAQL 5HDBE 3I50L 3P30L 4HK0B 5EFIA 4CU7A 1MRDL 4MJ6B 4JFDE 5JIHA 1NC4D 1J1PH 2PO6D 1NSNH 5D1XD 1CFNB 1EERB 3RVUD 5DR5L 3FQRB 5FEBA 5I30H 2JKXA 3LPWA 2O5YH 4XPGH 3B43A 5T5FL 4UQ2A 2E9JA 2ITDA 4PJXF 3GO1L 2X40A 4PYHA 4XWGL 4ZFZB 2HLAA 3ULVE 1EEZA 1IAII 2BRRL 1NUGA 4NQSB 4ONOA 5DA0B 4G6ML 2X1OA 4NFCA 1G6VK 2B2XH 1NGPH 2G2RB 4OLWL 3ZDZE 3BP6A 4U6HB 3HPLA 5AAMA 1P4BL 3ELAT 3TWCL 4HIEB 5TE4H 4K9EL 5B38A 2BJMH 1PG7W 4LPUA 5EUKB 3JSSA 5L0QB 4MA8L 2A83B 1CICC 4WO4C 2UY7A 1NUDA 1XAUA 3PV7A 4KJQC 3O6LH 4FS0A 3GUTA 4OAWB 3RL2A 1CBVH 1IGIH 1VDGA 4NM8L 5CCKH 1X4YA 1OAYL 3O3AA 3C8HA 5IFAL 3T2NH 2YD3A 4LFHG 3GJFB 4LCCC 1NKOA 5DT1L 1JPTH 4PV8B 2D7PA 4Y2DA 1UH3A 2VR9A 3H2WA 4FG6C 5BO1H 3RPIA 2GSGB 3MO1A 3GM0A 4U1LB 3U2SB 5TPWL 3TIDB 3O4LE 3QXDA 4U6YA 4ODVL 5D71H 1IEBA 4WU5B 1B4JL 2DQHH 2IF7A 4HMCA 1EHXA 5D7IB 4OZHF 1MFBH 1DP0A 4UQ3B 1FIGL 1WV7T 2OK0L 5ALCH 1U2HA 3DVGB 1G6RH 3NABL 3MRJB 3U4EB 4W6WB 3D3VA 2IGFL 3MCKA 1BFTA 3FQTA 1Q9KA 3OAYH 4YWGH 2Q76B 1P7KA 1BQUA 3ETBF 1KT2B 1S7UA 5GGTA 3WXWL 3TBSB 2VDQL 3FRUA 3C5JA 1EEUA 3QXVA 2NY5L 3RWGA 3LOWA 5D1ZB 3VD3A 3O9WA 4HWZA 1AP2B 3IGAB 1NBVL 5FYJD 5JHLL 1AGFB 1ITCA 1Z3GH 3PWLA 1SJXA 3MRQA 1KCUL 1QHPA 4POZD 1JK8A 1K2DB 2X4NB 2B4CL 1VFAA 1KCVH 4YHNA 4BQ9A 1S7RA 5ELIA 3MRDA 1LEKB 4JN1H 3MACH 3UTTA 5FECB 1A6UH 2JCCA 5K9KB 4J3OC 3CVHL 2W9EH 3QA3B 1I9IL 5CJ8A 5FHBH 5KANG 1I75A 2P8PB 4XAKE 3WEXA 3UTOA 4K3EL 4JR9H 4M6MH 1I3GL 1GC1L 3KYNA 2PTUA 5JO5B 3ULVH 4EVNA 4OCMC 3MYJA 4NBZB 4BFBD 4K71B 1KLUB 4XNUL 1VGKA 5DHVH 1D5XA 4O5LL 1UFUA 2B8OT 3FO0H 4QOKB 4YFEA 1DVFA 1CF8H 5E24E 1BOGA 2IWGA 2XFXA 2X4UA 3RZCC 3VI3E 2X1PA 1L7IH 2WLZA 