4JB9H

Crystal structure of antibody vrc06 in complex with hiv-1 gp120 core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
232
structure length
225
Chain Sequence
EVQLVESGPVMRKPGSSMKISCATSGYNFRDFSIHWVRFNRRYGFEWIGWIKPMWGAVNYARQLQGRVSMSRLFSQDLYYPDRGTAYLEFSGLTSADTADYFCVRRGSSCPHCGDFHFEHWGQGTAVVVSAASTKGPSVFPLAPSSKALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Delineating antibody recognition in polyclonal sera from patterns of HIV-1 isolate neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 33
structure length 225
sequence length 232
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jb9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jb9H01
2CK0H 2GCYA 1JPFA 1I7UB 4BZ1H 1GGUA 3RUGF 4KV5E 4AEIH 5KSBE 3IRPX 3RFZC 2H26B 5FYLL 3WV0A 5LJYH 2NZIA 5E8DL 5DD3L 2KZWA 4PBXA 4AEHH 2BNQA 4KQ4H 2ZCLL 1T1XB 1U6AH 4OB5L 3GO1L 3P30H 1BD2E 3MROA 2FO4A 4UTBL 5E8NA 3L6FB 3PG2A 3OKDA 4PJEA 3HC3H 2BRRL 1A0QH 1YEIH 3BFOA 5LBSH 1QHOA 3D69A 5BZDB 1NDMA 1B6DA 5EBWA 4P59L 2NXYD 5GJSL 1AQDB 3W39B 2F8VA 1E28B 4M6AA 4GKNA 4YR6B 1GC1L 1NMAH 1ZT4A 4G9DB 2J8UE 3DGGB 2F58H 4Z95H 2X4OA 3ZYZA 4OCNC 3ZYIA 1NJ9A 1QD0A 3PQYE 4F58H 1RZJC 1FG2A 1MCNA 3O4OB 1KUMA 2H9GA 2H3NB 3PL6A 3A6BH 3MRCB 4KUZL 3WXWH 3QIWA 4MS8C 3MYJA 3LD8B 1EIBA 2DD8L 1QFWL 2EYRB 4Y4FB 1T20B 1SY6H 3LH2L 2V2XA 5DF0A 4LK4A 5IFAL 4BQ8A 5JPMA 4XPBL 1IE5A 2YKLH 1KLUB 2O5YH 3BXNA 1I1FA 4KJQC 2IH1B 5F7KC 3RP1A 3S5LA 4FA8A 3KPSD 3S96B 4TOYH 5C7XH 5DRZA 2ZUXA 4LLVA 3V79C 1QSZA 4JO1H 2DIAA 4N8CL 2V2TB 1AHWB 1OP9A 4JCMA 4PJDA 1BAFL 4MLIA 4MJ4A 4ZFZA 2DQJL 3TN0A 5IFHL 4HK0A 2VC2H 2V7NA 3VGFA 2P24B 2YC1A 4GRWF 1S3KH 1F4YH 5D1QD 5D7LB 4BKLA 2ENYA 4JQIH 5ICYB 4PG9A 4KZDH 4IDJH 5CSBA 2BNRD 1IZJA 3H3PH 4C56A 2YZ8A 4OD3L 3VFGL 4QRUA 5I74C 5I1GH 4CVWA 2AERT 4YFDB 3MCKA 4KKLC 2CLVA 3LEYL 4YXLL 2YXFA 5IB4A 4PJIA 3H7LA 2Y07L 3IRZA 2UZIL 4AENA 3OAYH 3C5ZC 2CSPA 4WU7A 4XBEL 5BRZA 4PJHA 3VFWB 4CNIB 5F7HA 4L5FL 5GS0L 3NBNA 4I13B 5IMOB 4JQVA 1JTTA 1O5DT 4JFZH 3TCLB 3AAZB 3BPLC 2ADGB 3MV7D 2PYFB 4KQ3H 4WWKB 5A16A 5CMAB 1JP5A 1PGRB 3PWJB 3CGTA 5JDJA 5IB1B 1HQRB 2X41A 3WNPA 1GAFL 2UZXB 4X7DC 5D7KE 4P5TD 4RIRB 1ZVYA 2EDFA 3ILQD 3L5HA 5BW7A 4TNWK 3QRGH 2O93L 4WU5A 3QIBC 2ED7A 4OZFA 3ZZ1A 4MJ6B 4E5XA 3SCMC 5J0BA 3RPKA 3NZ8A 5JXEC 1L6ZA 4IJ3C 1KT2A 1RZ7H 1L9NA 2IAMA 2OP4L 2W0FB 4N1HB 5FYKU 3MJ9H 4X7SL 4Y88A 4P4KC 4OZIF 2I9TA 1J5OL 4BSVB 3BH9B 5BO1H 5FOBA 3ARSA 4XP9L 3PHOA 5HI5D 1ZLSL 1I8IA 5FYLE 5FYJL 5F6HI 1G7QB 1F4AA 2BSRA 2A6DA 1P1ZA 5DUPL 1TETL 1VCAA 5JOPE 3GSQA 2AJ3A 2MJWA 3MBED 1CFVL 4HKBA 4JM2C 3SKNB 1AR1C 3KLHC 1W0WA 4XXCC 5D1XD 4JPVL 4KVCL 3VDAA 1OTSC 1TJIH 3CXDL 4FQPA 5I1HH 1KCRL 3OR7B 4RZCB 1JZ7A 1HEZB 3O6FC 1SQ2N 1UACH 4CBPA 5DYOB 3KPRB 3DRTA 1LEGA 4OT1H 4QHMB 5EBLA 2KBGA 2OTPA 3L9RA 5JIPA 3KYMB 3GMOB 4PGDB 3CNKA 3RVVD 1YUHA 4LFHG 1RZKC 1II4E 1FVCB 3LIZH 4IRJB 4XXDB 5TE6H 4JDZB 1KEGH 1DFBL 3AU1A 3OXSB 3S3SA 1BJ8A 2JB6A 4P3DB 1FH5L 2C26A 4D3CH 2FJGA 1ZVHA 5EPMA 2JCCE 3QDJB 5FAAA 3DBXB 3VXTA 2BSTA 1LO4H 3G5ZA 4IS6A 3AREB 3O4OC 3PP4H 5C0IB 5BMFL 4LLMA 4PD4J 3QB7C 3LD8C 1XGUB 3HCVB 2DI7A 4AL8L 4Y4FC 4C57C 4LAQH 1ODAA 5HI4D 5JQ6H 1M05B 2OX5A 3BDYH 3PE9A 1VHPA 3EDDA 4PGEB 5GRZA 1MRFH 2DQTH 1KGCE 5TH2B 1MFEH 4OQTH 1EMTH 1F3DH 4RGOH 1AQKL 2RQ8A 4KRNA 3VFOB 2SEBB 2IPKB 5CP3A 3WXVL 3LN5B 1AHWC 3ZKQD 2CMRH 5FF6A 3EDEA 3WD5H 5D93B 4OGYH 1T1ZA 2XICA 7FABH 1LMKA 5K9KA 1IGYB 2Q86A 1MPAH 4HMDA 4JVWA 4TYUA 2EO1A 4MXQC 3DVGA 1NC2D 4H8WC 5A2KH 1JV5B 1JPTL 3BKCL 4NKDA 2DIBA 3DX8B 1MHPL 5HGDB 3IJSA 3RWDA 1I9JH 5MERB 3M8OL 3ECBA 5CZXC 5D2LF 4NN6B 4YXKL 1IAIH 4XRCB 3IFPB 3U7WL 1KLFA 2EDQA 4LHQB 1OTUC 2WAHA 5IQ7H 1A3RL 3DYOA 1CFSA 1L0YA 1SVCP 4NZRL 2AK1L 4WJ5B 1C08B 2J88H 2QSQA 3V6FA 1AC6A 2YD6A 3WDJA 2HT4C 3GSVB 1H5BB 2I5YH 4NRXA 2Q1EA 1MHCA 4WEBL 2A0LC 4WWKC 3GHBL 3QRFM 1CXHA 2BCKB 4I1NB 5I73B 4HJGA 3DUUB 3GMPB 2IG2L 4YBLC 5DUBB 4YHIA 1B2WH 2YWYA 4WI3A 5FYJE 1T5WB 2LU4A 1JHKH 1UYWL 2ITDA 3JTTA 3MOAH 1F3RB 5D2NB 3KPSA 1HSAB 1P2CB 4KKNA 5BZWA 4DTGL 1MFBL 2Z4QB 1A7QH 5BXFA 5EU7C 3BHBB 3HC0B 1I4FB 3UZEA 4FZEL 3LS5L 3MA7B 4KJWD 3QDMB 4KUCD 4DUWA 4OJFL 2EIDA 1P4LB 3KYNA 5DD6A 1R24B 2X1XR 4JRXB 1K5NA 1C16A 5CILL 1MI5B 1PZ5B 3VXPA 4GMSH 3T0EC 4UB0L 4JHZA 1NDGB 4K3DL 2YPLE 1G0DA 3UROR 4DK3A 1F42A 1I9IL 1IC1A 5D1QA 3VFSB 2ZZUT 4XP1L 1K4CA 4BELD 3JVGA 2V5YA 4ODSH 2DQGL 1NBYB 3RNKA 3OKKA 4LLDB 3OKNA 1M71A 4KPHH 5D8JH 4MA7L 3VGBA 1FZKB 3BVNB 3HG1D 1DQML 2HRPH 3MBXH 4D9RE 1I85A 4HT1L 1FL3B 5J12B 1JGUH 1UB6A 3QDGD 4ZQKB 1Q1JH 3INUH 3GSNL 3MOBL 3KNBA 3AY4A 2C3VA 2DTML 4WY7H 4KFZC 5E99H 3CC5B 3HZKB 3SKOB 1LEKA 5E7FA 3B5TA 4MS8D 4IRJC 4QWWD 5D7JB 3OJMB 1YEJH 3VRJB 1S7SB 1HQ4B 1LE9A 3MV7A 4K3JL 1A7PL 3GSOB 5I6XB 4Q74A 4DVRL 2JELH 1MAMH 2P8LA 4FP8L 5ACZB 1NLDH 1CLOH 2R69H 4NIKB 4P5TA 3QUYB 4KJQD 3UTTB 2PCPB 1G9MC 3CVIL 3J7HA 4JFEB 2HT2C 2IBGA 4R4ND 3RUGE 4EUPA 4LBEB 4X9FA 3WKML 4LCYA 2V6HA 3IDIA 1FE8H 3S35H 1AGDB 2W65B 3RWIA 4G9FE 2ZUSA 3CFCL 3H2WA 2E9BA 3LRSA 4AMKH 5EWIH 2HTLD 2X4NA 1CGWA 1I9EA 1VFBB 1VACA 5EUKA 1CBVH 1BM3L 2Y7QB 3O8XB 2R29L 3BDBA 1H3WM 