4JBGA

1.75a resolution structure of a thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
333
structure length
333
Chain Sequence
HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 101
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbgA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbgA01
5JYDA 3BTUA 3JD0A 4I8XA 2G82A 3W8DA 3FBGA 5B37A 3H65A 4ZQEA 4RQTA 5JAQA 1I2CA 1SO8A 1I30A 2VUSA 3TPCA 4UEOA 2JD2A 3OSUA 3JQ9A 2OBNA 5I8ZA 5TS3A 1H93A 4OSPA 2Y1GA 2GO1A 2OGUA 2ZB7A 2EWMA 3KZVA 3PZRA 3ZNNA 5BSFA 5KKAA 4WLVA 3DOJA 4PG8A 1DFIA 4BS9A 2YFQA 3UUWA 4ZICA 2WSBA 5CEFA 5FI3A 3DXFA 1A9YA 4O1MA 1PZFA 4BKUA 4IJVA 3HDHA 1BVRA 2GNAA 3K2BA 3JQFA 3ZDFA 2PGDA 1LJ8A 3ADPA 4TZTA 4RDHA 5C7LO 2QYSA 4FC7A 5JFOA 3V5NA 1T4BA 3N74A 4UAGA 4FOSA 1GQQA 1YQDA 2I9PA 4IDEA 1W8DA 2YDXA 3SLGA 2Y67A 1NASA 4R16A 1LQTA 3E03A 3IUPA 3DOCA 1EUZA 1U7TA 2B4TO 2PGLA 3ULKA 4CQLB 4FFOA 5T6BA 4BNWA 1I01A 5K0ZA 1U5CA 2JCYA 4CQMB 1ADCA 4XGNA 4KUHA 4O63O 3ZWWA 4MKXA 1I8TA 1NPTO 5JC8A 2D4AA 3G79A 1BDMA 4FQ8A 1F8GA 4Z3DA 1E5QA 4BUCA 2Q2QA 5BT9A 1SPXA 4JXKA 4QFDA 5A5FA 3ETEA 4GL4A 2WWRA 5GY7A 4GGPA 4DC1A 4JBIA 4OH1A 4A0SA 2Q99A 3WFIA 4YTEA 1OC2A 1M6HA 3DONA 3LF1A 3PRJA 3DHEA 2B4RO 1I2BA 2Q4EA 3LT2A 1UDAA 4IUYA 5L45A 2IYOA 3BMNA 1B8PA 1UP6A 3A1NA 2YUTA 1OAAA 3K2EA 3G3EA 3L0DA 3GAFA 3LQFA 4WE3A 2ZTMA 1YJ8A 3FWNA 1DRUA 1R6DA 2B37A 2HKIA 2OP0A 1SB8A 4DL9A 4BOYA 1OFGA 1FDTA 3TL3A 1U3TA 4YAEA 2X7HA 3PHGA 2DAPA 4E5NA 1UZLA 3K6JA 1ISMA 1RM4A 3GMDA 4JNKA 4K26A 4UVDA 5DBFA 3TQHA 5TJ9A 3C7CB 2FY8A 1E1NA 1BXZA 4C7JA 1P1KA 4RVDA 3PQFA 3CPSA 4OXKA 3U49A 2AG8A 2NQ8A 3NDJA 4Q3DA 4HFMA 1QRRA 5IXSA 1ZCJA 5CDGA 2HRZA 4ALIA 3SC4A 1C1XA 1RWBA 3PJDA 1VL6A 1T1SA 4JGBA 3JQ7A 4GSLA 4FFLA 2H1SA 4BKQA 4D43A 4RJTA 1PS0A 1IZ9A 1L7EA 4II3A 1I2ZA 3AUTA 1MC4A 2BLLA 2BFMA 1EVYA 4IINA 4IS2A 1LUAA 1UAYA 3V8BA 4O5OA 1GEGA 1AXGA 2CVQA 1QMGA 1Z74A 2B69A 4DQUA 2IZZA 4A7PA 1BDBA 1EE2A 1UH5A 3E9QA 3NJ8A 1N5DA 5CDTA 1QYVA 5IG2A 1JTVA 2VWQA 3OEYA 1ZK4A 2F00A 3ROQA 3GOHA 3H6KA 3DWFA 1CQJA 2W98A 3NT5A 4CM9D 4CV2A 5LDHA 3QWAA 1RM5A 2NUAA 2V6GA 3ICPA 4GX1A 1NYTA 3P5SA 1KEWA 1LNQA 3PTZA 4XA8A 3PLNA 3RJ9A 2ZB8A 1GR0A 1P1JA 4BGEA 1LLDA 2O4CA 5DBGA 4Y6SA 1HSZA 3D3WA 1GD1O 1I32A 2AQKA 3AUUA 4MINA 4DVJA 1B3RA 3MJTA 4NBRA 2ZTLA 4W7IA 1CETA 1ULSA 4AJ2A 3NRCA 4EW6A 1EVIA 3DC2A 1CEQA 1DAPA 1ENYA 3GF4A 4AJJA 1EBUA 4EJMA 4D3DA 5L7TA 3GG9A 4L4SA 3VDQA 1Z82A 3EUWA 3HSKA 1IPEA 1NX6A 1GPJA 3M1AA 4RZIA 3ANLA 4NFYA 2B4QA 4RVHA 3U4IA 2Y1CA 2FSVA 3M1LA 5ENVA 4CM4A 1BXGB 2JHGA 3QV1A 3HN2A 4ZQGA 2JCVA 5IXYA 3AM5A 3G1TA 4DIBA 3KLMX 3ZWAA 4CMBA 1J4AA 1DRWA 5BQFA 4Y8VA 1GFSA 1NQOA 1IYZA 5KVVA 2B0JA 1QYCA 4Z6KA 2Y66A 4S1VA 2VOEA 3GPDG 5I7FA 3WLEA 2AEJA 1LDEA 1BGVA 2EHDA 4RL6A 5AXCA 2QRLA 1Y8RB 2ZYGA 1PQUA 4OKIA 4RF2A 2GF2A 1YDWA 2G5CA 2NU6A 5ICMA 4N5LA 1HDGO 4BO1A 1K6JA 1JKFA 2PH3A 1PL6A 4GSKA 3TOZA 2Y1EA 3Q9NA 3V1UA 3WWYA 1IOLA 1CDOA 5TJHA 3ZWNA 5HS4A 3NJ4A 3UCFA 3QP9A 2WMDA 4XX0A 1QORA 5CG2A 2V6BA 5T67A 5U1PA 3SBOA 1GQ2A 1LEHA 1ZMOA 1TA4A 1G6KA 4W9NA 2JAHA 2VUTA 3EVNA 5TRTA 4BKOA 2VWPA 5BNIA 5JAZA 2QZZA 3CZRA 1EQ2A 5JCXA 1U4SA 4J1QA 1ZK2A 1ONPA 1YS4A 4CMHA 3WB9A 4NDNE 3WG9A 3QHAA 4ESOA 2HAEA 3V1TC 4ZHSA 4NBVA 4RF4A 5ES3A 3RCBA 3DAGA 2RHCA 3R0IA 1TT5B 2EF1A 5KVQA 3MJSA 3ITKA 5A02A 2QYTA 3B6ZA 1HDYA 3H9GA 2B36A 4QFCA 1I3MA 1LI4A 3OQ6A 3UOGA 1JVSA 2DQ4A 3GG2A 4CM6A 1DIAA 3HDJA 1E3EA 3QIVA 3OJLA 4MVJA 4OYRA 4MVJD 1ZSNA 2V6MA 5G0TA 2V6FA 4TRMA 4CLXA 4YT8A 2QRJA 3M2PA 3H5AA 2ET6A 2EKQA 4B4UA 1M75A 1YH3A 3JQBA 5G4LA 4MVJI 4R41A 3W4KA 4R1NA 3M6IA 4E12A 3RFVA 4XQ9A 3KB6A 4A10A 1KVUA 3FF4A 2CNBA 3UXYA 1ISFA 3WOHA 5C3MA 1KVTA 1XQ1A 3ZZNA 4TRJA 1I3NA 3KBOA 3CMCO 2PZMA 1YDEA 3PHHA 4L4XA 4YT5A 3NTRA 1H6BA 3PGJA 4IM7A 3DQPA 1ENZA 3NYWA 4IMPA 3B1JA 1EK5A 3DBVO 3KEQA 4YACA 3G17A 3F5SA 1TXGA 4ALNA 2DC1A 3KV3O 1LU9A 3DHNA 4OQYA 1NP3A 3D4NA 4Q3AA 1HYGA 2GDZA 1DC5A 3WSWA 3TL2A 1LDGA 4CUKA 4BNMA 1IULA 3KHUA 4E5MA 2BKAA 1H6CA 2VHZA 2GRAA 4IDGA 3ROMA 3VKVA 1SAYA 4J9VA 3PZBA 4N5NA 3FTNA 1KVSA 1UR5A 4KQWA 4E4YA 1SMKA 4XQCA 4RPHA 3VHRA 1Q0LA 2H9IA 1H0KA 2NM0A 2O4UX 1HKUA 2ZTVA 2GR9A 2GN9A 1YJQA 1PR9A 1CERA 5A5EA 2GN8A 1XYGA 1XKQA 1FDSA 2JL1A 4PGFA 4RPKA 3C1TA 3KETA 3BMQA 5GZ1A 2BFPA 3UFXA 5HTOA 1Z73A 4YPOA 4NPCA 1P1IA 1QYDA 2R00A 1TVEA 2NADA 3HB4X 2E49A 4B79A 4BMNA 4WLEA 4BV8A 5GZ3A 1X7GA 3H9EO 4UULA 2YV2A 2B35A 3QVSA 1FDWA 2JCXA 1JN0A 4LSMA 3ROPA 2JAPA 1N92A 2B5VA 2PKQO 3IP3A 1XWFA 4EEXA 4XZ3A 1RM3A 3I6IA 1UXHA 4CPDA 1GCOA 2EGHA 4ZGWA 1SBYA 1MGOA 3RJ5A 4AJEA 3W8EA 3QA9A 1NVTA 2ZTUA 1BVUA 4WNCA 4E13A 1M66A 1IY8A 3K31A 5T8KC 3L6OO 3TFOA 4R1UA 3ZWCA 4CLOB 4JLWA 1P3DA 1X13A 1NVGA 4BNNA 3CXRA 3D4PA 3PI7A 3B70A 1E7MA 1UUFA 5I7EA 1H2BA 5IDWA 4R4JA 4XR4A 5IZCA 3KSDO 4BGIA 2BI8A 4B3JA 3OIDA 5L53A 1PL8A 4KTVE 2IODA 1NR7A 2DTDA 4FFMA 4PZEA 5EPOA 3OBBA 1KEVA 3RI3A 1E5LA 1YL7A 1B26A 4OHUA 3WSVA 4BQRA 4ZJUA 5CDUA 1VJ1A 4GBJA 4I08A 4BB5A 1HE4A 3IC5A 3D5TA 3R3SA 1OBFO 1LBEA 4WK6A 4GKVA 3CKYA 4Q3BA 1KC1A 1ENOA 4PZDA 1ENPA 4F45A 2CDCA 