4K7PY 2ZCKL 2NXYB 4Y4FA 3RTQA 4XCYB 4UQ3A 2LFGA 5MEPB 4CUCA 4QYOA 4D3CH 4UNVA 3FO2B 2PNDA 3W0WE 1CYGA 4AEHL 1BM3H 3H3PH 4RAUA 3GB7A 4AIOA 8FABA 3K4DA 4YDJA 2HVJA 4PGBA 1V3JA 1VESA 4S1SL 2DN7A 2Y7QB 3RI5K 4N9GA 3O9WD 5ETUA 3VFUB 3HRZA 5MEQB 3NCBB 1YMHA 4Y16B 1JCKA 2BFVL 3B9EA 5HYQB 5FV1L 5CJOH 4LHUD 1BF2A 2R1XB 5CZVH 4HKBA 4MJ5B 2Z31C 3P4LA 4PR5A 2EDYA 3GO1H 2ORBL 4M4PA 4XP6H 3QAZC 1TIUA 5GS1B 2BOBB 3IRPX 1NGQL 1X3DA 1FVDA 3V95A 4JG1L 3TO4A 3QEGH 1M71A 3IU4L 2QHLA 3VG0H 1CDGA 3FN0H 1XR9B 1V05A 1S7QA 3HNTL 3KPLB 43C9A 1NBZB 5ENWB 3M07A 3QRGL 3JTTA 1GGUA 1A3LL 3LKNB 4HJJH 5D7LD 2CJUH 4NKOB 1IGCH 5CD5D 1TFHA 3MRPB 1KN2H 2J5LB 1I8KA 1CFQB 3D3VD 5DJAA 3OJDA 4S1SH 2EIDA 4DEPC 3DX8B 4HKZB 3NN8A 5ECJE 4QRRB 3OJMB 3EUUA 4PJXB 1IM9A 3HI6H 4YHYB 2MQ0A 2EIEA 3BWAA 5HYSA 3EGSB 3QXUA 1NFIA 2J5LC 4NQCE 2CD0A 1G9NH 3GSVA 3TLRA 3TJEH 1JYNA 1CT8A 4PJGA 3TP4A 1HE7A 3MRJA 2CRIA 4TPRH 4G7VL 4KK5C 5F7LB 1HHHA 2A2QT 2EDRA 3FQUA 3PDDA 1J86A 1NDGB 2JIXA 4A6YL 1OF2B 1Q9WA 4TSAH 1DLHB 1FBIH 3WIIH 1ZA6A 3CCHB 3VFRB 5I19H 3BWUC 4MB5A 3T2OA 1AXSB 4HGKC 1XR9A 3STZA 3HA0A 4LNRA 2O5ZL 2YKLL 4PIRF 3INUH 4HKJA 5I9QC 3QDMB 3LKQA 1D5IH 4UQ2B 2NXZB 1N4XH 2HKHH 2AK4D 2FX7L 3CXDH 4P3WA 3VD7A 2FB4H 3NACL 4XCNB 2XNAA 1IGTB 5FECA 2WINA 1QBML 1ZWIA 2XG5A 3ZDZF 1VSCA 1N3NB 1A1NA 1CQYA 8CGTA 4CADA 2FWOB 3KPTA 1DQQA 3ARGA 3GI8H 1RK1A 3AGVA 4WO4D 4F7EA 4O58H 4WIQA 2R29H 1JI1A 4HK3J 3MA7A 3T0ED 5HI3D 4JKPH 5F1IA 1KBGL 1HQ4B 2Z8VC 3U0TA 5KTEH 1SMAA 3JTTB 1TNNA 2DM4A 1D9KA 3TJEL 5DEGB 4DKFL 1UM6H 3IDGB 2R0ZL 2P5WE 2IBGA 4X6DE 4X8XA 1UQSA 1DVFB 1FYTB 3B9VA 3MNZA 1P4IH 3UJIH 1XF3B 5HVFB 1KV3A 4UDUA 