4IOFD 1FVDB 1MWAH 1ZVSA 5F3BA 3AS3A 2FECL 3KDMB 2ZCHH 2E6JA 5HI3C 2E27H 2YPKB 3MBEA 1FLRH 1UH4A 5D93C 3PABA 4IIQB 2YD1A 1QBAA 2WNGA 1TNNA 5DMIH 3V5DA 1RUPH 4MNHA 4EOWH 5LWYH 3U82B 3C5ZD 1QLEH 4NNXA 1XF3A 3L3JB 4HH9A 3T77A 4R7DB 1MCIA 1AY1L 4RRPG 4XAWH 4NJ9L 4K3GA 4U1LB 4YX2L 2AABL 2EDEA 2R2BA 3SGDI 3U0PB 4Y2DB 1MVUA 5E8OA 2Q76B 3OKMA 2WK2A 4NN7B 4C58B 4OD2B 4NN6C 1UM5L 1XGPA 3MRFA 4MWFB 4HJJL 3U83A 3V4UH 3RGVC 3HAEB 5J13C 5CEZL 3QQNA 4JRYB 3MGTA 2PW2A 3I6GB 1JRHI 4YHNA 4QF1A 4FTVD 5CINH 4CN1A 4ELKA 1OP3H 1G7LA 4LSUH 1YEKH 1H5BC 4QLRA 1G7JA 4HUKB 4X6BA 5DMYA 3VCLA 4GRWE 2Z31C 4CU7A 5CJOH 3AMKA 4FQ1L 4XMLL 1TZGL 1EFXD 5ESQA 5MEQA 1QZ1A 1RJCA 3JWDC 3QXVA 2IFFL 5I73C 4X7CC 5F8RC 3WL9B 4A6YH 4GH7B 5IKCA 2BVPB 3L3GB 1KIPA 3TBYA 5JW5B 2QQNH 3V8CA 1SJEA 5DJ2A 3SDCA 4WHYG 3O6KL 5D2NC 5SWZB 4Y19E 1GGCL 1PJ9A 1FDLL 3V7AE 1NGZA 4U0RB 2NTFA 1GIGH 3H42H 5JHDA 1AR1D 3KLHD 1K8IA 3ARBB 1AO7E 3MRBA 4FZ8L 5KVEL 3R8QA 3EGSB 5DEFB 4MB5A 1CGSH 3O6FD 3TGXA 5FKPB 3MQIA 1MSPA 3UTZB 1NC2A 4OF3A 5F71A 5IP4A 4BH8B 4HUNB 4MDJA 2FL5A 3WDHA 2Y72A 4KDTC 5GGUB 4QHNA 4M03A 1NUGA 1CLZH 1ZEAL 5E8EA 3ULUF 1OSZA 3U0WL 3N06B 3IVKB 5DQJA 3VJ6B 3ZDZF 5ADOL 1E4KC 4JLRA 4P57A 1LE5B 5J12C 2DWDA 2R56L 5J56B 4UQ2A 3CDCA 3GRWA 3MNWA 4JVPA 4I4WB 4PV9B 1GSMA 1IAKB 4OZIE 5EOQL 4PG2C 4M8VA 2X9XA 3QG6B 1V3KA 4MCZA 5D6CA 1OARH 1R3IL 5GRUL 5HHVH 4OKVB 1DTUA 3C5SA 4UQ3B 3FQRA 2MCG1 5DEGB 5I6XC 2EECA 1RI8A 5T1KD 3FQUA 2I27N 4CU6A 4QOKB 1T21B 3P4MB 2I07A 1DLFH 1WZ1L 3QUYC 2QR0A 1WWAX 3NGBB 4ZDHB 3GNML 3DV6A 1RUAL 2RCSH 4OV6F 1QFHA 5E2WL 3SY0A 1I1RA 1CVRA 4EVNA 3EOTH 3K8KA 2HJKA 4PB9L 5GS1B 5IVXB 4J2XA 1X5XA 4XPAL 1HCVA 3Q3GB 1FO0L 5CGYD 1M7IA 4KMQA 3BAEL 3T4AA 3O8XC 4LP4A 5EFIB 3W11C 5D7LD 2Y1VA 1ZK9A 4GBXD 4U1GB 2AV7A 1AE6H 5J3HD 5GGQH 1R3LB 1IJ9A 3BZ4B 1WWWX 5IF0B 5D5MF 5EOCJ 4PTTA 3AXLB 1PQZA 3K1DA 2VQTA 4UNVA 1R5IB 2VAAB 5CEZE 3HG1A 3MGOB 5C0RH 4ZG1A 2NLJA 3MZGB 4E9LA 1PBYA 1PY9A 2PO6C 5ERWA 3HUJA 4F80A 4ZUSA 4Y2DC 1YC8A 1Y18A 5CUSH 1BGXL 1DUYB 4NN7C 1KTLA 3EYFA 3LN4A 1CL7I 1CFNB 4H5SA 5JHLL 2A0LD 5DJ6B 4WUKL 4UDTB 3L3IB 3TFKD 3M1BB 1N6UA 2NY1D 4LCIL 5SWQA 5I18L 2YK1H 1ES0A 1JYWA 2CJUH 4BK4A 3CSGA 4JREB 1C5DA 2HKHL 3MRNA 3V5HB 5DURB 4U1HA 1LHZA 4S0SD 1DANT 1QRNB 2D2OA 4U1SA 4I5BA 5IHUH 4Z7QF 1U8NA 5FGBC 2FHBA 3GFUA 3X14B 4NDMA 2C1PB 4IMKC 3IF1B 4HGWA 3SDXA 1UXWB 3VFRA 5IV2A 5ILTH 3TIEA 3H3KA 3ZYOA 1TQBC 2AJVH 2BP3A 1KCUH 5I8OL 5EC1B 2GKIA 4AT6A 4C83B 3T0ED 5D2LE 3MLTB 3S8WA 4OUOA 5DK2A 2WUBH 4H88H 1NGQL 1KB5H 5C0EB 8FABA 3BEVA 1GOFA 4U0RC 1FBIH 2J6EH 3ZT6A 2WINA 3ARBC 4D2NA 2CDGA 1NGYA 3NTCH 4X7TB 5ECJE 1GGBH 3FT4B 1A21A 2EDJA 3BZEA 1G9NL 3RVTD 3C5ZA 3FT2A 5HHOE 3VWKB 2XN9B 1NC4B 1AFVH 1ZHKB 2DN7A 4K7PX 2FD6L 5J8OA 4QRPD 5AG8A 3V4PL 2CIIB 2XG5A 2N4IA 3IXAB 2MNUA 1FNHA 2ZSVA 5C0GB 5C0DB 4KDVA 5C0AA 1E27B 3N1QC 2DRUA 2QV2A 3BZFB 1W72H 5EC2B 1DN0B 5AZ2L 1D5MB 3F7QA 4XNZB 3KPMB 25C8H 4LEOB 1IC7H 3BD5A 3IAQA 4PYHA 2WP3T 4FTVA 3MV8B 4JFQB 2HT2D 3QIBA 1F4XH 1J1PH 3GSWA 1NKOA 4U1KA 3ZDYF 2E5EA 3SCMA 2BVQA 3TIDB 4LASH 4ELMA 1MFAH 2BHUA 1E4XL 1EO5A 2X44D 1FV1B 5E1HB 5JXEA 4FFZL 2W0LA 2OMBA 5DJ0A 4R97B 2EC9U 4HIIB 2W60A 4U6HB 4P4KA 1GGYA 4YBQC 5HYSB 2Q3ZA 2E7LC 3D87B 1S5HB 3OR6A 4NNYA 5EOCL 4RWHA 5D70H 3CCHB 1WEJL 4NO5B 5I19H 4QXWA 3SDDD 1CIUA 4XNUL 5HI3D 5ANMB 2Q7YB 3VE0A 3IU4L 3O3UN 1IRAY 1ZGLB 3NCBB 4JM2A 5JOEA 4XAKD 1OTTD 4PJ5D 1TZHB 5E6YA 1TVBA 1KF9B 1RIHH 2DKMA 4XXCA 1I7UA 1A1OB 4NM8H 1L4IA 1F45A 1J0HA 4HV8A 3NFSL 2H26A 3DROB 3O6FA 1SJXA 3E1F1 3BI9X 5CCKL 1X7QB 1PG7X 4P3CL 4AZ8A 4ZAKB 3EO0A 4XP4L 4U1GC 1OLZA 2MMXA 3CZFB 2CGRL 2EDBA 1T1XA 1JWMB 5EZOH 1WFUA 1QPPA 3QUMH 5DT1L 1MNUH 1AGCB 4LLWB 4UT7L 3U4EA 2MFNA 3L6FA 3WFHA 1FN4B 1ETZB 3RGVD 2DM4A 2VE6B 5CHNA 8CGTA 4L4TD 1AIFB 4RDQG 1P5UA 4UUJA 1X5YA 4G8EA 1AQDA 1V7NL 1AXSA 2CIKB 5EN2B 4G9DA 2YZ1A 4QGTA 3DGGA 5C9JB 5L2KE 4LSRH 2JE8A 1P6FA 3W5NA 4V1DD 3UBXB 3SGJC 2W9EH 3FN3A 1KENH 3HNVL 4JFFD 4Q9BA 2Z31D 2X4TB 1MCEA 4LSQH 4H20L 5DK0B 2H3NA 1YQVL 3MRCA 2VDNL 1D3CA 4RMTA 1AXTL 3ORJA 2EYRA 1UC6A 1T20A 3RAJL 4QCIB 1T7XA 1K9TA 1N7MH 3S3PA 4KK8C 5T1KA 1K6QL 1I3GL 4JREC 2HFGL 2HWZL 5EU6B 1UENA 4R96B 2IH1A 2AK4E 5D4QA 1BD2D 3S96A 4ONHB 2EEDA 3NFNB 4M1GH 4NQDE 1FAIH 5F7FA 3QDMD 2V2TA 1AHWA 1CF8L 5CLWA 4S1RL 3L95A 2Y6SD 2EO9A 2P24A 2HLFC 5CJ5A 5DHVB 3RY5A 5DVKA 5D7LA 1CXLA 3PQYD 1JGLL 1GHFL 3SQOL 4HCRL 3DUSB 4LP5A 1DQJB 1OD9A 1BLNA 1IGFH 3FKUS 4JB9H 4LHUG 3AB0B 4NC1E 4X6FB 1N0XH 1KC5H 5DO2C 2XIDA 4B5EA 5CLTA 4L3EB 2FATL 3M45A 5C0FA 1YEHL 5I8CB 5ACLA 1CDBA 4OGAC 3VFWA 1CFTB 3O0RL 2EDTA 3KJ6L 1CFBA 3NIGF 5IMOA 2W91A 3TCLA 2NCMA 2D4DA 1CXEA 3QEUB 4C54A 1JTOA 1ND0A 3HE7B 4WWKA 5TFSL 1WZMA 5CMAA 5IB1A 1HQRA 4XNZC 1MJ7L 3QUYD 1T5XB 4RIRA 1NFDB 2AXFB 1CYGA 2ILLA 1DQDL 2OMNA 4AEFA 1JRHH 2NY6D 1M6OB 2DDQL 3H9SE 3Q1SH 2O5XL 4S10A 4AYFA 4C4KO 4MJ6A 5DXWA 1FHGA 1J8HE 5FEBA 4PP1C 2W0FA 1TJHH 1CD8A 4R97C 5I0DA 3TJHC 2OR9H 3OJ2C 3MNZB 4Z6AT 2AEQL 1HDMB 3NCJH 4UTAL 3HPLB 3BH9A 5IK3A 1TTFA 3W11D 1KLGB 3VXME 3T0EA 3ULUE 1G7QA 3I6KB 4F9PA 4DVBB 5D7IB 1NCCL 4F7MA 1HILB 4PJGF 1J0JA 