4BO7A 3WGYA 3SXPA 1QR6A 1WLYA 3NTOA 3P7MA 5COQA 5F1PA 4FR5A 3F3SA 3GEGA 3KRTA 4B8WA 4CMCA 2UVDA 3RUCA 1NFRA 3GT0A 4OSOA 2PZLA 4XQGA 4QQRA 3VAZA 4CUZA 3ONDA 4M8SA 1XHLA 3HN7A 3SX2A 3AUSA 4KZPA 4D3SA 1YL6A 3P2YA 4FGSA 1N7GA 3N7UA 2FHSA 4KUEA 3WQQA 4CM8B 3LYLA 1PX0A 2HSDA 1P74A 2GSDA 3S2IA 2VHYA 2BD0A 3JQ8B 4J1TA 1DFHA 4LMPA 1J49A 4MIEA 4ND5A 2HJRA 2YQ5A 1HXHA 1PJQA 4UUPA 3ZU3A 1I10A 3ZHBA 3EMKA 1CJCA 3D5QA 3F6YA 3BZUA 4I9UA 2D2IA 2XXJA 4FDAA 5L4NA 2X5JO 3ZWBA 3QY9A 3PPIA 3IJPA 4I9HA 1F0YA 1JQBA 1E7YA 3EC7A 4GX2A 1CF2O 4K28A 1QG6A 1P45A 4CMIB 1N9GB 5JO0A 4RVSA 3H3FA 3DMTA 1XGKA 1MXHA 1GUYA 4R1TA 1R4MA 1IZ0A 1PJTA 5AXBA 2A94A 3C8MA 3F47A 1SNYA 3BXXA 5AVOA 4MOWA 4N54A 1B16A 2NU9A 4PCVA 4BNGA 2V7PA 3KVOA 4MVJH 4DWVA 3GPIA 2W2LA 1U8FO 2W2LD 3ONFA 1JKJA 1S6YA 1K6IA 4PLHA 4PG4A 4RVGA 3Q0EA 4E2WA 3RBZA 3TZ6A 2CUKA 4YJGB 1QYWA 4D3FA 2PD4A 4YJDA 4RO0A 3ZN2A 3PYMA 2VYVD 4R1SA 3AOGA 2WYVA 5A9TA 3T7EA 5A4DA 2EW2A 4Z0PA 5HBRA 4CMKA 4CR7A 5BNTA 3JQCA 3ZCXA 4HFJA 3VVBA 2OO5A 4ZN6A 5KJFA 5U9CA 1MB4A 1R37A 2FR1A 3Q1LA 4DMMA 4XQEA 4TQGA 2J3JA 1MLDA 3UHAA 5KOIA 3EZYA 3PEFA 1T24A 2Y05A 3PFFA 1G1AA 1JLLA 4IS3A 4Z9FA 4WCFC 3RUHA 2ZB4A 1MFPA 2HMVA 3WDSA 3BTVA 3GA0A 5IDQA 2GZ2A 4AJKA 4BGVA 2P2SA 4OOEA 2HLPA 3MJ4A 3LT4A 4YJFB 4ZRNA 4EEZA 4ALLA 2PY6A 1N1GA 2RH8A 3BMOB 2CY0A 1HETA 1JA9A 1PZEA 3WIEA 1B7GO 5JDCC 3WGZA 3ZI0A 3COSA 3A4VA 2AEMA 1YWGO 1ZMTA 5HWSA 1UDCA 3FCOA 2HMSA 2OORA 1ISJA 5KJ1A 1MX3A 3GZNA 1U3VA 2EERA 5EIOA 3LSYA 1GCUA 1OZAA 3JQEA 2ZCUA 3F1LA 5TT1A 1X15A 1JDJA 2ZQYA 4XD2A 4ZU3A 1M67A 5B12A 2QQ5A 2EW8A 4XDZA 3UH1A 1PJ2A 4DTIA 2A4KA 1LC3A 4WEQA 1TB4A 2X0JA 1Q7GA 3I9NA 4TRRA 3NAQA 1R4NB 2O48X 4NJOA 4BB6A 3QVWA 4C7KA 2WM3A 3GR6A 1OC4A 3PWKA 4Z9YA 1U8XX 4XJTA 3HG7A 4HNGA 4A73A 6LDHA 3KYCA 3PK0A 1VL0A 1N2SA 3IP1A 3ZHZA 3W1VA 1WWKA 4B4WA 2X0NA 1WP4A 4U0JA 1AN9A 4QTZA 4CODB 3QVXA 4BNLA 1CIVA 3UAGA 4HNHA 4PRLA 2UUOA 1SZJG 2BELA 3P2OA 4LVUA 3WBBA 1J5PA 1MP0A 3S8MA 1EK6A 4HFNA 3DAPA 1WW8A 3I9MA 1P44A 3L9WA 4E3ZA 2YZ7A 3MJVA 1KY4A 4YRDA 1EEHA 3PIIA 3L07A 3UCEA 7MDHA 5KNLA 5J23A 4PVDA 4BO5A 4IDCA 4UUOA 2QX7A 3EDMA 1FK8A 1K0UA 1R12A 1ADBA 1IPFA 3PP8A 1E3JA 1PZHA 3DAFA 4ZD6A 4BMSA 4J2HA 4UVEA 4GX5A 2DBQA 3D7LA 1DIHA 3OA0A 2R2GA 4J1SA 4NH4A 5KVSA 4C4OA 3W6UA 1EE9A 4P4NA 3GC6A 1ZBQA 3WFJA 4WEOA 3ZU5A 3ZWMA 1PGJA 1LDNA 2PH5A 4TVOA 3H9UA 1GZ3A 4GLLA 3C24A 4M87A 2B83A 5JE8A 4KQXA 5JC1A 4I9NA 5A05A 2I76A 2QHXA 3CZMA 3ZH2A 2XF8A 3ZW9A 1WZIA 4D42A 4UVGA 2HCTA 1EVJA 3QJ5A 1P1RA 1T2CA 2CF6A 3RBXA 4R5HA 4O0LA 4YB8A 2EP5A 2YHIA 2P4HX 4XGIA 2X5KO 1T25A 1HLPA 1F06A 1IHXA 1XSEA 3GMSA 3GEMA 1A71A 3JYQA 4TVBA 2VWGA 4CQLA 4IXTA 3JQGB 1KS9A 4BNUA 4CQMA 9LDTA 4CQMD 5THQA 2JD0A 3QWHA 1Z45A 2VQ3A 5EQDA 1IUKA 4CLRB 3A28A 3JYLA 2WD7A 1KEPA 1A9ZA 1LX6A 1Y8QB 1NNUA 3GZ4A 4DUPA 1XQ6A 2NSDA 4IBOA 5JPIA 2A35A 3ADOA 3PYXA 3VPHA 4DLAA 5CG1A 3OQBA 3OP4A 1NHGA 4L76A 1NTOA 1A5ZA 2OZPA 3DBRB 3IJRA 3I9OA 3AM3A 1DAOA 5CAEA 1VE9A 1ONOA 3A06A 4PLZA 4BL5A 5KWEA 3GQVA 2VRCA 4WLUA 3R6DA 1I36A 4TZKA 2D3TA 3JCZA 4PG7A 2I66A 2OUIA 3C7AA 4L0QA 1C0PA 3GLQA 1V35A 3E1KA 4QUKA 5JW6A 1O95A 3ZU4A 5F3RA 4CV3A 1QSGA 2R6JA 1EZ4A 2DBRA 4H7PA 4RVUA 4XDYA 2DM6A 1J6UA 1BW9B 1DXYA 1R16A 3TZQA 4URFA 2ZIZA 3GN2A 2H5LA 3DTTA 4D45A 3BMNB 1Y9EA 4AJPA 3CH6A 2D1YA 1WMBA 3LU1A 1DIRA 1ZK1A 4AJIA 3JQBC 1VSUA 5G0VA 1L1FA 5JYEA 4WCFB 3VH3A 4J1NA 1DLJA 2Q1TA 3HB5X 4Q39A 4EDFA 3CUKA 1CWUA 3TZHA 1IE3A 4MP3A 4BO9A 1MXFA 3L6EA 3I9JA 3DBHB 4DLLA 1U5AA 2G17A 2O3JA 4W82A 4XJSA 3RASA 4BNJA 4OJNA 1JWBB 5K9ZA 2J5KA 5KCZA 3DZJA 5ENDA 3I83A 1W73A 1U3WA 3OEWA 3FR8A 2BRUA 2PD6A 4EGFA 2WEKA 1C1XB 3AY3A 4INAA 2AQHA 3WLFA 3KYDB 3UVEA 3JQ7B 4D0SA 2PV7A 2W2KB 3ZWYA 4CV1A 5JDIC 2GCGA 2H6EA 4GI2A 2P9CA 2P9EA 4BO4A 2X86A 5JY1A 1PZGA 2NV6A 3AOEA 1YRLA 4YT2A 1U9JA 1YBVA 1HEUA 4TKMA 4B8ZA 4I5GA 1KBZA 5COBA 3GAZA 4BNFA 4RV9A 4J7CA 5C37A 4IJKA 4IQGA 3NT2A 4J4BA 1QV7A 2DT5A 3I9LA 3HHPA 2PK3A 2W90A 4XYGA 4YAJA 3OHSX 5EERA 1NXQA 1R66A 3DR3A 1B3BA 4AFNA 4JBHA 3O4RA 1E3WB 4YVFA 2NVUA 3HADA 2H63A 1ZXLA 5DP1A 1WZEA 3K8ZA 2C2YA 1G0OA 1BG6A 2WTBA 3IUSA 5EL0A 3NUGA 5F5NA 2VRBA 1D4FA 4DYVA 4L73A 2Q3EA 4OOFA 3R3JA 3LF2A 3E5MA 3ZGYA 1BXGA 2HMWA 1V8BA 2O50A 4H3VA 3RUIA 4CUJA 3RUDA 4RF5A 2C29D 5KJCA 3WIDA 1IHYA 2BGLA 2CZCA 3FI9A 2Y68A 3LK7A 4GX0A 4DC0A 4WOJA 4EZBA 3DTYA 4U6SA 5DCYA 4EJ6A 1E1MA 4TROA 1YB1A 4LSWA 5EN4A 3EHEA 4R3NA 2Q46A 4XYBA 2YY7A 3ANNA 3RU7A 3ZHYA 2EV9A 5LDGA 1NM5A 1ZJYA 4P4LA 2ZYAA 1C1DA 4GPD1 2FN7A 1DB3A 1DPGA 2G0TA 3NEPX 3U5TA 1GYPA 2DLDA 3OIFA 2C82A 4Q3CA 1YB5A 2O2YA 3ROKA 2C07A 2J8ZA 5EQFA 1W4ZA 4G2NA 4HBGA 3S2GA 4WLOA 3C85A 3IIEA 3WS7A 5TC4A 1BSVA 1T2EA 3O8QB 2AG5A 3AU9A 4NIMA 5H83A 2C7VA 3VOSA 2WYWA 3L77A 1KOLA 1E6WA 4NU6A 4FSHA 4D7AA 4NBUA 4N7RA 2G1UA 2AXQA 2I5PO 4I1IA 1EVZA 1X1TA 4PLFA 3W4IA 5ITVA 1YO6A 4XR9A 4AJLA 4J2OA 4BNHA 1DJQA 3KXDA 2X5OA 1HYEA 1MFZA 2X9VA 2X9NA 1DIGA 3GDOA 3Q6IA 4D46A 4XIYA 2BFOA 4XRRA 4FFRA 1TT5A 1T4DA 2V65A 4U0KA 1YONA 3BAZA 1VJ0A 2DPHA 3CE6A 1WVGA 5C7OO 1P9LA 1UXJA 2EKPA 3MTGA 2VZ9A 