4JBGA

1.75a resolution structure of a thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
333
structure length
333
Chain Sequence
b'HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
molecule tags Oxidoreductase
source organism Pyrobaculum aerophilum
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
total genus 101
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbgA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbgA01
1PZGA 3LC1O 4PRKA 4DMLA 5I9MA 2PH3A 4JJIA 5L7WA 1PL8A 4CMGA 1HL3A 2VHZA 1XGKA 1DEHA 4YR9A 1Y8QA 3GHYA 5MGBA 1HE3A 2GCGA 4EEXA 4R1TA 2D8AA 3NT5A 3NT4A 5J23A 2OMEA 3AFMA 3PWKA 2VNAA 3RJ9A 1PL7A 1ZMTA 1YL7A 1ZCJA 4CQMD 2Y1FA 4IJUA 3IL2A 1E1MA 5G0UA 3ZU5A 3IOYA 2FN7A 2Q1WA 2JAHA 2NSDA 4Q3CA 1DC4A 1GQQA 4R3WA 1QMGA 2O7SA 5DP2A 3SBOA 1I33A 1U9JA 4A7PA 4L4XA 1SB9A 3VZSA 4Q9NA 4NI5A 2PZJA 4ESOA 3K96A 3F3SA 2W4QA 1KYQA 4RF5A 3WYEA 4WE3A 2EP7A 5ICMA 1CQIA 3CEAA 3KTDA 1SPXA 2CF5A 2RBEA 4KDEA 1PJBA 3HUDA 1QYXA 1GTMA 1R66A 3CTMA 3F5SA 4IXWA 4WCDA 4CUJA 1KEVA 4TMFA 3T4XA 2X9NA 4UVHA 3ZU4A 1WMBA 5JO0A 1KVRA 3NTQA 4MVJF 1ORRA 1RJWA 5A3JA 5KJFA 2PV7A 1F12A 1E1KA 4E33A 2GZ1A 1GQYA 2VHWA 2YW9A 5JY1A 4Z9XA 4J9VA 3ZW8A 4CJXA 4E2ZA 1CF2O 1P9LA 5FFFA 5IZ4A 4CM9D 4O6VA 3VPHA 5K1SA 1PJSA 1HTBA 1HKUA 1PL6A 1ZMOA 3BHJA 2CVZA 1Y8RB 3K31A 2X58A 1NTOA 1Y9EA 5A1TA 3EZYA 3ADPA 1UH5A 1P1HA 5TLSA 2QRJA 2EKPA 2O3SA 4JBHA 4E31A 1BVUA 3OIGA 1Y9AA 3JQAA 1LC3A 5JMPA 4GVLA 5FWNA 4XX0A 4YT5A 3ZWWA 3M6IA 3QRWA 1G6KA 4XYGA 2D4AA 2H63A 2JD2A 3JD4A 4GMFA 1I01A 1SO8A 2ZTMA 4YJHB 3JQCA 4GH5A 4XYBA 2OFPA 5B4VA 1YQDA 3A06A 4TQGA 1GUYA 1UAGA 3H9EO 3GVCA 4IMRA 3ZV4A 1WXDA 2X6TA 3I9KA 3OJEA 1SB8A 1NPDA 1TI7A 3ZDFA 4CUZA 6LDHA 2VUSA 1BMDA 4UEOA 3LK7A 1ZXLA 4DIFA 1IB6A 3ZI0A 4GX2A 4LCEA 1GCUA 1KVQA 4BNNA 1WWKA 2PZLA 3JYPA 3KLMX 4MVJE 3S2IA 4XJTA 4LRSB 1V9LA 3NTOA 3Q6IA 4BO9A 2ZB8A 1BXKA 3C7AA 1R0LA 1HDZA 3KVOA 4K6FA 4CM9A 4MVJI 1SAYA 4EJ0A 1Z45A 1FXSA 2GLXA 4YBZA 4CV2A 1JDJA 1DIGA 1NQTA 2DBVO 4NJMA 2PGJA 3OIDA 4TKMA 5F21A 5DDIP 4BKOA 3QWBA 2IEBA 3KO8A 3DBRB 3CH6A 4CMJA 4CR8A 4Y9DA 4DUPA 1ZVMA 5BR7A 2Y1OA 1DAPA 1IPFA 1DJQA 1R4MA 3I52A 1MFPA 1VJ1A 2Q46A 3O26A 4D46A 2GR9A 2OP1A 2WD8A 4EW6A 4WCFB 1Z7BA 2HMTA 4NZ9A 5JLAA 2QHXA 2Q2VA 2GUGA 5AXBA 7MDHA 4GX1A 4YJFA 2ZYGA 4E13A 3BMQA 1ADCA 2VUTA 3CKYA 5AXAA 5JCJD 2CDCA 2YV1A 4J1TA 5BSGA 1VM6A 3LT4A 3G49A 3ZWXA 4O0LA 2UAGA 4CLXA 3VVCA 3INRA 2D0IA 3DHEA 3FD8A 4WEOA 1P31A 3WJ7A 2GN8A 3PQEA 4XQGA 3TWOA 5I8ZA 5TNXA 1I5RA 1N9GA 1PJTA 2BD0A 2OL4A 1XCBA 3JQ9A 1PS8A 1D8AA 2HJRA 4OO3A 4QFDA 2QRKA 3DO5A 3OEYA 1VJ0A 5MDHA 4XR9A 3A28A 3DQPA 3T4EA 4E5MA 4MKRA 1QLJA 3SVTA 3Q2IA 1LC0A 3TQHA 2VYVA 2ZCUA 4NU6A 1EVJA 4MDHA 4PLYA 1H2BA 4FCCA 1I3LA 1KOLA 3U4HA 2POQX 5G0WA 1TVEA 1Y7TA 1LDBA 3LVFO 2Q45A 4MINA 4OSOA 1P1IA 1DRVA 3UOGA 3ROKA 4ALLA 4N5MA 4CM1A 2FR1A 3PJGA 3OQBA 1GEEA 1GR0A 3ABIA 2AG5A 4UEKA 4EJMA 1E7MA 1WAMA 2RAFA 5A04A 3ORFA 3KEQA 1B16A 1VRWA 3S2GA 2ZYAA 3PRJA 4AJLA 3RU7A 5KCZA 4Q3NA 3DFZA 2B5VA 4XD2A 3Q11A 1C3VA 4D3DA 3OF2A 1E3JA 4D0RA 3M2PA 4B4UA 3SJ7A 1E3WA 4FFLA 3O03A 4R68A 3ZNNA 2P9CA 4OXNA 4J4BA 4L75A 3JCZA 1HYEA 3PZBA 4IMPA 3VAZA 3EHEA 4TROA 3RD5A 4J90A 3WQQA 2VWPA 2NUAA 1O94A 1VL8A 1UP7A 5H83A 1R4NB 2DBRA 3ONEA 2DQ4A 2WTBA 3WSWA 1AHHA 4K28A 1E6UA 2VWHA 4HFJA 4CL3A 5T8KA 2VTDA 4W9NA 5DCUA 3JD2A 3RFTA 3BZUA 3DXFA 4CQMB 2IE0A 1KBZA 4N54A 1H6CA 3ITDA 2AEJA 1JAXA 3Q9UA 1BVRA 2WE7A 3O9ZA 3NKLA 2C07A 3FBTA 1PTJA 4CM4B 3PHJA 1XWFA 4GI2A 1KC3A 1V3UA 4DA9A 1GDHA 4TKLA 4QUKA 1E92A 4XKJA 1HETA 4IQ0A 2X9VA 3GDFA 4UEJA 3MOIA 3FCOA 2PGLA 5DZSA 1XEAA 4P22A 3VKUA 2VOJA 3KYCB 2FZWA 2X0NA 2VN8A 2O2YA 2Q4EA 4QTZA 3E82A 1T1RA 3F1LA 5KOIA 1K6IA 2HK9A 3C7CB 4JXKA 3ASVA 3BMCB 4IQ8A 4RZIA 2OBYA 3WR5A 3UXYA 4BB6A 4HY3A 4CLOA 5L95A 3NYWA 4II3A 3OA0A 3PWSA 4HXYA 4OOEA 4QXMA 3NUGA 5TQVA 4KUGA 3UCEA 1NQAO 2QRLA 4TZKA 1EE9A 1W8DA 2V65A 4BQRA 4DLLA 5BQFA 5JS6A 5IFLA 1ADGA 4TRRA 4BHTA 1FMCA 4IUYA 1LLQA 4B7UA 4J7CA 4JROA 2WJPA 4PLPA 1TT5A 3WBBA 3DBRA 3GVXA 2J3HA 3RUFA 4DMMA 1CQJA 1ONOA 4JJGA 1BW9B 3P19A 5CPBA 4L74A 2I67A 3C8MA 4GVXA 1ZSYA 4PLHA 4EYEA 4OQZA 3WLEA 3OJOA 3RAJA 2C5EA 4BO3A 2HRZA 1LUAA 1U28A 5EL0A 4YRAA 3DTTA 3RCBA 3FRJA 4CLHA 2UDPA 4M89A 1MP0A 4Z9FA 4BIIA 3ROPA 1U5CA 4BOYA 1NYTA 4ND3A 2O2SA 4JN6B 1BW9A 1MC4A 1OC4A 3JYLA 3UHAA 3AOEA 1CJCA 3PLRA 1ONPA 2HO5A 2D5CA 4L9RA 3ZWYA 4NJMB 4E30A 5JC8A 4IGFA 4YXFA 2C7VA 2PKQO 1P1RA 4Y6RA 5A5EA 3CXRA 3D64A 5C7IO 3WFIA 4A5OA 3PGJA 2BF7A 4ND4A 1UP4A 4CLDA 2HJSA 3RUIA 1ZZEA 5DNAA 1WDLA 2NVWA 2VNSA 4D41A 4OJNA 3UW3A 1BRMA 4JNKA 3PZRA 3WGZA 1Q0HA 4YJDA 3LSYA 5COQA 4F45A 2EKLA 4F46A 2CVOA 1PGNA 1TEHA 4UAGA 2Q99A 1EFLA 5JCXA 1LSJA 1NHWA 2WM3A 4CQLB 3MCVA 3WMWA 3ZW9A 4MVJM 4NIMA 5ADHA 2YY7A 2WYWA 4IIUA 1NNUA 1P0CA 2G1UA 3OH8A 1JQBA 3KETA 1OFGA 3GNTA 8LDHA 3PI7A 3H8VA 3W4IA 4CL8A 3QA9A 4EGFA 3KYDB 3NDJA 5GMOA 3I9MA 1MA0A 3TZCA 1EQUA 1D4FA 3NJ8A 3WMXA 1QYVA 3DZJA 3JQGA 5JC1A 2Z95A 2F1KA 3GZ4A 3WIEA 3GNQA 4DBVO 3U4DA 1AHIA 3FPCA 1V0JA 1HLDA 1RWBA 3QLJA 3VZRA 4FFOA 3GDGA 4P4LA 5I7FA 