3CU1A 4WDIB 4CMMB 3EIFA 5HYJB 3ALXA 1GPOH 4KKBC 3DHJA 3MUGB 3SKNA 3UXFA 2RFXB 4GAJH 1S7VA 4B7LA 4RZCA 4P2CG 1HEZA 4KRPB 4G42B 2VITB 4FG6C 5FUOL 5DYOA 2FGWH 3KPRA 3TBTB 4ZAKC 3L3HB 4R4BB 1T7YA 2PO6D 5IFJB 4F3FB 4DKFL 4Y2DD 1I1YA 1BX2B 1HH6B 3GMOA 4WHTB 5INCB 3CXHK 4PGDA 5DSCB 3U30C 2YPVH 1ZGLP 4NUJA 1YMMD 1FVCA 3E6FA 4IRJA 4YHLH 5E9DE 4MDIB 3EDJA 3BWAB 5FYLD 4JFOA 4QYOA 2G5RA 2FJFB 2AXJA 4GQ9L 3QDJA 5LCVL 4U1NB 4WW2B 4YDKL 5JOPD 4TVPL 1RHHB 4YWGH 5F7LB 4CAGA 2H6PA 5C0IA 4HKJA 35C8H 4HG4J 1FORL 4R7NA 5HHQB 3TV3L 1XGUA 3HCVA 2HVKB 4JKPH 4HXAL 4I2XA 4TUOB 2HKFL 2YHGA 1RU9H 3VXRE 2HFTA 4PGEA 4J3XA 4KTYA 1QFUH 4LEXL 5D5ME 4K2UH 2FHCA 4G6JH 1NCBL 1Q0XH 5TH2A 1G84A 1G7MB 1E0OB 2E7CA 4OAWB 3VFOA 3I50L 5KTEL 4XCFL 1Z6JT 2IPKA 2SEBA 4S1QL 3QCTH 3TO2B 3LN5A 4CDGC 5I1EH 4TN9A 3UYRH 2XZZA 1CQKA 3VXSB 3IS0X 4PRHE 5FDYA 4ODXB 4DZ8B 3N9GH 4M1DH 1GVIA 4FXKB 1JV5A 2A6IA 2CXKA 3FONA 1TCRB 4P2QB 3DX8A 1QHPA 4Q2ZB 4P2OD 1XGYL 1RVFH 1QLFB 3H9HB 4XRCA 3AB0C 1XF5B 3IFPA 1DSFH 3BP6A 3RGVA 4K94C 2E9IA 1PSKL 3FOLB 3ARVA 2AJYL 4L4TA 1NBVL 4HS6B 3JV4B 4XPGH 3DI2B 1IT9H 3OMZA 4FQLL 2KUTA 3PGFL 4WJ5A 1CS6A 4UT6H 1C08A 4MA3A 5JA9A 3IYLW 4NQCB 5I1CL 4KU1A 3GKWH 1C5BH 2CKBB 2IH3B 4G5ZH 1BHGA 3JWOH 2AJXH 1H5BA 4QRRB 3U9PL 2Z31A 1IQWH 5CIPB 1P7KB 3H6JA 1HHHB 1FRGL 3HE7C 3RKPA 1CL7H 3BW9B 2BCKA 1MCRA 2H1PH 5T3ZL 3MA9H 5F8QC 1L7IH 3GMPA 3V0VB 3QFJE 5L88L 5DUBA 4GO6B 4RA0C 3DIFB 1JZ3A 4LKCB 3ZTNL 4YZFF 2Y9RT 4HFUH 1T5WA 2VLKB 1BD2A 1P2CA 3U4AA 5MENE 2Z4QA 3BHBA 2I25N 4JZJB 1I4FA 4Y4HB 3DRQA 5C0JB 3MA7A 2B2XL 4PIRF 1ZLVK 2R8SH 3QDMA 1IL1B 4UIMB 1G6VK 4X7FC 5GRJL 5IR1B 1R24A 4JRXA 1QR1A 2DL2A 1NCUA 2JJTA 1MI5A 1PZ5A 2IJ0C 1SJVA 1B88A 2LAGB 2I60L 2PUQT 4K23H 1I1AD 4GW4B 1ZWIB 3PQYA 5AAWA 3GSUB 3QH3A 5SX5K 3VFSA 1WIOA 3THMH 5K59F 5D71L 1RFDH 1TITA 4FMFA 4J3VA 1QLRA 2GJZB 4LLDA 3MR9B 3O2WL 2OYPA 2QADB 2WMPA 3BVNA 4KRPC 4O9HH 3ZDYE 1YECH 1E4KA 1FL3A 3M17B 3HHRB 3FFCE 3L5XH 2AEWA 5F1IB 2J12B 3RL2B 4ODWA 1G7IB 1YNKL 4DJMA 2OM5A 5E00B 4EXPX 1QSEB 4PG2A 1HHIB 4ETQB 1MF2H 4TVPE 4EBQL 1U8MB 3CC5A 3HZKA 3SKOA 1L9MA 3OL2A 3D0VB 5J9PB 1U8JB 3VRJA 1S7SA 5IBLD 2R0KL 1ZLUK 4L8DB 5INDA 1JVKA 4KK8D 5ACZA 4XP5H 4M02A 2DMCA 1WZKA 1FFNA 2P7TB 2YPLD 3QUYA 1EHAA 1U8PB 4JGMA 4G80A 2WWKO 1L7TH 4WW2C 1DE4B 3RY4A 2PCPA 3NFPA 4EI5D 1IEAB 1XF4A 4LBEA 4NJAH 5CEYB 3OV6A 4CUCA 1ZKAA 1HI6B 1AGDA 3BMWA 2W65A 2ZJSH 4YDIH 2Z92B 5HY9B 1E6JL 2ADJA 5DR5H 2V5RA 4D9RD 4OZGF 1A6UL 5MP6H 4Y1AB 1LO5B 3QA3A 3MJGX 1PYWA 1I3VA 4JO2H 2NX5D 2J1KA 3O8XA 1FVDA 3DX6A 3VXNB 4LPYA 3KDMA 4MA1B 3BN9D 1MCBA 4BK5A 5FGSA 3UJIH 3OGCB 3LEVL 1I3UA 5DUMH 3UPRB 3G5YB 5KG9B 2VDRH 5T5FH 3FQXB 5BVPL 4LCCB 1X3DA 2JTDA 3QPQC 4NQVB 1KCLA 1VESA 4U1LA 4OGAD 3V4VH 5J89A 2PO6A 1NUNB 2VL5B 4Y2DA 2X42A 2Q76A 3V6OC 3UZQA 2OK0L 3DMMB 3RVXD 4WNQB 1JGVH 1OQOA 4G9FD 4MWFA 3RDTB 1V05A 3HAEA 1PD6A 2EDKA 3CPLA 3UJTH 1YMMA 4ZD3L 1C8PA 2C1OA 2VR4A 4JRYA 5DS8B 5CBAA 4EDWH 5T3ZE 3CVHB 4XPHL 4NT6B 3GUTB 1RJZB 2VXUL 3DTXB 3RZCB 5BCAA 2C4FT 5FHAL 5FGBA 1MIEL 3GJFH 1EGJH 3KYKH 4IMKA 2BVEA 4PP1D 4WWID 4UBDC 5DRXB 5FGCB 1LNUB 3TJHD 4XT1C 4G7VL 4NKMA 5IW3A 4PY7B 3MYZA 2ICWI 4PV8B 4ALAH 1PG7L 4NQEB 1F58H 2BVPA 3L3GA 4YIQB 1NAKL 4MQSB 1FPTL 1MJUH 2F54D 2X5PA 3NA9H 5SWZA 4HBCH 3V52H 5LGKA 2ZKHL 3O11B 5JR1L 5HHPB 4JZJC 5F6IB 1IC4L 4Y4HC 4LQFH 4KKBD 4HGMA 3WUWB 5DJYB 1U92B 1U8QA 3NVQA 1LO0L 3S3JA 1MFNA 4NNPL 3FT3B 3NIGE 4QTHB 4I3SL 4FG6D 3AS2A 4G8GB 3WHE1 1A1NA 3UTZA 2HH0L 2IC2A 1MJ8H 5FYKD 5E24E 2VLRB 5DJ8B 5C92A 1UKTA 3WIHH 3HZVB 1F90H 4FFYL 4LL9A 5F7NC 4ZTOH 2QADC 4HUUA 4JKKA 1Z3GH 4WO4B 2A77L 5JTWA 3VJ6A 2YEZA 4NSKB 1EO7A 2G60L 1LE5A 2B8OT 4HWUA 2OTWA 3O2VL 5FO8B 4RFEA 2CQVA 4WUUE 4Y8AA 5I8KL 4Y19D 2AI0L 4PV9A 1IAKA 4WGWB 4Y2OA 4N1EA 1YNLH 1W0YT 1NCDL 2GTZA 1RY7B 1AGEB 5IVXE 1N3NB 3QG6A 2XZQH 1RZFH 4U2YA 3LPGA 1WAAA 3CFEB 4GMTH 1HH9B 3MSPA 4YGVA 4PJCB 5DEGA 4X6DF 4OLVL 4PJGE 3GSRB 4QOKA 5IMMB 2ESVE 2OSLB 2FH6A 4XCYA 1QQDB 4ZDHA 1KPUB 4U0QB 2OR7A 1G1YA 1IGMH 4FXLA 3SE3C 2WANA 5I15L 5GQBA 1CLCA 2NQCA 4KTDL 3GIZL 1ZLWK 2VXTH 4XP6L 5EO1B 2X4PB 4OLXH 3EOAB 3MREB 5IW6B 1W8NA 3X3FL 3O3DA 4NM4L 4Q6IB 5EFIA 4NGHH 3QO1B 4PJXB 1R3LA 4FFVD 4MA1C 3VG9B 2F53B 1TTUA 3V6ZB 5D96C 4GKSB 5GGRB 5IF0A 4LMQE 5KS9B 1NL0L 1PKOA 3TZVB 2DQFB 5JW4N 2OL3A 4LLQB 3ZL4L 4LCCC 1MCCA 3AXLA 2O5ZH 3DSFL 4X4XB 1FIGL 1R5IA 4G7YL 2XZAH 3MLSL 4WFFD 2X4QA 4M1CD 4D8PA 3BRGC 3BGMB 4MJ5B 2NXZB 3A6CL 2DQUH 4M00A 2XPGB 3SGJA 5DDHB 3QNYB 4ZS7H 2GFBB 4ZUTA 3AGVA 2EDDA 4DGYH 4P2RB 4X83A 1ZT1B 3RDTC 2GW5A 5KVFL 4UDTA 3L3IA 4Z7UB 2HN7B 1S9WB 4JFDE 4HX1A 2V2WB 3V5HA 3OQ3B 4OCRL 2VDML 1NPUA 1NCTA 1CD1B 1EO8H 3D85D 1KB9K 1QRNA 3SKUD 3CSBA 3GBNH 3RZCC 4EN3B 2FR4B 5BV7L 3X14A 5JNYA 3SQBA 2Z91B 3MLXL 4S1SL 1JFQL 43CAB 1E4JA 3IF1A 2AEPH 4PJ9B 5AYQA 1O7SA 2GAZB 2D0GA 1ED3A 2DM2A 1F00I 2P5EB 2E9WA 3MRLB 3DXAE 5CEZD 3OB8A 3VGHA 3VRIB 4L8CB 3PUCA 3QQ4B 4YUEH 4DAGL 3TNNB 3MLTA 4ERSH 4U7MA 4NBZB 5EU4A 3JBG7 1YY8B 2NX5A 4BZ2L 1N6VA 5DJXB 3T09A 2PW1A 1INDL 1CDUA 3HE6D 4ZXBB 4UU9B 4CVXB 2VXSL 1IAOA 4X7TA 1N4XL 1DBJL 1QTYT 4KK5C 1HYSC 3FT4A 