5DNAA 5HM8A 1ORRA 4NZ9A 2FPIA 2EP7A 3BHIA 3LDHA 2GERA 4JJGA 3ANMA 2DU8A 1AUPA 1O94A 5G0SA 4PFJA 2X1HA 5CP8A 2RAFA 2O3SA 2IZ0A 1P0CA 3WNVA 3FHLA 3ZV5A 1DOHA 1E7SA 4N18A 2TMDA 4FIZA 1QV6A 2BHLA 4EYEA 2EGGA 2BF7A 5IN5A 3LT1A 4QT0A 4OAQA 1ZKMA 4WECA 2YW9A 2C0CA 2BMAA 2GASA 4NHEA 1PGPA 1MG0A 5I8WA 1LDMA 1NQTA 4HXYA 2JD1A 5A9RA 4TMFA 3TNLA 5A03A 2J3IA 3RSHA 4E21A 2Y1FA 3Q9UA 5BR7A 3U4HA 3MWEB 3NGXA 4J7XA 1RPNA 1ZSVA 1X7DA 4RGBA 3H9JA 4A03A 2HQ1A 3GGGA 4LK3A 5A06A 4K1LA 2ZJ1A 1PWXA 3WYBA 1H9BA 2IXAA 5DZSA 1JWAB 4D44A 3FPLA 5H82A 4BNKA 2UYYA 1L7DA 1WDMA 1SOVA 2NVWA 1EUCA 4XEHA 3X2EA 3ZV4A 1MUUA 3Q11A 5B4VA 3PHJA 1ZNQO 1LSSA 2BI7A 3RAJA 4K6CA 1XDWA 3IAHA 4Y98A 1DHRA 3AFNA 3EK2A 3OJFA 2BFAA 2E37A 3H5NA 3RUAA 3DB2A 4DQVA 4MVJE 4II2A 2Q1SA 1Y1PA 3JQAA 4OXNA 1SB9A 3WXBA 1VL8A 3JQAD 2FPPA 2A9FA 4DYDA 1X1EA 2BGKA 3ZNPA 3A9WA 1VJTA 3ASVA 3H2SA 3VZRA 7ADHA 4PLYA 2WDZA 1GUFA 1SEPA 1T2DA 3GH3A 3QRWA 3PJFA 1R0SA 2RH4A 2EXXA 3WTBA 5IZ4A 3PHLA 3HFGA 1P0FA 4HX5A 3IKVA 5TGDA 1WPQA 3JD2A 4IQ8A 5L3ZA 1A72A 4IDDA 4IY1A 4MP6A 2DKNA 1PIWA 2O3UA 1BHSA 2GD1O 3GFGA 4JX8A 1P33A 1A27A 1A4UA 1LRJA 2GLXA 4CMEC 2NTJA 5I9NA 1V3VA 1Q0HA 3STHA 3CINA 3HE3A 1E1KA 4BVAA 4PLTA 4R68A 5G2OA 1E92A 1PJ3A 1WDLA 3KOUA 3ABIA 1AHIA 4CLOA 1Y6JA 4L75A 2VCYA 2DFVA 2ZKLA 4J16A 1VLLA 4LRSB 4UUNA 4K6FA 3OF2A 4LMRA 3NX4A 1F8FA 3DBLB 1I3LA 2EJVA 3H3JA 4BO8A 3DZBA 1LXCA 3GEDA 2P5YA 4IIUA 1O9BA 4KMSA 3I4FA 4MKZA 3RD5A 4BNYA 1WMAA 5EJ2A 3E9NA 2OP1A 2OBYA 2P4QA 3LT0A 3PGXA 4EITA 2NTNA 4IQ0A 2NNLD 3VKUA 4LN1A 3O03A 1ZVMA 3JYPA 4R5MA 3UGKA 3SVTA 5G4KB 1D1TA 2PGJA 5IDXA 4NJMA 3L4BA 4DPLA 5LC1A 3RFTA 1U2GA 3K92A 4FS3A 3S55A 4MP8A 4F6LA 4O6VA 2YFHA 1ONNA 5IF3A 4PG5A 3S1LA 4HADA 4B4OA 3PLRA 4Q3EA 3V1YA 1JAXA 3RROA 1U2DA 1GZ4A 3QWIA 1IB6A 2PKQP 3FNFA 1LSOA 4HV4A 2AEFA 4N5MA 1WNTA 2Q2VA 3QW2A 1B8VA 4J3FA 4D0RA 4CM8A 4Y6RA 1VPDA 3E5RA 3QWBA 5A9SA 1HF3A 5ER6A 1I0ZA 3JQ6A 3OICA 1M6WA 3PVZA 3JQ8A 4NK4A 3FRJA 1HE2A 5ITWA 1NWHA 4UEJA 3JQ9C 1F12A 1U28A 2Y99A 2C5AA 3AI2A 4M49A 3ZWPA 1ZSYA 2OL4A 3INRA 1GDHA 1RKXA 3BMCA 2UDPA 1HDOA 4DIOA 1RM0A 2VZ0A 4A26A 4J0FA 3HJAA 3TN7A 3GRKA 4GWKA 1C0LA 2P5UA 3O9ZA 4B3HA 2VHVA 1AXEA 5KKCA 4AJOA 5AXDA 1N9GA 1QP8A 1W0CA 2O23A 1PEDA 3MJCA 1UZNA 1Z75A 4XYEA 2AQ8A 3C7DB 1J0XO 3VZPA 1GPDG 2VTDA 5U4QA 3JQFC 2VYNA 3E48A 2VYND 4CLEA 3FPCA 3HDQA 2IZ1A 3W4JA 4BNZA 4NQZA 3PQEA 4ILKA 4WJZA 2NVBA 1Y9AA 4YQZA 3I5MA 2GGSA 3DOOA 4WKGA 5ER9A 1V3UA 4O59O 3LC2O 3EGOA 4CLHA 1V9LA 3ASUA 2C54A 2LDXA 5ILGA 5HRUA 2HK9A 1NWCA 5EMHA 3SLKA 1HE5A 5JLAA 5JXWA 3OMLA 1I5RA 4YAIA 4B4VA 4GWGA 3WICA 4QXMA 3I23A 2PA3A 2Q50A 3R1IA 2VWHA 4M89A 1I3KA 4DIFA 1E0DA 2NU7A 5TSDA 5DDIP 5H81A 2DPGA 3KM0A 1QYXA 3NTQA 4LCJA 3OIGA 4PLVA 1OOEA 8ADHA 1M76A 2QW8A 3AWDA 1KERA 3LVFO 2HJSA 1LLQA 5G0WA 4P38A 1WAMA 1GU7A 1PJCA 2P68A 4BNIA 5K6AA 4CMJA 3PXXA 1DDOA 1PS9A 2Q1UA 1YOVB 4BIIA 2I65A 2Z95A 4CMGA 4A27A 2NQTA 4FGWA 4GH5A 3OECA 3GRPA 4P22A 2X23A 3O38A 4XB2A 2P91A 3PJEA 1PGOA 4ZQFA 5TQVA 4IPTA 5A3VA 4YEDA 3AK4A 4F6CA 2VHWA 2VZ8A 9LDBA 1GUZA 5ILOA 3L6DA 2JFFA 5AXAA 1H9AA 4JJIA 2QIOA 4ONEA 4E6PA 3UW3A 4FW8A 1EFLA 3LZ6A 3BMOA 5F5LA 2GZ3A 3D3EA 1GZ6A 4L8VA 4J6FA 1CQIA 4H16A 2CFCA 4BQPA 1UXIA 1SEVA 4UUMA 5F1OA 2GN6A 4R9RA 5IJZA 3RC1A 1JKIA 1RYDA 2CVZA 2FPGA 3O26A 4J4TA 1A7KA 2ZYDA 4EUHA 2WYUA 1FDVA 1HSOA 4PLPA 4CR8A 1PS8A 1EFKA 2HO5A 2VHXA 4YA6A 5L4LA 3VPFA 4U6QA 4FJ0A 2JFHA 4AJ4A 4LCEA 3C3XA 4NBWA 2WE8A 4JCOA 2DTXA 4Q9NA 3DZFA 1R4NA 1HLDA 4YJHB 3MTJA 1E6EA 2AE2A 5KVCA 3K9QO 3DFUA 2CD9A 3GHHA 3I3OA 3JD3A 4LW8A 2AA3A 3GVHA 1YXMA 3GZNB 4ID9A 1QLHA 1Q0QA 3GGOA 3H7AA 3T7CA 3RC9A 5A1TA 1NQAO 1XG5A 5CDYA 4ZQBA 4TWRA 2UAGA 4F46A 4UVHA 3AOEC 3Q2IA 3BTOA 1ZUD1 1B8UA 5IN4A 3AM4A 3NKLA 2OFPA 3KLPX 4PN3A 5DOZA 4JQCA 2YDYA 4ZVVA 1GL3A 1U7HA 3CEAA 3EY4A 3K30A 4EJ0A 4XGKA 2DBZA 1KY5A 3BHMA 3KEOA 3KYCB 5HA5A 1LA2A 3UN1A 3SJ7A 1XEAA 4MPDA 4JIGA 4E0BA 1F17A 3GN1A 1YQXA 1LLCA 2VTEA 2D5CA 3D0OA 4HFRA 3WNQA 3ZNQA 4ROSA 1FJHA 4KP7A 4BO0A 4P8RA 1QLJA 1DJNA 3G0OA 3U9LA 4DPKA 4W4TA 1V6AA 3JQDA 5TF4A 4G81A 3JYOA 3E8XA 3RKUA 2X0RA 3TFQA 1BWSA 1VM6A 3HQ4O 3JV7A 5I9LA 4NBTA 5FEUA 2I6TA 4KOAA 4QX6A 4MIOA 5JY6A 1ZO8A 3PQDA 4YWJA 1JVBA 3K96A 3WX0A 2EKLA 4J4HA 4DXHA 4AJ1A 4MVJM 3B1KA 4ND2A 3I6QA 1N7HA 4IXWA 1HDCA 4WUVA 3T4EA 1UXKA 2FZEA 2Q1WA 4R3WA 1A7AA 2DFDA 2NWQA 3M2TA 3IQDB 3DDNA 4XIJA 1NVMB 3MOIA 1VKNA 3TJRA 1HRDA 3G1UA 3GNSA 3JQGA 4CR6A 2X22A 1NAIA 1NPYA 3GNTA 2I3AA 3RUFA 4W6ZA 2Y1OA 4UEKA 5GMOA 1ZFNA 2PZKA 4BGUA 4CLRA 1HL3A 1NHWA 2QZ9A 1Y8QA 5HS6A 4FD3A 2WD8A 3ETDA 3IMFA 3ON5A 2CVOA 2JHFA 5AOVA 5BNFA 3ST7A 2YHIB 4W9NC 4AL4A 4B3IA 4Y6PA 3EAGA 1DSSG 1ADFA 1OI7A 3GVCA 1DC6A 1KETA 1KVRA 3GK3A 3CIFA 1YVEI 3JTMA 1O0SA 3DO5A 4JBGA 3F9IA 1LC0A 3WGOA 5A04A 4NNJA 4NR0A 1GAEO 2I3GA 2Q4BA 3OM9A 4AG3A 3WGQA 1SC6A 3DBRA 3RFXA 4LGVA 2Q49A 5ADHA 1C0KA 3WYEA 2YYYA 3I52A 4HY3A 3GFBA 1DLIA 1VC2A 4R9SA 5DCUA 3BA1A 3WGIA 2VRCD 2ILTA 1DC3A 1ARZA 2WD7B 5MGBA 3OJ0A 5IAAA 3NGLA 4Y9DA 3F46A 4MJLA 3ETGA 4ZQHA 2E48A 4RVFA 4PVCA 3DZIA 3U3XA 4G65A 