3TOZA 3TRIA 4YQYA 4WOJA 3C24A 1Y8RA 1NHGA 1QV7A 4OSPA 2ET6A 2PKQP 2WE8A 4P8RA 2ILTA 3RBZA 5HWSA 4AJNA 3JQEA 4IDBA 1MXFA 1GL3A 2JD1A 3Q3CA 4NNJA 1ADBA 5L7TA 1JLLA 4DQXA 3OIFA 4J49A 2CUKA 3AJRA 4TRNA 4YAGA 1AXGA 1F0YA 1C0IA 3IJPA 5JYDA 5ER9A 3DBHB 2YZ7A 1E3WB 2HLPA 3EZLA 2PTGA 4YRDA 3VPFA 4D44A 3CINA 4B3HA 1F14A 2YHIA 3CMCO 1T2CA 1UXGA 2NWQA 1WZEA 3UCFA 3GN2A 5A02A 2FY8A 2GZ2A 2ZIZA 4CLRB 3GK3A 1P44A 3GG2A 1DC3A 2Z1NA 4B3JA 3EAGA 3W8DA 4XYLA 1YXMA 2P9GA 3IMFA 1QKIA 2B69A 2YV2A 1OZAA 2AEFA 4IDFA 3N74A 1U3WA 2DUUA 3PYMA 4FFMA 4S1VA 5LDGA 4PLCA 4BKRA 4E4YA 3I4CA 3QHAA 3G1TA 5LC1A 2HK8A 3MZ0A 2HMSA 4RVGA 5IF3A 2YFQA 3E8XA 2Q2QA 2O3TA 1O5IA 3W8FA 3H5RA 2NM0A 1LSUA 4M49A 4PG4A 2RCYA 2P91A 3WQRA 1I36A 3JQDA 2UVDA 5I7EA 1D7OA 1H0KA 3FPLA 4MIEA 5AXDA 1EQ2A 1UXKA 5FF9A 3TJRA 1A9YA 1H94A 4JP3A 2NTVA 1A71A 4YJFB 3EGOA 1UXIA 2IXAA 2Z1MA 1T4DA 2E6UX 4XWYA 1DRWA 3IJRA 1D1TA 2X86A 5K6AA 3DAGA 1DHRA 3BHMA 3EY4A 1YVEI 1LDNA 2IYPA 4RLSA 2ZB3A 5L4SA 4IQGA 1Q7GA 1LBEA 4DQUA 1PQUA 3GUCA 3JD3A 4GPD1 3OBBA 1Q1NA 3EYWA 5TRTA 1NPYA 1RYDA 3ZCXA 3ZWCA 5AQ1A 3G0OA 4CM7A 1NX6A 3HDHA 2IZ1A 1GQ2A 3KB6A 3SJUA 2PH5A 4OKNA 5TT0A 1NFFA 4BNVA 2CMDA 3GNSA 3QSGA 3GA0A 4CMCA 3G3EA 2G76A 3GF4A 3DB2A 3QWAA 4GGOA 2O50A 1MV8A 5TIIA 3LLVA 4D42A 3GY0A 3FHLA 2VT2A 3MJVA 5U1PA 3ZV3A 4J1SA 4YA6A 4ZD6A 3A1NA 4FPXA 2ZTUA 2WYUA 3ZWPA 2GERA 1OI7A 4M87A 3HB4X 1FDVA 1N2SA 1WPQA 2QYSA 4XRRA 3H9QA 4D7AA 2BLLA 5IXYA 5KWEA 1DFIA 3JD1A 3WTCA 1X1EA 2PFGA 3ETDA 1KY5A 4CV3A 2Y99A 2G5CA 3LU1A 2JAPA 4WEQA 3C1AA 4ZHSA 4X54A 4B3IA 4YJGB 1VI2A 1VSVA 3BA1A 4RQTA 2AQ8A 1AXEA 1FK8A 3U9LA 1ISIA 3JYOA 3ETEA 2DC1A 1EK5A 2YV3A 1FF9A 1KC1A 3K5PA 3QVXA 3PDJA 1PZHA 4D0SA 2X23A 2GPTA 3S2EA 3V2UA 1B8PA 2YFHA 1DRUA 5DULA 1LA2A 1UUFA 4J7XA 3GC6A 1EK6A 3ZHXA 1NAIA 1K5HA 3JQGB 3M2TA 2YQ4A 3TF5A 4BO0A 4NFYA 4XQ9A 4OGWA 3E48A 1KY4A 1HDYA 1N8KA 4R5HA 4B8ZA 3DBVO 4BO8A 3AU9A 1Z75A 4FOSA 4Q39A 1EDOA 3VKVA 3C85A 4CMBA 1PR9A 3JQAD 3MJ4A 1YJQA 4P38A 3RUDA 2NQ8A 2JFHA 3K2EA 4KMSA 2PKRA 4GGPA 5F1OA 5B4TA 1RM4A 2DKNA 5ILGA 1E7WA 1TT5B 3BMOA 4BGVA 3Q1LA 3VH2A 3BMNB 5JDIC 1HDXA 3WXBA 3G79A 4Z9YA 4FB5A 4WECA 3JYQA 4GWKA 1ZEMA 4MKZA 4ALNA 9LDTA 1IHXA 1XIVA 4O59O 1PGPA 2OHXA 4BGIA 3U3XA 2FHSA 3F4BA 3N7UA 3INGA 4M55A 5KKCA 3LC2O 4RL6A 3BMNA 4XA8A 3O38A 2ZTVA 3D4NA 2E4AA 4BB5A 4NPCA 3LT1A 2DVMA 3K8ZA 3GGPA 3NT2A 1C14A 1ZIDA 4F6LA 5JAMA 2QZZA 3KYCA 4MVJG 1VKOA 5IDWA 3WYBA 3PYLA 2NU7A 3JQ6A 1E5QA 1K6JA 2F00A 2EJVA 4O63O 3JSAA 2VRBA 4OXKA 4A10A 1R0SA 4MIYA 4M86A 2DTXA 1A4UA 2SCUA 3OQ6A 3QVTA 4MVJD 8ADHA 4YACA 1M76A 2X5KO 3ROMA 2VHXA 1NXQA 4NHEA 3GHHA 2D2IA 5CG2A 3RVDA 4PLGA 3D0OA 1E7RA 1A72A 1B15A 4XB2A 2X0IA 4I5FA 1O95A 5THKA 1DDOA 4UVEA 1T4BA 2CZCA 1B3BA 5DOVA 4NFHA 4G81A 3NDRA 5CG1A 4BL5A 4GSKA 5L3ZA 5DP1A 4QX6A 2BFAA 2IZ0A 1GFSA 4RDHA 5BNIA 4BO5A 4OH1A 2HRBA 2OORA 4BGUA 1JWBB 2O23A 1YL6A 2WD7A 1C1DB 2CVQA 4I9UA 4I5GA 3H3JA 3AY3A 2RHCA 2IYOA 4ALKA 3BYZA 2YDYA 2NQTA 3LZ6A 4XRGA 1WP4A 1ZUD1 2HMWA 5BNFA 1PJQA 2B83A 3WTBA 4FFNA 5DF1A 4PVDA 1LI4A 3U4IA 4A0SA 3KM0A 3HN2A 4W7HA 1PJLA 3I4FA 3U5TA 1C0KA 1GADO 3RFVA 3C3XA 1PJ3A 2DAPA 2FSVA 4J7UA 1I32A 4A03A 1DBVO 1TT7A 1X15A 3AM3A 3TFQA 4CV1A 5A9SB 1P77A 4AFNA 3PHHA 5TJ9A 5IZCC 1K89A 5A9SA 4FBGA 2GSDA 1MFZA 3BAZA 3PK0A 4J0EA 1PJ4A 1P3DA 4UUMA 1L1FA 2IDZA 5KJEA 5KVVA 2B35A 4Y6SA 3PFFA 4NBTA 3R1IA 1SC6A 4IIVA 3VTFA 1YL5A 1PS0A 3DTYA 3V1TC 1G1AA 1MC5A 2X22A 1VL6A 3UUWA 4XYEA 1J4AA 4EBFA 3L6OO 4E2WA 4L0QA 5G0TA 4QT0A 2BFMA 2A4KA 3RC1A 4UREA 3VZPA 3WWYA 1A7AA 1I24A 2AE1A 4BS9A 3K2BA 1FDTA 1YONA 3HE3A 3VH3A 5JYEA 2HUNA 2AQIA 2X4GA 3KBOA 1ZK3A 3RUCA 5F3RA 2EGGA 1Y5RA 2YYYA 4YTEA 4CPDA 4IZHA 3OM9A 5I8WA 4PG8A 1ZSVA 1LLUA 1GEGA 1NASA 4WLOA 1JA9A 4EEZA 5C37A 4ID9A 4ZGWA 1IL0A 4XB1A 4RO0A 5IZCA 4U7WA 5AVOA 2E48A 1XSEA 4WCFA 4RORA 4BO6A 5BSEA 1IULA 1GUZA 1NR1A 2YJZA 4Z6KA 3M1AA 3UF0A 1CIVA 2V6FA 1H5QA 2EG9A 1K0UA 3IC5A 3QVSA 1PQWA 4GLLA 5KVSA 4RPLA 5EPOA 1X7GA 3TDKA 3G1UA 2VYND 3KZVA 1ZKMA 3IDSA 2O3QA 5EN4A 5JMWA 4KQWA 5BSFA 4EI2A 2ZB7A 3DR3A 3H7AA 4FR5A 3CPSA 2XF8A 1U3UA 5L7YA 5L4NA 2OZPA 1X0VA 3F4LA 2BGKA 3GVPA 1V3TA 2ZQZA 6ADHA 4XDYA 1YBVA 3D3WB 4OKIA 5F5NA 1R4MB 3EUWA 3TNLA 1B7GO 2J8ZA 3D3WA 1QYDA 1GV0A 4ALJA 4J1QA 4E21A 4XZ3A 1DXYA 1ENOA 3MEQA 3DBLA 3K30A 4BNUA 1YDWA 3KSUA 4N7RA 3CIFA 4R1SA 4ZQGA 2X5JO 2OBNA 4W6ZA 2D5AA 1ONNA 1SMKA 2P68A 3MJCA 3NGLA 1BTOA 4FQ8A 4YJHA 4KOAA 4DGSA 2OO5A 1PIWA 4PG7A 3PHIA 5GZ1A 3AI3A 3WJAA 4I5DA 4IM7A 3O8QB 4WLNA 3TSCA 4YAEA 4BO4A 3VPXA 1EDZA 3GDOA 4K9DA 1LDMA 1B2LA 1HDGO 3GRPA 4IPTA 2C2YA 2Q2WA 3RIHA 5CAEA 5A03A 3W4JA 3CZRA 3JQAB 3OETA 2TMGA 4LSMA 4BMNA 4R9RA 4W82A 1IZ0A 4R5MA 2FPPA 3WGTA 4GSLA 4JCOA 1HDCA 3WB9A 2ZKLA 1BGVA 1U2DA 3H9GA 5JFOA 1XDWA 3UH1A 4RQUA 4Q3DA 3DL2A 3GAFA 3BTSA 3JV7A 4NK4A 2ZCVA 3D4OA 3HG7A 3KOUA 4RDIA 3ZN2A 1HF3A 3BTOA 4TVOA 2B4RO 5AXCA 2AHRA 3ST7A 3CSDA 3ZNQA 5I9LA 1ZNQO 3GMDA 1B0AA 5IDYA 1NVMB 1RYEA 3WYCA 1QRRA 1XG5A 2BRUA 3F6YA 3CE6A 3H9UA 1KETA 3ICPA 1ZH8A 1CWUA 3ZZNA 3L6DA 2JHGA 5JDCA 1QYCA 4I8XA 4P4NA 4ZQHA 1LEHA 