3L1OH 1EXUB 3FB6A 1GYAA 4Z78B 1VFAA 2XN9A 2OTUA 3TH2T 1X6NA 5ESVB 2UZYB 4LPTA 3CIQA 5AYUH 3RUGA 2OXGA 5IB3A 4LF3B 2XA3A 4QRTB 5FM4A 2R0LL 5A2LH 1EBPA 2PYEE 2CIIA 5JZ7D 2EYSB 3IXAA 3K2UH 5C0DA 1ADQA 5LKNA 3BN3B 3QI9D 3RWCB 2HFFB 5HDBF 1E27A 3KR3L 4JAMB 4YZFE 3TA3C 6FABL 5IBTL 3BZFA 3RQ3A 3MLWL 3QNXB 4NKIH 3QUZB 5ID1B 5EC2A 4Z7WB 3LKOB 4G6FD 3S37X 4LEOA 4AM0B 4Z0BL 2G9HA 4NO2B 3N85L 5BS0B 3MV8A 5FA4B 3NCMA 4NWUL 5GRWA 1T7ZA 3FRPA 2DQCH 4P46C 4UV4L 5ICZA 2D03H 1JMXA 1FV1A 3RWHA 1VPOH 4X4ZA 4ODBD 1UB5B 3W2DL 3TBSB 4HIIA 3K4AA 3PHSA 2ZUVA 5HYSA 5K59E 3BP7A 5HHOD 4LSDA 2YN3A 3B9EA 3G5VA 2CO7B 1C12B 3CCHA 2WUCL 2APFA 5KW9L 1JN6B 4NWTL 4NO5A 3TYFA 4ODVH 1J0IA 4F7PB 5K9JH 3BJ91 5FO7A 2F54A 1JBJA 4XBPB 5ANMA 1BZ7B 2CLZB 1PEZA 3BRDA 4LSVH 3PIQA 1MWAB 1ZGLA 4BQBA 5E6ID 3VXSD 1XCTA 1MHEB 1TZHA 2EC8A 3H0TB 4I0PB 5E2UL 3OG4B 3QPQD 5FA3B 2KH2B 4OUUA 2A74A 3QEGH 1A1OA 1BFVL 2H8PB 4AG4H 3LHPH 2YD8A 1NSNL 3DROA 4YNYB 1I7RB 4Q6IC 4ZAKA 2UWEF 3MOQA 5TPWH 3CZFA 1JNLL 3VG9C 1ZMYA 4DN4L 3ZKND 2EEAA 1LDPH 5HVGB 1HOCA 3NAAH 1F2QA 3FAXA 5DFWH 1JPGB 4GXVL 1MQKL 5KSVB 1AIFA 2ZG3A 3LCYA 2CLRB 5T3XH 5HHXL 4AQ1B 2F5AH 3LN9A 2CIKA 5DMJB 5EN2A 1DVFB 1X4YA 2NXZC 2QKIA 3GB7B 5C9JA 5FXCH 3VXOB 4Y19A 4TQEH 1FJ1B 4OZGE 3OX8B 5AD0B 1UFUA 3PWLA 4UBDD 3V7AG 5J6GB 4DQOL 4PGCB 3MLRH 2YN5A 5TGBB 3DV4B 2GK0B 4IRZH 4BFGA 4ZNEE 4R2GB 3GZKA 3TWCH 3QEQB 4Q9RH 3H9YA 4O4YH 2Q6WA 1WBZA 2OBGA 3GBML 4PR5B 5EU6A 2G75B 4A6YB 4R96A 4EN3C 2W0PA 4ISVA 1P7HL 2QHRH 1N5YL 1IGJB 3NFNA 2XA8H 3S35X 4M43L 1QFWI 2VXQH 3V6BR 4PJ9C 1HIML 5F9OL 3U2SA 3MRKB 3CMOH 1WZLA 3PWPE 4DFIA 5ADPH 3PXHA 3RRQA 3QDHA 4B41A 5L2KD 1P6AB 2ZOLA 5DHVA 3UTSE 2JLLA 4RBPK 2XWJB 4PGJA 3O4LE 4HK3J 3DUSA 5DMGD 2NY2D 5LVEA 3LS4H 4ZXBC 1XF2B 3EZ8A 5TE7H 4X6FA 3RU8H 1YDPA 4OCWL 4U6YB 4OIIL 2AV1B 5I8CA 4RGNE 2BY2A 1DQLL 2AK4D 4JHAH 1CFTA 5GRYA 5I1KL 1NEZA 1JL8A 3CLFH 1M4KA 4HUVB 4YBHA 5EO9B 3Q6FA 1NEZG 3BKJH 2DQDH 2AVGA 4GFTB 4M6NH 3QEUA 4X6CB 4OGXH 4MJIE 4F15C 5JLZB 1AD0B 5MEOB 4HWBH 4MNGA 3QCVH 4DEPB 2F9BT 4PJCF 1IKFH 5DJAA 1T5XA 1VFUA 1NFDA 2XTJE 3QXTA 5F9DC 5GGVH 1T6VN 3RPIA 3D85A 2BJMH 1QO3A 2EYTA 3SN6N 4MSWB 2CK0L 3T4YB 1HHJB 4HJ0C 1GOGA 1RULL 2OZ4A 4Y5VB 4P23D 5JPNB 1B4JL 1HINL 1WISA 2FLBT 3ARGB 2FJHB 1HDMA 4ZPTB 1UVQB 3HPLA 4I48A 4AEHL 3EFFA 3Q0HA 1KJMB 1KLGA 4NCC2 3P30L 3I6KA 4WTWA 2BY0A 4DVBA 2BNUB 1G7HA 5D7IA 5HYQB 3MTRA 2AJUH 4J23A 4PJXF 3T2NH 1IM9D 3FB7B 1HILA 1A6VH 4HXBH 5C08D 4CMMA 5HYJA 3TO4B 3I9GH 3MUGA 4I0PC 1D5ZA 3ABZA 3U36B 2RFXA 4U6XA 1A6WH 1A6ZA 3VW3L 1HNFA 5CP7A 5EU3A 4G42A 5KJRL 2F58L 1S9XA 3CH1B 2VITA 3WFCH 3FO0L 3BESR 5C0BB 3L3HA 4R4BA 2VQ1B 5IFJA 3H9SD 4BSWB 1K2DB 3PDOA 1RUQH 1BQLH 2GI7A 1A4JB 2C9AA 1BX2A 2OJZL 3T1WA 4YHYB 3FHQA 1J8HD 1HH6A 4X6DE 3A6BL 5INCA 3PDDA 1RIVL 3B8YA 5DEZA 5DSCA 3CFDB 5JMRA 3EYVB 1IBGL 2D7MA 4N5EC 2A1WL 3CFJA 4WVRA 4F7TB 5FUZL 5I71B 3F7YB 3RX5A 1DVFC 3VXMD 1PLGL 3BWAA 2XY2A 5D2LA 3ULUD 5J11B 2FJFA 4Q0XH 2D3VA 5M95B 4U1NA 4WW2A 4QRSB 1F8TL 5B38G 4NBYB 4L4VD 3W82A 4K3EL 1QR4A 4MNQE 3C6LB 4L9LB 3G6DL 3SGKC 3VD7A 1TLKA 4L8BA 5HHQA 4H25B 3R06A 2CRMA 2HVKA 5CWSA 4TUOA 5D1ZD 2HFEA 1F4YL 4R2GC 2ADIB 1R3JA 1MREL 1V5JA 3MUY1 4YE4L 4YHKH 3GMMB 5HHOA 4JQIL 1YN7A 4OCYL 4XBGB 3VI4F 2EEBA 1UXSA 3B2UC 1TDQA 4XWOC 1MLBA 3IXTB 1MCFA 2D7QA 1WBYB 5E2JA 3QZWB 3O2DH 1HKLL 3TO2A 4JR9L 5E9DD 3VXSA 1YEFL 4QRRE 3MUJA 3STZA 1F6FB 1XFPA 1TCRA 3WEXA 2FEEI 2VJXA 4OF5A 1UCTA 3LZFL 2X1WL 4Q2ZA 4JPWL 4UILH 1D5BB 3CVHL 1DANU 3TA3D 5D7SH 1T1YA 4HIJB 3FOLA 2RBLA 1DEDA 1OAUL 2P44B 2P45B 2DJUA 1H3PL 4HS6A 3VXRD 2VLKE 3FRUA 2ADFH 4XVTL 1Q72L 2GEEA 4L3CB 4JDTH 4GW1B 3EDFA 2YMXH 1P4BL 4CRPA 4NQCA 2FGZA 4P46D 2CKBA 3MJ8B 4W68A 4KRMB 4M9PA 5H94B 1I7ZB 4I0CC 3ILPB 1P7KA 4B50A 4K9EL 3OB0K 4GS7B 3GI8H 4PRHD 3BW9A 1BWMA 1DZBA 1U95B 3MX0A 4F2MA 3MACL 5EUOF 3V0VA 1ORQA 4DW2H 5I9QB 1BQUA 5F7MC 1LVEA 3I6LD 3BUYB 4RFOL 1CFQA 3MV9E 4M6OH 1ACZA 4ZFOA 1YEDB 5A43C 1FL5B 4JZOB 2FIKB 4JZJA 4Y4HA 3P4NA 4E0RB 1C5CH 3BSZL 4Y5VC 1UACL 1HWGB 3ARGC 3IDJA 2GCYB 5E2TH 5IR1A 4OT1L 5I17A 1QSEE 4NOBA 1M7DB 5L2KA 5HDBE 1QYGH 4TNVK 4W4OA 4GW4A 1ZWIA 2HJFA 4PPTA 4JQXC 3GJEB 4FQJH 3NIFF 5C2BL 3MROB 2FO4B 4D0DA 4XWGH 5ISZE 3TO4C 3OKDB 1KCSL 2GJZA 5EIVA 2DQEL 5JMOC 3D39B 1NDMB 5EBWB 3MRQB 1WJ3A 1NEUA 1VGEL 3QFJD 4GKNB 1ZT4B 5J7CC 3M17A 2BDNH 1OAZH 4GRLB 2AK4A 1G7IA 3VG0L 3S88H 1NJ9B 4OCSH 4YHYC 3KPPA 5MEND 1NCWL 5E00A 4P2RD 1HHIA 1N5AA 4X99B 4ETQA 1IFHL 5JQHC 1FG2B 5L7XL 5HGAA 3UC0L 3D0VA 1U8JA 3PL6B 3H7BA 4RMRA 2HG5B 3V0WH 4P9ML 5I71C 1A7RH 4L8DA 2VWEC 5CJBA 2V2XB 5DRWA 1MFEL 5IUSA 5J11C 5JPMB 1EMTL 1U8PA 2DYPD 1OAQH 1SY6A 1T80A 1FL6A 4XC3L 1DE4A 1I1FB 3MJ6A 2MPAH 5CEYA 1MUJA 4JCLA 3C6LC 4L9LC 5DRZB 3SE3A 3L7EB 4FQIL 4LLVB 7FABL 2X89D 2UWEE 4I18C 2Z92A 5HY9A 4LCUA 4NP4H 1S7XB 3UX9B 1WTLA 3GI9L 4Y1AA 5DI8A 1T0NB 2VZ1A 1LO5A 4HK0B 1KEMH 5DVLA 3FFCD 1FYTE 4XMKH 3O6MH 3ET9F 2NR6D 2HT3D 4LU5L 1CU4L 2X1OA 3VXNA 4BKLB 4PJ7B 4PG9B 2KL6A 3HI5L 7CGTA 2R1YA 1IM9A 3G5YA 5KG9A 1UM6L 5EBMA 5C08A 3MCKB 3FQXA 4XNMB 2VDLH 1KJ2H 4PJIB 3S37L 4NQVA 4MCYA 5IWLC 2DB8A 5I76A 3IDGA 