2O2SA 2FR8A 1UXGA 1BW9A 1HDXA 2W4QA 1OMOA 4XKJA 1MV8A 4GKBA 5FYDA 1T2AA 4WGGA 3T4XA 4NI5A 3QQPA 4BO6A 1PJSA 2D0IA 4CMAA 2DVMA 3HFSA 3VPXA 1X0VA 3DEYX 1T26A 4CL8A 3ZWXA 2GPTA 4U5QA 4WCFA 4DQXA 5DULA 1P31A 3BTSA 4M86A 5COAA 1Y5MA 2POQX 4FC6A 2FR0A 4IZIA 3VZQA 5AQ1A 4YQYA 4E33A 4YRBA 4EBFA 3VPGA 2BH9A 4RPGA 3VZSA 4YAKA 3DBHA 4L74A 4LRTB 3G49A 1IL0A 4CV0A 1YL5A 3AW9A 2DTEA 4I5DA 3RBVA 2Q45A 1H94A 1G0NA 4KWHA 3VVCA 5JDCA 1ZH8A 3WJ7A 1AE1A 1LLUA 1P1FA 1XU7A 2X58A 1E3SA 3MWDB 4YR9A 4PLGA 1DC4A 2RCYA 2PR2A 3KYDA 1NFQA 4ND3A 3V2UA 2W2KA 3GDGA 1GV1A 2FMUA 2YV3A 3ZU2A 3OH8A 1NPDA 2P9GA 2J6IA 4EUFA 1E1LA 1T2FA 1E7RA 3INTA 1EQUA 1X14A 1NAHA 1KVQA 1MA0A 4OMUA 1XLTA 3WGHA 1H6AA 3KYBA 1GTMA 3JYNA 4OGWA 5T57A 3U0BA 1BXKA 2O3TA 4QEDA 5JMWA 3GVPA 4E5PA 3MCVA 4E2YA 5CFZA 4OQZA 3DFZA 2RHRA 1E3WA 4WNIA 1X0XA 1GY8A 1PQPA 4L9RA 5AYVA 1E77A 3N58A 2ZQZA 4QO7A 3LC7O 4R51A 1VI2A 4U8GA 4CM9A 1Q7CA 2EJWA 3DZGA 3KSZO 2R00C 5KJ6A 4OKNA 3PDJA 5LCXA 5THKA 3BIOA 3ZW8A 2XPCA 2D5AA 4B7CA 1I33A 2NACA 4J90A 1XCBA 3UF0A 3H8VA 1PGNA 3AUAA 2WJPA 4Z0HO 4YYZA 3D3WB 5EINA 4OL9A 4CL3A 3PWZA 1C14A 2NLOA 4FN4A 1ULUA 3PWSA 2NVUB 3VC7A 5MDHA 1F14A 4M54A 4MIYA 5C7IO 3WMXA 1ZIDA 2YJZA 4NG5A 1FXSA 4RPLA 4B7XA 5TLSA 1LDBA 4FBGA 3WJAA 2PTGA 2D59A 3UCXA 4K9DA 1PSDA 1Y8RA 2X9GA 1H2HA 2WE7A 4RORA 3TDKA 4BO2A 5L7YA 4JP3A 3GVIA 3RIHA 3ZV6A 5CHEA 4CM4B 5IZCC 3MJEA 1HDZA 2DBVO 4IDFA 4IIVA 3FN4A 3PFWO 4MKRA 4H15A 1ML3A 1PL7A 4CJXA 4NMHA 1Z7EA 3FSRA 4OXYA 3D64A 3EYWA 3F4LA 2Z1MA 1E3IA 4GMFA 1ZEJA 2GN4A 3ZWVA 3O8QA 4TKLA 2ZATA 3TRIA 3QSGA 2CF5A 4HKTA 5TT0A 5BSHA 1C1DB 1E3LA 1XU9A 3L4BC 4BNVA 3WGGA 1WDKA 4BHTA 4IDBA 3JD4A 1DIBA 3RU9A 1K6XA 1HDRA 3QVTA 4BNTA 1SOWA 5JNLA 2IDZA 3PJGA 4YAGA 2E6UX 4JROA 3OJEA 3OA2A 2UUPA 4IJUA 4X54A 3NT4A 1PQWA 4DLBA 3AU8A 5JS6A 2C5EA 2X4GA 1VKOA 4D79A 2Q2WA 4DGSA 2PD3A 2HMUA 1HWYA 1Q2XA 3B20A 1GYQA 1R0LA 1O89A 2IXBA 4J9UE 4W7HA 5K1SA 3WBFA 3DL2A 4M55A 1W6UA 1GQYA 1Q1NA 1XA0A 2A92A 3OQ1A 5EESA 4E2XA 3OFSA 4CLDA 3HNPA 2VUUA 4ZA2A 1EUDA 1KEUA 1DRVA 1LSUA 4RLHA 4F3YA 1X7HA 4OO3A 2FP4A 1K2WA 2Z1NA 1T1RA 4I5FA 4Q3NA 4MVJG 3TSCA 4XB1A 2J5RA 3TF5A 5KJEA 4FFNA 5DN9A 1BMDA 1HZZA 2AQIA 2IYPA 2YV1A 3DMTC 3MZ0A 1P1HA 3P19A 3U62A 1YQGA 1BTOA 2C20A 4PZCA 2J5QA 4GQAA 2RBEA 1FMCA 4E2ZA 5JBIA 3LLVA 4DBVO 3ENNA 2O3RA 1D3AA 3E6AA 3JSAA 4EI2A 2EEZA 2UV8A 1LRKA 2W8ZA 1UZMA 5IDYA 2PZJA 2I67A 3Q3CA 4FJ1A 4ITUA 5FF9A 4S3MA 2HK7A 2J3KA 4YT4A 4DRYA 2XAAA 5G0UA 3GUYA 4BKRA 3PDUA 1TLTA 4TSKA 4U7WA 3FTPA 1B0AA 3NDRA 1PU2A 4ZRMA 2FOIA 1GADO 4PRKA 2OHXA 2ZK7A 1PJBA 1QKIA 4IJWA 4RLSA 2NTVA 3ENKA 1FDUA 3L9XA 4WASA 2O7SA 3ZHXA 1WXDA 4NU5A 4WOKA 3C1AA 4ALKA 1DEHA 3S2EA 1EBFA 5T5QA 4WLFA 1UDBA 3HDYA 3ZNOA 2QRKA 5BSGA 4Y67A 4DMLA 3WR5A 4ND1A 2CSUA 3WTCA 5FI5A 4PIVA 5K6AC 3GUCA 2OXIA 4CM3A 5JDIA 4M1QA 3NDIA 4BNXA 3K5PA 1YB4A 3RQSA 3DHYA 2BGMA 1H5QA 1GYRA 3H9QA 5CDSA 3KUXA 4LVCA 2J3HA 1AGNA 3INGA 1A4IA 3PYLA 1Q7BA 1D8AA 3A14A 3FD8A 1DO8A 3E18A 4E5KA 3F1KA 2G76A 1LTHR 1M2WA 4YRAA 4RF3A 2XOXA 1R15A 1Z6ZA 3JQAB 1TI7A 1MG5A 2AMFA 4JK3A 4GMGA 3S2FA 1E7WA 4YDRA 5L95A 4GVXA 2X8LA 2HU2A 1C0IA 3VTFA 2AHRA 4XYLA 3BMQB 3GGPA 3TOXA 4A5OA 2HDHA 2TMGA 5DP2A 3QWFA 4ALMA 3L4SO 4KDFA 3VH1A 3JD1A 2DUUA 4DBZA 1KC3A 1V0JA 4GGOA 4IDAA 2E82A 5C5IA 1KYQA 1Z7BA 1RJWA 4UREA 3QVOA 3DBLA 3VH4A 3AFMA 3QE3A 5L4SA 4QSMA 1HT0A 1MC5A 1PJ4A 1EMDA 5DBIA 3U09A 2HUNA 1JU9A 3LC1O 4AJNA 2C7GA 1YBMA 1KIFA 1NQ5A 3ITDA 4YBZA 3WQSB 2XXBA 1JAYA 3TZKA 5B4UA 2AE1A 4E31A 3W8FA 3GHYA 1PTJA 3GNQA 3VDRA 2IEBA 4D41A 2D8AA 4MVJF 2IEDA 3KO8A 3Q2KA 4FB5A 3HZZA 5ICSA 1O5IA 2YQ4A 2FSSA 3W6ZA 3PHIA 1ISHA 4BV9A 2I99A 2C59A 5G4KA 4XRGA 3FR7A 8LDHA 1DFGA 1K5HA 2ZCVA 3FBTA 4PLCA 1TEHA 2CDBA 4DA9A 4J91A 3HUDA 3IOYA 1BRMA 1YBAA 4B7UA 6ADHA 3AI3A 2JJYA 3ICCA 1LDYA 3MEQA 4FFPA 2CDAA 4FPXA 2NU8A 3LLSA 3AJRA 3GVXA 3V2GA 3HWRA 5FWNA 5KTKA 2RIRA 1P77A 1LRLA 3BYZA 4ALJA 3U4CA 4RQUA 2PFGA 1UP7A 1ZK3A 3FNEA 3PIDA 4IGEA 2Y0EA 3H2ZA 4BMVA 4NJMB 2HRBA 4J49A 4Z9XA 2FRDA 3FWZA 1K89A 2OMEA 4CM7A 2Y1DA 2Y93A 4IMRA 4YXFA 1HYHA 3VH2A 4FCCA 4Z0TA 3KSUA 4NK5A 2QG4A 5JO9A 2JFGA 4ND4A 3WYCA 3IKTA 1EDOA 4G5HA 3ONEA 1NBOA 3UKOA 2Y0CA 3F5QA 3OETA 1QXSA 4R54A 1O6ZA 5I7SA 1PR3A 3I4CA 5JMPA 4AJHA 2VNSA 4CMIA 3EZLA 3OJOA 1PJLA 4MO2A 3IDSA 3SEFA 5A9SB 1XR3A 2HMTA 4RCVA 5B1YA 1ZW1A 5I7VA 5L40A 1DHTA 1N1EA 3I1JA 4HP8A 4E30A 5FFFA 4DREA 2VOJA 3ORFA 4KWIA 5JCJA 5JCJD 4I5EA 3RC2A 2CMDA 4KUGA 4UVIA 3ZV3A 4YCAA 4GVLA 5CEEA 4RZHA 1CYDA 4L4RA 4LISA 5T64A 3BMCB 2ZB3A 2LDBA 5GZ6A 4WCDA 2ZJ0A 2VT3A 1TT7A 3QLJA 4HUJA 2PNFA 3DMYA 5KIAA 4CM5A 1Y5RA 5CEJA 4YJGA 3RUEA 2O3QA 3KTDA 4QO8A 1B14A 5TNXA 1ZZEA 1GV0A 4PLWA 1R4MB 1ISGA 1B15A 2PLAA 4XYMA 1HTBA 2YHUA 1RYEA 1D1SA 3CMMA 4NFHA 4E32A 4XCVA 3X2FA 3K73O 1SCUA 3TWOA 3H5RA 5A3JA 4JJFA 3GY0A 3H4VA 2F1KA 3I9KA 4R01A 1YOVA 3VTZA 4GLOA 1AHHA 1ZJZA 3CSDA 5JSFA 2VYVA 3SJUA 1EDZA 3IS3A 5F1KA 3B1FA 2X6TA 3E9MA 1HZJA 1K3TA 2DUWA 4BO3A 1VRWA 4WLNA 2PWZA 4FJ2A 5DF1A 3V2HA 2Y0DA 1XELA 3CTMA 1E7QA 5DOVA 1UJMA 2FWMX 1N8KA 1NFFA 2VNAA 4J7UA 