2EGHA 2P5YA 1I2CA 2BMAA 4LCJA 4BNWA 3W8EA 1GYQA 5CDTA 3K73O 3PIIA 4YAKA 1BHSA 1YJ8A 4IY1A 1GZ6A 3QIVA 4ND2A 1EZ4A 4OHUA 3DDNA 1ZSNA 2W2LD 1E7SA 2Z5LA 3WSVA 1XHLA 4MVJA 3AOEC 3DEYX 2LDBA 3AUAA 3H2SA 4PVCA 5LCXA 4E6PA 3KRTA 4BNFA 1I3NA 2NVUB 1JVBA 2FMUA 2GASA 3SC6A 3ZWAA 3PWZA 4I08A 3ZHBA 2PNFA 1U8XX 3KSDO 2VT3A 4BNMA 5T8KC 3PQDA 4UVGA 1HXHA 2B4TO 3GH3A 4PFJA 4RVHA 1HYGA 3G17A 3E9NA 3GUYA 4FIZA 3OEWA 4B4VA 2AEMA 4A26A 4E32A 1E77A 1DLIA 1G0OA 1P0FA 4R9SA 4BMVA 3UKOA 3WX0A 3GN1A 4PZCA 4Y98A 4PIVA 3LYLA 1SZJG 1BXGB 4RPJA 1XELA 4WCFC 1JAYA 1U3VA 3HFSA 3HWRA 4KP7A 4NK5A 4BKQA 4BMSA 3PXXA 3FWZA 3PPIA 4YEDA 1H6AA 4RVSA 1UDBA 3I23A 4CMEA 1KS9A 4TWRA 2VOEA 4ZQBA 1VSUA 4O1MA 4DRYA 1ML3A 3DHYA 4R3NA 3NAQA 1Y5MA 4CM8A 3W6ZA 3WGGA 4WLUA 4TRJA 1N5DA 1RM0A 4YDRA 3LT2A 5L45A 4E0BA 3TZKA 1FDWA 1EUCA 4GQAA 5ENVA 5JAZA 3GAZA 3IIEA 2JCVA 4J91A 1I0ZA 4WUVA 1YB1A 3AY6A 3IS3A 3MJSA 4G65A 1QG6A 3I83A 2NVBA 4IXTA 3ICCA 3V1UA 4ZU3A 4F6CA 2O4UX 4HV4A 4A2CA 4CMKA 1M6WA 1VJTA 4NDNE 1B8VA 5GZ3A 1GPDG 4MP6A 5DCWA 4XIJA 2CSUA 1JN0A 4PRLA 2HMUA 5DBFA 4XCVA 3WG9A 4ZRNA 2PWZA 4AJ4A 4DREA 5CPFA 2HCTA 2I6TA 3L9XA 1X13A 1LLCA 4AJKA 3GOHA 2FR0A 5FEUA 3AI1A 3AK4A 2O4CA 3DOCA 1SOWA 5A9TA 4CMAA 4ND5A 3FF4A 1YQXA 4E5NA 1YGYA 2CDAA 3RUEA 2H1SA 4ONEA 3UICA 2VZ8A 3L4SO 1UDAA 4L76A 1F8GA 3ANLA 2AQKA 4YJGA 3JQ7B 4IDCA 4KUHA 4Y6PA 3L07A 4H7PA 2GGSA 3QWIA 1NQOA 3FR7A 2I5PO 4FJ1A 5EERA 1D3AA 1NFRA 2X9GA 4BNLA 3RASA 1GPJA 4JBGA 1QV6A 3H6KA 1U7TA 1N1EA 2QYTA 5G4KB 1VLLA 2CFCA 4HFNA 1GYRA 1YRLA 3U09A 3HFGA 4AL4A 4J43A 4MOWA 1A7KA 1U7HA 4TZTA 5C7OO 1W6UA 1HLPA 3DZKA 4R54A 4K1LA 5KJ6A 3D5QA 1PSDA 1Q2XA 4GLOA 1P1KA 4B7CA 1W0CA 1LRLA 5TT1A 2NTJA 2EWMA 3PJDA 5JSFA 4J3FA 2Y1GA 5EQDA 2DPGA 2JHFA 3HNPA 2YUTA 3KEOA 4DYVA 1LX6A 1U5AA 5F1KA 4E5YA 5KVQA 1PGQA 1DIHA 3S2FA 4XGKA 1HZJA 5A4DA 3AUUA 3AY7A 3RFXA 3PHLA 2XXJA 1UZLA 4HP8A 4J4HA 1A9ZA 3KV3O 4MIOA 4NH4A 2DM6A 4FFRA 3FWNA 3GEDA 1K6XA 2ZK7A 4LRTB 3RWBA 2J3JA 3AW9A 3U0BA 4ZRMA 3OICA 1MB4A 4W9NC 2P4HX 2AA3A 5T5QA 4EZBA 3AUTA 2EXXA 5TGDA 4AJHA 3DOJA 4LVUA 3PGXA 5H81A 3VPGA 3QWFA 4INAA 5A9RA 3SLGA 4BKUA 2A35A 1M75A 2CY0A 1PJCA 4C7JA 3I9JA 3MJEA 3PLNA 4Q3EA 4WJZA 4FS3A 4M54A 4EUHA 3ON5A 4CMIA 5IN5A 1LLDA 1M2WA 2JD0A 1WZIA 2GN6A 5TJHA 3QE3A 3P5SA 5IXSA 1EBUA 2HAEA 2X5OA 5CFZA 3M1LA 2Y66A 4E2XA 3WNVA 4H15A 2ZTLA 3ULKA 4R1NA 4XQEA 4KUEA 2Y1DA 4K26A 4B8WA 1ARZA 3ENNA 1Y6JA 3R6DA 2HQ1A 3JQBA 1Y1PA 3D1LA 4OL9A 3ZU3A 4FJ2A 3LDHA 1YS4A 1ISJA 2LDXA 3FR8A 1UP6A 4AJ1A 4GX0A 4W99A 2D3TA 1O6ZA 5A3VA 3SC4A 4RPKA 5JDCC 5G4KA 2PZMA 3MTJA 3ZHYA 4XDZA 3P2YA 1B8UA 4FC6A 4TRMA 4B4WA 2G17A 4BNTA 2GN4A 1DJNA 1AN9A 1ZBQA 1YB5A 1NWHA 2GN9A 5ER6A 2GZ3A 3WICA 1ZFNA 2YHIB 4CLEA 2R6JA 4IS2A 2HU2A 3VC7A 4WNCA 1HE2A 2NV6A 2PGDA 3WBFA 1JKFA 3ADOA 2VWQA 4F3YA 1UAYA 1T25A 3GT0A 4P4GA 1JKJA 2J5QA 1E6EA 1T26A 4LMPA 2IXBA 5IN4A 4E2YA 1R16A 4HADA 3ZNPA 1HE5A 4YB8A 5T67A 4L4RA 2GDZA 2A92A 5COAA 4YAJA 4Q3BA 3FTNA 4XQCA 2AG8A 3UAGA 1YQGA 2BGLA 4E5KA 3WNQA 1YB4A 2PD3A 2CDBA 2NTNA 2HDHA 4MP3A 1YKFA 3COSA 2OGUA 2UUOA 4HKTA 4IINA 3HADA 3P7MA 2JCXA 5CP8A 4EDFA 3EVTA 5FI5A 2P9EA 2NU8A 5IDQA 1SOVA 4ALIA 3I9LA 3NV9A 1R6DA 3ITKA 1P1FA 4NBVA 1ENZA 1W73A 5AOVA 2HK7A 5HA5A 3GGOA 4J6FA 1I2BA 4R4JA 2XOXA 2I76A 1LNQA 4PGFA 3E5RA 4U0KA 1V3VA 3OHSX 3D5TA 3EVNA 2NU9A 4RPHA 2P5UA 4BNIA 1IZ9A 4G2NA 3ZV5A 2BHLA 2WEKA 5G0VA 5LDHA 2B37A 5TS3A 2WSBA 4YPOA 1YOVB 3ZWVA 5L51A 1CRWG 3GPDG 1ID1A 3TL2A 3GR6A 4DLBA 4OXYA 4KWIA 2W98A 2AW5A 2PR2A 3L6EA 1CYDA 3GLQA 2NADA 3MWDB 3I6QA 1Y8QB 1WDKA 5JNLA 1H9AA 4YCAA 3VVBA 4DTIA 2GO1A 1E3LA 3LF2A 1DIAA 4PZDA 4L73A 3TPCA 4MO2A 3E5MA 2Y68A 4CUKA 2PY6A 4RV9A 3V8BA 3AM5A 4JX8A 4XGNA 2QQ5A 3C7DB 2V6BA 2DBZA 2J5RA 4IZIA 3SX2A 1DHTA 3I1JA 4DPKA 1DC6A 3BMQB 1ZK4A 2HSDA 3U62A 3SXPA 2D1YA 2I9PA 4AG3A 1CETA 3A14A 1HSZA 4PLWA 5JAQA 3Q9NA 4FOOA 2X7HA 5EMHA 2O3UA 3DBHA 5IJZA 1UXJA 2AE2A 3ZU2A 3SEFA 4GX5A 4IDAA 4YT8A 3PVZA 3NJ4A 5BNTA 3BMOB 3K9QO 3Q0EA 3PJFA 4M1QA 2NNLD 1BWSA 5JE8A 4ZQFA 1ZK2A 2J6IA 4JP2A 2VYVD 4OYRA 1C1XA 4BNYA 2C29D 1NVGA 4J2OA 4IDDA 2OXIA 4AJJA 4D79A 2Q1TA 3JTMA 3V1YA 4ZICA 2ZYDA 4J9UE 3ANMA 1O0SA 4DC1A 1ZJYA 4DVJA 4ZJUA 4R16A 2JL1A 1VC2A 4AJPA 1ZO8A 4Z3KA 2X0RA 1X1TA 3D3EA 2C2XA 4QQRA 3V2GA 4LGVA 1B3RA 1TA4A 2C7GA 5DN9A 1MX3A 4NR0A 3PIDA 5JBIA 4GBJA 1ENPA 2YQ5A 5CEFA 3UVEA 1PX0A 4E12A 2VCYA 3FSRA 4BNJA 1Z82A 3O4RA 3LF1A 3PQFA 3U49A 2E82A 1FDUA 5KIAA 2QG4A 1LJ8A 5CDUA 4II2A 4C7KA 1IUKA 1B14A 4YWJA 1SEPA 2TMDA 4BO2A 3T7EA 1ENYA 1GYPA 1RKXA 3OMLA 5C7LO 3O8QA 9LDBA 1JWAB 4L8VA 4BNHA 4CR6A 1AGNA 4IBOA 1CERA 1ISFA 1OOEA 1L7EA 2EJWA 3NEPX 3KYDA 3AI2A 2FZEA 1DFGA 1PWXA 1BDMA 1R12A 1DSSG 2VWGA 3B70A 1PZEA 3I3OA 1UZMA 1SBYA 4A27A 5L53A 3WWZA 4JBIA 1Z7EA 4N5NA 3D4PA 1C0LA 1R4NA 3TOXA 1CEQA 4PLFA 3WQSB 2EW8A 1W4ZA 1NM5A 3H65A 5B12A 2BGMA 4RF3A 1ZK0A 2DTDA 5DOZA 3GEMA 1F8FA 3GVIA 4NJOA 5B4UA 3LQFA 5K9ZA 3OJLA 1NVTA 4AJIA 4CM3A 2Y0EA 3DFUA 3EMKA 1I30A 4QO7A 2I3GA 3IKVA 3U4CA 3RUHA 4K6CA 4ZA2A 3PFWO 3H4VA 4A73A 1M6HA 4EUEA 4JQCA 1PEDA 4J0FA 5U4QA 5BT9A 2BELA 4CQMA 