4JBGA

1.75a resolution structure of a thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
333
structure length
333
Chain Sequence
b'HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 101
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbgA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbgA01
1GEEA 1ZMTA 3KYDA 4G5HA 4CM1A 1UDCA 5JE8A 2P9CA 1ADCA 1MUUA 1Y6JA 5F1KA 2PD3A 1Z73A 3CSDA 2PH5A 1FDSA 3BXXA 4O1MA 3F4BA 3RSHA 1HETA 1PSDA 4ZRMA 3WFIA 4PLYA 4PVDA 4WUVA 1MV8A 5A5FA 1IYZA 1LNQA 4NFHA 3A28A 3TRIA 4IJKA 2JHFA 4OL9A 3K31A 4AJJA 4CM5A 3WGZA 1P44A 3NJ4A 3KSUA 1TT7A 1VE9A 3AY6A 1EUDA 2Z5LA 4H3VA 4Q3EA 5DCUA 5JC1A 1E5QA 3H8VA 4MP8A 4ZVVA 1GFSA 3WXBA 1LRLA 3VZQA 2G1UA 1JLLA 4U5QA 4LGVA 4OXYA 1BDMA 4DBVO 1LSOA 5A9SA 3NKLA 4Z9YA 3QV1A 8ADHA 3OJOA 2QRLA 4R5MA 3C8MA 3RKRA 4IZHA 1ZEMA 4Z9FA 1ML3A 1ONPA 1E1LA 1WMBA 3ICPA 4KWHA 4R1TA 1Z75A 3UN1A 1YL7A 3H9GA 4MVJM 4FFRA 1X7GA 1YONA 3P2YA 4RV9A 3JD1A 3ZWAA 4J6FA 4Y67A 2Q1TA 2RIRA 2BHLA 1NQOA 1WDKA 4C4OA 1RM5A 4CM4A 3CTMA 3I6QA 2OZPA 3E8XA 2BRUA 4J4BA 2G5CA 2GCGA 4UUNA 3FCOA 1BSVA 3I23A 5A5EA 1P1KA 1X1EA 3DZFA 1I8TA 1NPTO 4GPD1 5IZCC 3PVZA 4GSKA 1GZ4A 2ZCVA 1UP6A 2WE8A 2C54A 4YEDA 3WR5A 2HK9A 1B16A 1P9LA 3KOUA 3OIFA 1B7GO 2Q99A 3ZH2A 1Y1PA 4IJVA 2J3KA 3L4SO 5I7SA 1LSUA 1TXGA 2JCVA 2WEKA 4G2NA 2NVWA 1UP4A 5DDIP 2V6BA 2AMFA 2RCYA 3OMLA 3FBGA 4U6QA 2WE7A 3WJ7A 3UCXA 5C3MA 2C2YA 3QSGA 1ISHA 2A9FA 1OI7A 2FR1A 3LF2A 4HKTA 4ALLA 5L7YA 3DXFA 2P5YA 1SMKA 3A9WA 3AM5A 5KIAA 4MVJP 3VC7A 3Q0EA 3EHEA 1E92A 3CH6A 4CMEC 4Q9NA 1JKJA 4L76A 3AW9A 2VCYA 1DRVA 1B8VA 3V1YA 4HNGA 3WNVA 1YL6A 1V3TA 3VPXA 4BQPA 3B6ZA 4TRRA 2FP4A 5JAMA 1E0DA 4A2CA 3QA9A 3HDHA 2WD8A 4JGBA 3BMOB 2YQ5A 1GUYA 3JQBA 2QIOA 2RH4A 4CM9D 2YHIB 4XQEA 1H94A 3MTJA 2W90A 4CUZA 3NT4A 5MDHA 4XD2A 3S2FA 1LLDA 4F6CA 4Z3KA 1X0VA 1PJ2A 2DPGA 3EDMA 3RC1A 3S55A 5GZ3A 1LUAA 3GH3A 5JCJD 1E3WA 1Y8QA 4GX5A 5I7EA 2XXJA 1H6AA 3PQDA 5J23A 1C0PA 1ONNA 2JAPA 5A9TA 1UZLA 5BT9A 4WLNA 5DZSA 1KOLA 4PG8A 1GZ6A 3BIOA 3TOZA 3LZ6A 1XEAA 1E7RA 3ST7A 1H6CA 2WD7B 4S3MA 1HZZA 4PZCA 1EVJA 1NWHA 3EUWA 1H0KA 4GAEA 4GX1A 3HJAA 4GWGA 2I6TA 2X22A 1N9GA 1O94A 2I66A 3LK7A 4N18A 4UAGA 2W2KA 5CEJA 4FB5A 3IJRA 3PWZA 4ZRNA 4E4YA 1VKNA 1SCUA 1ZK1A 3FTPA 4DC0A 3HADA 4J1QA 4YYZA 5A4DA 3JYQA 4DIFA 1I30A 1U3TA 3SJUA 3RCBA 4P4GA 4WEOA 3FNGA 3PJGA 4BNYA 1VRWA 3DBHA 4GKVA 2EKPA 4WOKA 1N5DA 1PTJA 1P31A 1A7AA 1YJ8A 1QMGA 2OP1A 2FHSA 4A10A 3KYDB 3TPCA 4IXTA 1SB9A 1ZXBA 1Z45A 1GR0A 3HN7A 4NBVA 3ZWPA 2WTBA 3QQPA 3H9QA 5C37A 3DOCA 3X2EA 4NIMA 1R0KA 3IMFA 2ZTMA 4W9NA 4M54A 5IDYA 3I1JA 4NK4A 3TDKA 4B79A 5FFFA 3W4IA 3JD0A 4BO8A 2Q1UA 4GMFA 2WWRA 1GADO 1PGPA 1FK8A 3G3EA 3HSKA 3AOGA 2X0IA 1A9YA 3PIIA 4GKBA 2ZQZA 3L77A 3QLJA 3G49A 5G0UA 1EQ2A 2Q45A 4U7WA 3GY0A 3JD3A 2NM0A 4E5KA 1P1IA 1LDBA 1Z82A 3WLFA 3DOJA 3JYOA 3F47A 3GAZA 2R00A 5HTOA 1SC6A 4OGWA 3N58A 4EI2A 1NWCA 2BLLA 2HCTA 1KYQA 1GYQA 5A9SB 4XQ9A 3E6AA 2B37A 1QKIA 5JCXA 1X13A 4AFNA 4YT4A 1YDEA 1QORA 3K8ZA 1XSEA 3OIDA 3OJLA 2X0RA 4R9SA 4IDAA 3CZMA 1U3VA 4EDFA 1I2BA 4DLAA 3C1OA 5TC4A 1I32A 1EVIA 1R4MB 1U2DA 4TQGA 4D7AA 1U7TA 4OYRA 1HDZA 1O5IA 1ULUA 2NWQA 1Y8RB 4GX2A 4TRMA 5EMHA 4CM4B 1X0XA 4ALKA 3DZGA 5TGDA 1NXQA 4MPDA 2VOEA 4RQUA 3FNFA 4DPMA 2R2GA 4RLHA 3U49A 3O4RA 1ARZA 3CXRA 3NGLA 3PRJA 3W8DA 4BHTA 4N7RA 1ENYA 4PRKA 2FRDA 2I67A 2X8LA 3AY3A 1GAEO 2V6FA 2NU9A 4KDEA 5A3JA 2PA3A 4W7IA 1CRWG 4FC7A 3H2SA 2VZ8A 4EYEA 3WGIA 4R3NA 1O0SA 2Q1WA 1L7EA 2P91A 2X9GA 1YWGO 3GGPA 3JD2A 3ZV3A 1F0YA 2GD1O 3VZPA 3IKTA 1CQIA 3GGOA 1ADFA 4E3ZA 4KMSA 3A1NA 1RYDA 2GN6A 3B70A 2UV8A 4Y6RA 4LK3A 3ZNPA 4CPDA 1U9JA 4HFRA 4ROSA 2H5LA 4CM6A 3NX4A 2BGKA 1VL0A 3CMMA 3IJPA 2D1YA 3ZHXA 3O38A 1HSZA 4DWVA 2GN8A 1FMCA 3KETA 5KJEA 2VRCD 2Y0EA 3H5NA 4XCVA 3V8BA 2YV3A 2JKVA 4PLGA 2Y0CA 2C5EA 3UXYA 3PYMA 4F45A 5BSFA 2FPIA 5LDHA 4MVJF 1NAIA 1BMDA 1IULA 3G79A 1VL6A 3L07A 3P5SA 4NG5A 4FSHA 4CL3A 3DC2A 4YQZA 5ER9A 4AJNA 2GZ3A 2FY8A 2DBZA 5ITVA 4WCFC 1YKFA 5EJ2A 3B1JA 2VT3A 5L4LA 2J3IA 3HN2A 3K2EA 2YDYA 4G65A 4RQTA 1P33A 2NSDA 2OBYA 4O6VA 3RU7A 5G0SA 4PLPA 4HADA 4XZ3A 1A5ZA 3IC5A 2HK8A 3HDJA 4Z0HO 4CMIA 2GSDA 3AUUA 4U0JA 1ISIA 1O9BA 3OEYA 4BIIA 4OHUA 3RUCA 3PWSA 1BVUA 3WWYA 3G0OA 5AYVA 5JNLA 3ZWMA 1E3WB 3P19A 1Y8QB 3I9OA 3KZVA 4U6SA 1GPJA 4NI5A 5FWNA 2OBNA 3UHAA 3WIEA 1YRLA 3AI2A 3EZLA 2O7QA 3K2BA 4KP7A 1K6JA 1P1JA 5H83A 5ICSA 3IP1A 1K6IA 1M67A 3QIVA 4INAA 4E31A 1BW9B 2OFPA 3DBLA 4WNCA 3M1AA 4CM8A 2Q4BA 3DB2A 3I52A 1HXHA 4N5NA 4F3YA 3KV3O 1N9GB 2NVBA 5DP2A 3BTSA 3PQEA 1KVRA 1E7QA 2W2KB 1AGNA 2DAPA 4HFJA 5LDGA 3CIFA 1D3AA 1V35A 1VJ1A 1WW8A 3I83A 1WVGA 5KKAA 4BNZA 1P1FA 5DULA 2GZ1A 1C0KA 4XIYA 3TF5A 5JMWA 2Q2VA 1ZVMA 3ZHBA 2AXQA 1C0LA 1GV0A 3AU8A 3DAPA 4R54A 2CZCA 5CFZA 1NTOA 1Q7CA 1OAAA 1LU9A 4ILKA 2JAHA 4Z0TA 3RQSA 3WSVA 3KVOA 4II3A 3RJ5A 2FMUA 1U8XX 4AJHA 5TJ9A 3GN1A 1NP3A 3JQFA 4RF5A 4EW6A 3UAGA 2J5KA 2X9VA 1NPYA 2HSDA 1T2EA 3PLRA 4DLLA 2AG5A 2Z95A 3HDQA 1BTOA 4GGPA 4UREA 5KJ1A 4LSMA 1GPDG 2AQKA 2D3TA 5F1OA 3E18A 1EBUA 1NYTA 1PGQA 2UDPA 4I1IA 