4YJFA 1U4OA 5TX7A 1D7OA 5TIIA 5L9AA 1ZK0A 3RWBA 5JAIA 4A2CA 4FOOA 4JP2A 1NR1A 2OOSA 4OM8A 5I9MA 4EUEA 3FNGA 1JW9B 3UICA 1S7CA 2AW5A 5DT9A 5CPBA 3C1OA 1YE3A 3DZKA 1R0KA 1H6DA 1YGYA 3IL2A 3WMWA 4MVJP 1ZXBA 3EVTA 3MOGA 5L51A 2E4AA 3GDFA 1ID1A 5IFLA 5B4TA 1LQUA 2IRWA 4P4GA 5DCWA 1PGQA 4CMEA 4MDHA 3D4OA 4KDEA 1GEEA 4IGFA 2PKRA 2JKVA 4YJHA 2EIHA 2GYYA 5L7WA 3RVDA 1ADGA 4GAEA 4J43A 5T8KA 2HK8A 2GZ1A 4Z3KA 5CPFA 5BSEA 3VPSA 1B2LA 3U4DA 4BKPA 3AY6A 2O7QA 5F21A 1DBVO 3FNHA 4E5YA 4RPJA 1O8CA 2C2XA 1I24A 3WQRA 4TRNA 3DZHA 4XWYA 3E82A 3TZCA 3WGTA 2B5WA 1HE3A 5JAMA 4NFSA 2GUGA 3D1LA 4AVYA 1Y81A 2Z5LA 1U3UA 1V3TA 1PWZA 1ISIA 4QECA 2FZWA 4W99A 1UP4A 4PG6A 4RDIA 2X0IA 4OIMA 4JN6B 4AICA 4HWKA 3WWZA 1UAGA 1YKFA 3AI1A 1C3VA 3NV9A 4KTTE 2SCUA 3EW7A 1CRWG 1ZEMA 4R69A 4J0EA 1VSVA 1E6UA 2EG9A 2VT2A 2VN8A 1FF9A 1Y7TA 4IZHA 3RC7A 3ZWOA 4WPGA 4CM1A 4DPMA 1U1IA 1LSJA 1XIVA 3AY7A 3BHJA 3RKRA 3SC6A 2IE0A 3F4BA
chains in the Genus database with same CATH superfamily
2AT1A 1TUBB 2I6QA 2PN1A 4OU5A 4Q3KA 3BTUA 2G82A 3RT7A 1E66A 4LVNA 2ZI7A 3F2IA 2BSAA 4RJ2A 4ZQEA 2E55A 2QE7A 3HYLA 5IVDA 4LXTA 2WJWA 5K3SA 4KQHA 1NRWA 2X2EA 4MS1A 3C3AA 2DFPA 4HGZA 3OSUA 4DOMA 5K0JA 1TM1E 2OBNA 3QKWA 4KPFC 1HT1E 5AJYA 5FORA 3VNRA 4YCBA 1D0SA 3A1DA 4HR7A 1XTBA 2Q28A 2Y1GA 1N9ZA 1RRMA 2GO1A 2EWMA 2ZB7A 3D54D 3KZVA 5E6RA 4DB4A 3M5PA 1L4GA 5LLSA 4O3FA 2NO5A 3KDSE 4WLVA 4TT3D 2CZQA 1KEKA 4PG8A 1VYVA 4DBLE 2A5GA 1ZX1A 1HA3A 2P8SA 3MFYA 4DMGA 4O4HA 3C7TA 1Z83A 3UUWA 1LBIA 1VB5A 3CVUA 4G23A 2ZIXB 4Q01A 5HDQA 1SU4A 1JRLA 1NP6A 5M5BA 4CEIB 5CLJA 1XDUA 3P0EA 2QUHA 1BVRA 3JQFA 2WLSA 4Z51A 2ZUUA 3QFFA 4RDHA 5C7LO 4FC7A 3Q5EA 5IRCD 4MA0A 4UAGA 1N3BA 3UMMA 4LZNA 4IDEA 3KXPA 1TIKA 3BGOS 3DZ8A 4DDUA 2XCTB 4PX5A 4LJ9A 2Y76A 1NASA 1LQTA 4XUDA 5ALWA 3NIFB 3UBMA 4F71A 1EUZA 3FVQA 4CQLB 3EG9B 3A9SA 5EMLA 3TL6A 3QI7A 1JSLA 1K08A 2PIDA 3VI3B 4RDXA 3ZYCA 5DYTA 4JOSA 3JAKB 3FETA 3AM1A 2OYSA 1NZDA 2CLEB 3OLQA 4XGNA 2V7BA 2P11A 3TK1A 3QVKA 4EELA 1I8TA 1NPTO 2WJHA 4KYUA 4AN1A 1DQSA 4KAXA 4XWTA 4Y7DA 1XN4A 2AMJA 2EGUA 4HDRB 4Q4JB 2PBFA 1E69A 1R00A 1CHDA 2C4MA 2ZTSA 3IUYA 2CB9A 2Q2QA 3L0ZA 3MCTA 4NICA 2KLBA 1R0WA 4BUCA 4QFDA 4P93A 2J9YB 3ETEA 1ZNWA 3PRYA 1EG2A 4OH1A 3AV0B 1Z0FA 2QUBA 1MAHA 1N2CB 1EDEA 4PZYA 4YTEA 1OC2A 3LF1A 4EHJA 3PRJA 1YJ5A 3PLAE 1G9XA 1I2BA 4KIWA 4JUCA 3H18A 4ARCA 3BMNA 1B8PA 1U3FA 1D0IA 1UP6A 3A1NA 3I2GA 4HLNA 2WYOA 3G3EA 5DN6D 3HA5A 4LE0A 1T4CB 3GFPA 4AP6A 2W2XA 4RY2A 3GCDA 3R2JA 5LA6A 2O19A 2HKIA 3VZBA 1QPBA 1OFGA 1FDTA 4BOYA 1FVHA 3VPBA 1VPWA 4ROTA 4OHFA 4LJSA 2V5AA 4EMUA 3AP1A 4F3KA 1ZC3A 5JH7A 1ZR2A 3K6JA 1O8BA 3DW1X 3S70A 1AQUA 1EX1A 1RM4A 4NFLA 1N7JA 2QSZA 3K0HA 4RPCA 4BDSA 3C7CB 4XIGS 1V25A 5JVDA 3DC7A 4Q9DA 4ZJYA 4WK2B 1Z2EA 4GYKA 5A2GA 2ZXEA 4YP9A 1YFKA 4OXKA 5FOTA 2NQ8A 3ZDXB 3LWNA 4ZT6A 1XP8A 3SU8A 3ELWA 1NLZA 3LCVB 4N3NA 4HFMA 3GLGA 3P2EA 1F48A 3HO8A 3M4JA 3MWDA 4ALIA 1JGTA 1QQ5A 2HXSA 1RWBA 3PJDA 4X5OA 5BW5A 2BFWA 3ELBA 4FFLA 1UM8A 3PHBE 5FNVB 3FTCA 1IZ9A 3QH4A 4II3A 1I2ZA 3I2KA 1UBSB 5FO1A 4REMA 1NBME 2BLLA 3UM9A 4UBKA 5H68A 2PLNA 3SIPA 2MINA 4AROA 2C9BA 1LWNA 2P2DA 1QMGA 1Z74A 3I5YA 4HZUA 4I6EA 3STWA 1EE2A 1COZA 3DPIA 4ESVA 1E6LA 3FFAA 5KHAA 3E9QA 1LK7A 3NJ8A 2B1QA 2XUQA 1I4WA 4GZ3A 2XQJA 3LQQA 1K92A 3G6WA 5CM9C 1TQHA 1E1RD 1B2RA 1JTVA 1IAVA 1RPJA 1SCKA 3HEBA 4JUFA 4Z1MA 5C53B 4M1YA 3HSSA 4C4PA 3GOHA 2YOFA 2VATA 5AI5A 1X80B 5TGZA 3TGLA 1Y3HA 5EP4A 1BC5A 3KXLA 4X7RA 2C7PA 2EL9A 3I62A 1JBQA 3F6SA 2NUAA 3LIIA 3QKRA 2BEUA 4JA2A 3HR4A 5K0SA 2V6GA 2QW0X 3ICPA 1NYTA 2W0MA 3D4IA 4M4SA 1RPAA 2ZB8A 2WP8J 3FNIA 3FYTA 3L7JA 2O4CA 2G6TA 1ABFA 2OQIA 1XQ9A 4EKGA 3CJQA 3VHLB 3WNZA 3A6JA 1N33B 1E8DA 3RRFA 1I32A 1NQXA 1VBMA 4KXXA 4LY6A 4FQ7A 4W7IA 1G19A 1SU8A 4FXPA 2ZQ5A 4GM1A 1NC3A 4YCDA 4RAQA 2PYZA 2I78A 5C8YB 1YCHA 2AF3C 1G21A 2TRSB 3GF4A 4NCIA 4IIEA 3UK0A 4KREA 5JROA 1NXPA 4UHCA 3GG9A 4MRRA 1XCPA 4L4SA 3DT9A 4Q15A 3ZBTA 3GI1A 1UFOA 4CLHA 4C29A 5JCPA 3MCAA 1GPJA 4U9IS 5HGJA 1CUYA 1H1DA 3ANLA 3I9V1 1THTA 2L0XA 3S8YA 2FSVA 3M1LA 1JLKA 5FV4A 1A9PA 2JCVA 3R44A 2JGAA 4IDHA 1OH8A 2A9KA 1YFZA 4DIBA 5C1BA 4CMBA 4GD3Q 2B1IA 3DLCA 4NQRA 1GFSA 3D8NA 1L8QA 4O2RA 1NQOA 4MCJA 1CB0A 2ZI9A 1D2MA 3K1AA 4ZAYA 2XYGA 4FYYA 5I9BA 5KVVA 1IN6A 2B0JA 3LQ2A 1FZTA 2Z4RA 1SCBA 3SEQA 4S1VA 2NX2A 3GPDG 5L3SB 1II9A 5I7FA 3B9PA 3NC1C 5DMHA 1LDEA 1BGVA 3QGMA 4RL6A 2WWTA 3V4SA 2FPOA 2ZYGA 4A23A 2Q1XA 4OKIA 4WZ6A 2B2NA 2EBHX 2G5CA 3GP8A 1KQFA 5ICMA 3DBIA 2H17A 3H99A 1R4ZA 4PWYA 3RR2A 1HDGO 3FMIA 5KNCH 5EWMA 5JASA 1JKFA 3C6XA 4OGKA 1JG3A 4KN6A 1YE8A 2C98A 4UNSA 2I87A 3V1UA 3WWYA 5KNDD 3ZWNA 4EY7A 2BW0A 1T3HA 2C2ZA 1U2DC 1BKDR 1DAEA 1U9YA 1W46A 3ILSA 1WMEA 3FVWA 1QORA 1PHPA 2AHOA 2BBWA 3KAKA 4XX0A 3O2NA 5U1PA 3W9YA 5IWAB 5BWNA 1UM9B 3MGBA 1ZMOA 2I8CA 2GS9A 1TA4A 4NJEA 2JLWA 4QVGA 1CJSA 2QY9A 4QXOA 5K6TA 3CEJA 4HNUA 4BKOA 1FZQA 2NPIA 3CZRA 4M76B 3VC1A 3IKTA 5EIEA 2P67A 5T4EA 1YS4A 5K0CA 1IJEA 4F4FA 1PT8A 2OCBA 1ST2A 3Q0TA 4BP9A 1CUCA 1M2NA 4EYQA 2PWYA 1UKYA 1KMCA 1XCJA 4QGAA 1AS3A 3DAGA 1CE8A 