1UZNA 1DFHA 1LSSA 2I66A 1Q7BA 4OAQA 1DB3A 2W90A 2X1HA 3BHIA 3EDMA 1GZ4A 4AJEA 1XLTA 3JQ8B 4OQYA 1X14A 3X2FA 3I9NA 1TB4A 3HN7A 5HM8A 3QVWA 1ISGA 1LTHR 4Z3DA 3B1KA 1GU7A 1YE3A 3GQVA 2I3AA 4ALMA 1JW9B 3F9IA 3UN1A 1ISMA 1FDSA 1XU9A 2VZ9A 4GKBA 4XYMA 3VDRA 4KWHA 2RH8A 4KTTE 3ZNOA 4PZEA 1T2FA 4LSWA 5TX7A 4MPDA 5HS6A 4WASA 1D1SA 3RC9A 4HX5A 2FP4A 1KVUA 3D7LA 1E7QA 2FPIA 4ROSA 4ND1A 1J5PA 4RF2A 3ZGYA 2GF2A 3DMYA 3R3SA 2YHUA 1M66A 3MOGA 2WD7B 3H3FA 3H5AA 1HZZA 4UVIA 3BTVA 3AUSA 3PJEA 4FFPA 4FW8A 2PD4A 5CDYA 1HWYA 2DPHA 1OC2A 4KQXA 2V6MA 3PHGA 4HNGA 4S3MA 4U0JA 3WGHA 1RPNA 3L0DA 4NU5A 3GPIA 5DCYA 4AICA 1BSVA 3FNFA 3I5MA 1PS9A 1OAAA 3DWFA 1R15A 3WFJA 5JDIA 1HYHA 1R37A 5COBA 2NLOA 1Z74A 2B4QA 5KNLA 4CMHA 1QLHA 1MGOA 5F5LA 1U3TA 3L4BA 3NTRA 3FBGA 1GD1O 3F1KA 4BUCA 2PA3A 1B26A 3A4VA 4CLRA 4WLFA 3JD0A 3F46A 3WLFA 3JQBC 3IP1A 4DQVA 5KJ1A 2IODA 2VZ0A 3JQ7A 3TZQA 3E6AA 4U5QA 5IG2A 3PYXA 3IUPA 4MVJP 4XIYA 3EW7A 1IE3A 1OBFO 4CMEC 1WNTA 3OQ1A 3WGQA 2CF6A 5TSDA 3H5NA 1F17A 1TXGA 1PZFA 4HBGA 4ZQEA 1X0XA 1Z6ZA 2IZZA 2W2KA 3TFOA 1QXSA 1J6UA 2EKQA 1H6BA 1BG6A 4DIBA 3MTGA 4KTVE 4DC0A 3QWHA 2A94A 3UCXA 4LW8A 3VDQA 3DZHA 1XQ6A 4D3SA 5EESA 3C1OA 1XYGA 4LN1A 1E3IA 1T2EA 1GZ3A 1Q0QA 1T2AA 1GY8A 2DFVA 3AU8A 2AMFA 2VHVA 3S55A 3E9QA 3W6UA 2BFOA 4XEHA 1QSGA 2BI8A 3GRKA 2BFPA 4QFCA 4G5HA 1WW8A 3HZZA 2FRDA 1VL0A 4R1UA 1EFKA 1EVYA 5ICSA 4WNIA 2W8ZA 2R00C 1V35A 1CDOA 1ISHA 4D43A 2HKIA 3NGXA 1M67A 1E1NA 1T24A 2EF1A 4WPGA 4J16A 2Y1EA 4HWKA 2B0JA 4R51A 5ILOA 1LXCA 1UXHA 2B5WA 5JCJA 5THQA 2Y1CA 4EJ6A 2FWMX 4JGBA 3VOSA 1LDGA 4ZVVA 1GUFA 4RVUA 4B7XA 1IYZA 1O9BA 1QP8A 3JQ8A 2O3JA 1IPEA 4PCVA 4BQPA 3ANNA 3ZH2A 4AJOA 1HE4A 2PD6A 3R3JA 1LRJA 3QP9A 3RC2A 3RI3A 2V7PA 4FGSA 4RGBA 2OUIA 1C0PA 3MJTA 1EUZA 1SNYA 1KVTA 4LK3A 2Q50A 5ES3A 2G0TA 4DWVA 1PQPA 2ZATA 5JAIA 3FN4A 2GYYA 3JQFC 2EERA 3FI9A 1C1XB 3BIOA 1GAEO 4M8SA 4URFA 1YBAA 1ZJZA 4XGIA 4AJ2A 4W7IA 3VTZA 2V6GA 3ZHZA 3OECA 5DT9A 2WDZA 5U9CA 3QV1A 2JFGA 1U4SA 4DYDA 3CUKA 1SEVA 1H9BA 1TLTA 1JKIA 2CNBA 2OOSA 3PDUA 4GKVA 2I65A 1XKQA 1ZK1A 3GFGA 4I5EA 4CLOB 2H5LA 2RHRA 2WWRA 1VE9A 1DIBA 5HS4A 3B1JA 1LSOA 5DBGA 5KKAA 1P74A 1XA0A 2EEZA 4BNKA 4XJSA 2UUPA 3C1TA 3A9WA 1S6YA 1E3SA 1AE1A 4BVAA 1V6AA 3ONDA 1E0DA 3KSZO 1S7CA 2AXQA 4JLWA 4E5PA 5KVCA 2O3RA 1N7GA 2XAAA 2Y05A 2J3IA 2FPGA 4RZHA 4YQZA 4B79A 3RUAA 4DBZA 3V5NA 4E3ZA 4W4TA 4NBWA 1N92A 3K6JA 2PZKA 4IDGA 1WVGA 3L4BC 3EC7A 4WGGA 2H9IA 4LVCA 3QQPA 3DMTA 3FNHA 2Y67A 1R0KA 4OIMA 1XU7A 3IUSA 3CZMA 4DIOA 2RIRA 1T1SA 1FJHA 1G0NA 2O48X 5T6BA 3TL3A 3OSUA 1X7HA 4N18A 4Z0PA 1P33A 2DLDA 4CM4A 4YT2A 2YDXA 3E18A 3WDSA 2ZJ1A 3HDQA 1JTVA 2AQHA 3TZ6A 3L77A 3ONFA 2EV9A 4HNHA 3RBXA 5EIOA 4U8GA 1EE2A 1A27A 1DOHA 4DL9A 1K2WA 5C3MA 1KERA 2C82A 1SCUA 4DXHA 1MLDA 2XXBA 3FNEA 2J5KA 4RJTA 4PLVA 4WK6A 1YO6A 2P4QA 3ZWMA 1I2ZA 1P45A 4PLTA 4CODB 1QORA 1WLYA 5K0ZA 4NQZA 1RM3A 4OOFA 1GV1A 5B1YA 1WDMA 1E5LA 1X7DA 3AFNA 2WMDA 2FSSA 2ZB4A 5TC4A 1J0XO 5BSHA 3E9MA 5H82A 4GL4A 5G2OA 4C4OA 3IP3A 2BKAA 4BNGA 1MXHA 1EUDA 3DHNA 1RM5A 5JPIA 2IEDA 5HTOA 1A5ZA 1YWGO 1LU9A 1MG5A 2PLAA 3NX4A 4RF4A 5GZ6A 5JO9A 1DO8A 1P1JA 1PGOA 2VTEA 1A4IA 4BO1A 2VYNA 1UJMA 4IDEA 1H6DA 4FSHA 3DC2A 4Z0HO 2X8LA 1Q7CA 1MG0A 2UV8A 4UUNA 3KXDA 4NFSA 3RC7A 2EHDA 5IAAA 1UR5A 1ULUA 2QZ9A 1N9GB 4MVJH 4JIGA 2EP5A 1UDCA 4ZN6A 3RSHA 2P2SA 1ZEJA 5G4LA 5B37A 1ZXBA 5I9NA 5A06A 3HSKA 4LMRA 3DZFA 1I10A 1BXZA 2DT5A 3F5QA 4CM8B 3KLPX 3PTZA 5EINA 3RBVA 4BV9A 2VQ3A 2QW8A 4WOKA 1XQ1A 3S1LA 3TN7A 2XPCA 4IGEA 2Q49A 3FNGA 4GAEA 1EBFA 1NPTO 1PU2A 4JK3A 2QX7A 1WMAA 4PN3A 4FDAA 1LDEA 3GVHA 1LDYA 3W4KA 4IJKA 2Q4BA 1LQTA 5GY7A 3WGOA 3QY9A 1BDBA 1O89A 3VZQA 3GEGA 4ILKA 2GNAA 3ASUA 1VPDA 5AYVA 4I1IA 4RVFA 3OJFA 3LT0A 4KDFA 2A9FA 3CMMA 1I3MA 1PGJA 1DAOA 4MJLA 1U8FO 2WYVA 2GD1O 4L4SA 2RH4A 5KTKA 3PEFA 5HRUA 4OMUA 5HBRA 5I7SA 2VRCD 4FC7A 4D45A 2B36A 4B4OA 3BXXA 3WGIA 4OM8A 3UGKA 4CR7A 4FJ0A 4CV0A 1E7YA 2E37A 3ZWNA 2BI7A 3IKTA 5JY6A 1E3EA 4DPLA 1N7HA 4J1NA 2QIOA 3OA2A 4J2HA 4UVDA 4CQLA 3F47A 5CEJA 5ITVA 4ITUA 1DC5A 2UYYA 4QO8A 3WIDA 1C1DA 1GCOA 3AWDA 1DIRA 1O8CA 1U1IA 2PK3A 5CDGA 3RQSA 3B1FA 2BH9A 3S8MA 4WKGA 5A5FA 1NFQA 4IJVA 1YH3A 3FTPA 5JXWA 5ENDA 2D59A 2OP0A 2W2LA 3HHPA 2J3KA 2DUWA 3GZNB 4WLVA 1QR6A 4QSMA 1PWZA 1MUUA 2EW2A 3VHRA 3GMSA 1HRDA 3EK2A 4BV8A 2NACA 3OJ0A 4D3FA 1NR7A 3JQFA 3I9OA 4NBRA 2C59A 1ADFA 5JW6A 2H6EA 5CHEA 2JFFA 4I9NA 2VHYA 4HUJA 3RROA 4PG5A 4UULA 3ENKA 3ZWBA 4RLHA 3RKRA 4EITA 1NP3A 3NRCA 3GG9A 4IJWA 4RPGA 2X0JA 2DFDA 1J49A 4HFMA 4UUPA 4JJFA 2FOIA 2JKVA 3H2ZA 1NBOA 1H93A 3HQ4O 3B6ZA 4BO7A 2VRCA 1QYWA 1EVZA 4CM6A 3DBLB 3PP8A 3GZNA 3V2HA 1OMOA 1ZW1A 3DZGA 5A05A 1U2GA 5ITWA 1EVIA 1YBMA 4BNZA 1IOLA 1NAHA 3B20A 4AVYA 2FR8A 3E03A 4YT4A 4U6QA 1KVSA 3GFBA 3WOHA 1KEWA 4GWGA 3VH1A 4DLAA 3RJ5A 2DBQA 3WS7A 4CMIB 1ULSA 2R00A 4R01A 1IY8A 4R69A 4YYZA 5L40A 4GMGA 3ZWOA 1Y81A 4NBUA 3STHA 3E1KA 1PJ2A 5T64A 1IHYA 2EIHA 4I9HA 1E6WA 5FI3A 4Z0TA 5F1PA 3AM4A 1DPGA 1HSOA 4N5LA 4Y67A 3L9WA 3KUXA 5C5IA 4YVFA 1NQ5A 2E49A 4Q3AA 5EJ2A 4DPMA 5IDXA 3VPSA 3DMTC 5CEEA 4TVBA 3LC7O 