5JXWA 5BNTA 5BNFA 4DL9A 3G1TA 2WSBA 4RF2A 3JQAB 4OKIA 3RFXA 3LC1O 4Z6KA 4QX6A 2IRWA 2IDZA 4XB2A 3ROKA 5A9RA 3U4HA 1MX3A 1WAMA 4ALNA 2XOXA 2LDBA 3OJEA 3KXDA 3E9MA 2Z1MA 1P0FA 5TIIA 1ZO8A 4PLVA 3I3OA 2EWMA 3C1TA 3TL2A 3ZZNA 5TRTA 3RUAA 4E2XA 3JQ6A 3RUDA 2NV6A 4BKPA 7MDHA 1IHXA 3WQSB 3GLQA 3NDRA 5GZ1A 2FPPA 3AOEA 4KDFA 3RJ9A 3GNTA 3DQPA 3H9EO 2LDXA 4FDAA 2DM6A 3ZWCA 4BGVA 5JSFA 1WXDA 1S7CA 3BTOA 3PPIA 5L95A 2NACA 3H4VA 4RLSA 1LXCA 2GN4A 3RFVA 1I33A 1YB4A 4Q3BA 4KUGA 1DAPA 1FDVA 2C7VA 3Q6IA 1ENPA 2NNLD 1W8DA 2AW5A 5IN5A 1J5PA 4DIBA 4BMSA 3UCEA 1XIVA 5JDCA 4PFJA 4Q3CA 4YVFA 5CDSA 4W99A 3ZWNA 4FGWA 1GQQA 4NFYA 1DRWA 1J6UA 4FW8A 1H5QA 4Q39A 4CMHA 5BSEA 1CF2O 1E3LA 4EITA 1D4FA 3STHA 5KKCA 4FJ1A 2ZCUA 3PDUA 4RDHA 1JWAB 5FEUA 1ZEJA 4QT0A 4J1NA 4HFMA 5IZ4A 2QRKA 4B4WA 4BNXA 3TL3A 1C1DA 2I9PA 4RORA 2NU7A 5I8ZA 3RBZA 2R6JA 4JBIA 1K2WA 5T8KC 4DYVA 1F12A 3E1KA 2AE1A 4RPKA 4B3IA 3JD4A 4DGSA 3GQVA 2AHRA 2HMSA 3NDIA 1GY8A 4TSKA 4EBFA 2VYVD 4GWKA 3AY7A 1W73A 4MKXA 1DC5A 2VWQA 3ZWVA 3BA1A 4IY1A 1PWXA 1AHHA 3JQAD 2ZQYA 2AQ8A 2PZMA 4CQLA 1NHWA 4CQMD 1YDWA 3WWZA 1G1AA 4YDRA 4YJHA 3LQFA 3OF2A 4Q3AA 1LTHR 1R15A 2Q2QA 4O5OA 3MWEB 3WOHA 5B37A 3V2GA 4QFDA 4YXFA 3WNQA 3GGGA 3U62A 4YJGA 3PLNA 4B8ZA 1CDOA 4HXYA 3T4EA 1EK6A 3PJDA 5JDIC 1PZHA 4FN4A 5BR7A 3VH1A 1B14A 5A02A 5TQVA 4B7XA 3R3SA 4BO1A 1YB5A 3FD8A 1ADBA 1S6YA 4PZDA 5LC1A 4MVJI 1KC1A 1QYXA 2IODA 3GNQA 3UKOA 3GDGA 4NMHA 2YQ4A 3D4PA 2GUGA 3INTA 5A06A 3RBVA 1CWUA 2JFGA 3ZV5A 2CD9A 4YJFA 3F5QA 1LRJA 2G0TA 5L51A 4RL6A 1G0OA 3S1LA 3WX0A 1H2BA 1ZCJA 4UUOA 5CG2A 1F17A 4L74A 1KEPA 2D5AA 3OP4A 4D3DA 5TLSA 3WBFA 4YRDA 1PL6A 3INRA 3D7LA 5BSGA 3ZWBA 4BMNA 5HM8A 1YXMA 5JFOA 4BNVA 1ISFA 1TI7A 3SLGA 1H6DA 2GN9A 3CMCO 3ZWOA 1F06A 1EQUA 2IE0A 1NR7A 4D3FA 4UVIA 3WJAA 2CVOA 3VZSA 1K5HA 1JAYA 3NGXA 1DO8A 2CNBA 2YW9A 1B0AA 3EAGA 4QTZA 2BH9A 2V6MA 1DDOA 1AUPA 4CM8B 2OP0A 4EJMA 3C7DB 1NHGA 3CZRA 4CV3A 4QSMA 1T26A 1OOEA 3TZHA 4R68A 1YS4A 3FWNA 4FGSA 2EGGA 4R9RA 1PZGA 3WGYA 5U4QA 1K6XA 2QHXA 1O6ZA 3PFFA 3I9NA 4IDEA 5JLAA 4OXKA 3JYNA 4DMMA 4BKRA 4B7UA 4GBJA 2ZYGA 2B5VA 4XGNA 4ZQGA 5TNXA 1NVGA 3F1KA 4CLRA 2GF2A 1BVRA 1V8BA 4AJEA 5ICMA 2NVUA 3LLSA 4A7PA 3P2OA 3WDSA 4IBOA 4OOEA 2O3RA 3PZRA 4HP8A 1EUCA 3GVXA 2W4QA 2NU6A 4PVCA 4ND3A 5DT9A 3DONA 2XPCA 2NADA 5I9LA 3W4KA 2J5QA 3H2ZA 4ZN6A 1UR5A 4PZEA 4MIYA 4L4XA 3KM0A 5CDGA 3WICA 1DIRA 4QO8A 5K6AC 1X7HA 4NJMA 4OJNA 2EERA 4R69A 1MGOA 1T2FA 4IDDA 5G4KB 4J9VA 3ICCA 4WCDA 5I9MA 3GZNA 4AJ1A 3Q3CA 2DBVO 3ZWYA 1JQBA 3VVBA 5AVOA 1PJCA 3H3JA 1DC6A 3OBBA 5CEFA 3NJ8A 5AOVA 3JQ9A 1YB1A 2PGLA 2B0JA 1VSVA 3TWOA 5JY1A 3NYWA 4EZBA 2PD6A 4I9UA 2Y1FA 5U1PA 3AUAA 3DZKA 4W4TA 1QXSA 4DQVA 4J1TA 3HQ4O 4H15A 3DR3A 1ZMOA 2DFDA 2ZYAA 5CDUA 3PGJA 3Q1LA 2X7HA 2P4QA 1NQ5A 2NQTA 2ZJ0A 2ZK7A 2AQIA 5AXBA 3D3WA 3PZBA 4PRLA 4K28A 3K92A 1SO8A 3FWZA 3U09A 7ADHA 2QYSA 4R51A 4CMJA 3K73O 2VRCA 3CE6A 1ZXLA 3E03A 3WYCA 2Y66A 4A5OA 3KUXA 2WDZA 4ZQHA 3COSA 4LW8A 3BTUA 2Y1DA 4XQGA 1A27A 3IDSA 4CV1A 3PEFA 5JPIA 4AJOA 1PJLA 3HDYA 2E49A 1UXJA 2Q1SA 4DRYA 1C1DB 4GSLA 5AXAA 1G6KA 4S1VA 3WGQA 3WYBA 4YAJA 3ZW8A 2EG9A 2EIHA 3RFTA 4TMFA 3RROA 5K9ZA 2EV9A 3KO8A 2D5CA 3N7UA 4MJLA 4PLCA 5CDTA 1NFRA 4TKMA 3X2FA 1AXGA 1DOHA 2ZYDA 4EEXA 2I5PO 4XEHA 3S8MA 2YFQA 3ZDFA 3KSDO 2CMDA 4HUJA 4YRBA 2AEMA 4FS3A 1HYGA 1KVUA 4CQLB 5U9CA 4IZIA 4OQYA 4XX0A 4YJHB 1U4OA 3FR7A 5G0TA 1DC4A 5COQA 3CPSA 1FF9A 1GD1O 1ONOA 2CDCA 4OSOA 1T2CA 4J49A 4YR9A 1Q2XA 4QFCA 1JVBA 2V65A 4R16A 4RGBA 4JXKA 2PZLA 3Q9UA 4GI2A 4K1LA 4ID9A 4D0RA 1QR6A 3PYXA 4WLVA 3DHEA 3FNEA 4DTIA 4BB6A 1PU2A 4MP6A 1VM6A 4ZQBA 1BDBA 3QVSA 4PCVA 1E1NA 3ABIA 4ZU3A 4A27A 1HYHA 3PGXA 3N74A 2X9NA 2GDZA 1LEHA 1QRRA 5ES3A 5CDYA 4I08A 4L73A 4FOOA 4I9HA 2Y99A 4P22A 3JYLA 4NBWA 3TNLA 2C5AA 1A9ZA 4YJFB 5IZCA 1Q0QA 3FN4A 1PJBA 1KC3A 3ANLA 4NU6A 4Z9XA 3VDQA 1C1XA 1T4BA 1IB6A 1LDYA 4JX8A 5L4NA 2NTNA 5JBIA 3DDNA 1ZK3A 3VKVA 1TA4A 2J6IA 1GZ3A 4I5DA 4PG7A 2WJPA 1N92A 4NHEA 4R1SA 2JFHA 2QZZA 4IPTA 4IQGA 4XQCA 5DBIA 3EYWA 4BMVA 1HDCA 1YBAA 3NTRA 5JAZA 4D46A 2AEFA 2GPTA 1PJSA 1NAHA 5A05A 3ZCXA 4YQYA 3DBRA 1BWSA 1ZK0A 4IGFA 4LVUA 3TQHA 3LF1A 3I9MA 3VH3A 3K6JA 5IF3A 2P5UA 4E32A 1NQAO 2HJRA 2W98A 5JC8A 5TS3A 2ZB4A 3QY9A 5JAQA 3TN7A 2Y1CA 3IP3A 3GVPA 3LLVA 4GX0A 3D64A 3V5NA 1QG6A 3QWHA 4Q3NA 4AJ4A 4KTVE 1PL7A 1I2ZA 1LLUA 3L9WA 4K26A 1LDEA 2HUNA 4CMEA 1KVSA 1FJHA 4D44A 2FSSA 4D45A 1PS0A 1LRKA 4IGEA 1PR9A 5A03A 3LT2A 1J0XO 2QW8A 3R3JA 3JQ8A 3U4CA 1JA9A 2IYPA 2O3TA 4J91A 2YDXA 4FJ0A 1NVMB 3QWIA 1NX6A 5I7VA 4PLTA 2IZ0A 4JN6B 2FPGA 4DVJA 3A06A 1LDNA 4HX5A 5EQFA 1I5RA 1MFZA 4E2WA 1GU7A 3GC6A 4X54A 1M6HA 3ON5A 2AG8A 4UVHA 4E12A 2PZJA 2W2LD 1X15A 1QLHA 4OAQA 2DPHA 3EK2A 1LLQA 2H6EA 1B3BA 4RPJA 4CLEA 4K9DA 2O50A 3RAJA 3W6ZA 2VNSA 4CM3A 4F46A 4NQZA 3M2TA 4OKNA 4FIZA 2HU2A 5HA5A 1D1SA 5FYDA 2O3QA 4QUKA 2PK3A 1A4IA 2P68A 3BZUA 1CJCA 4GMGA 3JQDA 2Q49A 3AI1A 3BMNA 1HZJA 1KY4A 4J3FA 3MJSA 5ITWA 3GK3A 2X6TA 1EDOA 3CUKA 3OQ6A 4XDZA 3PJFA 1ZJZA 4E2ZA 4WLOA 1N8KA 1L7DA 2FR8A 3DEYX 4N5LA 3NRCA 3D1LA 5T6BA 