1KOFA 2AN4A 3LA6A 1JQ3A 4F11A 4ZOCA 1B00A 3PC6A 2EF1A 4X0EA 1XTKA 1FQKA 1I0IA 3MLBA 3MJSA 1VE1A 3EH2A 2CCJA 2JCGA 2O1XA 1L7BA 2QYTA 1Y4AE 3QMPA 3HA7A 1ZYUA 3B6ZA 2MR5A 3LRPA 2FLVA 1HDYA 2ZUTA 1LI4A 2WUEA 2GPNA 1VZ2A 5EE1A 1G6Q1 1NSYA 2FPIB 2ISSD 2JDIA 3DE3X 1DIAA 3GG2A 3K9NA 4G6ZA 4NP6A 4QBIA 1FFCA 1QQ6A 3EXG1 3OJLA 4MVJD 2O8NA 1ZSNA 5AKIA 3RU3A 2GM5A 2EFGA 3NTLA 4IR7A 2C9OA 2XY4A 4YT8A 1GG8A 3KJNA 1TJ4A 2WYHA 3DYIA 1VDZA 2EKQA 4B4UA 4DMKA 1ZDMA 1AUXA 4R41A 1FYXA 5F4ZA 5IUJC 4PZ0A 4Z4CA 2PAFA 4X92A 2KLHA 5AOCA 3RFVA 4JOQA 2QGZA 3KB6A 4A10A 5BOVA 2CNBA 3EOBI 5C3MA 3WOHA 1L8LA 1PJAA 2GCNA 2VEOA 1G3QA 3BWEA 3KBOA 4ZCPA 3UHJA 3MTQA 1H2WA 1P9OA 2XQVA 3MGKA 3OKFA 5TPZA 2RHWA 3PHHA 1SVNA 1IK4A 5IKOA 1FFDA 5ECDA 2A3RA 1LF0A 2VJMA 3VC2A 3NYWA 1PUJA 2G08A 3FLMA 4IMPA 3TRFA 1EK5A 3DBVO 4AECA 3GZTB 3KEQA 1PW7A 3D59A 4OHKA 1ZOLA 3F5SA 1RMQA 5TQ2A 3IB3A 4K05A 5FL7A 5AKJA 5B64A 3DHNA 3CSSA 4OQYA 5I47A 4IXNA 4TL8A 4IFEA 4XPZA 2GDZA 3P71T 1DC5A 4B80A 3ZDCA 5CAEA 2OHJA 1MRSA 1NOIA 1LDGA 4PHGA 3V2IA 3OWXA 1I1QB 4GPTA 2VHZA 1T3TA 2Q9UA 4Q1FA 4ZEOA 2X41A 3TZEA 4RVOA 1E2FA 1UR5A 1Y37A 1U9IC 3FGZA 5K0NA 1AV6A 2H0AA 2IDJA 1ODCA 4DANA 2H9IA 4BZWA 2NM0A 3BX1A 4YIKA 2CNNA 3NFYA 2RHOA 3RS3A 2AB0A 1DADA 1E2UA 3SKXA 3TQCA 1PR9A 1RT9A 3W04A 3CWCA 4NCNA 4WBNB 4AN4A 3VVMA 3PA6A 5BV0A 1SZCA 2FPPB 1QCZA 3USCS 4RPKA 4ZVOA 3ZI7A 3TMKA 3BMQA 5ELLA 1NRJB 1SCNE 3HPRA 4JSYA 2JGDB 5HW0A 1A8SA 5HTOA 1Y5LA 1AKWA 4FYJA 4OQPA 4R81A 2HNKA 3AB8A 1LPAB 3K5WA 4BB9A 1Q5PA 4XSGA 4YMSA 5AJVB 2RARA 3QVSA 1JUDA 3ROPA 4CI9A 4FT2A 5CTJA 2A9JA 2AN1A 2O1WA 2WTEA 2H5EA 3M3HA 3U3ZA 3WGUA 1L5NA 1MV5A 2ZUCA 4DG8A 1FFEA 2ANBA 4MIKA 1EA7A 1GHTA 1FYVA 1US8B 3NYQA 3QYAA 4HEA6 4PBSA 2ZBDA 1V48A 2EGHA 5BV2P 1SBYA 3EXFB 1IN5A 2HCRA 2OD9A 3IEIA 3RJ5A 4AJEA 4QM7A 3W5UA 2JIDA 2XUPA 3L41A 1WHTB 5BVHB 3K31A 2OBBA 1RJ9A 1Q16A 4K8RB 4G25A 1REQB 1C2YA 1TCCA 1CY7A 3SVLA 4FDLA 4BQPA 5AW7A 2JLXA 1I4LD 1P3DA 2QR2A 3IOEA 1U7XA 2BM1A 2W00A 4M0MA 2BI4A 4XWGA 5A4JA 2Y1WA 3D4PA 1GGEA 1N5LA 2L69A 1H2BA 2PQ0A 4JOBA 5SY9A 4R4JA 4EA6A 1RWOA 2VHQA 4YGYA 3CGWA 3SHQA 3AMVA 1ZA1A 4B3JA 4PSKA 5J59A 2WIBA 1UQTA 3FIJA 2JFYA 3OIDA 1ZGJA 4KTVE 4GEKA 1QKJA 2DOKA 2IEYA 2IODA 2TS1A 4FFMA 3ZZMA 2WF9A 4KLNA 3KKNA 4BQRA 1E5LA 3TIFA 3CR7A 4PTZA 5AKZA 3WSVA 1VJ1A 4BB5A 3MMSA 1YFJA 1YS9A 2XKBA 2V7EA 4IHAA 2V54A 3SR4A 4BAZA 5BQ3A 5CCEA 2WFMA 1WQ4A 3GGJA 4EX6A 3LUKA 2VUHB 1DS6A 1CF9A 1KKLA 2BEKA 3DVLA 3AHJA 4PZDA 5PNTA 3R40A 3GD5A 4H1VA 1MMFB 2CDCA 1E5XA 4IKPA 1XDSA 4L8YA 1S9HA 3SXPA 2D4HA 5HNKA 5COQA 5F1PA 2E85A 4FR5A 4OHYA 2VDVE 2BR5A 1W2HA 2QPTA 3U7IA 4CMCA 7MHTA 2UVDA 3NAGA 3OQJA 2JC3A 4OSOA 1KS2A 3FHJA 3TVYA 1KNXA 1ODIA 4P4SB 1ZUNB 3HN7A 3AUSA 4KZPA 3N6XA 2PCJA 1R0BA 1OXTA 1E9SA 3GUHA 3IUQA 2NZVG 1JHMA 1ODJA 2GTPA 3JASB 5IPFA 3F9CA 4H6VA 1O5OA 2X7JA 4PBTA 1QHHA 3CQ9A 4KUEA 1CQWA 2DXIA 2XTNA 1KEEA 2HSDA 2AMYA 2W6JA 1P29A 2A59A 3DGEC 3BJEA 3DTVB 3S2IA 1ECPA 3EPRA 1FRQA 1ORIA 3V1LA 4ZVPA 1DFHA 2GUWA 2XUGA 3ZH9B 4P3PA 3RHZA 3KOYA 4UUPA 1XAHA 2Z5VA 1I10A 3D5QA 4I9UA 1NMSA 4RE5A 2D2IA 2XXJA 5E3JA 1POXA 1N0UA 5HJ2A 3E4DA 5AVUA 3STUA 4ZT5A 1KL7A 1JQBA 3LY7A 5A6SB 1WDTA 2NXWA 4OH7A 4QODA 5C1IA 4CIWA 3GDHA 1ODKA 1P45A 2P75A 1N9GB 3R3WA 3H3FA 4JHXA 2Q27A 1U1GA 1V39A 1KH3A 1XGKA 3B5JA 3PUJA 3FGOA 1GUYA 3UAZA 2F3UA 3U7QA 2DWCA 5JNSA 1IZ0A 1PJTA 5K0LA 1QTQA 4KVZA 4Q3OA 2A94A 2G7MC 3C8MA 1P61B 3KR1A 5JIBA 4N6NA 2QQEA 4C6SA 4DV3B 1T6NA 2NU9A 1JQ5A 4KN8A 4BNGA 3FF1A 3OFNA 3PCTA 3NANA 4YJ2A 1L8XA 3GPIA 1ULAA 2B7LA 1F0KA 1GCIA 2W2LD 3AKCA 3QM1A 1NMXA 1NL3A 3H17A 4BU1A 1UWVA 1CUDA 5A71A 4S12A 1VGVA 4A2WA 4KPYA 3PDWA 4GOXA 4E2WA 3RBZA 2F43A 2BR4A 3K0AA 1JAHA 1YCDA 5IEBA 1G8MA 4YXWA 3SXUB 4D3FA 5LD2B 2W2TA 1KP2A 1ZH4A 1W8IA 4LY0A 2VYVD 4IAOA 3AG5A 2PMDA 3PV0A 1Q95A 4UTPA 3G5AA 3ZDYB 5HBRA 4BFTA 2QNIA 1ZD1A 4C9BA 4TKVA 3FPBA 3PVSA 4W1SA 3JQCA 1X87A 3NS7A 2IX9A 3A36A 2GPBA 3DV2A 1T9AA 1UIRA 2JIBA 2OO5A 5U9CA 5C4IA 2FPLA 2YVUA 4Q21A 1MB4A 2HDOA 4B9AA 2FQYA 1PFYA 1W1WA 3JARB 3L0IB 4NARA 4ER0A 2C8KA 3FWHA 1MLDA 1XRRA 3EZYA 4K9LA 1ZW6A 4Z99A 2IYYA 3HZHA 3P52A 3CCCA 3GLFA 4LF9B 4ZAGA 5J2TA 3PR1A 2FEAA 3TUJC 2XMSA 3BTVA 2VP5A 4L1KA 2R5NA 2ZAIA 3FY4A 1WTCA 1QGED 2DQZA 4AKIA 4AJKA 5IKPA 4BGVA 1OU0A 3K1YA 2HLPA 4N9WA 3D8TA 3X1MA 3LT4A 3IQZA 4ALLA 4FHCA 4J94A 4I4CA 2HCBA 2Q21A 3D2CA 3JZAA 5JISA 1AZTA 4L9AA 5ALMA 1N1GA 3BMOB 1GNTA 5TR9A 3RSFA 1JA9A 4HMPA 1T34A 1W1UA 4BVLA 4UFPA 2QLBA 3BFJA 4FNMA 4R2IA 2EAUA 3ZI0A 3COSA 3SD7A 4BP8A 2YMQA 3UIEA 3Q9LA 1ISJA 1Z8DA 1RZ3A 2ZR0A 1YKGA 4DCNA 1VYHA 1V37A 1XJCA 3TW0A 4DM4A 1V1JA 4FWBA 1U1FA 1OZAA 2RHJA 3CURA 1MDFA 3ZX4A 3W9BA 2W4IA 5TT1A 1E5VA 2YY6A 1OVGA 1QH1B 1XNJA 3M3PA 3M70A 1JDJA 3AR4A 4XJVA 1V9SA 5LBIA 4OFWA 3UG6A 3I0NA 4XDZA 3QY0A 1PJ2A 2OHFA 5TQ0A 4DTIA 2B21A 1XLTC 1K7FB 3DFFA 3DKIA 3N6RA 4JI3B 4MW0A 4WRRA 3PS9A 1TB4A 2X0JA 1XEXA 4XOUA 2O48X 4NYJQ 3DYBA 3EN0A 4CDGA 3HRHA 2WM3A 4HJXA 1HFWA 2AOVA 2XDAA 1RYNA 1HE8B 4GUDA 1P7VA 4Z9YA 4DQLA 4ES6A 6LDHA 5ES4B 2YNMD 2WIKA 3EXHA 2QDXA 2RGXA 