5GGSY 1QOKA 2NTSP 3BGFB 4WU7B 2VL5A 3C2AH 3ARXA 4JFYA 4O2FA 1CIDA 4ODUA 2YA1A 4WNQA 3DPBA 4TUKL 3RDTA 4LCWE 2VISB 5FYLH 5DS8A 1K8DB 5E8DH 1LK3L 3EZJB 5DD3H 1JGEB 2QEJA 3L3KA 2ZCLH 1QSVA 4UT9L 5BS0D 4OB5H 3GUTA 1RJZA 3GO1H 2VERN 3B43A 1NUDA 3K4ZA 1KG0A 1P7QB 4KKAC 5TDOB 3DTXA 3RZCA 3PGDB 2PTTB 1UH2A 4KZEL 4L4VA 1A3LH 2BRRH 3Q2CA 2Q87A 1TCMA 3JV0A 1KT2B 4GS7C 4P59H 2X9YA 5GJSH 2VZ3A 2XKSA 4K71B 2K7PA 4PY7A 3IU3B 1GC1H 2FX9L 5F89A 5T5NF 4PV8A 2I9TB 1WC7A 4MXWL 2HRLA 1T0MA 4J3TA 4RMWA 3MJ9A 3BD4A 4YIQA 1KN2L 1I8IB 5DFVC 2EDWA 2XT1B 1FC2D 1VEMA 5ITFB 1KIUA 3P77A 4XZUA 4X9IA 3EJYC 5TF1L 3VFNA 3O11A 4KUZH 3GSQB 2AJ3B 5HHPA 5D8JL 5I1JL 4PRID 3WUWA 3QWRD 1A9BB 1U92A 5DJYA 2DD8H 1QFWH 4HSQA 3LH2H 2Y4SA 5IFAH 3F58L 5E9DA 1JGUL 4XPBH 2FWOB 5T3ZD 3FO2B 4G8GA 2B0SL 2XKNA 5F88B 4X5XA 2ZCKL 2UY7A 2PETA 4WI8A 3DRTB 1LEGB 5E99L 3L7FB 3MPCA 1R0AH 4PJCE 3QHZL 3L9RB 2ORBH 1U3HB 4N8CH 5DJ8A 1TFHA 2PXYB 2KQMA 3VXUB 3SJVB 1BAFH 5HVHC 2KKQA 1XCQA 1YUHB 4N5ED 2JELL 1ZE3C 3BIAX 5GHWL 3SKJL 1JE6A 5IFHH 1NLDL 3TA3A 2ARWA 2E7HA 3AU1B 1IEHA 4NSKA 4O2EB 1Y6MR 4NKOB 3VDCA 5E03A 5FO8A 1OSPH 4GRLC 3QJFA 5EPMB 1KYOK 1OQXA 3VFPB 4OD3H 3VFGH 4IS6B 4P46A 1AGEA 1N3NA 3LEYH 1ZSDB 3B9DA 4YXLH 3VD9A 5CKAA 4LDOB 3CFEA 1HH9A 2WP3O 4LLMB 2Y07H 2UZIH 4R2GD 4PJXE 3RWGB 3K2MC 2MHAB 4XBEH 3GSRA 1OLLA 1OY3B 2OSLA 5FM5M 1J05A 4L5FH 5GS0H 5JDSB 3B2UD 4RMVA 4FS0A 5GRXG 2GJ6E 3WNOA 1QQDA 4XWOD 5F3HB 4MA8L 5FCUH 4HZLB 4EI6B 2X05A 4CDHA 1K85A 1G6RA 2P5WE 1YYLH 4OQTA 4LIQL 1QLEL 5KVMC 1GAFH 1JZ2A 2GHWB 3E2HB 5EO1A 5IT2H 2X4PA 2Q86B 5AWNL 2JIXB 2V5TA 1DBAL 1MY7A 1NBQA 2NY5H 3EOAA 5IW6A 4X4ME 1JZ6A 3RBGA 4Q6IA 1S8DB 4WUUD 1MHHA 1XIWC 4NKDB 3QO1A 3RIAK 2VLJE 2F53A 4NQXA 1CDGA 1U8OB 1G1CA 3V6ZA 4IOSD 1TZIA 5GGRA 5E4EB 2OP4H 3W0WD 5KS9A 3ECBB 4MQ7B 4X7SH 3S34L 2DQFA 4LLQA 1J5OH 4HWEH 4X4XA 1YY9D 1NBZB 5DD1L 2HMID 1NANI 1Q9OA 4XP9H 5CINL 5FYJH 2NXYB 3BGMA 4MJ5A 3BGFC 4DGVL 3JUYA 5SWSB 4ZUVB 5DUPH 2EIBA 2XPGA 4M93C 3V6FB 3QNYA 4J3OC 1CFVH 2GFBA 5LXGL 1DQTA 4P2RA 1ZT1A 4JPVH 4KVCH 4NRXB 3VI4E 3T0VA 2ZUWA 3NA4A 4A6YL 3CXDH 4M7KL 1KCRH 4Z7UA 3IDXL 2HN7A 3W81A 2HA1A 3GBLA 1S9WA 2V2WA 3GMNB 3I75A 2DYPA 4Z7NF 2XYCA 3FZUC 4EN3A 3H42L 2FR4A 3O6LH 2ITDB 3JTTB 4NC2B 3KPSB 2Z91A 3B9VA 5BXFB 3GGWB 1KBGL 4PJ9A 1J18A 1CGSL 1DFBH 2GAZA 4W4NA 4K71C 1RMFL 4YPJA 3MRLA 3VRIA 4L8CA 1JYVA 3E8UL 3QQ4A 2ZUTA 3IB4A 3EYUL 2DQIL 4MHHG 3QDAA 1K5NB 5J57B 3L3OB 3T3PF 3TNNA 1C16B 4NOFA 4K8RL 3T0DA 4OKDA 3FB5B 1YY8A 3P11L 1G9EA 5BMFH 1CGTA 1JCKA 5D1QB 5DJXA 3QUXD 4DKAA 1K4CB 3BH8A 2BNRB 2ATKB 4UAOB 4ZXBA 4JPKL 4TSAH 2HTKC 4UU9A 4PJEF 1OGTB 1ZS8A 3OKNB 1M71B 1U93B 1H15A 1EXUA 4JFDD 3WUZA 1FQ9C 3DO3A 1AQKH 3KNBB 4LF3A 3WXVH 1U3HC 2C3VB 1WBXA 4S2SA 2PXYC 2IPTL 2P4AB 5EUOE 2EYSA 3UTOA 2BVOB 1S78C 3RWCA 3OF6D 2HFFA 5FUCE 4JAMA 3U7YL 3DXAD 3QNXA 2Q8AL 5T1MA 2W9DL 3MV7B 5ID1A 1JPTH 4Z7WA 3LKOA 4ODTL 1BJ1J 4GAGL 5C71A 5I1DB 3BKCH 1OVZA 4ENEC 3DGCR 5E5MA 2XQYK 4P5TB 3UTQA 3RX7A 4NO2A 5BS0A 1MCWM 1CZ8H 3UMTA 3UO1L 4C55A 5FA4A 1MRDH 3M8OH 3BEWB 1I7TA 4JG0L 3Q6GL 4YXKH 3U7WH 1DJSA 2Q20A 4LCYB 2BRQA 1P9MA 1XZ0A 3MUZ1 1RZ8B 4N90E 1A3RH 3TBSA 3LRSB 1QSFE 4LIQE 4PJDF 3MMEB 3VFTB 2AK1H 3NIFE 3A6OA 4UV7L 3LKRA 4U7SA 5IHZB 1TPXB 4CVZA 4OM1L 1JN6A 4X80L 4F7PA 5F3BB 2PYED 3OHXA 3G08B 4XBPA 5IVOA 4WEBH 2CLZA 2APWA 3MBEB 1MWAA 2NY4D 3GHBH 3MLYH 5FM8A 4PRIA 1MHEA 3E2HC 5FV2A 1U8IB 5C09B 3NACH 4MNHB 5D1XB 2IG2H 5D9SB 2H32H 4NNXB 3T77B 1XF3B 4HH9B 1I7RA 1EERB 1V7ML 1FFOA 4MAYC 5I16A 3P2TA 3QHFL 5I30H 1UYWH 4GRWH 4PRBB 1QVOB 4DTGH 3MXVH 4PJHF 1FYHB 1MFBH 2IBBA 5JIIA 1BBDL 5E8OB 4FZEH 5E4EC 3LS5H 3G6JA 1P4IH 4CW1B 3HS0A 3REVB 2ED9A 1CGUA 4KGLA 4OJFH 4NO3B 5C6TH 5HHMD 1JPGA 5KSVA 3MXWL 4MQTB 3ALPA 2CLRA 4N1CA 5CILH 1YPZA 2E8YA 2LAAA 2NXYC 4UB0H 4K3DH 4U1JA 3GB7A 1I9IH 4OF0A 3GM0A 2WV3A 2YRLA 4ELKB 4XP1H 4KKAD 3TJEL 5FHBH 3OX8A 4TRPL 5ILTL 2NY7L 2DQGH 5AD0A 3GEWB 2AJVL 3ZE1F 3SGKA 3JWOC 1DQMH 1UA6H 5TGBA 2GK0A 5ESQB 4HT1H 5MEQB 5TJWK 3GJFB 4YDLB 2D7OA 3GSNH 3MOBH 3TBYB 4PR5A 2G75A 1SJEB 2RIKA 3CSYB 5DJ2B 1F4HA 2DTMH 4D0BA 1A6PA 1H8NA 1PAMA 4QHLB 1JI2A 3NTCL 3QISA 5MHSD 1GGBL 4M62L 4K3JH 1A7PH 3MRBB 1OGAD 4DVRH 4FP8H 2VH5L 4QGYA 1INQB 3W5MA 5F93C 4IMLA 1N2RB 1NC2B 2P48B 2NW3B 2XWJA 1FZOB 5LAXA 4M3JA 2DJ4A 3WKMH 1MRCL 2FL5B 5DLML 4DGIH 3CFCH 3ELAT 4UAOC 4QHNB 3W0WA 4PGZA 3VXQA 3D39D 2QQLL 2C4FU 4K3HA 1CDYA 5DQJB 4U6YA 4OZHF 1BM3H 4LSPL 4PJGA 4P57B 4DKEL 5DHXB 2XFXB 1MH5A 4QNPF 3QEHB 5F97E 3MNWB 3ZYJA 5E5RB 5EO9A 4X4YA 3PV6B 2V17L 2JJVA 4X6CA 3PWPD 1ZLVH 1TIUA 5IVNA 5D70L 4KK6D 1AY1H 2P42B 4NJ9H 3J8F7 2DS4A 1ZANL 2AABH 3UTSD 2I07B 4IM8A 2DLIA 4N0UB 5CZVL 4U33A 3ILQC 2BXZA 2QR0B 2BOBB 4ZOBA 4P5KB 3V8OA 2VLLB 3DV6B 4PYGA 4QXGL 1UM5H 4UI2A 4HJJH 1BBJB 1FP5A 5HPOA 5IROC 1O7VA 3T4YA 5CEZH 4ONGL 4C59B 4NC0B 1EHXA 2HJKB 2CDFB 4Y5VA 2VKWA 1LP9B 4MB3A 5JPNA 4OV5B 1F11B 3HFMH 3ARGA 1IARB 4ZPTA 4KI5C 1UVQA 4RGND 1CE1L 1R3KA 1KJMA 1M7IB 1XIWD 1W0VB 3WSQL 1TPXC 5HI5C 12E8L 5HYQA 3E0GA 2I24N 4JQXA 1IM3B 1S7UA 4FQ1H 3F7PC 1EAPB 1IAII 4XMLH 1TZGH 4I3RL 5IMKA 4UIKL 1AD9B 4LVHB 3TO4A 