1HE2A 4UEJA 4IDGA 1DHRA 1E77A 1HT0A 2IYOA 1UJMA 4MKZA 2HAEA 3FI9A 3R1IA 3Q11A 2I3AA 2CDBA 2CDAA 4ONEA 2JD2A 1IY8A 1YL5A 2GO1A 3WFJA 5FF9A 1GCOA 2AQHA 3GOHA 4DQXA 5IDWA 1H93A 5H81A 1QYWA 3WMXA 3ZV4A 2HO5A 5KVSA 5CG1A 1MXHA 4WLEA 5L53A 1DJNA 1CYDA 3K96A 1N2SA 1QV6A 4FJ2A 4DPLA 1GDHA 1QLJA 1ORRA 3AJRA 3JV7A 2GZ2A 4YT5A 4YT8A 4OMUA 4KOAA 2HQ1A 3PJEA 5DN9A 5G4LA 1PQWA 1VI2A 3OETA 2JFFA 4M87A 2YJZA 5B4TA 1XG5A 3CINA 3ANMA 1NPDA 1UXKA 2VYND 4WKGA 3VHRA 1NFFA 1UAYA 4BOYA 1U5AA 3F5SA 1RKXA 3CEAA 1UXHA 1PJ4A 1SNYA 1XQ1A 4TROA 3T7CA 2PKQO 2E37A 3LU1A 4YBZA 4KZPA 4AJPA 1U3WA 1HE3A 1QYDA 2FN7A 2OO5A 4IQ0A 1DPGA 1U4SA 4HBGA 4AVYA 1OC2A 4B4OA 5L45A 3TFQA 1BG6A 1KEUA 1ENOA 4TVBA 1BGVA 1Q0LA 1T2AA 2WYUA 2YV2A 3MCVA 5JYEA 3ASUA 3H9JA 4PG5A 1M75A 5K0ZA 3NTOA 3DFZA 2B35A 4WASA 1E7WA 2BFOA 1Z7BA 4OH1A 1Q7BA 2GLXA 1MG5A 4BQRA 3LVFO 2NLOA 1GUZA 2Q4EA 5DCWA 4ZGWA 3BHIA 2VZ0A 3ETEA 1DEHA 1DLIA 1BXGA 4MVJG 1DAOA 4CJXA 2PNFA 1I0ZA 4ZHSA 4CMCA 3WMWA 5DF1A 4IIUA 3JQGA 3S2EA 5JMPA 3L4BC 1B15A 4UULA 1MXFA 2POQX 3GRKA 5IDQA 4AL4A 3FRJA 1AXEA 1SEVA 3FR8A 4J7UA 1VJTA 1TT5A 5B4VA 1AHIA 5LCXA 4BB5A 1DLJA 3JTMA 5T64A 2AA3A 3DTYA 2UYYA 3OSUA 3L0DA 4PG6A 5ADHA 1YQDA 3R0IA 4BNHA 3HHPA 4CL8A 1JU9A 1JDJA 1P1RA 4OXNA 2Q3EA 1R16A 1M6WA 4PLFA 3DBRB 1DJQA 5EQDA 2Y05A 3U5TA 5TF4A 9LDTA 1HDYA 3UCFA 4JQCA 3MJEA 3C85A 3K5PA 4E13A 3DZBA 2NU8A 1LSJA 1KVTA 1B2LA 4YT2A 2H63A 5HS4A 3VVCA 3KLPX 3C1AA 4MP3A 4K6FA 2E82A 4XJSA 5AXDA 1IZ0A 3AK4A 2VTDA 1HKUA 2IZ1A 3HWRA 4G81A 4JP3A 4L4SA 4JP2A 2HJSA 4L9RA 1R4NA 1XYGA 5CP8A 2X5JO 1U3UA 4E5YA 5DBGA 4R4JA 1QYCA 3JYPA 4WCFA 4AJLA 3KSZO 3DBHB 4FBGA 4CODB 3U3XA 4IDFA 4DC1A 3L6OO 1WZIA 4HV4A 2O48X 4ND4A 1M76A 3FPLA 3I4CA 4JLWA 2RH8A 1WP4A 3SJ7A 3LT1A 1YOVA 1GCUA 3AOEC 3MEQA 3TZCA 1LI4A 5FI5A 4BO4A 1JW9B 1PGOA 2EKQA 2WYVA 4DA9A 1KY5A 1HDOA 2E48A 3E5RA 1CETA 4BUCA 3HG7A 1DIGA 2DUUA 3JCZA 3KB6A 3M2PA 2CVQA 1IZ9A 3O8QA 1EMDA 5JDCC 4AJ2A 2PH3A 9LDBA 1KERA 3EVTA 4JBHA 3B1FA 3HB5X 4MVJD 4FR5A 2NQ8A 5GMOA 4JROA 4O0LA 4I8XA 3DAGA 2FWMX 3RBXA 4NNJA 1PX0A 2EHDA 3BMNB 5JO0A 3ENNA 2NUAA 1FXSA 2X0NA 5T57A 2V6GA 4A0SA 3DZJA 3QWAA 4W82A 1N1GA 2I3GA 3GAFA 3GFBA 3AU9A 1ISMA 1SZJG 3RUIA 2J3JA 3GUCA 3NDJA 2OMEA 2ZTUA 3ADPA 4DBZA 4TRJA 3ZWWA 2X58A 1DIHA 4QXMA 4AICA 4E5MA 1XWFA 1PS9A 1ISJA 2C59A 2VWGA 5KJCA 1CEQA 3LC7O 1QSGA 3ITKA 4NR0A 4D3SA 4M89A 1LC3A 5DNAA 6LDHA 2EP7A 4F6LA 4IINA 1R12A 2CF5A 2DKNA 3GDFA 3WGGA 5F5NA 1LLCA 4R5HA 3LYLA 1ZSNA 1PWZA 3RUHA 1WPQA 5IXSA 3OJ0A 2B4QA 5L7TA 1XGKA 3DMTC 3DZHA 3K30A 4BS9A 1SB8A 5IN4A 3AM4A 2EF1A 2D0IA 3DOOA 5GZ6A 1YGYA 4CR8A 3OQ1A 3H5AA 4CM9A 1EZ4A 4EEZA 1F14A 2PZKA 4FFMA 2DLDA 4AJKA 1UH5A 1EBFA 1I3NA 2DTXA 4D41A 1ZFNA 4JIGA 2EJVA 2VHYA 4U0KA 3ZU3A 1LSSA 4BGUA 5BNIA 3RI3A 5JCJA 4C7KA 3OA2A 1OBFO 2X1HA 3O26A 3GA0A 3W8EA 1YVEI 3ROQA 1Z7EA 1TB4A 1BXKA 4CV2A 1UXIA 4HNHA 1CQJA 2FZEA 5COBA 1BXGB 1ISGA 4KWIA 3V1TC 3BMCA 1HF3A 3JQ7A 1V0JA 2PGJA 1EK5A 4E21A 1MLDA 4BV8A 3MOGA 4BKQA 3JQGB 1ZSVA 3NT5A 2C7GA 2J3HA 1PS8A 4FPXA 1ZH8A 4ND1A 3D5TA 3ZV6A 1RM0A 4IMRA 4J16A 4LN1A 1UZMA 5T8KA 1E3EA 3OM9A 4RVFA 5L40A 4NDNE 2XXBA 4BNJA 3UICA 1B3RA 3NEPX 3PHLA 4MVJE 2PR2A 4J7XA 1MA0A 4CMIB 1T4DA 3RUFA 3ZN2A 4E33A 3ZI0A 4CLOA 1YQGA 2EKLA 4CLXA 1PQUA 1R0SA 3OH8A 5HRUA 1XHLA 4RVDA 4N54A 1RPNA 5KJFA 1HE5A 3D5QA 5KVQA 2ILTA 2H1SA 2EJWA 5JY6A 3UVEA 5B1YA 1PGJA 2VRBA 2D59A 4W6ZA 3GFGA 1UUFA 2VQ3A 1E7MA 5B12A 1WWKA 3DBLB 1WLYA 1A4UA 3EVNA 1DBVO 4BGEA 2J8ZA 3BMOA 5JDIA 2P9EA 1Q7GA 4H16A 1KVQA 3C7AA 4HFNA 4NK5A 4MDHA 4RCVA 5DCYA 2YHIA 4YPOA 5IJZA 1I2CA 1RJWA 1ZJYA 1PJQA 2EEZA 3L6DA 2Y1GA 4HWKA 4WECA 1NR1A 2X86A 3KBOA 1B26A 3U4IA 1V9LA 1NBOA 1L1FA 1N1EA 3WYEA 1KEVA 4A26A 1YBMA 1PQPA 3FPCA 3ONFA 4GGOA 1HEUA 4Y9DA 4RVUA 4RZIA 2A35A 3OIGA 4BNFA 4TVOA 4EJ0A 1GV1A 2CFCA 4BNUA 2BELA 4DYDA 4E5NA 4J2HA 2WD7A 3D4NA 4GH5A 2JL1A 1GQYA 1F8GA 1E1KA 2VOJA 3W8FA 4M55A 2HMWA 3WGHA 3UFXA 4E5PA 1WDMA 1P74A 2HLPA 1JKFA 3HE3A 1UP7A 3AWDA 1EE9A 3F9IA 1WDLA 4YRAA 4RF4A 4KTTE 2HK7A 5CHEA 3M1LA 4R3WA 3TJRA 1PZFA 3QWFA 4YCAA 4NU5A 3D4OA 3O8QB 4TRNA 3FTNA 2RBEA 4I5EA 3H6KA 1ADGA 1ID1A 4M8SA 2HMVA 3IS3A 3LT4A 3UW3A 3WTBA 4J0EA 2VHWA 4E0BA 1NVTA 2TMDA 3PHGA 1H9BA 1K0UA 5AXCA 4CLDA 4CV0A 2VYNA 1T1RA 3BMQA 4XRRA 3JSAA 5ILOA 3H9UA 4CMGA 5C7IO 3GNSA 4ZD6A 3F46A 2RHCA 3RC9A 4XJTA 3BAZA 3RU9A 3RWBA 4XYLA 3WGOA 2DVMA 3I5MA 2RHRA 3PXXA 5TJHA 5EN4A 3ZNNA 4J9UE 3H7AA 4XA8A 5ER6A 5TX7A 5I8WA 5AQ1A 1XDWA 2AEJA 4ALMA 2BKAA 2JCXA 3QVOA 4PLZA 4FD3A 4CUKA 4XWYA 1DRUA 5DOVA 1YH3A 4L4RA 4FOSA 3RVDA 4J0FA 4P38A 4P4LA 3O9ZA 1Q1NA 4NBRA 1EFKA 1SOVA 2NTVA 1YBVA 2V7PA 4Y98A 5CPBA 4UEOA 2DU8A 4MIOA 2VHZA 2C07A 3EY4A 3SC6A 3IKVA 1SAYA 2B69A 3VPFA 1X7DA 1ZK4A 1SBYA 4WEQA 1A71A 1OC4A 4BGIA 1E6UA 4N5MA 5K6AA 5JAIA 4FFNA 5TT0A 4BNLA 4R1NA 2VTEA 2C2XA 3KEOA 5I9NA 1P45A 4RO0A 2PTGA 1ZBQA 2P9GA 4I5FA 4Y8VA 2O3UA 2PKQP 4IM7A 4LRTB 4ZICA 1H2HA 1JKIA 3MTGA 1I3KA 3HB4X 1BXZA 4XR9A 2HDHA 1VL8A 4YAEA 3ETGA 2B36A 1R4MA 3GT0A 4WLFA 2HRZA 3CKYA 1WMAA 1Y8RA 3VH4A 3TZQA 4YAGA 2EXXA 4J7CA 3E9QA 