4DUVA 4UNTA 1HH9A 3VD9A 1G7IA 4KKLD 4JB9H 4PRBB 1ZSDA 4UOW1 4RAVA 3MUGB 5DC4B 1DJSA 3VXUE 2I25N 4M8QB 3PGCA 2F74B 1G84A 3QDJA 3DGGB 3VFOA 1HSAB 1JWUB 2H26B 5IMLA 5KZCB 4WHTB 1KCSL 1DL7L 2Z91A 3TCLA 1IC4H 1C5CL 1JPST 5FYLD 1NCCL 4JY4B 5ADPH 3V6OC 2CRYA 4GAGH 5DT1H 5DHYA 3QJHA 1ORQB 2OBGA 3VFSB 2OI9B 5T33H 5JDSB 1WAAA 3I6GB 1F58H 1NAML 1LMKA 5HDQH 2NY0B 2H32A 1OTSD 2X9YA 1QLFB 2NX5D 4JPVL 4BH8A 4XMLH 2HJFB 2HTLD 1AGFA 1ZT7B 3F7VA 3LRSB 1IAMA 1C5DA 4EN3A 1DEDA 1R3IH 1FRGH 2NNAA 5CEZL 1M7DA 3O4LD 4R7DA 1FGVH 5I1DB 4OGYL 4JRYB 2R9HC 2N1KA 1OD7A 1QO3A 4L4VD 5SWSA 3QPQD 2P5EB 2B2XL 3NPZB 4EI5D 1KB5B 4P2RE 1NSNL 1QVOA 2R4RL 1T7WA 4AEIH 4XZUB 1MCQA 5KSAA 3OKDB 1NCWH 4R96A 3CFEB 5EOCJ 5HHOB 1EJOH 3IT8D 5AYUH 3P9LB 1JL8A 4W70A 4EUPA 1GGBL 4NRYB 4PLKC 3VMPA 4IRJA 3IXTB 2DLIA 3SDAC 1LO2L 1KYOJ 2C3VB 3O8XB 3MV7B 4P4KD 1PY9A 3BH8A 5CEYB 3NZHL 1D3CA 5FHBL 2VMFA 2F53D 3AM8A 1JZ5A 4ZOEA 2IQ9H 4AT6A 4QHUA 3BGFB 1LNUB 1CICD 5CBAA 2BVPB 3Q48A 3BE1L 4ZUTA 2A1WL 3TVMC 1S5IL 2ATKA 3UTTE 4Z78B 4M5YH 5L2JA 4K94L 4J23A 1FZOA 2AERT 3S36L 3B9KA 4EDXA 4NHCL 3AMKA 2EC9U 4LCIH 4CJ0A 3GJEB 3BP4B 5DHVA 4Z77A 5F6IC 4M7ZC 4A2MA 5FGSA 1P4IL 2IPKB 4XXDA 3VXSB 4HUMB 5DI8A 3GMQA 5D93B 2VJXA 4ZUTB 1G6RB 1LD9A 2CKBA 2VXVH 2A73A 3AS3A 3TBYA 1GGBH 2XZQL 3ZKSD 4I0CC 4TN9A 4KY1L 2PYEA 4FQXD 2OR8A 4CVUA 4J12A 4TNVK 4XGZB 1KBGH 3ZTNH 4JQIH 1CIDA 1T80A 2PYFA 5EG6C 3D18A 5I6XB 1E4KC 5MEPA 3UTZB 1CDJA 1ZA3B 5AG9A 3MLTA 1OSZB 4OF3A 1A6WH 1Q9OB 3BJ91 1IJ9A 3R06B 5BXFB 5D1XB 1YEEH 2D2OA 3G6AB 3H8NA 3ARBD 3W0WB 5ICZA 1CS6A 1IC5L 5DS8A 1ZT4A 2JELL 2I5YH 4G5ZL 4ZAKA 3RVVC 5CSZB 2XQYG 4KRPD 3ULVC 