3WDIA 1U2CA 2IFFH 3U36A 4PTTB 3VWJD 5D1XC 3B9KD 1I3RA 1ZXQA 2W9EL 5C0BA 2VQ1A 1SEBB 4BSWA 1K2DA 3O6KH 1X5GA 1JF1B 1GGCH 1FDLH 3QDGB 4ZUSB 1A4JA 1Y18B 3ULVF 4IOIA 1KTLB 2AXGB 4FZ8H 5KVEH 3CFDA 1JK8A 3EYVA 3RVVC 3LN4B 1EH9A 4PLJD 1KPRA 2A9ML 3OF6A 2EXYD 3BPCB 3DXAA 3GSXB 5EZIL 3FO9B 3F7YA 3BT2L 1OCWL 2YBRB 5SWQB 1QRKA 1Z9MA 5A40E 3MRNB 3WHE0 4U1HB 1T83C 3FZUD 4MHHI 3K4DA 4QRSA 4U1SB 5B39A 1U8NB 1ZEAH 3C6LA 4L9LA 3U0WH 3L5JA 4KTEL 5B39G 3UAJC 4I18A 2MQCA 1I9RL 5IV2B 1BVZA 3TIEB 5ADOH 1CXIA 3GKZA 5T33L 2BY3A 4YDLC 1VGKB 5JW4M 2ADIA 4XI5D 3TESA 1YJDL 3GMMA 5HI4C 5EOQH 1DEEA 3EFDL 3G9AB 1R3IH 1WBYA 5GRUH 8FABB 2M1KA 3QZWA 4GG6B 2PYEA 1DL7H 3BEVB 1KB5A 2WINB 3QR2A 2FBJH 2CDGB 1N64H 2J6EA 2AKRA 5CFHA 3UYPA 1VA9A 4E41E 3CAFA 4WIQA 2WZPD 5IMLB 3MO1B 3C5ZB 3GNMH 3QIUD 3QQ9D 5KSAB 1RUAH 3LKPA 3SPVB 4X8JA 1YYML 3B2VL 5E2WH 2MCPL 4NFBA 1D5BA 4MNQD 3VXUD 2APBA 4PB9H 3SJVD 4W6YB 3BQUC 1X4ZA 4GRMB 1WF5A 4HIJA 4XPAH 4Z7NE 1FO0H 1CTNA 3BAEH 4DUVA 1W72A 5C0CB 5HGGS 4L3CA 4HPOH 3LDBC 4GW1A 3BPNC 4FTVB 1ORSA 3HI6L 3NCCB 5H94A 3T3PE 1I7ZA 2OQJA 4OZ4B 1FFPB 4LPWA 3TT1H 3ILPA 4ELMB 3T0BA 2EIZA 5EIIA 3V95A 2R15A 5IGXL 1EFXB 2W60B 2BNQE 4WCYL 1U95A 3FN0L 3N1MC 3MRHB 4NNYB 5CJQL 2W1NA 4PJEE 3BUYA 1JGDB 2WWMD 4OM0L 5JHLH 1OL0A 4WUKH 4JZOA 4LAJH 5DJCA 4GQPH 2VDOL 1ULVA 4ORGB 5FYJU 3VE0B 4E0RA 1JIBA 1Q9WB 1PX4A 4M7JL 3KLAB 3LMJH 4KJWC 4LCIH 4QHKJ 3ZLQC 5I18H 2JIXD 1OGAA 2HKHH 4HV8B 3BKML 4Q6YA 4ZSOB 3O6FB 4MAYD 1M7DA 1JTPA 3EO0B 1ZV5A 3GJEA 5CAYB 4QY8A 4F7EA 1F4WL 4E42A 2P43B 5LGHL 3U4EB 5T1DL 3CSPA 3C2SA 4H1LG 4LVHC 3WFHB 1D5XB 2V9TA 2FDBP 3B6SA 2IGFH 4JG1L 3QUMA 5CHNB 5I8OH 1VADA 3D39A 1YNTA 1Z0MA 3MRQA 4UUJB 4G8EB 1CWVA 1AXSB 5SWSD 2OCFD 3BE1L 1NGQH 3OKLA 1UCBL 1IC5L 3KPTA 5J1SC 1FZJB 3MV9D 4GRLA 2EKSA 4PJDE 35C8L 4OLYL 5L2JB 1SEQL 4YJZL 4X99A 3VGGA 2DMKA 5EDXA 4G8FA 5CS7A 1ZLWH 4NZJA 3PWPA 2HG5A 4QWWC 1A47A 1G9NH 4Z7VB 1RJYA 4M9OA 1Q0XL 5J1TC 5T1KB 3G5XA 4MZ2A 2FD6H 4C56E 4K7FA 2LQRA 1HN1A 1EJOL 4HIEB 2EE6A 2EDNA 5I1EL 3UYRL 4R4NC 5ISZD 4OFYD 2HVJB 2V9RA 3GHEL 3L7EA 3RVUC 2EDLA 3D9AH 2P8PA 2OXHA 1WLHA 3I85A 2BFVL 4HQQH 5AZ2H 5BRZE 1CLYL 1S7XA 4PJHE 5F70A 3IAGC 4XH2B 3L95B 3ARWA 2VZSA 3ARTA 1T0NA 4UNTA 2HTLC 1CICB 3O3AB 5DZOA 1FGVH 1XIWA 5HHNB 4LOUD 5TQ0L 3ARFB 4ZFFA 4OIBA 4IOFC 4PJ7A 4GBXB 1E4XH 3HA0A 4BQCA 4OCMC 4Y16D 4FFZH 4LHUB 1BLNB 3OAUL 3EO9L 15C8H 5GISL 4HKZA 1RK1A 1IT9L 4XNMA 3ULVL 5DQDL 3BWUC 5EOCH 3QP3A 1EEYA 4PJBA 3B9KA 3RWEB 5J4MA 5KSAC 1WEJH 1FVEB 5C0FB 1KOAA 3ZE1E 1GOHA 2BHYA 3JWOL 4XNUH 2ZP0T 1E6OL 1L0XA 3IU4H 2YD7A 1Q0YH 2Z93A 2IANE 1CL7L 4FN0A 1EZVX 1A6TA 4PJAB 1ZGLM 3VMOA 3NFSH 1EA9C 5TF0A 5IG7A 2AEIT 1ND0B 2VISA 3ULUH 1ZHLB 1K8DA 5CCKH 5E1AB 1FYTD 1OM3L 4P3CH 3LV3B 4XP4H 3UJJH 1JGEA 2NY1B 1XR8B 4LMQI 2CGRH 4YBLB 5DT1H 4I9WE 5C6WH 5TDOA 1P7QA 2LTQB 5C6PB 3PGDA 2PTTA 3C6SA 3O3EB 2XY1A 3FCTA 5ACMA 4JGJA 1V7NH 4PS4L 2XRAH 3IU3A 1JZ4A 4KI5D 4UINH 3TVMC 5IK3B 4NRZB 5HBBA 3T0EB 3CUPB 4F33B 1OD7A 4FQCL 4N5UA 4X98A 3CXHJ 3HNVH 2ICES 5ITFA 2ICWB 4OZHE 4H20H 4JE4B 4O00A 4F7MB 2CO6B 3QSKB 1YQVH 1ACYL 2VDNH 3K1KC 1A6AA 4QNPE 1AXTH 1A9BA 4LCWD 4MX7B 4Z8FL 3RAJH 5C09D 1OP3K 1K6QH 1I3GH 1S7VB 2DTSA 2FWOA 5EOTB 2HWZH 3FO2A 5F88A 1X5ZA 3ULSA 1WCBB 3L7FA 3RNQB 5SV4A 3HUJF 1I1YB 4QRPB 1U3HA 2YOCA 1CF8H 2PXYA 3VXUA 4K07A 3SJVA 1BQHG 4S1RH 4NUJB 1WICA 3E6FB 4XP5L 1JF5A 2OR8A 2RHEA 1MLCB 4O2EA 4NKOA 4ZTPL 4GOSA 4JFOB 4QYOB 1GHFH 3SQOH 4HCRH 3JWNC 2IPUG 4U3CA 1Z9SA 3VFPA 2GUOB 4PLOB 3KPLB 2H6PB 1ZSDA 4HKJB 3UAJD 1T2QL 5C70A 4R7NB 4YEEA 3SDXF 1U58A 5D72H 1S5IL 3LKSB 4I2XB 1YEHH 3RWGA 2MHAA 1YMHA 5HYEA 3QBTB 2W92A 3O0RH 5JDSA 5ALCL 1G6RH 3KJ6H 5KOVC 5F3HA 2EXWC 4HZLA 5DUML 2B1HL 4EI6A 3VFUB 3P40A 2F8OA 3SDDB 2WBJC 2FH8A 5TFSH 4PRNB 3P3YA 3OZ9L 4PJ5B 4BQ6A 1R3HA 1MJ7H 2JIXA 5DJDA 3RA7L 3WFZA 3ULVE 1DQDH 1CICC 2DDQH 2PTVA 2A6IB 5CGYC 1S8DA 2O5XH 3FONB 3IFOB 4JJHA 4MAYA 3ARFC 5A3ID 4GBXC 1VENA 5J3HC 1GCFA 1U8OA 3UCRA 4CKVX 3S36X 1T2XA 4XVUD 3BQUD 4MQ7A 5E94B 2VLME 2XWBA 2AEQH 3BP6B 4FOMA 3RGVB 4UTAH 4G43A 1NBZA 1SBSL 3D3VB 5J13B 4L4TB 2FX7L 5IESH 3CMGA 4LGSB 5FECB 5SWSA 4ZUVA 1GJIA 4NHCL 4JN2B 4MA3B 4JO3L 4WV1B 3MV9A 5ENWA 2P5WD 4PRPE 4V1DB 1CD9B 4NUGL 3ZKMC 5ABDE 4PY8J 5C1MB 4IRSC 4JFFB 2Z31B 1AJ7H 4ZUWA 4P48A 1UM4L 2GQHA 5FUOH 4QEGA 3H8NA 5KSBB 1XGQB 1HXMA 4G6KL 3DHMA 4M7LL 1S7WA 2NY1C 3TFKC 4DKFH 3OJDB 2CDEA 5DMKB 4YDVB 3GMNA 3NA9L 1J0KA 4RBPH 2VLJD 2LTQC 3LQAL 1CDJA 3BKYL 1BD2B 1FGNL 4MD4B 3GGWA 5DD5L 3DRQB 4JM2F 3HC4L 5GSRA 4OLWL 1QR1B 1KCVL 4PUBL 4GQ9H 3L3OA 3ARDD 3WFEL 5IB5A 3OXRB 4LDLB 3FB5A 4F9PC 2BMKA 4XNYL 4TVPH 3LPWA 3U79A 2B4CL 1AR2A 3PQYB 3QH3B 5FFLA 1FORH 3LRGA 2BNRA 2ATKA 1ZA3A 3GRWL 1CE6A 1QLRB 5IB2B 4HXAH 5F1OB 1OGTA 3IDNA 2HKFH 1AI1L 4KK9D 4YO0B 4WTXA 1U93A 1GXEA 1YEEL 4LEXH 3T3MF 1NCBH 3RVTC 4M8QB 2APTA 4AIZA 1QG3A 1NGPL 2ZNWA 3VFMA 3I50H 5KTEH 4ODWB 4XCFH 3R0MA 2IF7A 4HLZG 1P69B 4QXTA 3DJ9A 5FIEA 3CX5J 3P0YH 3RI5F 2BVOA 1LEIA 3HR5A 3QULB 3E3QC 5DWUL 1HZHL 4OLEA 3I02A 1X5LA 1Q94B 2N7BA 5INDB 3QWQB 5I1DA 1FYTA 1S9YA 1FFNB 4GW5B 4KC3B 4L1DA 3JUZA 4G80B 1BVKA 