1XLTA 2B83A 3BYZA 1Q0HA 3PFWO 4JBGA 4TKLA 4U8GA 4Y6SA 1B8UA 1M2WA 4JJIA 2HRBA 1E3IA 4UVEA 3E9NA 2HMUA 1FDWA 4BNMA 4YJGB 5IXYA 3FF4A 2OGUA 3MWDB 3JQBC 4NFSA 1LA2A 3H3FA 2Y67A 3BMCB 3GHHA 3HUDA 4JJGA 1E3JA 3JQ7B 4KUEA 1I3LA 1PJTA 3ANNA 2JCYA 1ZZEA 4LISA 4BNGA 5THQA 1U8FO 1TVEA 3QW2A 1E7SA 3VAZA 1W4ZA 3WB9A 1HDXA 2ZB8A 1Z6ZA 1UAGA 3NUGA 5A1TA 2TMGA 1Z74A 4PGFA 1E6EA 3ONDA 4L8VA 1O95A 3H5RA 5IDXA 4WLUA 2C20A 1T2DA 1C0IA 1XCBA 1ZKMA 2HMTA 3SX2A 4DUPA 5COAA 1KETA 4CLOB 1N7HA 5F21A 4IDBA 4BNIA 2EP5A 4M49A 4BV9A 1IL0A 1DIAA 2OORA 2VUTA 3HNPA 1NNUA 1TLTA 2FSVA 3QWBA 3UH1A 3V2HA 4IXWA 3SEFA 2GGSA 4B8WA 2ZTVA 3L9XA 1Y7TA 4MOWA 3VTFA 2QZ9A 4WK6A 2CY0A 2QG4A 3MZ0A 1NQTA 2QRJA 2OL4A 5KOIA 2DTEA 2Y93A 1LX6A 1KS9A 3AFMA 2O23A 3F1LA 4BO9A 4CMBA 3OICA 1VLLA 5HBRA 2G82A 4RVGA 3DL2A 3GF4A 1DFIA 4DIOA 1TEHA 1MG0A 3Q2IA 4BNTA 2RAFA 3R6DA 4MVJA 5DP1A 2EW8A 1YO6A 3MJ4A 3ONEA 4JJFA 4W9NC 3GRPA 1LQUA 5EINA 5I7FA 2DT5A 1SPXA 4O63O 4NJOA 3ETDA 4WPGA 4XR4A 3UF0A 4CLRB 1RM3A 4LSWA 3OEWA 4CUJA 2VHVA 1QYVA 2YY7A 5CPFA 3RC7A 4FCCA 3WTCA 1J4AA 2NVUB 4E30A 5H82A 1UZNA 3C3XA 1BW9A 2NTJA 3TOXA 1XA0A 3GVIA 2PY6A 4P4NA 2E6UX 5A04A 4OIMA 2BF7A 5IAAA 3KTDA 4FFOA 3OECA 4OO3A 2R00C 3QP9A 3ZNQA 1JVSA 3UGKA 1I10A 3WSWA 1PL8A 3OQBA 3QVWA 2VWPA 2VZ9A 1DFHA 4RZHA 4RVHA 3VPHA 4A03A 1EUZA 3VKUA 3WS7A 4MINA 4NJMB 4FC6A 3GEGA 4BO2A 1H9AA 5KNLA 2Q50A 4WNIA 2ZB3A 2E4AA 2X0JA 3GZ4A 3GMSA 3GZNB 2P2SA 4YTEA 3IQDB 4XYEA 4OQZA 1RWBA 2BGMA 3KYBA 1XU7A 2PFGA 2IXBA 1H6BA 1HWYA 1MC4A 3BMQB 5KTKA 5F1PA 1IPFA 1LBEA 2DFVA 2ZTLA 1HTBA 4J4HA 4DPKA 4BO5A 2PV7A 4MKRA 5BQFA 4UVGA 2VYVA 2X23A 5C7OO 1O89A 1U2GA 1HDGO 2IEBA 2QQ5A 1VSUA 3OJFA 4C7JA 2PD4A 2AE2A 3LDHA 3NV9A 4HY3A 4I9NA 3SXPA 1P77A 3B1KA 3SVTA 4GVXA 1D1TA 3JQAA 3EGOA 3ZHZA 3SLKA 2Z1NA 2H9IA 3D3WB 4CQMA 3F3SA 4D79A 5KWEA 4NPCA 3IUPA 4J4TA 2F00A 2C0CA 1ZK2A 4JK3A 1ENZA 4XRGA 1Y5MA 3DHYA 3EW7A 4D0SA 1P0CA 3H65A 4MIEA 3UOGA 2C29D 1F8FA 3JQCA 3QVXA 3PQFA 3WQRA 4QEDA 3ZU4A 2BFMA 2X5KO 1XU9A 4A73A 4B4VA 2G17A 3EC7A 4Z0PA 4GLLA 1K89A 1KEWA 1PGNA 4ND2A 4P8RA 1ZSYA 4NH4A 1XR3A 2UAGA 4BKOA 1YQXA 2ZIZA 4QQRA 3MJTA 2ZJ1A 1X14A 2GRAA 3GR6A 3NT2A 2DUWA 3VOSA 4URFA 2BI7A 4O59O 5A3VA 3W4JA 1XKQA 4LVCA 3RASA 2CF6A 6ADHA 1LC0A 4MO2A 1OMOA 1JAXA 4KQXA 4WOJA 3RUEA 2ZATA 2O3JA 3NAQA 4CLHA 4YAKA 1BRMA 3GG9A 3PYLA 2GYYA 2A92A 2DBRA 3INGA 4EUHA 4RJTA 2C82A 2DC1A 3DZIA 1E1MA 2BD0A 4RPHA 4BO0A 4D43A 1VC2A 1HYEA 4K6CA 4ZQEA 3ZNOA 4ZQFA 4YB8A 1GL3A 4ALIA 4DLBA 1FDUA 1D8AA 4UUPA 4QO7A 4NBTA 3VH2A 3I6IA 3TZKA 1E7YA 4EUFA 5EERA 4NZ9A 1DC3A 1WNTA 2XAAA 4IUYA 4IDCA 4PLWA 3AM3A 3KYCA 3FSRA 4IS3A 4UVDA 4H7PA 4BNKA 1JN0A 1GYRA 1ZIDA 3JQEA 3TZ6A 3HZZA 4E6PA 1EDZA 5DOZA 2A4KA 2OXIA 1R6DA 3B20A 3E48A 3LSYA 3MOIA 4J90A 3WQQA 4CR7A 3IL2A 5KVVA 5T67A 2WM3A 3BHJA 2X4GA 1B8PA 1IHYA 3DFUA 3IOYA 2PKRA 1SOWA 3ZU2A 5L9AA 3P7MA 1PR3A 4AG3A 1C1XB 1DXYA 3GUYA 1IUKA 1OFGA 1RM4A 2JJYA 4QECA 4YACA 5B4UA 5K1SA 3MJCA 4IS2A 2JD0A 1U1IA 5G2OA 1HDRA 3RD5A 3ASVA 2VWHA 4IJUA 1PJ3A 3C24A 1JWBB 3AFNA 1YJQA 4GVLA 4ITUA 1QV7A 1HLPA 2DTDA 3E82A 5FI3A 2Y1EA 1K3TA 1N7GA 2PGDA 4RF3A 4LRSB 1JTVA 4UUMA 4WE3A 1UXGA 3LC2O 3QRWA 3WLEA 2P4HX 3EZYA 3GPIA 3WG9A 5TT1A 3GVHA 2EGHA 1OZAA 2BGLA 1R66A 3SC4A 4TZKA 1BHSA 4J2OA 2JD1A 3QE3A 3JQFC 2Q46A 5L4SA 3L6EA 3QJ5A 3AUTA 2GR9A 1GQ2A 4J43A 3ZW9A 5C7LO 1HRDA 4ALJA 4TWRA 3F6YA 4BNNA 1U5CA 1E6WA 3DAFA 1C14A 1NASA 2VHXA 2YYYA 2O2YA 1VJ0A 4Q3DA 4XYGA 1M66A 2F1KA 1PIWA 1ULSA 2ZKLA 1XQ6A 2Y0DA 3L4BA 2DBQA 5C5IA 5JO9A 5DBFA 2O7SA 3PI7A 2QYTA 3JQ8B 4FFLA 1W6UA 2SCUA 2DQ4A 1UDAA 4XYBA 4XB1A 1LJ8A 3KLMX 1UDBA 3GPDG 4RPGA 3OA0A 3GG2A 4B4UA 2D8AA 4BO7A 3PDJA 3PHIA 4UEKA 4B3JA 2D4AA 2XF8A 4BNWA 1U28A 2YZ7A 5F5LA 4M86A 3DTTA 5ENDA 5JS6A 1A7KA 5EPOA 1A72A 2Y1OA 4JNKA 4PG4A 2YFHA 4DXHA 3A4VA 1QP8A 1GTMA 5CEEA 1U7HA 3FNHA 5KJ6A 3GHYA 2IEDA 3I9LA 3PHJA 2UUOA 1E3SA 4RDIA 5HS6A 4CM7A 1EE2A 3U9LA 4BKUA 1HE4A 3U4DA 4I5GA 5EESA 3ROMA 3ULKA 3GEMA 3ITDA 4XIJA 3NTQA 3TFOA 5HWSA 3FHLA 2VN8A 5KVCA 1V3VA 4YA6A 3T7EA 2FZWA 1IOLA 1Y5RA 2GERA 2CUKA 4WJZA 5F3RA 4CQMB 3Q2KA 2X5OA 1YE3A 1LDMA 1P1HA 3Q9NA 4KQWA 4Z3DA 2WMDA 2O2SA 1EVYA 5THKA 3GVCA 5G4KA 3DWFA 3ORFA 3W6UA 4D42A 3D0OA 3KHUA 4XGIA 3VPGA 1DB3A 4L0QA 5JYDA 3DMYA 3RIHA 3D3EA 3RKUA 1EFLA 3OFSA 4WGGA 4RPLA 3WIDA 1E5LA 2O3SA 3ZHYA 3S2GA 2EW2A 1D7OA 4TZTA 3ZU5A 1AN9A 2CVZA 1CIVA 5G0WA 2FR0A 1IE3A 3V2UA 4GQAA 3PHHA 4KUHA 4XGKA 1DHTA 2VUSA 3HFSA 3IUSA 4ND5A 5TSDA 2UUPA 3PP8A 5KCZA 1MP0A 2VUUA 2BFAA 2OHXA 3MJVA 3A14A 3T4XA 4E2YA 4PN3A 5T5QA 3VZRA 1MFPA 4J1SA 1I36A 4M1QA 4EJ6A 4EUEA 3I9KA 4B7CA 1I01A 2GNAA 2B5WA 2BI8A 4LMRA 5G0VA 2ZB7A 3VTZA 2PLAA 2Y68A 3U0BA 3EMKA 4IIVA 3K9QO 1GYPA 2I99A 4ZJUA 3I9JA 1HL3A 2I76A 2Q2WA 1XELA 3I4FA 2UVDA 3F4LA 4NBUA 4PLHA 3GEDA 1T25A 3KYCB 2ET6A 2YUTA 2CSUA 4II2A 4CR6A 1IPEA 3LT0A 3BTVA 1I3MA 4W7HA 2IZZA 3IAHA 4XDYA 3O03A 4BO6A 4RVSA 3HFGA 2IXAA 2WYWA 5EIOA 4LMPA 3KRTA 5JW6A 1WZEA 5ILGA 1VPDA 3ROPA 5CAEA 1EVZA 1SEPA 2B4RO 4BO3A 3W1VA 4MVJH 1RYEA 2OUIA 1KBZA 3PTZA 1TT5B 4OSPA 3G1UA 4LCEA 