1N1GA 3Q2KA 1DLJA 1KEPA 1U4OA 3KYBA 2CD9A 3WGYA 1LRKA 2JJYA 3QVOA 4FN4A 2C54A 2Y0CA 1JVSA 5CDSA 4UUOA 1NWCA 5L9AA 1KEUA 4R41A 3DAFA 3GGGA 3JYNA 3INTA 1F06A 1BXGA 3DOOA 4PLZA 3NDIA 5L4LA 3DAPA 4O5OA 4IS3A 3OFSA 4HFRA 2R2GA 5T57A 4QECA 1HT0A 3W1VA 2ZQYA 1L7DA 4FGWA 4YRBA 4J4TA 4RVDA 3TZHA 2C20A 3VH4A 3MWEB 4WLEA 3ETGA 1V8BA 3ROQA 2DU8A 1I3KA 4YAIA 2C5AA 4BNXA 1EEHA 2O7QA 2Y0DA 4LISA 1I8TA 2Q3EA 2GRAA 3BMCA 4Y8VA 2Y93A 3HDJA 3HDYA 3ZV6A 1HDOA 1Q0LA 1YDEA 2G82A 2NVUA 3I6IA 4NG5A 2HMVA 2NU6A 1EMDA 3T7CA 4QEDA 4CM5A 5I7VA 2W2KB 3RKUA 3R0IA 5FYDA 5G0SA 3IAHA 1VKNA 3P2OA 4MP8A 2VUUA 3AOGA 3DONA 1LQUA 3DZIA 3LLSA 4TSKA 5EQFA 1YOVA 1JU9A 4U6SA 4RCVA 2I99A 4XR4A 3KHUA 3K92A 2JCYA 3DZBA 3RU9A 1K3TA 5DBIA 3OP4A 1PR3A 3JQ9C 3QW2A 4H16A 4BKPA 5K6AC 5TF4A 1T2DA 2DTEA 5KJCA 4MKXA 4KZPA 3UFXA 1KIFA 4EUFA 3SLKA 1AUPA 3H9JA 1Z73A 1XR3A 3N58A 4H3VA 4NMHA 2C0CA 3QJ5A 2IRWA 3HJAA 4PG6A 7ADHA 3BTUA 4FD3A 2Q1SA 3HB5X 2ZJ0A 1H2HA 1E1LA 2Q1UA 3X2EA 3IQDB 4BGEA 1HDRA 1HEUA
chains in the Genus database with same CATH superfamily
2VXYA 1CZNA 4H6VA 3LHSA 3T34A 3PGA1 3E0XA 5DW3A 3ZTTA 2C8LA 3EEIA 5C4MA 2VZLA 5E38A 2FAXA 4GKJB 2PH3A 3MB8A 4N0MA 4YMGA 1FL9A 2IGTA 2N46A 1PL8A 5F7ZA 2XBLA 4KGVA 5FJJA 2H48A 1M34E 5CLJA 1XGKA 1U81A 2NXEA 2QZSA 2WWFA 4B3XA 2YN0A 2QSYA 4XWKA 1Y8QA 2YWFA 4ASUA 2VCEA 4MRRA 2GCGA 3KL4A 4LE0A 4ARZB 4R1TA 4PYNA 1UPFA 1WX1A 3UMCA 3NOQA 4G0PA 3AFMA 3PWKA 1QGYA 1PL7A 3LD9A 4G09A 1YL7A 4FLMA 3EPRA 3FSEA 1B6GA 3ESBA 1T5OA 1BAPA 4JITA 2CXUA 3MS4A 5AI9A 3QE2A 4ZO7A 3IL2A 2QTRA 1TFRA 3IOYA 4PBRA 2FN7A 5EJGA 4C22A 2C1XA 2Q1WA 1IY2A 2NSDA 4ISCA 4X7PA 1PT7A 2F7SA 4Q21A 5EHIA 1KSGA 3SBOA 4R3WA 1QMGA 2AVDA 2QM0A 3VR5D 2ZR7A 1U9JA 5IK2A 4KPEC 3GRRA 5JI2E 4CF5A 3RYIA 2EGUA 4ZCMA 1X7YA 2GNOA 4MRMB 4ESOA 4YUZA 5BWNA 3HM9A 3PI6A 2VBIA 2AB0A 4JEIA 2PUAA 5GJCA 2EP7A 1O4VA 4S35A 1PFWA 3DGFC 3AY0A 2DFTA 5DX1A 2O8BA 2RBEA 3LFHA 1YKGA 4KDEA 1PJBA 4U8HA 1R66A 1Z6YA 4IXWA 3F5SA 4MVYA 3KXKA 4CUJA 5KYXB 3OX4A 4TMFA 5KTSA 3T4XA 1PFVA 3BK2A 3PQCA 3ZI7A 3ZU4A 3L7NA 4RTRA 1PKEA 1M54A 1PQYA 1T2VA 2CSXA 3P52A 1CV2A 3MTBA 3PCRB 3ZGZA 3D6AA 4U39A 5A3JA 5KSYA 1E2LA 1E1KA 1VCIA 1JB9A 1SY7A 1GQYA 1C3JA 3I45A 3BZWA 4ZVOA 4E2ZA 1OBHA 3UA4A 1PR5A 1GKUB 2PMWB 3DOFA 1UPUA 4X00A 4CM9D 1DINA 4DG9A 4EL5A 4ER7A 1L7XA 2HGZA 2EBFX 4EJFA 1XTSA 1PL6A 1U9ZA 3BHJA 3AF6A 2OGTA 5IABA 5ULLA 1Y8RB 5DI3A 2OC9A 1NTOA 3GIDA 2CLIB 4EHFA 1UH5A 2H59A 3GZJA 3DHWC 1GZ7A 1H66A 1XPUA 2W2NA 4GVLA 1U3FA 4ERXA 1I4TD 1MB2A 4LZOA 4XX0A 4LNAA 4HT3B 5KREA 1QVRA 4H4DA 4I4IA 3OKPA 2FW6A 3QX9A 2PIAA 2H63A 3JD4A 2FEKA 4D4GA 1F4LA 3LP5A 1SO8A 3HVJA 2ZTMA 4Q7QA 3JQCA 2FEAA 4JDPA 5EKUA 4WL0A 2G5PA 1M6VB 1GIAA 1GUYA 1UIMA 4HATA 4YMVA 5IHPA 5K5EA 1WXDA 2PS9A 4DILA 5D3KA 4DQLA 3CZCA 3L8FA 4CKYA 1RYBA 2CNNA 2VUSA 3ND8A 4BCBA 2XGSA 3A27A 1SKBA 3LK7A 3JPYA 2ZM5A 1XV5A 3C3BA 5CYFA 4DDWA 5U4XA 3Q3HA 4RU1A 4WHMA 2CMFA 4RK7A 4WT7A 4Z2AA 1X1RA 3OZSA 5CR9A 2EKDA 4MVJE 3SDZA 2QROA 4WVFA 2V3WA 4TS3A 4WA7A 4F5ZA 5IHXA 3ISTA 1D2CA 1OXKB 2P8SA 4QC2A 3UAOA 3SM9A 2Z2YA 4CM9A 1AO0A 3KQSA 1IAVA 2WF6A 2Y9MB 4G0QA 5BVGA 5KYGA 2NYRA 5JI3E 4MV0A 4OU5A 2DQSA 3H5VA 3FWKA 4KVAA 1RAIA 4K7JA 4DGQA 5F21A 4N48A 3QWBA 3P9ZA 3CH6A 3F6RA 4B6QA 3P2EA 3VR1A 2VAWA 5ALMA 4CGYA 1ZVMA 1JWLA 1KU6A 2KLBA 3NCHA 4M46A 1R4MA 5BR7A 3I52A 4KIFA 5CFMA 1XZEA 4OK6A 4UNSA 3THRA 4ER0A 4UM7A 4EW6A 4TWJA 4ZZ0A 1DBQA 3L43A 5KMGB 2QHXA 2IQ5A 2OAGA 5AK6A 1EHIA 1N57A 1ZISA 2Q2VA 4H4CA 4RZQA 2I1LA 5DNDA 4GOLD 3AYXB 1M8FA 1ZUNB 2ZYGA 1AN0A 3Q40A 4GX1A 4HGOA 4QLAA 1QG4A 4V03A 1NU6A 3VU1A 4ARBA 5BOSB 4DEXA 1F0KA 5AXAA 1OPXA 4J1TA 2ZM6B 1I94B 1TQ8A 4LDNA 3PRYA 3LX8A 4IXDA 3LT4A 1E2GA 4REMA 3ZWXA 4C4XA 1ZM7A 3BH6A 2J0QA 2Q5FA 3B8HA 3VVCA 3ZCTA 4CLXA 1G2PA 4P3KA 5BSRA 4KH0A 2V4MA 3CLTD 2GWRA 5FP0A 1XZCA 4NYIQ 3LCJA 1I5RA 2OL4A 1PJTA 2G9UA 3AEZA 3KLOA 3O4JA 5ARDA 1TYEB 1XCBA 3EULA 1CX9B 1PS8A 1GPAA 1VLQA 1VTKA 3A9CA 4YS6A 5JOQA 1QQBA 5FTNA 4OH7A 1LF5A 3OEYA 1PT9A 2XUQA 3WIBA 3AKZA 1RTKA 1BVYF 3VZCA 1KSFX 5C4GB 1DEAA 2GVDC 3GJ0A 1OF1A 3WHKA 5TF0A 2JVIA 5F9FA 3Q2IA 4FX2A 3TQHA 5CXXA 2B61A 1JE1A 4C3UA 4DIOA 2YWDA 2CJWB 1I3LA 2QA5A 2POQX 1I9GA 2F3RA 3T0FA 5DCLA 1TVEA 3LVFO 1LDBA 1JHYA 1D6NA 4AZWA 2AN4A 2VEDA 5CXUA 1W1UA 5B7GA 4GD3Q 1NF8A 3ROKA 1E5XA 5EPEA 4ALLA 1OAOA 4PXAA 2Q3BA 1I3OA 5SY6A 5C46F 3PQ7A 3ABIA 1KZHA 2HWWA 5AFSA 1Z9BA 2XUOA 5DYWA 4Z0NA 3DMGA 4IAOA 5D8DA 5EMMA 2M6KA 5DBOA 2MSEB 1LWOA 2BMFA 2D2VA 1DKRA 2ZB2A 5CVJA 3S5JA 3S2GA 1FP7A 5KCZA 2JKZA 3C5VA 4AYXA 3I5YA 3UT0A 2G67A 1IWOA 4XD2A 1YFZA 3Q11A 4B31A 1C3VA 1KRHA 1WUIS 4BVGA 4BWYA 1O54A 5DNVA 4B75A 5CGZA 4YRGA 4MKIA 3GLTA 1HO3A 4M7WA 4BN4A 4N7MA 1JT2A 2R7AA 3O03A 4FFLA 4MJ7A 4QGAA 2I7CA 3GJRA 3ET5A 4R68A 2P9CA 4HYEA 5EXEA 1V1JA 4IIBA 4LG1A 3COYA 2FZLA 3PZBA 2WNHA 2ZVJA 5HQTA 4TROA 5DSZA 3DV0B 3I73A 4LVNA 4QU5A 3WQQA 3ELYA 3H1GA 3OLWA 1RWOA 1INLA 3IAS1 5D85A 5H83A 1TMKA 1UP7A 4RK1A 3VJLA 1ZJ4A 4K40A 3H1BA 1U02A 3ONEA 4ECEA 4EENA 1GFWA 1U0JA 2ZU6A 2JLZA 1E6UA 4KZKA 1SRRA 5T8KA 3KX2A 2MYTA 2DJ5A 3ZXSA 3QU4A 