3OZTA 4H4EA 3P8ZA 1ECJA 5EKTA 2CXTA 4L6CA 5I48A 1P3Y1 1R50A 1XVUA 1GRVA 3TJZA 1VFPA 2VP0A 2X0NA 3QLTA 1V4VA 2XWBF 2JI9A 2XCUA 1AN9A 1EVLA 3AESB 3A0UA 4QTZA 4BNLA 4CODB 5MN4A 3K6SA 3EQ7A 4Y6OA 3RE1A 1RPTA 3EVGA 2VA9A 2QN1A 5FPKA 5KAMA 2V3CC 1L7AA 1P0MA 5JXHA 4LVUA 1UFVA 5AVXA 1TJ5A 1MP0A 3GLHE 3BQNB 2V9CA 1EGHA 1EK6A 4I50F 4RK6A 2C2OA 5HPYB 4QTYA 2XSZA 1QVWA 4E3ZA 3UCEA 4MKIA 1KY4A 7MDHA 4CLRA 3FNQA 1JFLA 3ANXA 3LPMA 5J23A 4MO9A 3NMUF 2OV8A 2QX7A 3EDMA 3RF6A 1XZBA 2R8ZA 1K0UA 1R12A 1GKLA 3A70A 3OCWA 4WUTA 4FLMA 1ORVA 1RADA 1UBFA 1AU9A 1IHUA 4ZD6A 1TE2A 4J2HA 2CC2A 3O2QB 5CM2Z 4GX5A 2DBQA 4JEUA 4M0FA 3DE2X 3GFOA 5J5CA 5A5VA 3OA0A 1G8JA 1CUSA 3OU7A 2ZUBA 3H1EA 3DF7A 3WK8A 3VNUA 3LKVA 1MO4A 4QZVA 2WUVA 3VC3A 4C4OA 2CBXA 3P9QA 1K1EA 1EE9A 3V8PA 4C1BA 5GIOE 4TXHA 1PNOA 5CR9A 1TZMA 4G9GA 2JVJA 4HPWA 4U7JA 1L5SA 4HAWA 3MT9A 4TLCA 3WQHA 3I2FA 2YXNA 3H9UA 2O5RA 4M1TA 2ERYA 3LOUA 3ZOZA 5LBTA 2TYSB 5K3BA 5T4BA 5JC1A 1GPLA 9ABPA 4HWOA 1QGUA 3QXXA 4TM8A 1XZCA 2GD6A 2AFIB 3E7FA 3OSZA 1BYIA 2C9CA 4MTLA 1TPZA 2GWHA 4ZI7B 3OTHA 3VBCA 1Z2DA 2C5BA 1N7IA 3SBXA 3HWWA 1YZGA 2X0FA 4ZZ1A 4BEWA 4ZYWA 3QJ5A 3DCIA 2VHUA 2PO7A 1OTHA 4LXIA 4OF4A 3LA8A 4QA9A 2WY2D 4R5HA 4O0LA 4YB8A 1JIUA 2EP5A 3G0BA 3Q5GA 3TUIC 1FFYA 1NYRA 1G2OA 4KH1A 4EJSA 3THWA 4P53A 3A32A 2VTBA 1WETA 1IHXA 3C87A 2H1VA 3WNCA 1CQPA 2VWGA 4KCGA 3NM6B 3Q8WA 1J8MF 1KKUA 1RHRA 3RTEA 4R31A 3MS4A 4J6EA 5ANRB 3L6RA 3PUHA 3Q3JB 5KSPA 4RY9A 1A3CA 3DO6A 5GONF 1VSTA 3NM5A 1W47A 1RRCA 1SZPA 2V5UA 4I4TA 3QWHA 3PDCA 1IC6A 4DGQA 5KQLA 1Z4LA 2XTAA 3U0VA 3A1FA 4A6DA 1IUKA 1ZMBA 2VJLA 3JYLA 3KOOA 1A9ZA 1XAGA 1Y8QB 1J2TA 1TYZA 5ULLA 4DS3A 2YJ4A 1NMQA 1Z0KA 3AUFA 4Y6QA 2AUTA 2C7QA 4DUPA 1XQVA 4AW9A 1QV9A 4QUHA 5FI0B 5HKOA 1QF6A 3IPCA 3LX5A 1GRRA 2E4ZA 2Q3LA 2I4LA 3ADOA 1BROA 2EEPA 3IPYA 4X24A 5ALZA 1U80A 4DLAA 1GL6A 4Y2XA 5C4MA 4L76A 2CJWB 3EA0A 5AVRA 3FZEA 2OZPA 2HDWA 1Y98A 5C52B 1RI4A 3I0ZA 1CR6A 1HFKA 4YIHA 2QX8A 2PG3A 1Y5IA 3PXDA 4PG7A 4B2YA 5I4CA 2OUIA 3SFTA 5AP9A 4L0QA 4NH0A 1LW6E 5JD6A 2ZWPA 5JW6A 3DEZA 3PPYA 5A2QA 1O95A 2I6GA 2VR1A 1RQLA 3BVPA 4PE5B 1DKRA 1JEAA 3P2MA 1EZ4A 1RJGA 2O05A 3O4GA 2FW7A 4L4UA 3VGJA 2DM6A 4NYJR 3RV4A 1U0JA 5EQJB 1T2VA 4HH4A 2DWUA 3OC0A 3PUVA 10MHA 1R16A 3VYVA 2VQSA 4URFA 3TLGB 3LNCA 2H5LA 3DTTA 4D45A 4MA4A 2QVCA 4HB2A 4KQ6A 4JYAB 2DULA 2D2VA 3AF0A 5K3CA 1DIRA 1EPUA 4M1WA 3PC2A 3JQBC 3EVDA 4V24A 4AF8A 1YACA 5JYEA 5MFZA 3UMFA 1ZM3A 2R751 2HLDA 5M7EA 2IHNA 1DLJA 1SD5A 2WSSA 4MS4A 4W1QA 3R7WA 5F98A 2IUFA 3HB5X 1N5IA 2HQBA 3BL8A 3CUKA 4Q39A 1NI3A 3VR6H 1VCHA 4E1VA 1WCWA 5FH9A 3GU3A 3ESZA 4MP3A 2QZPA 5BN1A 2NTEA 4QUDA 3RS7A 2OB1A 3L6EA 1DT5A 3I9JA 3NHKA 3RLFA 3HYNA 5BV1A 4PZAA 1GA4A 3IHKA 1ZGZA 2F1JA 4KX5A 5D51S 2GXSA 2JKYA 3EH1A 3GRRA 1UMDB 2G8LA 3GP5A 4OJNA 4Q9IA 3RT1A 4YRNA 1M72A 4HNVA 1RP1A 4DA4A 2VCEA 5KCZA 4UPDA 5E9QA 3I83A 4QICA 1ESZA 2OEPA 1NVBA 3LUFA 5F7ZA 4XI9A 5DLDA 4DSTA 5KYXB 1QPZA 4BE7B 2BRUA 4C6RA 3AY3A 4XE5A 3WL6A 3WLFA 3KYDB 2NO7A 2IYEA 3UVEA 3WRVA 4X8MA 4TLAA 4B76A 4EZIA 1QK3A 3KT8A 5HMMA 4Z1MD 4RHYA 1TM5E 2H6EA 2OT3B 4GI2A 4JQSA 4CWAA 5JY1A 3MMZA 1PZGA 4X8LA 1NUPA 2XGGA 3GQBB 1HEUA 2OG2A 4FE7A 4I5GA 2ETVA 3GAZA 2ZWOA 3FCCA 3PQ4A 4CKYA 1GRCA 1O97C 1S3SA 2IHJA 2OD2A 1J0BA 1PDWA 1X19A 2WIAA 4B4DA 4F9TA 1OB2A 5F52A 5LOVA 4I99A 1DRKA 3QVLA 2PK3A 4OBEA 3OHSX 4HNAB 5EERA 1YS7A 1A2BA 1R66A 4Q00A 1B3BA 2Z98A 3MT7A 5EC8A 4XGRA 4DLUA 1U99A 1OFTA 3ND6A 4JLAA 2C03A 3MJFA 1FNDA 1B74A 1RQNA 4JKYA 4P7BA 1WZEA 5CFRA 1XVVA 5CA1A 3SMVA 2XQGA 4FWTA 1V4NA 4XUGB 1E1YA 5A7FA 2OLJA 3HP1A 5HSGA 1KI1A 3CW8X 3R0VA 2AGVA 3JALB 2ZSEA 5K51A 4L73A 5AVZA 4BVBA 2VJBA 1SQFA 3NBZC 1EI9A 3LF2A 4IFIA 3SR3A 4ESEA 1MAWA 3NH9A 5LIPA 1BXGA 4CUJA 4H3VA 4L7VA 1AB5A 3CF2A 4RF5A 2GQ0A 1J20A 2O2IA 4G1VA 1UMCB 2N9UA 4H17A 4LHYA 4UM5A 5SY4A 1JSZA 2EG5A 3U1TA 4D6YA 4UTZA 4GX0A 5EP1A 3OHMA 3QF7A 1Q14A 3HPQA 3H97A 1PTJC 4EHLA 2J0SA 3MB5A 6Q21A 3DTYA 3N2IA 4EJ6A 2AUMA 2FPRA 1YB1A 4HAOA 5EN4A 3EHEA 2Q3CA 4NWIA 4R2WA 2YN2A 1XPUA 5LDGA 1MT0A 4C04A 2CXSA 1DX6A 5CCXA 3F71A 4NVRA 3G8CA 3KSMA 4TVKA 3KUDA 1DB3A 3L5KA 4TTPA 1N25A 2ZKIA 3TD6A 4H0CA 5D7NA 4L8WB 1VKZA 1XEWY 2BBTA 3HL4A 2RGBA 3TKYA 3EGWA 1TK9A 5JWOA 3MK31 4AUNA 3P96A 3THYA 1X9GA 3ZXSA 3ISVA 4KBGA 3FHCB 1OLXA 1KZGB 5HK9A 2IEZA 3SHOA 4DVGA 1NVVR 3RYHB 3H5TA 4WLOA 2H1FA 3OOWA 3C85A 3T3OA 3NG1A 2FSGA 4DIUA 1QDEA 1FSFA 1KPHA 3U49A 1XMOB 4JL8A 4WKOA 1URPA 4NIMA 4JDUA 2H1WA 2ODAA 3L77A 4WESB 4YP0A 5K4GA 1N3LA 4KXFB 3UMGA 5FUYA 2M2IA 4C2AA 4IZOA 3E27A 2G1UA 5T3UA 3AFIA 3OZXA 1EVZA 4I1IA 3F2VA 4NNOA 5DH9A 1W88A 2REOA 4J2OA 2QN8A 3D31A 4DQXA 3OY7A 2IYZA 5CFPA 3KT3A 2XUFA 2X9VA 3GDOA 2H54A 2VPIA 2SHKA 5K99A 3EZGA 1SRQA 4ZXPA 5F2OA 5SV2A 4FFRA 1KMIY 1SCAA 2A0XA 3H1TA 3KQOA 4KQFA 4U0KA 3BAZA 1SELA 3GXOA 3TBHA 4CIVA 1VJ0A 3KHKA 2OCIA 3U3KA 4E70A 1UXJA 3MTGA 1IXKA 1T6YA 4US2R 1T8UA 3CY6A 3OZDA 2PT9A 5JLJA 4J1TC 2GERA 2GRUA 2JDID 3N9IA 1T0BA 3ANMA 2DU8A 4KOEC 3S1AA 4P3NA 3CUEF 4UMVA 6GPBA 4E22A 4PFJA 5CP8A 2O3SA 1T36B 3ENZA 4DLXA 2HOQA 2IZ0A 