3GN2A 4B3HA 4CMKA 1EEHA 1Y9EA 2G76A 2JHGA 1MC5A 1PZEA 2HKIA 4DMLA 1VKOA 1NM5A 3DMTA 1Y81A 4BVAA 4IQ8A 1P3DA 1V6AA 4FQ8A 5IFLA 5IG2A 3KEQA 4ESOA 4R1UA 1LQTA 2D2IA 2BFPA 4R01A 1GEGA 3G17A 3OHSX 2W2LA 1AE1A 1O8CA 1GUFA 1T24A 3C7CB 5MGBA 4IMPA 1HLDA 1X1TA 3VDRA 4DREA 3ZWXA 3DHNA 3DO5A 3IIEA 1J49A 4OM8A 4R41A 2GASA 1HSOA 2O4UX 1C3VA 1ZNQO 2YHUA 4YAIA 1I24A 2J5RA 4EGFA 4CMAA 5GY7A 4PIVA 1R37A 5L7WA 4OOFA 3PIDA 1R4NB 1ZUD1 3AUSA 3WBBA 2YV1A 3PWKA 1R0LA 2QX7A 2FOIA 4WCFB 1NFQA 3ENKA 3QHAA 3UUWA 1T1SA 2PWZA 3TSCA 3RC2A 4DQUA 4GLOA 5ENVA 1MB4A 3VPSA 5EL0A 3ADOA 1PEDA 3QVTA 3ZGYA 1Y9AA 3JQ9C 3GMDA 4XKJA 3SBOA 3WGTA 3S2IA 1YOVB 1W0CA 2I65A 3E5MA 3PK0A 5BSHA 2A94A 4L75A 3V1UA 2VNAA 1LDGA 1DIBA 1G0NA 4YWJA 3GDOA 1V3UA 2VT2A 3AI3A 3FBTA 4IJWA 1ZW1A 4ZA2A 4GL4A 4XYMA 1CERA 3BHMA 2OOSA 4Y6PA 4LCJA 4JCOA 4FFPA 4AJIA 5L3ZA 2W8ZA 8LDHA 1FDTA 3DBVO 1DSSG 2B4TO 2O4CA 4YJDA 4BL5A 1DFGA 1KIFA 3M6IA 2BMAA
chains in the Genus database with same CATH superfamily
2EWWA 4G5XA 4D1YA 3KYDA 3QBTA 2WG1A 1RJFA 1TJYA 4JUDX 1HNNA 5DT2A 2NUAB 1BHO1 1UDCA 5FRDA 3RWOA 2OG1A 2P9CA 2ZYUX 4R8LA 2B4AA 1DKOA 3WKCA 2PT6A 4JY7A 5KWSA 3UB3A 3OX4A 4FXPA 3WB2A 4F9FA 3BXXA 4ZU1X 1XE3A 4ZVKA 3B6KA 1XZJA 3P45A 2HMAA 1PSDA 2XYRA 3P1JA 4H7KA 1JHYA 3ELWA 1NDUA 3OFNA 3OTHA 4MRNA 4PLYA 4Z1MA 3WDLA 4CDMA 3E9EA 5G3ZA 1G8KA 1N0WA 1MW9X 4IJKA 4TT3A 2JHFA 2BN4A 1FRZA 1I0IA 2H51A 1M8KA 2JVJA 2BHTA 1O8BA 1SVUA 3K70B 1P44A 2OCLA 2HWXA 1ZHFA 4U7JA 3UT0A 1TT7A 3AY6A 1H3EA 1EUDA 5JC1A 2XGMA 1Z7WA 1A1VA 1GNLA 3LUKA 3WXBA 3GYBA 1OZ0A 5AVUA 5BYAA 1LRLA 5J4YA 1Z2EA 4D0LB 1D1PA 2G1UA 2PBFA 3BCRA 1N7JA 2ZRKA 1KIAA 1T8RA 2B1RA 2QG6A 5CUQA 3FPHA 5AW4A 2ZRHA 3UUEA 1BDMA 3I0MA 1NF2A 4QJ3A 5JSHA 3QVUA 5H16A 5JZOA 3OQMA 4Q9LA 2VF8A 1QFZA 2DETA 3HRIA 2YICA 1ONPA 1T15A 3QBEA 2F62A 4JC0A 4JLKA 1OX4B 4BXOB 2H0RA 4KWHA 1Z75A 1U98A 4MVJM 3MGBA 3EODA 3RH0A 1O5TA 4LYEA 3JD1A 3TEFA 5HF9A 1XPOA 2VXCA 1Q77A 3E3NA 2Q5EA 2RIRA 3K0AB 5CB4F 2XNJA 3CHYA 4I8DA 5TQ2B 4XWOA 4YRGA 3CTMA 3ND9A 1K97A 5EZYF 3WE7A 2BRUA 4TZ0A 4YH1A 4C88A 2G4CA 3UV3A 1FSPA 2PZ8A 3C7KA 1I8TA 2GTIA 4N8DA 1SHLA 2R6DA 4KAXA 1W9MA 4QUEA 3TE6A 2QEQA 4FEEA 4GSKA 3S5JA 2VAXA 5JRZA 2BEWA 2ZCVA 4I81A 1PUIA 4HAVA 2C54A 1VPTA 1W29A 4C7VA 1IMOA 1ZISA 2EAUA 4YEDA 3C5HA 5AI5A 3QFHA 2HK9A 3R76A 2O8FB 3UQZA 2QTVA 3KOUA 3L7DA 3OIFA 4V2UA 3AUYA 4MX8A 4O8CA 4R98A 1EXNA 4NY1A 2WWFA 3FZYA 2XCRB 2H4YA 3L4SO 3ERCA 1DUVG 3IAS6 5DCLA 4ZPXA 1NRIA 2NVWA 3EZXA 2ZWAA 3K0FA 4X5OA 4YUVA 3LXRA 1D8TA 3RDPA 2RCYA 1Y6ZA 2YWFA 1JFSA 1HK7A 4FWBA 1QDUA 1G42A 3TLAA 2VQ6A 3U3JA 3UPDA 1CY6A 3UCXA 3JRXA 3WJ7A 4WZBE 1ISHA 1M7HA 2A9FA 4YUAA 3LF2A 3EZFA 2BE7A 3AHGA 2BFFB 2NUTB 1QANA 4RMNA 3PT5A 3VSCA 1M1NB 4WFKA 4QT4A 4L02A 5JJCA 5KNCA 3QPUA 1SURA 2YINC 3DXFA 2H18A 3HJUA 3JARB 3WP0A 3WMFA 1ZINA 3OPXA 4F2PA 2GBCA 2H85A 4JXXA 1RQ2A 4MVJP 3VC7A 2QAGB 2IHJA 3TR5A 3EHEA 3IXMA 4N12A 4DM4A 4P9NA 1JKJA 1IWPB 1V6CA 2VCYA 2PX4A 4HNAA 5A7GA 2PZGA 1KI2A 2H48A 5CLQA 3R3VA 2N0SA 5FPTA 1V8OA 4M1ZA 1JQ5A 4BQPA 5ECWA 4TKUA 1BQ3A 4TRRA 2MSKA 1XBTA 3COJA 1XL0A 2FP4A 5JAMA 1L4EA 2A88A 1NRXA 4QM6A 2WD8A 1LI7A 5ALWA 3ILYA 4EGFA 2YQ5A 1GUYA 4MQEA 4TSRA 3F73A 1B42A 1RHQA 5I3ZA 3T15A 4CM9D 1QZZA 2C77A 2NTEA 2CUTA 1H94A 3CUTA 3MTJA 2W90A 5F33A 4CUZA 3DL7A 4N7MA 4HNVA 1CXZA 1OJLA 3JATB 3Q7TA 3VU0A 3HU3A 5BURA 2RB5A 4DIKA 3EDMA 2Y92A 3A2NA 4KBFA 5HPYB 1QPZA 1E3WA 1CDDA 2B1GA 1Y8QA 3G9XA 3GCDA 3IBGA 1XJ0A 4PSVA 4KXNA 2BFDB 4HGRA 3PQDA 4P92A 1G5TA 2CV2A 4AECA 4M1TA 1MAHA 1UZLA 4LZLA 4LHXA 3A2KA 3HCWA 4WLNA 4FTWA 2H7YA 3A9TA 2QM8A 3E58A 4PG8A 1GZ6A 5LYJF 2PUJA 1L4BA 4F3CA 2QG9A 3CYFA 3LZ6A 3TOZA 3NNSA 4OL0A 3ST7A 3ZOZA 4HYTA 1KI7A 2H11A 3EXIA 5CVCA 1QRDA 3L0BA 1EVJA 2BR3A 4N18A 3CB2A 2I6TA 3LK7A 1O94A 3D31A 1OLSA 3HKEA 4UAGA 2HBRA 2W2KA 5CEJA 1V16A 3HA3A 3IJRA 3NALA 4MQFB 3E27A 4G84A 1M2GA 4ZRNA 4E4YA 4ZYXA 1LTKA 1TX4B 2JIZD 1JEAA 3FTPA 4DC0A 1TCBA 3V9AA 3OSZA 1I30A 1RE1A 1U3TA 1VCOA 1ZDMA 2H92A 4NH0A 2I6SA 3D1VA 3L1VA 1T0HB 3NDBB 1SD1A 3PJGA 1VRWA 2HF9A 4BNYA 3O47A 2J4DA 1GPYA 5BR4A 4WOKA 2ZBRA 2I03A 1M5UA 1P31A 2NO6A 5SYMA 1EIZA 4KAJA 1GLVA 2QB5A 2ZRNA 2X0EA 1F2TB 1M1YE 3UFBA 2FHSA 2YXBA 4WNAB 2PV0A 4Z4IA 3NWEA 1NI5A 1N3IA 5ALVA 5KPJA 4G0OA 1GR0A 3ZWPA 2AN4A 3QQPA 3PDIA 3QVGA 1MX5A 1L5YA 2ANBA 3X2EA 3KB1A 4NIMA 3KDAA 2CLFB 4W9NA 4M54A 4N65A 4NZMA 4TWAA 4OA8A 5IDYA 1XZNA 3SFVA 3ZQKA 1G7RA 4I4TF 5FFFA 4B79A 1N6KA 4IS2A 4IGAA 5AK5A 1Z8NA 4MLCA 4FDMA 3KQQA 5C80A 1Y1RA 4Y18A 1PGPA 3HSKA 1FK8A 4FI3C 4WXEA 3SS7X 1YVPA 2RGNA 3E4CA 3UXHA 3DVAA 2GUWA 4GKBA 2BMFA 2C9CA 3U4GA 4LEIA 1ULZA 2JNWA 1P8JA 1EX6A 1X2BA 2JRLA 1EQ2A 1V1RA 3ELUA 3HCBA 3GY0A 4IIJA 5DLPA 5F7ZA 4D98A 1O6BA 4J7AA 1LDBA 1Z82A 2JGDA 1LBIA 1M0EA 1K2VN 1OILA 2I8LA 1AUXA 3K8OE 3K6SB 3JYOA 5KOJB 4D25A 3BD9A 2R00A 2ACEA 5HTOA 2CLMB 2ZYIA 1HKHA 3ILHA 4OGWA 4D5GA 1NKSA 2BKXA 4EI2A 5AW8A 2CXUA 2BLLA 2HCTA 1S7GA 5ALOA 1VMIA 2EBWA 4A36A 2B37A 5K3AA 1UZAA 2OCGA 2V7EA 4X3PA 5IMBA 4AFNA 3KVYA 4R9SA 3K8ZA 1XSEA 1GTZA 2I9KA 4X1IA 3PX7A 1XMVA 1U9IA 