1XGYH 2NY6B 3BEWA 3NFPB 2C3GA 1XF4B 3RVUD 4YHML 5HDQL 2EZ0D 5ITBL 1PSKH 1RZ8A 5IROA 4EJ1C 2AJYH 5BJTB 3TH3T 1NBVH 2ADJB 3QUKA 3IFNL 4R4FL 3MMEA 3PGFH 3VFTA 1KACB 1A7BA 3QA3B 5KZCD 3JV6B 5IHZA 1PYWB 5I1CH 3TT3L 1QEWA 4UNUA 3MCLL 4NZUL 1KN4L 1F2XK 3LEXA 3DX6B 3U9PH 3G08A 3X11A 1VB9A 3IKCA 1NQBA 3RVWC 3SDDC 1FRGH 2O5ZL 2W59A 2Q3AA 1I8LA 5KANG 1OTTC 5T3ZH 2P49B 1U8IA 5C09A 4RRPA 1RZJL 5D1XA 5C3TA 5D9SA 5L88H 5KSAD 2WIIB 3ZTNH 4OLZL 3OJVC 2DJSA 2JJUA 3PHQB 2MTPA 2PO6B 4PRBA 1QVOA 4J3UA 1A7NL 4X0KA 3FFDB 1HKFA 4GG8B 5IW1A 4RA3A 4CW1A 3REVA 2VZTA 4NO3A 5F7YC 1MCPL 2WQRA 5GRJH 5FK9B 3CPLB 1YMMB 2C1OB 1RJLA 5CBAB 2I60H 1J10A 5C0CD 5IEHB 1NLBL 1DBML 1T3FB 1B0RA 5JHDE 5D71H 4WV1C 4XHJD 2K9UA 1T83A 3HZYA 4XPFL 3FAWA 2YUWA 3O2WH 2LU7A 1NCNA 3MZTA 4OSUL 2ED8A 1EX0A 4YUEL 2FIRT 2H2SC 1IKNA 4NKMB 1TQBB 5F9JA 3GJFA 1EGJA 3TVMD 1CTOA 4QTIL 1CK0L 1YNKH 2BERA 3CSYA 3TF7C 2X09A 3P4OB 2D7TL 2VMFA 2CXGA 5DA4A 4QHLA 2V5SA 5B21A 4EQ3A 3FTGB 2R0KH 1U8QB 5I1IH 2X4UB 3T0XA 1JPSH 1INQA 2N56A 3LQMA 2Y6SC 4R90L 2JJTC 1N2RA 4QRQB 1A1NB 2NW3A 4QO1A 3I2CL 1FZOA 1TMCB 2JB5L 3NN8B 4P2OB 5FCSH 1E6JH 3BQUA 3VD4A 4NKIL 3EO1B 3OB0H 4MMXC 3ZDXF 1A6UH 1DBBL 2CRZA 3UYOD 4HUUB 4CN6A 3WIHA 2YEZB 1UWGL 2CUHA 5E4IA 2FO1A 5DC0A 2LVCA 1NAMA 5T3XD 1JNHB 2XFXA 4K8RD 2DQCL 2OTWB 4JKMA 3QEHA 4RFEB 5KVDL 3V9FA 1VPOL 3LEVH 3TPUB 3PV6A 2P5WA 2GTZB 4NZDA 3EOYG 1KNOA 5BVPH 4OFPA 3O3BB 3F6IA 5T1LB 1X44A 2FLRT 1J7VR 4YGVB 2IEPA 1XH3A 2PF6A 4X4MA 5ELIA 2NY0D 2A73B 4N0UA 4G6AD 2EXWD 4XCYB 5GRVK 2NY6C 2BOBA 4ETYA 5IHLB 4P5KA 2VLLA 2IQ9L 5GGSA 1A3QA 4C4KT 1S7TB 2WBJD 1BBJA 2PTUA 4HAGA 3HG1E 1XF1A 4ZD3H 4XCEA 4G8IB 2CDFA 1D6VL 1SYVB 2PR4H 1LP9A 4OV5A 1F11A 3HUJE 3MJ7A 5C86A 1CICD 4XPHH 1MFDL 4QT5A 4APQD 4R8WL 1W0VA 3ARFD 3O3DB 2VXUH 3CK0L 1RZKL 5GZOC 5KVGL 5FHAH 1ERNA 1PKQE 2EH8L 5B3NA 3VH8G 1I1AB 1MIEH 1IM3A 4LHUD 1EAPA 1EAJA 2VQUA 2XQBL 1AD9A 1UH3A 4G7VH 1QBBA 1MIML 4DZBA 1CT8B 2EH7H 2OL3B 3OG6B 2AJSL 1PG7H 4O58L 3MRJB 3WIFB 2X4QB 4D8PB 1NAKH 1KB9J 1FPTH 3HI1B 1SEBA 1JF1A 3SDXE 4DOHB 3QDGA 1INEL 2OLDA 2ZKHH 5JR1H 1IEBB 3ZKMD 1BFSA 4UOJA 4BQ9A 4ZUTB 1MCOL 3ISWA 4P5MA 5K9OA 2AXGA 4IRSD 1LO0H 4NNPH 2NW2B 3EW3B 4NO0D 1BOYA 2Y25A 4I3SH 2C4XA 4OD1L 3BPCA 3GSXA 1BEYL 3FO9A 2HH0H 2YBRA 4HX1B 4GSDL 4U2ZA 3ARZA 2YPLB 3MRPA 2VXQL 4I77L 4LLAA 4EI5B 5JNYB 4H8WL 4YHOL 5GSVB 4OLUL 2A77H 4J7RA 1ED3B 3T8XA 3BMVA 1FNSL 3SGEI 3P9MB 3D2UD 1VGKA 3O2VH 1SJHB 5I8KH 1NMCB 2AI0H 1GC1C 1UWEL 3MODL 3TH4T 1NCDH 5EU4B 2NX5B 3LS4L 5C0AE 4O02H 4J6RL 3ROOB 2DQHL 2WSKA 1OWRM 4GG6A 5TE7L 4TTGA 4KAQL 2PW1B 3RU8L 1X5HA 2Y06L 3FB8B 4OLVH 1IAOB 1KIQA 4FTVE 3RGHA 4XPTL 3HNSL 3C08L 3QCUL 3WFBL 3FB6B 5IM7B 5M94B 1CD0A 5IMLA 3MO1A 5KSAA 1VFAB 2OTUB 3RWFB 3SPVA 2UV3A 3BKJL 5I15H 3Q5YA 4L8SC 3RUGB 1QKZL 2J4WH 5IB3B 4P2OC 4KTDH 3S6CA 4HWZB 1WT5C 4XP6H 5HGBA 4IHOB 4GRMA 4G9FB 4Y5YC 1LK2A 3X3FH 4D9LL 4NM4H 5C07D 3NPSB 3QQ3B 1KJVA 5GGVL 5C0CA 1J1XL 1H3VA 2YD4A 5FM5O 2G9HB 3R4DA 3V5KA 1MEXL 3EYSL 5CBEA 5GJTL 1MAJA 5ICZB 3ZL4H 4ONFL 4URTB 4OZ4A 1FFPA 1J12A 3KXFD 3RWHB 5LGJB 3DSFH 1FIGH 4G7YH 5BQ7A 3WO4B 4E41D 1EFXA 1KTKE 4ZOCA 5E6ZA 3A6CH 3BP7B 1P5VA 3C60C 4ORZC 3TVMA 2XWTB 3MRHA 5KANI 4Q9QL 3GMRA 4PJFA 3T2NL 3G5VB 4NQSA 5IEKB 2NY3C 3TYFB 3S36L 1JGDA 5GS0C 3BD3A 3KLDA 3RVWD 5FO7B 3T3ME 2F54B 5FKAB 2GK2A 2NZ9D 3Q5OA 3X3GL 1C7TA 4ORGA 3TP4A 4RISL 5KVFH 1Q9WA 2ERJB 3PIQB 1GL4B 3KLAA 4J8RA 1DQQA 1XCTB 1Q38A 3WFCL 4OUUB 2A74B 4MAUH 1Z9LA 5TQ2L 2L0DA 4ZSOA 4MVBD 4OCRH 2VDMH 4WGVB 4H1LH 1IGIL 4MD0A 2NY5C 5BV7H 1I1AC 3MLXH 4YK4C 1NFKA 4S1SH 2FSEB 3BUTA 4EZMA 3RKDC 2VAJA 1JWUA 3GK8L 4RSVA 4GRWB 1D5XA 3WKNA 1HOCB 3U30B 2F8XC 3U0TB 1KXTB 3D3VD 4N0YL 1G9ML 4DAGH 3IFLL 3BYTA 4G3YL 4BZ2H 2QKIB 3ZKSD 4N0CC 1FZJA 1QACA 3KPNB 4FXGA 5HSFA 1G0XA 5L2JA 1INDH 4Y19B 1A14L 3UZVB 2VXSH 5HPMA 4R26L 3PWLB 1QNZL 1N4XH 2H2SD 5GZND 1AO7B 4Z7VA 5KN5A 4HULB 5D7LE 5EORL 5IBLC 1W2KT 3HMXH 4YFLF 2Q6WB 1WBZB 5HTSA 1U42A 4KJPD 2R0LH 4HIEA 1KTDA 4JKLA 4BZYA 4ISVB 1DBKL 4EI5C 2HVJA 3KR3H 6FABH 3U2SB 5IBTH 2WBJA 1UEYA 2DLGA 3U1SL 3MLWH 4UDUB 4N9GA 3NIDF 5ESAB 3DURB 4XH2A 1MOEA 3HNTL 4ZNCD 4HZAA 1CICA 3O3AA 1NMCC 3N85H 2WLZA 5CGTA 4NWUH 2ZOLB 2Y36L 1MFCL 4MB4A 5HHNA 3WIIL 3ARFA 5CD3B 4GBXA 3TN0D 5C3LD 1KJ3L 3FQNA 4HBQA 3K74B 4LHUA 3BN9C 1SM3L 4HFWA 4X9HA 1BOGA 5T5NG 3W2DH 1B3JA 5KSUA 1A8JH 5J1AB 2ADFL 2LFGA 4P99A 1ZAGA 1YDPB 3U4BL 3P9WB 4JDTL 3RWEA 2WUCH 4C56D 5KW9H 1FVEA 2R9HD 1A2YA 3DOSA 3VRLE 5EU7E 2X7LA 1N59B 3WLWC 3D18A 2VUOA 2B5IB 3JWDL 1NEZB 2XG4A 1W8OA 3Q6FB 1VSCA 4H26A 3GI8L 1Q9LA 5E2UH 3OKOA 3RVXC 3SDYL 4PJAA 1BPVA 4IRSA 3NABL 4WFEE 1BFVH 5TDPB 3T0EE 1WAAF 1NSNH 4WTZG 5DA0B 4MNGB 2DKUA 4DW2L 1ZHLA 2XV6B 3C9NA 5BVJB 5E1AA 1LO2L 3LV3A 1SHMA 3NPSC 4LSSL 4KROD 5DJAB 1XR8A 4HWBA 1JNLH 3HLAA 4GT7A 2Q8BH 3STLA 1KSRA 3CFIC 3V2AR 4DN4H 3A67L 3RPIB 3D85B 4LSTL 1QO3B 4HDIA 1DLHB 3O3EA 2EYTB 4GXVH 1MQKH 4Z5RA 4N8VG 4FABL 1XMWA 3KPRE 4G6ML 3T65B 3WO4C 5CGMA 3CDGB 5HHXH 3SE4C 1SYSB 3S4SG 5F7EL 2Z8RA 1UJTA 1EHLL 3JZ7A 1QYGL 5JW4Q 5IVXF 4I48B 2CD0A 1S9KC 3EFFB 4NRZA 4HS3A 1EVUA 4U05A 4FMKA 1K4DB 2IAMD 