4BXOA 3WNVA 3ZV5A 2WIJA 4IXDA 1K7SN 2TMDA 4G1MB 4KLAA 4OQEA 4OY3A 2VF8A 3DS8A 4QUGA 4CG1A 3U19A 3FB1A 3ND7A 2FP4B 2R1VA 3QELB 1CIPA 4JLNA 4WECA 2YW9A 1UBEA 2GASA 1WZUA 1ICIA 1PGPA 3CBQA 3W7BA 2BFBB 5I8WA 1LDMA 3AGQA 3IHTA 3NR2A 4D9FA 1DKPA 4P92A 2Q8QA 1TK3A 3Q6NA 4GU5A 3P97A 3TNLA 2NYRA 4ZVLA 3VOAA 2GFHA 4A8JA 2DWOA 1F7VA 3UKJA 2HB6A 1P91A 5TPZD 1APBA 1ZSVA 3PFHA 4OA5A 3VHXB 3F8WA 4L22A 4DIDA 3AERA 1DDGA 1ETHA 3EJWA 4DUGA 1JP7A 1SWVA 4EFLA 2ZJ1A 2D2FA 4PZUA 5TMBA 4IH1A 2HSJA 5DLQC 5KTOA 4CEHB 3NHYA 3T7AA 3QUQA 2IXAA 4PZZA 4QBTA 5KNBA 2O59A 3LW7A 3FPLA 1L5RA 5H82A 3T3PB 4BNKA 1RR6A 1KRHA 1L7DA 1VL5A 2PUVA 2V8BA 2W2NA 2HWWA 2QAGA 2HV9A 3DE4X 1U1DA 5E6SB 4F9FA 3T1QA 2WPDA 1MUUA 4KXLA 3PT9A 3DV0B 1Q3HA 2NO1A 4YJ3A 3EGXA 4M9ZA 2HWYA 1P4RA 5J47A 3CUSA 3RAJA 4HRXA 1SKUA 3I9FA 4BGDA 4K6CA 4YRRA 1LJUA 5JI3E 1CD5A 2Q0HA 3IAHA 4JBLA 4Y98A 4KQ1A 5FB3A 3VTAA 3I6YA 3H5NA 1FUIA 2GHTA 3EQ2A 3JWPA 1P18A 2G25A 3HBFA 3KLBA 1WOMA 4MVJE 2KB0A 3AUYA 3BQ9A 5ECYA 4N5HX 3LRTA 1E0SA 5TEVA 4E5DA 2YXLA 1GQOA 3NOXA 1PR0A 1X1BA 2P2NA 2X3FA 1AQYA 3MC1A 3H87A 3NEYA 1F0NA 4KWTA 4UD6A 2P78A 4PLYA 2GPYA 1T2DA 3VU1A 4CEJA 3IV9A 4LDQA 1IXRC 3EQ9A 4GYYA 2YRFA 1VJCA 4JKIA 5HCUA 4YO7A 3JXEA 1SR8A 4HWRA 4C08A 3K2IA 1Y9DA 3UJCA 5AWFC 4EARA 2XWQA 3WTBA 5IZ4A 5KHOC 3KZCA 3IR5A 4Z5XA 1XYVA 2OAQ1 4KW7A 5L3ZA 5TGDA 3FX2A 4IDDA 4BMXA 4BMYA 5LR6A 1TJYA 2DKNA 2O3UA 2WQ6A 1BHSA 1KO1A 2BMWA 5KSOA 1O0CA 2GD1O 3UXMA 1A4UA 2GLXA 5FWYA 1P80A 2OUKA 2GFQA 2I1WA 2ID4A 3CINA 3G5TA 2A9PA 4AZVA 2G09A 4PQGA 1JPNA 2WJIA 4PLTA 2E4VA 2CLOB 1ZIPA 2GJ9A 1C8KA 3B6KA 2QJOA 1XZFA 3MSXA 3K9HA 4ZAXA 4X3PA 4F4HA 5IFKA 1DBPA 3ABIA 1W0JD 2ZRCA 1LCIA 5D87A 3L4JA 2IEAA 5EJ4A 3RRXA 1PVOA 1K4YA 4WXYB 3OF2A 3A04A 4LMRA 2O0JA 4DWJA 1FP2A 5KYNA 2JIZD 2EJVA 2VFAA 4ZO6A 2AJLI 4JBWA 4XUCA 2BE9A 1HMYA 1UBNA 2CVFA 3DZBA 3GEDA 3R0JA 2P5YA 2IXFA 4EG6A 1NNSA 1O9BA 3NW9A 4POOA 4BRUA 1HR0B 1NNEA 1WMAA 2F9FA 2VPTA 2OP1A 2OBYA 3E9NA 1H85A 4NOKA 4RD0A 4BFXA 4CG2A 2AWOA 1TDJA 4EITA 4WX2B 1JIVA 2QT9A 3B85A 3GCXA 2NNLD 1FBTA 1ID8A 1OT3A 3CG0A 2D7JA 2AI1A 2W37A 3O03A 4K5QA 1ZVMA 3JYPA 4M2LA 5DTJA 2JAOA 1N6IA 5EQTA 3T5MA 3M82A 3VOBA 4A8TA 4OYLA 1T43A 4B09A 2WG1A 3I2HA 4NJMA 1FLNA 3L4BA 2C2BA 1P1CA 1G5QA 3GJ4A 4HTFB 4OQDA 3UK1A 4TMZA 4IIJA 1IBLB 4UDXX 1YC5A 3MAAC 1I4DD 4Z1OA 2ZT7A 5EE3A 3HGMA 1ONNA 4G0NA 5IF3A 2NAPA 3UGJA 1OTYA 2YINC 2YYSA 3BSFA 2JH3A 3WXMA 1UPFA 1BGXT 1OQAA 1RDFA 5BNWA 3K7EA 4KXYA 1Z62A 1U2DA 1KZ6A 4KR0A 2IK8A 5AHRA 1M8FA 4HV4A 2AEFA 3BH0A 4N5MA 1WNTA 2Q2VA 3BWBA 4J3NA 1QRUA 4WXPA 1N2XA 2B8EA 4DQKA 1E18A 3QWBA 2OSVA 3D81A 4ZHQB 2W6JD 2QXYA 3C3YA 2ENWA 3WLLA 4L72A 2CWDA 3JQ8A 4NK4A 1YTUA 4GR9A 5EJAA 3GFTA 4TKZA 1FS4A 2GRJA 1FTNA 3LP8A 5D84A 2XT6A 1USGA 2B3TA 3K4HA 3UV7A 5B30A 2QTVA 3FOAA 3DNMA 2C31A 5BSTA 2C5AA 4M49A 3TW8B 4LV6A 1ZSYA 1CRPA 3H6GA 5C9ZA 1GDHA 1KDTA 1BS2A 2WFZA 2CK3A 4DJDC 1L7NA 3LH5A 5L8VA 1Q0ZA 3E23A 5I8PA 2F1RA 3KL4A 3QMWA 4URWR 3D8SA 4B3HA 1DG3A 2M9MA 2QXUA 1M8JA 5AXDA 1OX6A 4AY2A 2O23A 1UPAA 1R0RE 3OQPA 3UV3A 1Z75A 3FXAA 1FDRA 4XDGA 1J0XO 2A1UA 2DPYA 4ZVNA 2P1RA 1BN6A 3LX6A 3TRKA 1GPDG 5U4QA 2OENG 1Z5GA 2IDKA 2VYNA 3P2KA 2IV7A 4CLEA 3FPCA 4BU0A 2IZ1A 3W4JA 4BNZA 3TYXA 2QTGA 3L01A 3P4YA 4NQZA 1LGYA 1GZ7A 4ZOAA 1TUGA 5K4AA 1SVUA 3WRYA 3OFKA 5JSYA 5FOXA 3I5MA 3OFND 3DOOA 1OXKB 1V3UA 1E62A 3R5XA 4KIUA 1AKUA 3LC2O 4WI1A 3U7JA 2EVWX 2PZBA 2VJNA 3FMGA 3ASUA 3LBHA 2C54A 1SU6A 2LDXA 2W2PA 3IR7A 1CVRA 3P2IA 4O2AB 2CXUA 5ILGA 2B9EA 2HK9A 1K8ZB 3SLKA 3IVMA 5JXWA 1M6VA 3BILA 2PWPA 3B13B 4EHBA 4YAIA 2ONYA 4MRPA 5D5PA 1AD2A 4YXWD 2ODNA 4IF4A 3R1IA 5TVKA 3RYCA 5SY6A 4Z7NB 5HCNA 1XV5A 4N65A 3UH0A 4H4CA 3OZRA 5ADVA 5DDIP 2DPGA 2I4IA 3F78A 4RY0A 4IJQA 3H6HA 3D2AA 5KHLB 1OOEA 4GRIA 1U2QA 3AHFA 3M9XA 4QIHA 2NO0A 2QW8A 2W5UA 2ZI5A 2VUIB 1KERA 1M0WA 3GEEA 4IWXA 2G70A 2CJFA 2ECQA 2VYQA 3L05A 5EY5B 3WBJA 4P38A 1WAMA 1ZD5A 1GU7A 2FX5A 2P68A 3ENVA 5EZYA 1D2AA 2Q1UA 3ONNA 2HNAA 5AO9A 3RIXA 3OE7D 1RLOA 1ATIA 3W5HA 2FV8A 1MOZA 2XZDA 4CMGA 2A1TS 4QFMA 4GOND 1T6XA 1E1CB 4KRXA 3V4ZA 2H57A 3W5IA 5JRJA 3CO0S 5A3VA 1QLWA 4IIDA 2ZZKA 4YEDA 2VHWA 2PKCA 2ZETA 4KR2A 1N5RA 1GUZA 2Z3VA 1AMNA 1DKOA 1E2GA 1FYEA 3EWAA 5KYGA 1C4XA 1J1UA 1H9AA 4ONEA 4CN9A 2CHUA 3K4PA 1VHTA 2H3HA 3LVBA 3X1WA 5HX7A 4S05A 2RDMA 4I81A 1X94A 1ZKDA 1JIIA 3CF4G 4TWJA 1SCDA 2IHVA 2I80A 1E2QA 2ASVA 2ZE7A 4OLBA 1GZ6A 1PR1A 2ABWA 4YASA 4PS1A 1XDGA 1TMGE 2R6ZA 4JJZA 2E1PA 1CQIA 3FLBA 2CFCA 3TAXA 5JR3A 4IDNA 1A4RA 5IJZA 1MHPA 1Z17A 3CF4A 1YZLA 2CVZA 2JI7A 2V59A 3QOXA 4HWGA 2CL5A 1NJFA 1SXHA 2J08A 4EFKA 4J4TA 1A7KA 1KK2A 4GXQA 2WYUA 4QWMA 1HSOA 3ZCQA 5HUQA 3TKAA 3CTPA 2BTQB 2Y2VA 1JEDA 3ZE8A 4NYMQ 3VPFA 1L7QA 4FJ0A 1KJ8A 3GLSA 4DLSA 5FLYA 2JFHA 4AJ4A 6PFKA 3C3XA 2Q4RA 4MI3A 1XAIA 4EG5A 4EY5A 2P9HA 2NO6A 1E3MA 3WY9A 4NCBA 4Q9NA 2NZUG 3NHZA 1EHCA 1R4NA 4F2HA 4YJHB 4AXXA 2QZJA 1JSRA 5KCMA 5T4HA 1W5TA 1SXIA 2UUCB 521PA 1E2MA 1QVVA 2FWJA 2V74B 1V3QE 5FTNA 1JPJA 4QGHA 3I3OA 1GILA 1ZAKA 3GZNB 1YXMA 4NMWA 5JRDS 3BD8A 3LDUA 5DTQA 4JUAA 5CDYA