3PEUA 4IDAA 3KALA 3TQQA 4WXYB 2LBPA 1OYOA 1GNPA 1K8XB 2Q3BA 2ZRMA 1L8AA 4X1KB 2ZJOA 4DLAA 4TTRA 5TC4A 5ALPA 2L69A 5IDXA 1R4MB 1W30A 1W88A 1U7TA 1L5NA 1HDZA 3JZAA 4GX2A 3T1YB 3CWQA 5EGSA 4U39A 2ZM6B 3AONB 4BX9A 5LMNB 4DEXA 5BR8B 3O8RA 3EN0A 1NXQA 5IT0A 2PTHA 1C3EA 1LPMA 1OV4A 1ZVKA 2E7ZA 2OZLA 3Q87B 2EOAA 2QMEA 4JZKA 4MDYA 5DEIA 1Q0UA 3FNFA 3IEXA 4DPMA 3ZGXA 5BPHA 1CUYA 2R2GA 3K4PA 1APBA 4II7A 2XBLA 3PRJA 3TPZA 4MKHA 2JEYA 2X8AA 4FXOA 1PUXA 2REQA 4XQ0A 5HR5A 5JZBA 3HBMA 1XQVA 2I67A 1A76A 2V6FA 3TQIA 1QJCA 3DCYA 5FUYA 3CZAA 1CRWG 2VEOA 1ZJ4A 3FIJA 4EYEA 3THYA 1T36B 1KH3A 1W87A 2K2QB 3KDSE 4YRTA 5AVJA 4C4ZA 1PEYA 3ZJTA 1K6EA 3JD2A 4FKBA 2DSNA 5D7BA 3VZPA 2RKBA 3SWWA 1PLKA 3VO8A 4JLUA 4E3ZA 2AS0A 2UV8A 1RYDA 1Y1LA 4Y6RA 1X92A 4B09A 4CPDA 2F17A 5IARA 1QZTA 1PUJA 2OV1A 2XMGA 3G5TA 3DR5A 2BGKA 4JQZA 4YREA 4MEAA 1LZKA 3OM0A 2OT3B 4ZALA 1I6MA 1CDEA 1YS2X 2AZ4A 1I9CA 2D1YA 2V7VA 2WIBA 3FYHA 3O38A 3O75A 3MWEA 4PZZA 4DABA 3OIWA 5KJEA 1JAZA 5JJ5A 3MHPA 5IT5A 4C7XA 1ZICA 1QOQB 4Q1VA 5KYXA 2WTUA 2J0SA 1GCGA 1L5OA 2AH5A 1XZGA 2JKVA 1EHIA 4PBSA 3AJ8A 1G8FA 3E2IA 3QKSA 4YQEA 3M81A 3ZQ4A 3PYMA 4V0RA 3U56A 1C8BA 2FPIA 1K08A 1NXTA 1QCCA 1BMDA 1FFSA 1AF4A 5L3RA 2JIPA 2P2ZA 3BRWA 4IUDS 4KLAA 221PA 4GF5A 4MUFA 3QJYA 4IUBS 1J25A 3BD6A 5D01A 4YQZA 4AW9A 1K0FA 1T0JB 4NCJA 2H7CA 5JBNA 5BQPA 2E18A 4X8HA 2AVNA 2MSCB 2HQSA 1SY7A 2J3IA 4KN6A 3ZY4A 2XBMA 1WB5A 3A6GA 1FMFA 2YDYA 4G65A 4RQTA 5B57C 3BA6A 2KPOA 2WWYA 2OBYA 5G0SA 1SJ9A 1L7QA 1ZNZA 1A5ZA 3RABA 1LPSA 1UM9A 3UB4A 9ATCA 1K66A 2C4VA 1QE0A 4Z0HO 1T2NA 3IMEA 4P36A 4AZ3A 2GSDA 1WQ1R 2HWUA 5FQNA 3CONA 3OEYA 2D7DA 3KD3A 2QUJA 4QUIA 1B6SA 3EOZA 4MO9A 3DMRA 3SC3A 4BIIA 3PUYA 5A62A 3WWEA 2HNAA 5AYVA 1S89A 1CZHA 4Y0AA 4P6VF 3ZE6A 1MTOA 1BQEA 3KZVA 3OPYB 1UK7A 3LPMA 3UHAA 3RHZA 3STTA 3HEMA 1R00A 4GP9A 4OP2A 2O7QA 4DW8A 1SK8A 2G7ZA 4RYLA 5KU7A 4RULA 1NDHA 1KA9H 1P1JA 4X90A 2AZXA 2A3NA 3V8NA 1SBQA 1K6IA 2YWHA 4TLEA 2DJ5A 4PGMA 4JL6A 4YRZA 1M67A 4INAA 2ODPA 1ZRHA 3U61B 3CSUA 2AOTB 4CM8A 3DEIA 2Q4BA 2GNPA 3URMA 3EXFB 3I52A 2BDTA 4N5NA 3HJFA 1E2IA 5ERXA 3DDUA 4ZWNA 3BTSA 5FOVA 4KPEC 1T6XA 3K71B 4P93A 4FLMA 2OV2A 4Q4JB 4S2EA 5LLSA 4HFJA 3CIFA 1ISPA 5K8UA 1V35A 1VJ1A 3FNIA 5JSFA 2ZT5A 3U7QB 2I2DA 3I83A 2PEYA 2PMCA 4LKRA 2CFTA 2H16A 1RE0A 3KYJB 3W5IA 1LK5A 1O95D 3BD8A 3L41A 1J99A 5JMWA 5EJEA 3ZHBA 2AXQA 2J9FB 3TCXB 4Y1RB 2RCNA 2C42A 2ZI9A 3DAPA 4BEJA 3RODA 3GFTA 1LU9A 2JAHA 3OTIA 4Z0TA 4RDCA 1CS0A 4EGSA 3X2SA 1F3OA 3W3AA 2ICAA 1PR4A 1U8XX 1Q74A 3MM4A 1UKEA 2YCBA 4UFPA 1NP3A 1TTQB 1U9CA 1X80B 4DLRA 1QONA 4QLAA 4QNMA 2SBTA 4ZT4A 3ROXA 2RARA 4Z7NB 3BIJA 2V74B 4DS3A 3FYUA 2GJSA 3WVNA 5K8TA 1CK4A 4HDMA 1T3GA 2D3TA 1E2QA 4NCIA 4TYMA 5BNTA 1LJUA 3RS3A 4AUKA 3HO1A 1N2CE 3WADA 4O2AB 1JI0A 1TL7C 2QJFA 4RUKA 2IDZA 3ZC3A 4TKVB 2D0OB 5TF0A 1R5OA 3PPXA 2XOXA 2FW6A 2ZU0C 3OJEA 2GS9A 3E9MA 1NRWA 1P0FA 1ZO8A 2Q8QA 3QLVC 4PTYA 5TIIA 1J20A 1QH8B 4FVTA 3I3OA 4G6ZA 3V8QA 1D9XA 3OCVA 1YZQA 3ZYZA 1W4RA 4TOIA 2ZSHA 4Z9AA 4A6PA 1R3UA 2VSXA 4M9UA 3RUAA 4E2XA 5A0VA 2ACWA 4G1VA 2ILVA 1IHXA 3B6IA 1WXGA 1Z28A 2HDNB 2KW5A 3KXLA 2AWNA 1YDGA 5IWCA 3H9EO 1QO0A 1XCJA 2J6BA 3OAAD 2LDXA 1SD2A 3GI1A 4ZVQA 3ZWCA 5KMGB 2GN1A 4L9SA 4YDQA 1K75A 3CRMA 1WXDA 1YD7A 3LOQA 3PPIA 4YMGA 2PL1A 1ZOIA 5C9ZA 4RLSA 5L95A 3GLIE 3R9WA 1JG4A 4G1UC 2ZRPA 3KPVA 3N5KA 5IEBA 4QUDA 3RTGA 1GG8A 1JEQB 2VDRB 2G40A 3AF1A 4KUGA 4ESEA 1XFAA 2C7VA 3Q6IA 3RQIA 5JZSA 2NNLD 2VC2B 4LCBA 4GSYA 2CW5A 1DJLA 3FBWA 4G5RA 3LM8A 5K05A 4ZV7A 4Q05A 4AZTA 2LCIA 4H60A 4W99A 3ZWNA 5ERGB 3TG8A 1VCHA 1J6UA 1KAQA 2VTBA 3U44A 1RYYA 2X4LA 4KMMA 4UNSA 1VGQA 3AERA 1XROA 3K1JA 1N6RA 3NWBA 5JVDB 2FWPA 5KYTA 4FJ1A 4RDHA 1YULA 1GXSA 2IW3A 2YUIA 4EJSB 4FHDA 4LJRA 5DBEX 3HXPA 1IVYA 3OLVA 4G24A 5CLLA 4Z51A 3KZCA 3BIWA 2VJQA 2HT6A 2ZR9A 721PA 5IZ4A 1EFPB 2QRKA 2V7QD 3KXPA 4WBSA 4B4WA 4XEUA 1VLJA 3P9XA 4B2LA 5I8ZA 3O94A 2DPXA 4B6RA 4R0MA 1JPNA 1UT6A 2HGSA 4JBIA 3R6TA 4LC1A 4CQMD 2WWIA 4DYVA 5LN1A 1TF5A 2I22A 3DG9A 4RPKA 1K88A 4KO1S 3KP1A 2G0AA 3QYAA 1T5LA 3NDIA 4B3IA 2ZXUA 2F8SA 2DKFA 2J59A 4A8JA 2O2XA 4MKXA 2VHTA 3BJZA 2ORWA 4PPNA 4COOA 1NE7A 3I6ZA 4JLSA 3QEAZ 2Y71A 4ZYUA 4FQ7A 2ZS7A 1COWA 3EG9B 1AHHA 2I8CA 2ZS8A 3JQAD 4MWGA 2ZQYA 3LP5A 4WVFA 2KHZA 1J8MF 1E61A 2AC4A 2A1TS 2YXPX 3PUZA 5TGZA 5K0JA 1R88A 2NZVG 1FVOA 4ZEVA 4YJHA 1J00A 3N3BC 1M2EA 1HMYA 1PNQA 3CUEF 4JJ8A 3OF2A 4GGMX 1LTHR 4PHGA 1NY6A 4UDOA 3B8EA 4EELA 3EJWA 4WZ6A 3EXEA 2GVNA 3ZCUA 2R3SA 4J76A 2O54A 3O2JA 5BP7A 4A0HA 1M1UA 1AMOA 4WI1A 3F8TA 4CTNA 1CDOA 1AMUA 4UMVA 1M73E 1XK6A 2WFLA 1VMAA 3QVVA 4QGFA 1KI8A 1PZHA 4FN4A 2A0WA 4S24A 2WR8A 3DT9A 3COPA 3V42A 1J0EA 3IOMA 4F5YA 2IH5A 5DTEA 4EAQA 4H31A 1IN5A 4ENPA 2EFGA 1MC1A 3E22B 4MGYR 1SIBE 4URHA 1YQEA 2I62A 2ZSDA 1P5ZB 1KC1A 1N3BA 1QGDA 3GPCA 1XZMA 2X7XA 1QYXA 4UTZA 1KR2A 2GJ8A 2ZAMA 4XIIA 5K3EA 1MMFB 2WV9A 3A9VA 1E6CA 2M1XA 5D3QA 4CKEA 4NMHA 5IU6A 5A06A 4EB6A 3AYXB 4NOJA 1CWUA 4INPA 1HDIA 2GH1A 2VJPA 2W2NA 4L1KA 4TUYB 4EZIA 2RB4A 3F5QA 1LRJA 1ISSA 2HSWA 5FWYB 5L51A 2FZVA 3CLRD 