3HM2A 5KWSA 1R88A 2NVOA 3DXFA 1Z22A 3L6BA 3LHIA 5THXA 2PKWA 4X8MA 4XASA 3ITDA 1XN4A 1VE5A 2OCLA 1U7PA 1JLSA 4KMRA 1A77A 3KE9A 1XC7A 1ULZA 3NKLA 3VOAA 3V8QA 4CM4B 2AXNA 3FYUA 3BXHA 4QVKA 4DA9A 3M1IA 2Q8NA 3BBPA 3OZWA 1NVAA 5FL7A 3NTXA 2FUCA 2ODAA 1E18A 2X9VA 3GDFA 4URZR 1B23P 3FCOA 2QDXA 1Z62A 3KYCB 2JLYA 3SU8A 4NEQA 2QL5A 4Z5XA 4C05A 1FFGA 2VN8A 1FYVA 2M1XA 5E4JA 5AVQA 2P9JA 4JL6A 3QUSA 4IKPA 4XEUA 4WOPA 4DV7B 1LBTA 1TUGA 2HK9A 3V9PA 4E11A 1O97C 5HVNA 3G2LA 2HF2A 3GT3A 3HN6A 2D2FA 2GF9A 5HIKA 4W5OA 4KKXB 4MIKA 1NBWB 1XEWX 3BDIA 3L01A 2XGOA 3NYWA 3P27A 1LPNA 1TIPA 3PWSA 4QULA 4V3CA 4EY5A 3RTBA 2D0DA 1U2ZA 2IXDA 4BJHB 1YGPA 3I0MA 4PZYA 4BQRA 3VNQA 4DQKA 1K1EA 5TMBA 4DIEA 1GL7A 4C0HA 5IFLA 4D4LA 4HQ6A 5IAKA 1U8YA 4PQYA 4EOGA 3PIRA 2JH9A 1FMCA 3EXFB 3OZTA 3GFTA 1P60A 3N3AC 4J7CA 5BY2A 1VYUA 3WBBA 5HM6A 3DBRA 4EJSC 2CL5A 4RY2A 4GPTA 3EVGA 6CHYA 3OKCA 3RUFA 1L8OA 2D5IA 1G5QA 4LJ4A 3KP1A 1P73A 3RHSA 1IJEA 1LPMA 3EGEA 6GPBA 1ORDA 2JASA 1BW9B 2P0AA 5CPBA 2HTFA 4L74A 3F7OA 2WKSA 4EYEA 1ZSYA 3C87A 4M8KA 4XI9A 3K0EA 2ZYHA 4BO3A 3JAWA 2C94A 2HRZA 1U28A 2P2YA 4PONA 3RCBA 4YPVA 3JAWB 5JFGA 4BIIA 4CTOA 1W25A 2IKSA 1Z2DA 2OCYC 4LZAA 1BW9A 3VJKA 3AOEA 4P35A 4OCZA 3PLRA 3ZWYA 4L9RA 1G5RA 4WZBA 1SCNE 4NJMB 1NV9A 1Q74A 1YULA 2C7VA 2NO9A 2PKQO 4D97A 1AKTA 2X2PA 3CXRA 2CXHA 3OLVA 1PJZA 3DQQA 3R7AA 4M9CA 3SK0A 4A5OA 3SQXA 4FEGA 1UP4A 4CLDA 5E2BA 2B9VA 4KWCA 4AIRA 4YUYA 2W6ZA 3RS8A 3WE7A 2YJ6A 3NBFA 5A7FA 4AMZA 8OHMA 2AZXA 3GJ3A 5AT1A 4MLDA 2BMWA 4IGAA 4OXIA 1SBQA 2P77A 1JMKC 3WGZA 1ZRSA 1Q0HA 5BV1A 4EA6A 2V6JA 5BN3A 1M5TA 1GITA 3TI7A 5DYTA 3THXB 2BTOA 3DTVB 1TEHA 4MV3A 4NICA 2CGEA 3GMIA 1QFMA 1OA1A 4Y0VA 1N6NA 1KI3A 4QYXA 3UT6A 3TNJA 2K4MA 2Q5OA 2WM3A 2MDTA 3IV9A 3MCVA 1M5UA 5B7QA 1XJ0A 3K8OE 1CNFA 5AIAA 3ZW9A 4MVJM 1SGWA 3PICA 1YCHA 2J4FA 2HWXA 2KWIA 2VEOA 1B8OA 3KHSA 2WYWA 2WABA 3FWHA 4IIUA 2YCLA 5EZ5A 4KLAA 1J24A 3I30X 1NNUA 1P0CA 2G1UA 3SQWA 1H2ZA 3OH8A 4M0MA 4DJDC 1OFGA 1BQ4A 3OCCA 2HHJA 4G8BA 4HNQA 3H8VA 3RVPA 5AVTA 1KKMA 2P1DA 1F48A 2IBTA 1DAGA 2HMAA 2P9HA 3FZYA 2AOUB 3I9MA 5GMOA 3NG1A 4KPFC 2UUAB 1XROA 5B1SA 4Z8YA 5EZYB 1SURA 1W5TA 4K6HA 2Z95A 1FTYA 2NUAB 5EZSA 1BS1A 3H19A 4XD7D 5LOVA 4FDLA 1SCAA 2IUUA 4DBVO 1V0JA 2ZJOA 3PT9A 4JLMA 4M0CA 2VZEA 3QLJA 5DV9A 4Q4HB 3RE1A 3TOZA 5I7FA 1KL7A 2G4CA 3D2LA 3PQ6A 4PYJA 2KBFA 3C24A 2B8WA 1YC5A 1QV7A 4YIHA 4QYSA 2PKQP 3DPSA 3PWTA 1EVLA 2C3PA 4OB8A 1JJFA 2F67A 2QG6A 4AJNA 4HRVA 5EIFA 1IK6A 3JQRA 2UVPB 2W00A 1MOZA 4K2AA 4Y2YA 3DV0A 4HLQB 1EJ6A 4MTLA 3B89A 4L6CA 4RC9A 1OYOA 2Z4TA 4TRNA 1V8OA 2AN1A 4LFBB 3D2AA 2HU8A 1C0IA 5FUBA 4KAJA 1SQGA 4M98A 3SMQA 5J4LA 5E6UA 1P2DA 3DBHB 1RRGA 3TQQA 2HLPA 2C7PA 4KNYA 2PTGA 2MINA 2WJJA 1ODKA 1VLZA 2X9QA 3D59A 4HPXB 1QRAA 3EX7C 4NECA 1PX2A 1UXGA 2B2XA 2NWQA 1WZEA 1G9TA 2GQ0A 2BGUA 3ESYA 3H2JA 5FADA 2O7VA 1W85B 1Z5UA 5AKHA 2BAGA 1RP7A 3IUQA 2XWSA 2O8FB 2JFVA 1FQOA 4AK9A 4B3DA 3LC0A 1DC3A 2V0NA 4B3JA 4EMBA 1TYCA 5FL3A 1PK9A 4XYLA 2PQ6A 3G9UA 1YASA 5IK2D 1VLMA 4FM9A 1NI5A 3LUPA 4U7GA 2ZVDA 2QRZA 1OZAA 1E4OA 1XLUA 2PJRA 3N74A 5LDGA 1PK8A 1JDZA 3QY0A 4ZV7A 1ZR2A 3I4CA 1W9MA 4PSUA 5KYYA 2OGSA 4RCYA 2FSPA 4QXRA 1WJGA 4E3WA 2XE8A 4FN5A 1P62B 2OYRA 3EGIA 3RAPR 1TM2A 1ZMXA 2Q2QA 3OD1A 4GOKA 4F2GA 3RADC 5AR1A 3VHXA 1WD7A 3P9IA 3H5RA 1OFIA 4QDZA 5BN3B 1KIMA 2H1OA 3L0BA 4CKEB 1GNSA 2RCYA 4FZJA 1JZQA 4MUAA 3RRXA 4EFMA 5I7EA 4LRXA 2E4VA 1D7OA 2RHBA 3ABZA 4JEUA 5AJVB 5CFNA 5GM2A 2BFWA 1A9YA 1H94A 5CDFA 4JP3A 3VSEA 2CNKA 2NTVA 2EJTA 3BFXA 3GFVA 4HH3C 3RJZA 4PC1A 4KXNA 1UXIA 5IAGA 3TO5A 3UK1A 3UA3A 4I6JA 4OI1A 1UMDB 3U3MA 4ZYUA 5FORA 4HPWA 5LMZA 1C29B 2J41A 3JWJA 4J1TC 2X86A 2FZGA 3CBQA 5LBIA 2IYPA 1HMYA 2ZB3A 2HI0A 2XVXA 1BKYA 4ZOAA 4YYEA 1HOTA 1SR8A 4WY2A 1TU0A 2VF7A 3BE8A 4FOTA 3JD3A 2Y1XA 1OBOA 3OBBA 4IJ5A 3EYWA 1JDTA 4OQDA 4P93A 5KYWB 1QAMA 1R0RE 4RGVA 5EWMA 3WMFA 1LNSA 3ZHUA 3I09A 2H16A 1KJJA 1R9JA 3KB6A 3SJUA 2PH5A 1XMIA 2ODWA 2QAJA 4OP3A 4Q7LA 3GBVA 3HA3A 1T1EA 3BRWD 3GF4A 2BLNA 2JGAA 2VP6A 4FFSA 3VO9A 3QWAA 4NBLA 4BCDA 4F0JA 5DGCA 2ODTX 4DLTA 5J2TB 2NP6A 1MEJA 4V24A 2YOHA 3FHLA 2FEPA 1YOBA 5HDQA 2AN9A 2RHMA 3ZV3A 5EJ7A 3A1NA 4K9NA 5C9ZA 1EZ1A 3DPUA 1Z15A 4CG1A 1I13A 2CZGA 2QB5A 4M87A 1U0TA 3GWGA 4NP6A 3OZVA 5KNDH 2PCLA 4XVUA 2FMFA 1BMQA 3W05A 1TUBA 1GSOA 2QYSA 3H9QA 1T0IA 1MNQA 4DMUB 3JD1A 1Y48E 2O05A 2PFGA 3WTCA 2Q5QA 4CV3A 2A1TR 2P9TA 2Y99A 3TRFA 2G5CA 2X7XA 4U3JA 1K08A 5TGZA 3C1AA 3L0PA 4X54A 5HIAA 2X8JB 5BQ5A 1AF4A 3LWNA 1VI2A 3U7IA 3MQ4A 1GNRA 1QE5A 1TKBA 2WZQA 4FHZA 3QM1A 4H7KA 3RSSA 5JJLA 3ETEA 3N87A 2YV3A 2AMJA 3QVXA 2CXPA 2JGKA 1CEEA 2HLDA 2VSOA 1DRUA 1UKEA 1UUFA 1EK6A 1PYDA 5CA0A 1ZNWA 1G2OA 2V5UA 3K16A 2ZJ3A 3K3PA 2G1PA 2O54A 3JQGB 2E1RA 2YQ4A 3NATA 4TTPA 1NRIA 3VI3B 2RHOA 1UMBA 3COVA 4U02A 1C8LA 3LJKA 3U0VA 5M04A 5ECGC 4R5HA 4BO8A 2ORYA 2PKCA 2V7GA 2R11A 3C3JA 5ABPA 3OPXA 5BN5B 4ZYVA 1GGKA 5DEIA 3JW8A 2ZRJA 4IF6A 3RUDA 3TZLA 1DT5A 2V45A 4O1IA 4NAUA 2Q6OA 4C87A 3DAOA 3PNMA 2LCQA 5B4TA 1LNZA 1UC5B 1TT5B 3BMOA 3MCUA 4H1TA 4CRWB 2XT0A 3BMNB 3LSTA 1LV7A 4B2LA 