1HYSC 1UB6A 2IH3A 1K4CB 3U9UA 5CZVL 1AHWA 2IFFL 1I8LA 1A7RH 5T5NG 2WK2A 1CXLA 2BHUA 4P5TB 3PWPE 1TDQA 4YBLB 3LN4B 5IIEB 3O0RH 5BJTB 5HYJB 4MAYB 4FZEL 3WFEL 5SWZD 3OKMB 3LKRB 4APQD 5F7UA 4MDIB 3K1DA 2HT2D 3CSGA 5IK3B 1I9JH 3IFOA 1NJ9A 3K2UL 1ZHLA 3RDTC 3T4YA 5JNYA 5ILTH 2N4IA 1DBJL 2DMKA 5F1OB 1NGPL 3A6BL 5HHVL 4FFVC 1JPFA 5C0JB 1FAIH 4YBQD 2X1QA 3TVMA 3LN5A 3BKYH 4YGVB 3WSQH 1RJYA 3AAZA 1FFRA 1G0YR 4MNQE 2I9LB 3PJSB 2JJSA 5J13B 5L6YL 1S78C 5BMFL 2EC8A 4DFHA 5I1LB 2XNAB 1KJVA 3NGBC 1MRFL 1JN6A 3MMEA 5I1EL 2DDQH 4Z7QF 3PP4L 2MCPL 3H9SB 1AGDB 3NFNA 2DAVA 1P9MC 5INDA 2X05A 5HJ3A 4QRQB 1FL3B 1TTGA 2NY1C 4JHWH 4ZNEA 3CLFL 3OKEB 4PR5B 5GRUL 1W72H 2VQUA 2CLRB 3MV11 4XCCL 3D48R 1KGCE 5C9JB 3QFJA 4FQPA 2MQ3A 4HFWA 5E4IA 5JR1L 4ODHL 2BERA 3UO1L 2BFVH 3S7GA 4RDQG 1DR9A 3GNML 4Q6IC 4IJ3B 1BAFH 3FQUB 1I7ZA 4R4FH 1MCWM 4XPBL 1AI1H 2UWEE 3TPUA 3M45A 4I48B 3V0VB 4JFXB 1RFDH 2H45A 2XICA 3ARGB 1GC1C 1BBJB 1RMFL 1Q9WB 3MA9H 4EJ1C 5ID1A 4BQ6A 4JREC 3U46B 1JFQH 4IJ3C 1FPTH 4LVHB 4W81A 4FQ1L 4ZDHB 3ZZ1A 4NIKB 3ARZA 4XT1C 3QUML 4HIIA 3MRDB 3RWFA 4NQCD 1B4JH 2DQHL 3C60A 2VXSL 4E41D 5L88L 5IB4A 4JO1H 1MEXL 5C1MB 2CDFB 5C0GA 1QFHA 4IMLA 3PIQB 3IDYB 1K8IB 4TSAL 5IEKB 1JHKL 1IT9L 5CD5C 4QXGH 2A73B 4ZO9A 1NAMA 1T66C 4PJEE 1EO5A 4LARH 2W9DL 3VG9C 3FHAA 1GCFA 3VXSE 3QUMA 3ISWA 4I4WB 4HWBL 2FIKB 1OWRM 4K55A 3B6SB 4HPYL 1F3JA 3ZE2E 1CR9L 2APTA 4AH2A 4UILH 1H15B 3LEYL 1FN4A 2IBBA 3DRQB 3QUXD 5E2JA 3KVQA 4N5EC 4KMQA 5MEQA 1A4KA 3G5YA 4MSWB 4OLZH 1A7PH 4RMRA 3MJ7A 3MLZL 4LPTA 1TCRA 2ESVD 3N9GL 3MOBH 5E2TH 3GI9L 3SKOB 3W11C 4LL9A 4XMKH 2BCKA 1SJHA 2IFFH 1AC0A 5D7KD 4I18C 3T04D 1CLZH 