3ER6A 4OJTA 4EVSA 4DCGA 5JFGA 4QZVA 1Y9DA 5JMTA 1E6MA 4RA9B 4UUOA 5T4BA 1GRRA 1NQUA 2D5AA 4D3DA 5TLSA 4QUHA 4YRDA 1DQZA 3QBDA 2I8AA 2Q3DA 4ZYLA 2QPOA 4JLJA 4WUTA 5BSGA 3A37A 1QH0A 1PZXA 2RH9B 3CBQA 3PBKA 2Q9CA 4BNVA 2IW1A 2B1QA 2M1ZA 2VCHA 1GAWA 2CLKB 4PQYA 4PXAA 1XQXA 1ZD9A 2P77A 1ISFA 1JHUA 3EFOA 3REGA 1WCWA 1TI7A 2UVPA 1XZCA 2FXVA 3H6HA 1U7ZA 4DHWA 2W42A 2OGZA 3IP9A 5IUKC 3KQSA 2CVOA 2OHJA 3JU3A 1JU3A 3BWXA 3P9PA 1SUSA 1TM5E 2Q8PA 3F49S 2QW1A 3HLTA 4QTZA 3VGJA 1W0KD 2R86A 4DA7A 1MIOA 4RSGA 1NQVA 4OHBA 1AUPA 2W37A 5EUCA 1XDDA 3O92A 3RC8A 4MYRA 4I0WB 4EJMA 3C7DB 1NI4A 1SCNE 4IILA 1OAOA 1QFXA 3LMKA 1F8XA 2FV8A 4DCTA 4EHDA 4AG6A 4QSMA 1T26A 1ZGZA 3PC8C 3QU9A 5BWLA 1K63A 1DKUA 5HKKA 2GF9A 2PVPA 1KMNA 3GWZA 2GEVA 1AKYA 1E1CB 3R9KA 2ZYTX 1K6XA 4JT4A 2YXNA 4EHNA 4IDEA 4DMMA 5BUZA 3N1UA 1PR6A 3JYNA 4HRYA 4OXKA 4OYLA 2X77A 4R9NA 1X9GA 1NU8A 2A7QA 2F43B 1OASA 2B5VA 4GBJA 4XGNA 5KYGA 4PCUA 5TNXA 4TVSA 3K94A 3REQA 2O9JA 4P7BA 4CRWB 2VPPA 4U2GA 1G9SA 4FOTA 3UK0A 1W46A 1V8BA 3DH0A 4YRLA 2QTWB 2H4WA 2O3RA 3IO5A 1R10A 2E4VA 3DV9A 5HFJA 1I5OA 2QLJA 2YYAA 2QRUA 1D0IA 2IEZA 1YCDA 1JDBC 1Q1GA 1RLTA 2XYVA 3OTQA 1TF2A 3CWZA 3E2PA 2JLQA 1L5QA 4M9ZA 4UM5A 3DONA 4RIEA 1H65A 5I9LA 5H4GA 3JZFA 1UR5A 4PZEA 4Y2HA 4UBIA 4DY4A 3LV8A 5T7BA 3EDYA 4G4IA 3I2GA 3Q2OA 1DT5A 1QQ7A 4HJRA 3WICA 4D99A 2NUPB 3F7NA 5CA1A 2JDIA 4NJMA 2AOVA 4EI8A 2EERA 2JGJA 1CT9A 1C2YA 1UJ5A 1Z8DA 3ICCA 1QAOA 4J9VA 1THGA 4WCDA 1PQYA 3Q3CA 3FZQA 3KTAB 3V00A 1ATZA 1VE5A 2WP8J 5CVVA 2RHMA 1ZXXA 3L8MA 5AVOA 3H3JA 1DC6A 1F2UB 1YZGA 2GX6A 2XODA 4PY2A 1YB1A 2PGLA 1JAIA 5HK9A 1W36B 5JT1A 5A2GA 2KYRA 2PD6A 5BT8A 4I9UA 1N1MA 1VG1A 2Y1FA 5U1PA 3UJ9A 5CB6A 3AUAA 1E9DA 4Q4HA 2GEBA 3OWOA 3DZKA 5F51A 1AQYA 3SXUB 4DQVA 3ZLTA 3A32A 3KKPA 4H15A 4OU5A 3V1MA 2VZEA 1BEUB 4E6EA 2PUEA 1P17A 2X7HA 3OG9A 4ZGGA 4YRMA 2AQIA 4DSUA 3RJTA 5AXBA 3CISA 1MKYA 1Y42X 3ORHA 3PZBA 4UHBA 1VYUA 1E20A 3H99A 3HL4A 2O8EB 1Y3FE 3BQ9A 3ORYA 2QYSA 4R51A 1ONBA 4PM4A 5DXAA 4A2PA 5BWBA 3E61A 3RIMA 1VRVA 3K7EA 4ENQA 3CE6A 3VR6H 4F6RA 2Y66A 3KSMA 1SXJC 2WDZA 4RAQA 2XNDA 4UXJA 2WKPA 4ERNA 1OXMA 1XZIA 5IAKA 3WGUA 3A8TA 4DMHA 4FD2A 1SU8A 1WDTA 2W0MA 1ANKA 2WT8A 2FUNB 1UANA 3OFJA 4TGLA 2WWVD 4AJOA 4UM9D 2NYRA 1UXJA 3BFPA 2XMCA 4CBVA 3WGQA 2JCBA 1EGVB 3WGVA 1OU4A 5A5DA 2EG9A 3RFTA 3Q0IA 4TMFA 2QLMA 2YWGA 4ZOEA 3D6HA 2ZYRA 3Q9LA 4OKSA 2P9BA 2BT4A 3AHJA 1QFJA 4FKZA 3PNVA 2ODTX 3N7UA 1NI3A 1O95C 3ESRA 4HN4B 4PLCA 3X0DA 4G8JA 3QG5A 4X3OA 3O93A 4MR7A 1ODTC 4ARCA 1OH7A 3ZXSA 1XPUA 4QARA 4E08A 1YS1X 1KI3A 3P4UA 1M6EX 2I5PO 2P6NA 2DKOA 1AZSC 2NZWA 4LY9A 2CJYA 1GJRA 4GEGA 4PYRA 4YRNA 4ZVTA 2VYFA 3EBOA 4HUJA 1N4AA 4HDQB 3BILA 4DUGD 1BX0A 4CQLB 1HYGA 1KVUA 3QTTA 3SG0A 4YRBA 5DWDA 4OQYA 1XVLA 4KFCA 4KLZA 3A1DA 5AKJA 4EFMA 1DC4A 1TCVA 4D8TA 3O4IA 3EPKA 2NXNA 2CDCA 3JR3A 5PGMA 5HZGA 5ABPA 3M0EA 5FHQA 2LW7A 4J49A 1XZQA 4WZAE 1R6VA 4QFCA 2D1RA 3QJGA 2FCAA 4B6OA 4GEKA 5CHYA 2A2ZA 4GI2A 1NXWA 2VQFB 2BMDA 4R31A 1QB8A 2HXGA 3HSYA 4G67A 4ID9A 1EX9A 2XDWA 3D4LA 3IP7A 3M4ZA 3P71T 3W1EA 3DHEA 4UE3S 4DTIA 5JBQA 4GZLA 2IHNA 2PYIA 1EK0A 2FX5A 1LPBB 5GJCA 4B2PA 4HQ0A 4M21A 4MP6A 1N3YA 2Y9PB 1QQ6A 3CO0S 1XZEA 2QZPA 2YXEA 1E1NA 4IR7A 3ABIA 1DAEA 2QN3A 3RSGA 1BCRA 4A27A 3PGXA 4BJ6A 5IP5A 1NMSA 2X9NA 3L8CA 3KKLA 1R74A 2F2TA 1YBFA 2GDZA 3N2LA 1TTTA 2C4KA 4P2BA 4FOOA 4KGZA 3PXCX 5DHRA 4UOQA 1EIWA 2P7HA 4NBWA 3AR7A 1YIDA 1KO1A 2ATCA 2Q5CA 3WL5A 3HVUA 2H4ZA 3R7BA 1K8RA 3UTCA 5JD3A 2PT5A 4B2IA 1KC3A 2PAAA 3ANLA 5CDSA 4C21A 1ISRA 4NU6A 2C92A 1IB6A 4IVNA 4DMUB 4JX8A 5DE3A 1OF1A 1XKXA 2NTNA 2BAGA 1L8LA 3F9RA 3VC1A 2WSIA 3DDNA 3ONWA 1TZCA 4ND6A 4QVIA 1GZ3A 2GPBA 2F1IA 2GAJA 2IWRA 2WJPA 1PKEA 5FWAA 3CVXA 2AN1A 2ZITA 3AESA 3OE4A 3SK0A 4IPTA 4BMVA 1Q0ZA 4MEJA 3M8KA 1MNAA 3Q88A 1W0JD 4KR0A 2WI8A 1CW2B 2WIDA 2P27A 2GPTA 2ZR8A 5I51A 4K86A 1P2UA 2ECKA 2Z30A 4UE2A 1SOUA 1BWSA 2ZSEA 3ESBA 4IGFA 4LVUA 3TQHA 3ZW7A 3C6XA 4W5TA 1BOOA 3JTEA 2QORA 1U8YA 4E32A 2C9MA 2HJRA 2ZBUA 3LL4A 1YA8A 3EYAA 2G9ZA 3Q8WA 5AI0A 2C96A 3LLVA 4M83A 2P2CA 4AJ4A 2P6RA 2CB0A 5K0TA 5J2TA 2HPAA 2Q1XA 3QMWA 5LA6B 1LLUA 1KVSA 1FJHA 3D1JA 2M6LA 3WLTA 2JLUA 1EESA 3TLGB 5CXUA 5ITZA 1KY3A 2GHTA 3HVKA 1GPAA 4B17A 1E1RA 3T3EA 4IGEA 5EHNA 5IFKA 2G1PA 3HCAA 5A03A 5MN4A 1DOAA 4FN5A 4K03A 3JZMA 2G8NA 4DNQA 2B5OA 1XRRA 1H0RA 3BX1A 3K4HA 1U6JA 2GK6A 3WZ2A 4F4FA 3ER8A 2XMSA 1UOPA 2IZ0A 3L18A 1ORHA 1W4LA 4MDFA 4JJAA 3WC4A 2BONA 3PPYA 1SHJA 2NUBA 1XA4A 2FPGA 1JXMA 3JPYA 1AQJA 5EQFA 1I5RA 1OH6A 1MFZA 2GPWA 1WMFA 4FDLA 1X70A 4RU1A 4L2IB 3CX6A 4BE4A 4F4CA 2ZUEA 5K3BA 1M6HA 4AYWA 3ON5A 3O3OB 3S44A 1YJCA 1X15A 2W2LD 2D1SA 4ZJZA 2DPHA 1QZXA 3JWPA 2V03A 2J0EA 3UMGA 3E3AA 4GLBA 4DLWA 2IUTA 3GQBA 2H6EA 5KNBH 5AW1A 4N7BA 1DL5A 3AHIA 1F5NA 1RPAA 3M82A 4EG7A 2V3WA 3K1AA 1GZHB 3C1UA 4NQZA 3UB2A 2Y76A 2OCKA 1DEOA 3MIZA 4IIEA 4OKNA 1UDRA 2HU2A 4P86A 2WJJA 1D1SA 1VMDA 2HN9A 1P0IA 2VA8A 3GMTA 4MNTA 4ZK2A 5JD5A 5FLXA 4AMUA 6REQB 2WVGA 4CDNA 1G291 5BN5B 1O9GA 3BZUA 1KAHA 1XXLA 2XTAA 3L4EA 3JQDA 5CBPA 1F1BA 3GD5A 5ESRA 