4WECA 3KOXA 1QH9A 5JVDF 3K70D 4REQB 2QTVB 1LPPA 4UAUA 1T9GR 4ACBA 1VYTA 3V8NA 3F78A 3DOUA 1IHXA 3PEEA 4F4FA 1PGPA 3NETA 5H8WA 2FHSA 5TQ0B 2NPFA 5KKCA 3EMDA 3CEPB 1IRXA 1Z5ZA 2XB9A 5LUBA 4UEQA 4RL6A 2JLUA 1YR6A 3OX2A 2AOXA 2E9SA 3NC1C 2HWKA 2Q3JA 2SICE 3D4NA 4V0ME 1KWKA 2F4VB 4MA5A 2IP1A 3MXTA 1YUNA 5JXHA 5ALRA 1ESCA 3KZNA 2XUDA 3B60A 3K8ZA 4DARA 3GAAA 5EP3A 4BQOA 4JXXA 1I14A 3GGPA 5EHXA 3OPNA 4JI7B 2PWAA 3CTPA 1TC2A 5DYGA 2WOJA 3NO4A 3PYLA 4EG4A 1E5QA 2AOTB 4O63O 3N2NA 2VRBA 1CDEA 1Y1SA 2WHXA 4OXKA 4BLPA 1R0SA 4MIYA 2JEOA 2LIPA 4HLCA 2SCUA 4UU1A 4Y2GA 5DHRA 3USCS 8ADHA 4Q01A 4PC2A 2WKQA 1IFXA 3ROMA 1NXQA 1FFWA 1HC7A 4P31A 1TZ2A 4NHEA 3GHHA 3UG7A 5CG2A 1K66A 2H57A 1E7RA 3TKLA 1K5PA 3VPDA 3K5HA 5DN6D 4LTNA 4K6GA 2E5LB 4I5FA 3D3KA 4FX5A 2I2WA 2OV2A 4DW8A 2WOOA 2VAXA 4ICIA 5INTA 3IELA 1COZA 4JLOA 4Q37A 2QVCA 4EO9A 4LVOA 3ZTWA 1GGVA 2B20A 3M5WA 1EXVA 2Y2VA 3F3KA 4JYAB 1E3QA 2PSHA 4QX6A 2AJLI 1SUCA 2BFAA 1RWPA 2WHQA 1GFSA 3RBAA 2FGJA 4CU5A 1FB5A 1VBFA 3K94A 5LWHA 4FINA 3L79A 3HCDA 2TRSB 2AOWA 5CLHA 3RO7A 4F3TA 1C9JA 3TUJC 1QZZA 3LOPA 4QDOA 3BIWA 2R4TA 1GDDA 3AY3A 2XECA 5KNBH 3BL8A 4JR1A 5KSWB 1VGQA 2YDYA 2GKGA 4FBLA 3X3HA 3E2MA 3I6ZA 4NE7A 3CG4A 3L41A 1HT3A 2A9PA 2QTLA 4ZT7A 3DLIA 3U4IA 2YVLA 1IUNA 3A2MA 4NCHA 1V7PC 3K9GA 2QJOA 4D3FA 5EIEA 1YHZA 3KM0A 1E3TA 3DP9A 2WT4A 1JZTA 2J08A 3SAJA 1C0KA 4AQYB 4Y0NA 1G8GA 3KOWA 1ZVVA 1PJ3A 2OV8A 2DAPA 2Q3DA 4J7UA 1KZ9A 4JT8A 4Y1EA 1I32A 1N7IA 4MW6A 4A03A 3H4TA 1DBVO 1TT7A 1X15A 3ND6A 3TFQA 3ZUPA 4CV1A 1JDBB 2O5EA 1VSQA 2ZDQA 4AY3A 1P77A 1T5BA 4MPTA 4AFNA 5A9SB 4XFDA 4MW5A 4YMWA 1K89A 5A9SA 4FBGA 1NMXA 4H2DA 1FDRA 3TSZA 4J0EA 4OPMA 2HQBA 5K0GA 2WT8A 2DQKA 1IQUA 4K46A 2HDOA 2YUIA 1L1FA 3V42A 5C51B 1QKJA 1V5GA 2RJNA 3PS9A 4K6OA 2R5FA 3ZUGA 1FXUA 2JI6A 4L72A 4IQ4A 1Q3KA 4D9IA 1E69A 3R1IA 5NULA 3ML1A 4R6XA 1JA0A 3CUUA 4ER5A 5IM4F 4PSKA 3VTFA 2RDMA 3DEJA 5LFAA 1RVV1 5ELXA 5A3RA 4B3SB 2B25A 2QR2A 4BQNA 3UUWA 4DABA 1UFRA 2BEVA 2WVAA 4F21A 3L6OO 4E2WA 3LCVB 3N0WA 1S7GA 3FYDA 3UJNA 1GSHA 2BFMA 3M49A 1V95A 4PWYA 6PFKA 5J3JA 3SKVA 4PS0A 1SM4A 4Y2PA 1VFNA 4YBRA 3K2BA 1FDTA 3HE3A 4AS2A 4DV2B 3Q88A 3RIYA 3T5GA 3ZIAA 3MHTA 1FEZA 2AQIA 2ATIA 1RRMA 3EXEA 4AXXA 4F11A 3KZXA 3ZJTA 2EGGA 2ZI6A 2ZJZA 5CIQA 1XRMA 3D1VA 4MW1A 2JVKA 3OM9A 1ZGAA 2CWDA 1NASA 2XVAA 3LX6A 1A8HA 4DCGA 4EEZA 1T4CB 1V4NA 4ID9A 1DELA 2I6FA 2Y3IA 5C37A 2IUTA 2DX7A 2PJUA 2GXUA 3A70A 4N0PA 1XJQA 2G4LA 4UHDA 1G5HA 5IZCA 1Z0KA 1KJ9A 2A3NA 5IVIA 1WO8A 1KSHA 2BVNA 4MK4A 5AVOA 2BGNA 3R5HA 4HNUA 3K6SB 1JPVA 1S0UA 1CE8B 2ODQA 4AI6A 3G7SA 1MN6A 4B76A 1ECFA 1JLRA 4UBLA 2G7ZA 1NR1A 3P0HA 1XTIA 3C6MA 1YQUA 1GT6A 4UDNA 3COJA 4AP5A 2PMBA 3NFYA 3BX1A 4GMDA 5K7SA 1GG8A 3L84A 1K0UA 3GGSA 1K4MA 1W5BA 2Z4RA 4M22A 1D0SA 4RPLA 3X1WA 1QE3A 5IKMA 3BD7A 1M83A 1CK4A 3A3NA 5EEHA 5JNSA 1MIOB 2ISQA 3IVCA 3TLCA 4CIAA 2AX3A 3TR6A 5KSZA 1LFAA 2XF2A 3HP4A 4R2HA 4YUXA 5FUQA 5JMWA 5BSFA 5EA2A 5LQUA 3IEVA 1Z4OA 5BV7A 3H7AA 3BCRA 5L3SA 4LKRA 5JH7B 2A9OA 1U3UA 2BFEB 3OOSA 5L7YA 1A8PA 1NX9A 4TKUA 1F7VA 3L8EA 1XBTA 4G1EB 3WBJA 5CA1A 2OHIA 1V3TA 1VBNA 1NJFA 3KYJB 1YBVA 4XDYA 1J7JA 1WU7A 3DDCA 3D5EA 1I4DD 1B7GO 3FMFA 5TQ2B 3S7TA 3ESAA 2OHGA 3FHOA 1H0HA 4JYZA 3KAPA 4IVPA 4J1QA 5LQRA 4IJMA 5EOVA 1AKQA 4XZ3A 2BJHA 2UKDA 4K6MA 4BVBA 1RYZA 4QFMA 1E64A 1GKKA 2VDKB 1Y1QA 1VCNA 2DG2A 3K35A 4BEJA 3LY5A 1DV1A 3AKYA 3CIFA 1UT8A 2GNPA 2I7VA 2QNBA 2X5JO 4MRMA 3T3NA 2HYDA 4JI0B 3G5AA 4CKWB 1YA4A 5IUJC 1PT6A 1YQWA 4BWFB 3CF4A 2GKOA 4B6SA 3RK0A 4YAWA 1KZ4A 2P68A 4AECA 1VQ1A 1BTOA 4FQ8A 4HXGA 3T35A 5JD5A 5EYPB 1FFXA 2IDKA 1H0RA 3UT5B 4KXLA 4DGSA 1U80A 3L5OA 4PG7A 5T41A 4X7BA 3EXEB 3AI3A 3U40A 3WJAA 3FUWA 4IM7A 4BO4A 5CIYA 4YAEA 4LOKA 2ZRAA 3TEFA 3KPJA 4TL8A 3VR6H 3HJTA 3W4JA 3NZEA 1DOZA 2Z3WA 3JQAB 4P3NA 3W5CA 1EUYA 4UBOA 4QBFA 4E1VA 2FF7A 2MSDB 2B1RA 2WZBA 3QVJA 2R48A 2FPPA 4R5MA 2VBFA 4GSLA 4W82A 5DX8A 2DXIA 3L02A 1HDCA 3ZE9A 1AK2A 3QEMB 1N6IA 1U2DA 5ALHA 1XDWA 2QE6A 3L0CA 1TMYA 3A3YA 4QBTA 1GRRA 3KQWA 1CRQA 2O1XA 1JSRA 3DL2A 3GAFA 2GEDA 3K6KA 3L5KA 4HAWA 4NK4A 3ZHQA 1FPQA 4B81A 3GJQA 1NUUA 3TNFA 3HFRA 4QATA 5AXCA 3LQQA 1L5HB 3TQRA 4Q7EA 5DYYA 1NVMB 3NBUA 3CCFA 5ES4B 2WHPA 1E3DA 1XG5A 3CE6A 2JAOA 3T3EA 4BRSA 4R31A 1TO6A 1KETA 1TEXA 3ZZNA 3RVSA 2NYVA 3R7DA 1DWUA 1KAGA 4O02B 4P4NA 1LEHA 1EXNA 4W8GA 1U8TA 5FPHA 3W8EA 3CRVA 3K73O 1ZGGA 3CM0A 2FKAA 1LTKA 1IJBA 1BHSA 1JP7A 2Q07A 2JIBA 1GZ6A 5D6OA 4ND2A 2PRZA 1V9SA 4JR2A 2HHHB 2JA2A 1BGWA 2OO5C 4Y2VA 1E7SA 1GKYA 1QIEA 4MVJA 3AOEC 3DEYX 3HDGA 3P9NA 4E6PA 3NCTA 4MQEB 3Q8XB 2OB1A 4L5YA 3ETNA 2XT9A 1YU9A 2IL1A 4H77A 2NVUB 3MWDA 3W2HA 2GASA 2QLMA 2XH8A 3QU9A 3NHBA 4LYHA 3PWZA 3RTAA 3ZOKA 4YJ2A 2H9YA 3F2IA 4LDRA 1T15A 5E7QA 4FFVA 5EQTA 1G8YA 4KO8A 2FE1A 1FVXA 2CJYA 3WXMA 4KPUA 3QSYA 3FTDA 3CRW1 3L0IB 3A10A 2A57A 1OWNA 3QTTA 4BNMA 3N8DA 8ABPA 3FOEC 4TLMB 1HXHA 1ZUHA 2IZOA 4RLQA 4Q9LA 2Q6LA 1HYGA 2R85A 4BV2A 4FIZA 2VS1A 3EG9A 4IIEA 4DOMA 2B1IA 2V7TA 4FYYA 2ZREA 4Y1RA 2FVYA 1DLIA 5DSTA 2FK8A 2PRYA 4Q3KA 3WX0A 3GN1A 4QQNA 2LXNA 4GLBA 1JU4A 1UZAA 2ZBDA 