1NPUA 1ZLUH 1TQCB 4XB8A 1UENA 1HILB 3EO1A 5EB9A 4S1DC 2WWKO 4S10A 3VXRD 4R0LC 1U8LA 5KVDH 3TN0D 2F8XC 1RUML 3NCYP 4M6NH 1PSKL 3CDGB 4TVPL 3NIFF 2UVEA 5F96L 1MIML 1N3NA 4GLRI 3HE7C 1K4DA 2CIIA 2GTWA 3HNSL 4GQ9L 1JHTB 3DYOA 4U1SB 4PY7A 4I48A 5IESL 5FAAA 4C56A 1ACYL 3WO3B 5CGMA 4P2QB 2OR7A 4FNLH 4HIJA 2OYPA 5LGJB 3TF7C 4RGNC 5HHMD 4FXGA 4Z95H 2ITCA 3WHE1 1LO3L 2IAMD 4FQJL 5GGSB 3W5NA 4N1HB 4D3CL 2F74A 5IMOB 3VFGL 4XRCB 3ZT5A 4GRMA 1JNHB 5TH2B 4PYGA 3OF6A 1KTDA 4M1DL 4XVTL 1MCFA 3MJ6A 3BD4A 1B0GA 2UYLA 4KRLB 2R39A 4Z7VF 1A6AB 1JUFB 4NNYA 1YEHH 1F97A 4Q0XL 1JIBA 3EGSA 4TULH 5BW7A 2HTKD 4QXUL 1ORQA 3AUVA 5CJXA 1ZLSL 2DYPD 2CIKB 3QNZA 3IDIA 4L8CA 1MHPH 2V5MA 2D7MA 2Q86A 3TNNA 3TCLB 3EJZD 1I7RB 1LGVA 4HIEA 5GGQL 5KAQG 3QT2A 4WEBL 5FK9A 2DQGH 4KU1A 1J7VR 4PJ5B 1A3RL 1KIRA 2X1WL 5DQDH 2FJFB 3C5ZD 1NCCH 3G5ZB 2CGRL 5EA0H 4L3AA 4OLUL 4F7CB 1OCWL 3RP1A 3VMOA 2MSPA 1GH7A 4TOYL 3MV8E 1T3FA 1IRAY 2B5IC 2FIRT 1A3LH 2JCCF 5D7JC 5FB8B 1QBLL 4UIKL 4WI2A 1CD0A 4PG2A 2OJZL 2VZSA 3D0VA 4U1JA 4XP5L 4Z0BH 4KROB 4B41A 4L3EA 2IH1B 3P11H 1MREL 4JG1H 1D9KB 2O5YL 4ZD3L 1OARH 4M8VA 4N9GB 1VFAB 4Z7QE 5FM8A 3I3BA 1CU4H 1D5BB 4GBXC 3IFPA 4Y16A 4YHIA 4UT9H 3GI9H 4XC1H 4OFKA 3S96B 4PY8J 4G6JH 2DD8L 4O2EB 1IAOB 5J57B 1AGCB 5KS9A 5IB2A 3O8XC 4ETYA 3HZYB 4EI5A 5ESVA 1A7OH 4V2CB 2X7LB 3HKFA 1CD8A 3VXPA 4Z7WF 3RQ3A 3D39B 1R0AH 5SWQA 2Q7YB 4XPFH 3G5XB 1OP3H 4OZGF 4FTVA 5A43C 1WIPA 1PX3A 3C6LC 1TENA 2ZSVB 4K7FB 3LSOA 2FX8L 4PUBL 3O6FB 5F7EL 4WI8A 3Q3GB 3NCJH 4X6BA 2A6DB 3T2NL 1MFDH 3CC5B 1YN6A 4M6OH 3EJYD 4L1HA 4NM8H 1EX0A 3QG6A 2A1WH 4P99A 1T7ZA 3QCTL 5CD3B 2EXWC 3VFOB 5HD8C 1OP9A 5BMFH