3CUPA 4F33A 5GZOD 3ZDXE 4PRDA 1FCCA 1G7HB 1IZKA 2ICWA 2IAND 3GM8A 3SBWC 4DQOH 4ODHL 5CSZB 1FZMB 2ERJC 3DSNA 3UTPE 4MX7A 3HE6B 4XNQB 1CGVA 1D5ZB 4U6XB 3QDJE 1A6ZB 5D7KD 3GBMH 5CP7B 1Z2KA 5EOTA 5EU3B 1S9XB 2VDQH 3S88L 1FNEB 4GUPB 2CUMA 3GJFK 3PDOB 4I9WD 4O5LH 1N5YH 1WCBA 3N0PB 1A7OL 3LKQB 3DX7A 3RNQA 1HIMH 5F9OH 4QRPA 4I2XE 1H9VA 1ONQA 4OI7A 2J5LB 3QI9B 3CFJB 3C8KA 1MLCA 4I0KA 2FX8L 4TNVF 2VB5A 3CLEL 3K3QA 5D2LB 5C07A 2MPAL 2V7HB 4G6FB 5B38B 5I1LB 2MWCA 4LKXA 1IGTA 4D0CA 2R4RL 3OKEA 2GUOA 3BX7C 4DCQB 1H3XA 3KPLA 2O61B 2YA2A 3KXFA 4OCWH 4L8BB 3R06B 4OIIH 4B7IA 2M2DA 5CWSB 1DCLA 3LKSA 2HFEB 5CIPH 1R3JB 3RJDA 1DQLH 5HHOB 4NFCA 5I1KH 1YN7B 2PN5A 4CU8A 1GGIL 1UXSB 1MLBB 4EXKA 3VFUA 1JMZA 4YPGA 4L4TE 1KFAL 3SDDA 4YH6A 2VDLL 4X5LA 4XMPH 3ZMRA 2ICEB 3C09B 4PRNA 1QBML 3O2DA 5E6IB 1D9KC 4PJ5A 2W38A 5F1KC 3STZB 3IFOA 5EG6C 3WEXB 2XI9A 5EULV 5E08H 2A83A 5JW4R 4WI6A 4TTDD 4FFVC 4BA8A 4GKZA 4X8XA 1RULH 3TPKA 2VR9A 5JXAL 3QG7H 4LPXA 5E94A 1MCQA 3P0VL 1B4JH 1HINH 1EDQA 1T1YB 4CN4A 5B4MD 4XNXL 2Y23A 4PRAB 3D3VA 3FRUB 5D2NE 4HEPG 4M1CC 5FECA 2UVFA 3KS0J 4JN2A 1IGCH 1KGCD 1FO0B 1QP1A 4OI9A 1CR9L 5DGRA 5HD8C 1A3LL 2B5IC 2DM7A 4WV1A 2BVUA 3ME0A 3QDME 4V1DA 3SE8L 3WHXB 5EH1A 1B0GB 3FO1B 4JRXE 5T1LD 2G2RA 4JFFA 1MI5E 4MD5B 2E9JA 3VW3H 1K3ZA 5KJRH 3ULVD 3GIVB 1RURL 3FO0H 4O51B 2R4SL 3FN9A 3C60D 4RGMB 1KIRB 1XGQA 4F2MB 2VRAA 5KSBA 3RL1B 3OJDA 5DMKA 3R0NA 4YDVA 3ZKXB 1ORQB 1OAKL 4KXZH 2ZSWA 2OJZH 4JY4A 2NY3D 4ZUUB 2FEDD 5A2JH 1WWBX 1RIVH 5GS0D 1CFQB 3AMLA 5CJXA 4JFPA 4ZFOB 2A6KA 4JO4L 1IBGH 4L9DA 4MD4A 2VLMD 2A1WH 3P4NB 3H3BC 4MGXA 5FUZH 1F3JB 4S0TD 4P9HH 1PLGH 3IDJB 3OAZH 2NYYC 4HC1H 5C9KA 3QPXL 3SGEH 5I17B 1R0AL 2J8UA 1F8TH 3OXRA 3S5LG 5L2KB 2ORBL 4MYWB 2IQAB 4PRPD 2HJFB 4K3EH 4Z9KB 3RKDD 5I8EA 3G6DH 1JNNL 1OP5H 1U0QA 5BJTA 1GZQB 2EDHA 4D0DB 1UKSA 3QFDA 2NY2B 5L9DL 3IJYB 3HE6C 5IB2A 3H9ZA 4YO0A 2ZPKL 3QO0A 1MREH 4YE4H 3UTTE 4IBLT 4OCYH 4HLZH 1OSPL 4JFEE 4M8QA 4N0CD 4D9QE 5FYJD 3E6HB 2E8ZA 2AK4B 1HKLH 3ARYA 3KPPB 5MI0B 4JR9H 2J7LA 1N5AB 4U31A 4X6EB 4NQDB 2DICA 1YEFH 5JZ7C 5HGAB 5DQ9B 2J5LC 3QULA 3QI9C 2QSCH 3H7BB 3NPZB 1Q94A 4JY5L 1U9KA 4WEUD 4JZNA 1AXIB 5IQ9B 4X9GA 5DRWB 5FCUL 1X5KA 1BIHA 3LZFH 3S9DB 5EZJB 4GW5A 4JPWH 1U36A 3PP3K 3U46B 2EE3A 1CDIA 1FL6B 1ZTXL 2BY1A 2CK2A 1YYLL 3WLBB 3CVHH 2D0FA 3PDGA 1MUJB 3BISA 2DLFL 4RMQA 5IT2L 1RQ5A 1OAUH 1H3PH 2NY5L 2VDKH 1HE7A 3CX5K 4ZPVA 4LCUB 5C0ND 4XVTH 1Q72H 1KTRL 4K7PY 4P23B 4TSCL 5DI8B 2FB4L 3JV6A 5F96L 1P4BH 4HIXL 4K7PL 4OZFG 2OL3L 2P1YA 4YEFA 3SOBL 1YMME 4UOW1 4NPYA 4JRYE 4HWEL 2IANA 2R1YB 5D96B 4K9EH 1IM9B 5KBNC 4KKCD 3KYOA 5GS3A 3C09C 4YQXL 2QQKH 5EBMB 5C08B 5E6IC 1I8KB 3LY6A 3MACH 4MCYB 1GZPB 3CFKB 3TNMB 3MRRA 5F21B 5I76B 2WIIA 3DX9B 3IDGB 1Z5LB 4HF5L 4RFOH 1KJ2A 4KMTL 3PHQA 3WLWD 3H9SB 1PZUB 1RUKL 2R1XA 3FFDA 2ZNXA 4XCNB 4GG8A 1U41A 4JFYB 4O2FB 4ODUB 1J8HB 3BSZH 4PB0L 3ZKNC 3RIFK 3ZHDA 1FC1A 5FK9A 2FRGP 2B20A 1HCFX 2QBWA 5SWZE 4PTUA 5IEHA 3RIAF 4PGBB 3L3KB 4YLQT 3VXMB 4GJTB 1T3FA 3LKNA 1NFDF 3O6LL 3CDFA 1UZ8B 3BIKA 5C2BH 3NIDE 3NCYS 1KG0B 4OZHA 2UUDH 2YUXA 4WFGE 4L4VB 1KCSH 2DQEH 3I3BA 1E4WL 4M5ZL 4U3XA 5DTFB 4BM7A 4BSJA 1VGEH 2QJDA 2G5BB 2X1PA 2XZCL 4RGMC 4WRLA 5F89B 1N8ZA 2DBLL 1WC7B 2ZOKB 5D1ZB 1T0MB 2R2HB 3ZKXC 1T89A 3VG0H 1NCWH 5I2IB 1SMAA 2EE9A 3PGCB 1IFHH 4Z0XB 1OW0C 1AP2A 3WJJC 3P4OA 5L7XH 3ROLA 3P77B 4XZUB 1T4KB 5D7IF 4XC1L 3UC0H 3KWWB 4TSAL 1IAMA 2X70A 1VFOA 3VFNB 4ZYKA 2APXA 4Y7MA 1NGXB 3FTGA 4H0GA 4P9MH 3DNKA 4FNLL 4DKDC 3OPZL 2X4UA 2HJLA 3SDCD 3RI5K 3GMQB 5E9DB 3T2PA 2D4FA 2VXVL 3UDWC 5LQBL 1CVSC 1KYOJ 2XKNB 4QRQA 4XC3H 1ADQL 2BOCA 2FEEL 4X5XB 5JHDD 3BRFA 1CI5A 4W4OC 1WAAE 2JCCA 2GSGB 4RAUA 4FQIH 4L8SA 3NN8A 4POYA 4P2OA 3EYQD 5DMGC 2NY2C 4NRYB 4M6ML 1WT5A 4QOKE 4F57L 3EO1A 4XVSL 2A9NL 1XCQB 4X5WA 3GI9H 1NAMH 4Y5YA 3TA3B 1JHLL 3AFLA 1CZ8L 4JGUA 1T2JA 4LU5H 1CU4H 1MRDL 3VXRB 1JNHA 5E2VL 5D5MB 4KHTL 5JOFB 3HI5H 4EIGB 5DD0L 3QJFB 1ROWA 2ITCA 3SE9L 3TPUA 5MI0C 4WW2F 1N6QL 4P46B 1UM6H 2W07A 2YRPA 4LGRB 3O3BA 3ARRA 4N68A 1AO7D 5T1LA 3S37H 1FCGA 3FHAA 4PRHB 4JANB 3C60A 1G9NC 1MCJA 1J05B 2A73A 1JZ5A 4JPIB 1TNMA 1JUFB 3STBA 1J0YA 3MLYL 3PWUA 3MC0A 4TUKH 4HAFA 1G6RB 1S7TA 2K3TA 1WV7T 1OAYL 3NACL 4G8IA 4NC1C 1SYVA 1D9KD 1LK3H 1BZQK 2FHFA 4MJ2A 4DOHE 4AEEA 5FYKL 4P23C 1T7VA 2F19L 4UT9H 5I30L 1QPXA 5JA8B 4X7EC 3MXVL 43C9B 1MHHB 3LVEA 5IBUG 4KZEH 1P4IL 5AG9A 4PRPA 1I1AA 5C6TL 4NQXB 1TZIB 4HS8L 5KOMC 4JM4L 1NGWB 1CT8A 4RWYH 2FX9H 1RZIA 1X6LA 4LARH 4MXWH 5EB9A 2DMBA 2Z9TA 2WBWB 3MRJA 1WCQA 1QRNE 3WIFA 1Q9OB 1KN2H 4DN3L 1JZ8A 3HI1A 5FHBL 3F5WA 3QFJB 3MLVL 4LLUB 1MJJB 5HD8D 3QWOB 5TF1H 1V8HA 1IEBA 5I1JH 3PWVB 5MENB 4OTXL 1UA6L 2L7UA 2XNAA 4POZC 2NW2A 3NZHH 3F58H 3PXJA 4JN1L 2VO5A 2B0SH 2NX5E 3DLQR 5FGRA 1VDGA 4WI2A 1A5FH 2ZCKH 3Q48A 1DN2A 1KXQE 4U6VL 1F02I 3F7RA 3ULUC 1T22A 3I75B 2YPLA 3QHZH 4N0FB 2DYPB 5E0QA 5GS2D 2XTLA 4NBXB 5DVMA 4EI5A 5GHWH 3SKJH 2RGSA 2A6JB 2F15A 3HRZA 5GSVA 2XN9E 4HMCA 1V3LA 3P9MA 5ICXB 1QBLL 4H0IA 2NYYD 5L6YL 3AREC 5D1ZC 1S7RA 1SJHA 1D5IH 2DF3A 3FFCB 4EUPG 1EEZB 4HUWB 4K94L 4DGIL 3B9AA 3ROOA 5D6DC