5HFAA 4CCYB 4EPWA 4D4IA 1BXGB 3SSMA 4N01A 1CEXA 4Q1EA 1YCGA 3HWRA 1DTWA 3EXG2 3D6FA 3PC8A 1LB1B 4BMSA 3A26A 1YAJA 2FEOA 3E35A 3MNFA 4IEFB 1T5LA 5JQGA 1H6AA 4RVSA 3I23A 4CMEA 1KS9A 2ZUVA 1LK0A 2AJDA 4TWRA 4C3ZA 4ZQBA 1VSUA 1NP6A 3ADKA 2VHQA 3G2KA 3DHYA 2VBGA 4B47A 1E2DA 2BCGY 3LYUA 4UOEA 3NAQA 4JJZA 2IWHA 4Q4JA 3TMAA 4CM8A 1MHTA 3LO8A 4H9GA 1BXRB 2Z9BA 4WGFA 2G9RA 1LPAB 4WLUA 5FRDA 4BP3A 1BH2A 4E5UA 4DR6B 1D8TA 1P0MA 3W2IA 4TYQA 3LT2A 4UU7A 4KQMA 4YDRA 3JTEA 3QKIA 1W4AA 4Y6QA 1FDWA 3UKDA 5L6MB 4E6EA 1T8TA 3Q6NA 5JAZA 4TWBA 4Y2UA 3B9PA 4TV8B 2DETA 5LYJF 1QG6A 3HV2A 3I83A 4XJXA 1Q1AA 1RHJA 4IXTA 9GPBA 3G2PA 3QUCA 2M2IA 1E5DA 5GONF 3MBIA 2HC9A 3JAKB 1H4TA 4RACA 3TPZA 2DHQA 5LNK1 5EKSA 3NRJA 3P2MA 1SBHA 1U11A 2JVJA 3IV7A 3ZLUA 2XBMA 1GPDG 1Q1ZA 3HJHA 4LJ5A 4C4PA 1BFUA 5B6PA 2QDKA 3NBZC 3RTCA 3S1AA 1BE8A 1TECE 4M1YA 4WMLA 4DF3A 4RTJA 2R2AA 1PFGA 2Y71A 3I2YX 3RUPA 4ZRNA 3WG9A 3ZE1B 3PR2B 4AJ4A 1UQTA 1W75A 221PA 3BSFA 2RHWA 4RUKA 5CK5A 5CPFA 3QF4A 4GI1A 4AJKA 3GOHA 4RXMA 1GM5A 3AI1A 3AK4A 4RTMA 3DOCA 5DNUA 5A9TA 1Z29A 3IO5A 1FP4B 4HO1X 4ND5A 3HGTA 1VGVA 2WUWE 4OUDA 5TS2A 3STYA 3KKKA 3NDPA 1FBTA 3SF8B 1KMIY 2WFZA 5IYZB 3UICA 1EXDA 1XZKA 2VZ8A 1UDAA 2Z9DA 1F8GA 4L76A 2AQKA 3OEHD 4YJGA 4IIJB 1YJAA 1REQB 4LMAA 4O4IB 3BD9A 4S0XA 3N6XA 5L3VA 2PKYX 3HRKA 2FMIA 3TD2A 2DBYA 4C29A 3B5EA 4JQYA 2ODNA 4D9FA 1OVMA 2HBZA 3ABSB 5EERA 2XNDD 1NFRA 3OFJA 2X9GA 5CA0B 1KEKA 4Q5IA 1GPJA 1E9VA 5H3HA 2V7XA 3RASA 1ZVKA 2ABWA 3ZV7A 4JBGA 2FFRA 3L92A 3WVNA 1HE8B 4MNTA 1U7TA 3L4JA 4QYMA 1XF1A 2PSJA 2VK8A 2QYTA 4G85A 2GHQA 2NN3C 3LECA 1C30B 1VLLA 1VRCA 2CFCA 3I8XA 2P9YA 5G53C 1G1MA 5CVVA 4I50A 3LBYA 3HFGA 3JY6A 1E1RA 1VHDA 4J43A 5C7OO 1U7HA 1ZMBA 2XX3A 3DZDA 3QEMA 4UDXX 5ALUA 4NCAA 4DCOA 5AHXA 3C98A 3RC8A 4Q19A 1VDZA 3OI7A 2PBFA 2CJPA 5IX8A 1IY1A 2XOKD 4L02A 1PSDA 3HCRA 1N2XA 2P9ZA 1MRSA 3LWZA 3G2MA 3P9XA 1JR3D 5FTLA 2FMXA 4B7CA 1N1DA 5BRAA 1V96A 1RABA 1W0CA 3IT2A 2YOFA 2GD0A 4PPNA 16PKA 5EKXA 5TT1A 2OCXA 3WAKA 2GD6A 2Y1GA 1VMDA 4CZ2A 2DPGA 3DE6X 3JVDA 1J2EA 3T3GA 3ZE2B 4Z51A 3MMPA 1ZIPA 3B82A 4XVQA 4M0DA 2KLHA 1HI9A 4JQOA 2J0EA 4WAUA 3G89A 1PSZA 1U6KA 4D6PA 2ZJ5A 3PE6A 1VKHA 2IP2A 3PHLA 2XXJA 1YR8A 3EXG1 1X77A 1J06A 1WMEA 1MR3F 3U4QB 4FFRA 3FWNA 3SHTA 4YCJA 2Z8YM 2FQXA 4EARA 3V2IA 3EPLA 4RWEA 1NONA 3IUBA 1DBPA 3K0CA 2XMQA 4Q9KA 4QQFA 4ZRMA 4ABYA 4W9NC 2JB9A 2CK3A 3DWIA 1IHDA 4YC7A 2EXXA 3K1YA 2GAFA 3ZIDA 2W70A 1JG1A 3DOJA 2I3ZA 1U0NA 1W46A 3FAKA 2G3YA 2J3DA 3I4LA 1J56A 3QWFA 5A9RA 2K7FA 5CFPA 2GX6A 1WXGA 4BKUA 1O95C 1J90A 2CY0A 1PJCA 2A1IA 2PSDA 1L5ZA 1PBNA 2QW0X 4RV4A 3NALA 4UQOA 2QT0A 4US1R 1KPHA 3DEKA 4OLHA 2VCHA 3ANYB 4FS3A 4UTNA 1WVIA 1UFVA 2WTUA 1LLDA 2CVFA 1WZIA 4KAXA 5KNCA 1BS2A 1ZI6A 3QE3A 4EB3A 1VL1A 4EYSA 1Q6YA 1EBUA 4CT0A 5IAOA 4B3TB 2RHHA 5AVRA 3KQHA 3FFAA 2OAP1 1JXAA 4H15A 3CVVA 5JNRA 2VUHB 4KW7A 1NDQA 4BYMA 1ECPA 4DA8A 5TEWA 4MPJA 1Q22A 2FDXA 1JIXA 1KI4A 2AV6A 2VDNB 3F74A 1FSGA 4ZRDA 1IVNA 3BILA 2HQ1A 2UZ1A 4UFOA 2Z30A 3D1LA 4AP9A 1TIKA 3LDHA 1YS4A 3O8NA 1GQRA 4B8YA 1GRNA 4CCYA 2JLCA 3FR8A 4LWZA 4EM6A 1SU6A 1K3UB 2DJIA 2I87A 2RK4A 3SVZA 1T6ZA 3T4PA 1Z5OA 1T4CA 3IBSA 3VTAA 3D6NB 1XMXA 3EMVA 3TG8A 2XMDA 2D3TA 4JLBA 3SC4A 3U60B 2Q62A 3G7NA 4DBLC 3U19A 2PZMA 3MTJA 1C9YA 3TBHA 4BN0A 1B8UA 3R09A 2XKJE 2WP8J 3WNCA 1DAIA 1L7NA 2HJ9A 1FX1A 2GN4A 1DJNA 2V7QA 4IV5A 1SIUA 3NMUF 2R9VA 5CK4A 2Q21A 1GFZA 2AFRA 4OGGA 4NBNA 4DXDA 5DM0A 5JSQA 1G7SA 1HQDA 4LNHA 1OFUX 2ID9A 1AY0A 2V55B 3T9AA 3NAMA 4CLEA 2HU2A 4S0ZA 4WADA 2ICAA 3FY4A 3T5DA 2HA4A 1JKFA 2FWJA 2MIIA 3ADOA 4I4TA 2XE7A 3TH5A 4OHYA 2R5WA 1T25A 2QRQA 3AIOA 3GT0A 3IA7A 3KT0A 4P4GA 4TT3A 5EWJB 5EUBA 2J5QA 1T26A 1VMKA 2EYQA 3PFIA 1U8CB 2X2OA 5D5QA 1OX4A 1WB4A 4P0TA 1NSFA 2IXBA 4E2YA 2CLOB 3ZNPA 2B5OA 4YFYA 1S3IA 1HE5A 3EWIA 4G97A 4HDKA 4RD4A 4LY6A 1R7RA 2A92A 2VI5A 4HMQA 4TLLB 4WBNF 5CYOA 4BJ1A 4YAJA 4CFSA 2PH1A 1E2FA 3UAGA 4GYKA 4WN9B 1KPIA 2UU9B 4AG5A 2PD3A 4IMJB 4QPPA 3LKBA 3BH7A 2WIDA 3LXRA 4WDRA 5HCNA 4CEJA 1BMFD 2CYBA 3B6IA 1SXJA 4IIDA 1O0BA 2G63A 3COSA 3W7VA 2UUOA 4HKTA 3HO8A 1A7JA 1XVTA 5ALZA 2F1OA 5FI5A 1ZYUA 5AK5A 2OENG 3CRZA 2IYWA 3I9LA 3LK6A 3NV9A 4LEIA 4BB0A 4IOLA 3ZI4A 3OY7A 1W73A 2Q5LA 2HK7A 3NIBA 4DRXB 4NESA 2GEVA 1I2BA 4H0NA 3HYTA 3OIUA 4PGFA 1SXJC 1BS9A 1DO0A 3QVUA 1V3VA 4PHTA 2G40A 3OKFA 4Z7NB 1D09A 3TDMA 4LJ9A 1VE6A 3KQOA 1RBZA 3IP5A 4G2NA 2QL6A 4BFYA 5JSKA 1L7OA 2WAXA 3VSBA 1HNNA 2COKA 5G0VA 1GA4A 1M2KA 5LDHA 3ENVA 1EFHA 3ZY6A 4PFSA 4YPOA 1YOVB 4R7GA 4ECAA 1M34A 2JFYA 4F9FA 3BICA 1CRWG 1T9KA 3BJMA 4L51A 3GPDG 1JHVA 1CY2A 1G3MA 3TL2A 1Z7GA 4ENQA 4D8YA 3FMVA 2AW5A 2FW8A 1V1RA 2PR2A 1CYDA 1DEKA 1SQ6A 3B13B 4NJEB 3B7GA 4TM8A 3ZYZA 3UMBA 4YMUA 5GIPE 3JARA 3O47A 3KJZA 5CLGA 4EQ6B 1CP2A 1WDKA 1USVA 3RTGA 1YR3A 2J5BA 1WUJS 4TL6A 5CX1A 3RYCB 4GUDA 4OHVA 4B09A 3K53A 3AFIA 3TPCA 4PZDA 2BKLA 3T9FA 4CQNA 2Y68A 1L5VA 3BIXA 4YMTA 2IELA 1GPYA 1SCKA 1KDPA 2V6BA 2Q6TA 1KZ1A 1AKWA 4H7EA 3SX2A 1DHTA 4JFRA 2PUGA 4DPKA 2ZRFA 2QP9X 5CUQA 1STOA 3HSSA 2AWOA 3FDIA 1HYQA 5AM4A 1IAQA 1K0FA 4NX2A 1M6EX