4CFSA 1JX6A 4F7WA 1VIVA 2CHQA 4J3FA 3EC2A 1M2FA 1X39A 4M8IA 4XDZA 5K6RA 3PJFA 4MITA 4E2ZA 4HHEA 1L7DA 2XA1A 1T1EA 3D1LA 3THWA 3TTVA 1ZUNB 3LWDA 3EFHA 1X6VA 4YRJA 5KYVA 4IDGA 3K32A 1HT0A 1I7NA 2CFRA 2IYOA 2W6MA 4RM2A 4UQOA 2XUOA 3PG5A 3T9BA 1SCJA 1VLMA 3NBYC 3EW9A 3P4XA 4DRXA 1CULC 5J4KA 4OQXA 1IY8A 3GXOA 3SDSA 1PK9A 2PXAA 1XCMA 5FF9A 5K03A 3SR3A 3GOHA 5IM4A 3IR5A 4IV0A 5K6TA 5JATA 4IZ6A 4OSEA 5KTSA 5IDWA 3U6BA 2HO5A 5IJ9A 1MXHA 4WLEA 3AJAA 5L53A 2REBA 2QN2A 1DJNA 1CYDA 4DPLA 1L5KA 4JFRA 2GEUA 4LJKA 5DM60 5IF9A 2P0YA 1M0SA 1Y1TA 4K6KA 3OD5A 1REQB 4KOAA 2HQ1A 1PQWA 3SX0A 2A0YA 2B8TA 3AEYA 3LFTA 1SHZA 3NHSA 4JVLA 5B4TA 1CUIA 3CINA 4KODA 5EKDA 3AXTA 2ZUVA 3MBIA 1UAYA 3T3HA 2J09A 3C14C 1OT5A 2ZSIA 5LP6A 2BTQB 3CEAA 4ZU6X 1PJ4A 1XQ1A 3TW6A 1OW3B 3PPVA 2E37A 3LU1A 4KV7A 2QL9A 4KB5A 4YBZA 3DGEC 1U3WA 2PUWA 1P7YA 4IQ0A 2J7KA 1TO2E 1DPGA 4HEQA 4R05A 3SM3A 5ALSA 4AVYA 3OFND 4Z1MD 1WHSA 3EDQA 1CP2A 2XWSA 4TVBA 2VSQA 1TW2A 3F98A 1M2OA 1J0BA 1BGVA 1EFVB 1K98A 1M6YA 1Q0LA 1T2AA 3BIFA 1I4WA 5BOVA 2ODAA 3DL0A 2C7OA 5HCNA 1NN5A 1QKJA 2EYUA 2N75A 2G36A 1Z5GA 3F71A 2FN3A 2R7LA 3DFZA 3UHPA 1SIWA 1E7WA 2BFOA 1Z7BA 2V9PA 3FMOB 4OH1A 5KYKA 5KYWB 2ZYHA 3DMFA 3MF4A 3SX4A 4BN5A 1E6KA 2R1VB 2I2CA 3LVFO 1N8NA 3KFVA 3VM6A 4U02A 2D5IA 2Q4EA 4ZGWA 3NEJA 2XX3A 4EH1A 1PR5A 4OQLA 3IP6A 3KVVA 2QN7A 5EIEA 4LWQA 4UXIA 1DEHA 5GWXA 1BXGA 4IFIA 1IEQA 4IFEA 4QPNA 4UHJA 1I0ZA 3ZDQA 4ZHSA 5EOVA 1E62A 4IVPA 4UTVA 2J32A 3C48A 3DDZX 5DF1A 4IIUA 3ZIDA 2IYEA 5IKOA 4UULA 1WV0A 2HYIC 2POQX 3FKQA 4EO9A 5IDQA 1IM8A 4C3VA 2W6JA 3TBKA 3HU5A 4AL4A 4BFXA 1Y9ZA 4MICA 3W2GA 5FOUA 3LBAA 3SKXA 1VJTA 4ZCMA 3QG1A 1TT5A 2DXIA 1UK6A 1ZOLA 3FZNA 4QHTA 5LCXA 1DLJA 2EX0A 3MWJA 2VHQA 4RD2A 3L0DA 4MS3A 2UZIR 2O1XA 1ZZGA 5D2CA 5BW4A 3FCYA 3R0IA 1SUDA 4G4JA 5J59A 1SKMA 5CB0A 1E3MA 2VPWA 3ASYA 4CL8A 4WKOA 1AM4D 1CF4A 3X1YA 4Q1FA 1YRBA 3FGZA 4JI5B 2Q3EA 3LQRA 2G9QA 3NAMA 2GAIA 4PLFA 1KSHA 1KYZA 1SGWA 3CB4A 4DIEA 1CHDA 1HDYA 3EEBA 4C20A 3UCFA 3ED5A 3MJEA 3C85A 1IBLB 1E89A 1R2QA 3DZDA 3D6UA 4M98A 1SBHA 3DZBA 1LSJA 4EYQA 4EKYA 3CKKA 1QFMA 5BVGA 1UKZA 3G88A 3F2IA 3R7DA 3VVCA 3C1AA 4V39A 4L08A 4RIIA 1KJIA 3R7WA 2R11A 4PC7A 1Z8FA 3AK4A 4AP5A 2VTDA 1HKUA 3HM2A 3WV4A 3HABA 1YCGA 3GRVA 4XAQA 1CY2A 5GVRA 1L7PA 4G26A 4L95C 1J06A 4ME6A 4D6YA 3NC1C 4HGPA 3KUDA 1A2KC 1EDEA 1M5RA 4NENA 1R4NA 2X5JO 3SQMA 4YGXB 3EXG1 3JYPA 1E0KA 4AJLA 3MPUA 4CHTA 3CR8A 4OHRA 2OHGA 3FOCA 1GPMA 3NYQA 5LQKA 1ZQ9A 3ESCA 4FBGA 4PHFA 5KNCD 5E1OA 1R8SA 2Z98A 3B1VA 3EZ6A 2BFCB 3AF0A 4TS9A 5CM2Z 1YHYA 3L6OO 1PF7E 2EFDB 2P6PA 13PKA 2DCMA 2XF2A 3QZUA 1ZX1A 4P35A 4EA6A 4LWPA 2O48X 4ND4A 1M76A 4Y6OA 4JUFA 3IRUA 4M9SA 2RH8A 4B0OA 1WP4A 1NMYA 3CZ4A 3AI7A 3SJ7A 1YOVA 1GCUA 3AOEC 3TZCA 4C22A 3DPUA 3LS2A 1X7YB 4BO4A 2Q4RA 3DYIA 2EKQA 4DDWA 2OKCA 4D8WA 1YKSA 3Q6NA 1K5PA 5BN3B 2AK2A 3COYA 2PSSA 1DIGA 4UKDA 2C4HA 3IAS1 2F67A 2E1PA 1DBQA 3H9BA 3LFUA 4BDSA 4L85A 4AJ2A 2PH3A 9LDBA 2FEOA 2LKCA 2BPOA 2PH1A 1S2IA 1ZH0A 1Z6YA 4MVJD 4NJEA 5JEEA 4M8NE 1YFZA 4HDRB 4RKEA 3DAGA 3RBXA 4NNJA 1PX0A 2CGEA 1IHPA 3HNOA 4Z4HA 5BQOA 2NUAA 4U2DA 3VV2A 1VG9B 1J0CA 2PZAA 2W4MA 2OBMA 2TYSB 1DQPA 3O8BA 3RO7A 3REOA 5C5EA 4W82A 3J7AC 4I4LA 2X14A 3MTAA 2Y2UA 4P84A 5I47A 1O54A 2JBWA 2IC5A 4N5HX 3RUIA 4EGCB 1AKVA 2QAJA 3FYCA 2PGXA 3N07A 4Q3LA 2J6HA 2C99A 1FVFA 1O94D 2ZTUA 3QXXA 4G0QA 4TRJA 1TQ4A 2R8EA 2R87A 1QHIA 4REMA 4EAAA 2E5FA 2X58A 4ER6A 1DIHA 4EUNA 2QBYA 2YHAA 1UZUA 4C03A 2JCGA 4PHTA 2WUFA 3K9GA 3ESQA 1PS9A 2DR0A 2IHBA 2NO0A 3EZ2A 3H87A 4LWOA 1K4KA 2JBAB 2Z6UA 3IAEA 1M8FA 2Z2XA 3AP2A 1K7EB 2EJCA 3D7MA 1YQUA 4REQB 3LC7O 2FN4A 4KGVA 3G6KA 1GLNA 4A4DA 4DEYA 4TYYA 5JNUA 1K27A 1H22A 2EP7A 3AR5A 3E2MA 4XASA 3TM4A 1UMCA 3VNAA 4F6LA 3A3YA 3D2CA 4WY5A 5ERYA 5H02A 4CKBB 2HXYA 2WKQA 4KR3A 4Q93A 3LYLA 5G3YA 3I64A 2NU9B 1P2BA 1P4HA 2CWWA 3TI7A 4UEWA 1OX4A 4CM5A 4NULA 2CV1A 3VNUA 1PWZA 3UJDA 1TKAA 1SZCA 4H6XA 4OHZA 3RUHA 3W9BA 5L7TA 1EB8A 3K53A 1JXAA 4R2WA 3KQTA 1W9HA 2JFWA 1D04A 1E2KA 4C4TA 3DHVA 3UXEA 3EZGA 1N0IA 5GZ6A 2IYNA 4CR8A 1OCEA 1UFVA 3ZXUB 4I1PA 3M33A 1NONA 2XMZA 2UZ1B 4K3UA 4MB0A 1RJDA 3EUFA 2B6NA 3QX9A 4BV3A 3UUGA 4Q7QA 4R40A 2ZAIA 5HE8A 3IQFA 4E5UA 5FV7A 1LSSA 2ZVQX 2XBUA 3R5HA 1I3CA 5JCJA 4C7KA 1DE0A 3L6UA 3IAM6 2B4YA 3GLUA 3OA2A 2X1HA 4MJ3A 1H1TA 3GA0A 4CL2A 3GU3A 3HBFA 4GXNA 1RHRA 3TL6A 1TB4A 1BXKA 2O8FA 1WM1A 2FFRA 3EQ6A 2QNRA 1CQJA 3MPOA 5COBA 3NHBA 5KTPA 4QDXA 1ISGA 1FXWF 4KN8A 3V46A 4JWKA 3WWPA 1V0JA 2PGJA 3JVEA 1ZM9A 1MLDA 4A82A 2FZLA 1GZDA 2VDMB 5EKSA 1BEEA 1ZSVA 4BU1A 5JNLA 2CNLA 4Q4AA 5D5PA 2C7GA 3CNHA 4WK4B 3UWOA 4B6GA 3MBKA 2QI9F 3KUUA 4ZZ0A 3H1FA 1SVIA 1E2BA 4ND1A 1YNSA 1IQUA 4IMRA 4LN1A 1AA6A 4HDNB 4QUBA 2KI5A 1C9JA 5CYPA 3IPXA 1H2RS 2VPTA 3EFBA 4NDNE 4Q21A 4ZOLA 5L40A 2R44A 3GBVA 4BNJA 1WTCA 1RMQA 1YJBA 2PR2A 2NUTA 1MA0A 1OA1A 1QIKA 4XI9A 1X1SA 1KSJA 1DBPA 3ZI0A 4D9NA 1QP0A 3H3XA 1YQGA 4CF5A 3IEKA 1JG6A 4H35A 2Z8ZA 3M5DA 2IJGX 3JZIA 4FZ5A 3MGCA 2IYYA 1Z5NA 4UZSA 4AP9A 5AJXA 1LNZA 3IMGA 2OM6A 2EL7A 4E5VA 4DFDA 1ZC4A 1HE5A 3D5QA