4JCQA

Clpp1 from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
170
Chain Sequence
ILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into caseinolytic proteases reveal an unprecedented regulation principle of their catalytic triad.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 170
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4jcqA00
1EY3A 3V5IA 4EMPA 5KJPA 3T3WA 3IB9A 4QIJA 3KTHA 1EF9A 3R0OA 3OC7A 4HC8A 3Q0JA 4NNQA 4U18A 3TVWA 1PIXA 1O8UA 2J5GA 4Z0MA 3TZ3A 5FUSA 4ZU2A 3OT6A 2J5II 2PPYA 5DZKH 5DTPA 5C9GA 2J5IA 3M6NA 1RJNA 1XO6A 1WDLA 3MOYA 1N6DA 1RJMA 2A7KA 5G1SA 1XNVA 2Q35A 1MJ3A 4ASIA 2W3PA 3SWXA 2VSSA 1ON9A 3P5MA 3T8AA 5KDRB 1FC6A 4ZDEA 2ZL0A 4U19A 1EF8A 5DL1A 3I47A 5E0SH 5FIFA 3H0UA 3ZWAA 2HW5A 1OD4A 3QKAA 2QQ3A 1UIYA 2A7SA 5DU6A 4K2NA 2ZQRA 4KPKA 4QFEA 3HP0A 3R6HA 3U9RB 3T89A 3BPPA 3ZWBA 3Q0GA 4U0GH 3QK8A 1N6FA 3HLN1 4LK5A 1XNWA 2EJ5A 3RRVA 1HNUA 4WCZA 3ISAA 2ZL3A 1FC7A 3IAVA 1Q51A 4L6WA 2J5SA 3OMEA 4B3HA 4WYOB 2VSSF 3TT7A 2VSUC 3TRRA 2F9IA 3BEZA 4FZWC 3QWDA 4U0HA 3LAOA 3DORA 3P2LA 1X0UA 4RCNA 3R9QA 2VREA 4JFCA 5DU8A 3RSTA 2WTBA 5DU4A 5INIA 3H0SA 2VSSE 4I4ZA 1UYSA 5DZKA 5E0NX 3ZWCA 3VIVA 3TT6A 3K50A 1HZDA 4JCQA 4NEKA 4MOUA 3T88A 4G2RA 3KQFA 4EMLA 4F47A 4K29A 4DI1A 1W2XA 4B3JA 4ZDDA 2F9YB 2Q34A 2VSUE 3HRXA 1ON3A 5G1QA 3ZW8A 1TYFA 3LKEA 3V5EA 5INFA 3H81A 1JXZA 2F6IA 3U9SB 2X24A 4L8KA 4ELWA 1J7XA 3PEAA 4FN7A 4IZCA 1XNYA 2X58A 3H02A 4KD6A 4JCRA 1N6EA 4ZDFA 3HE2A 4OG1A 2VSUF 3TDCA 3GMAA 4WZ8B 4ZDBA 1NZYB 4JCTA 4QIIA 2DEOA 3QMJA 3KTGA 4ELXA 5G1RA 3DJAA 2J5IB 4JCSA 1XX4A 4HNKA 2FW2A 3GF3A 4IZDA 4JJTA 3NJBA 3R9SA 3H0JA 2Q2XA 2A81A 3TV5A 2D3TA 4JWVA 3MYBA 4FN8A 2VSUA 4I42A 5INGA 3FF6A 2CBYA 1YG6A 4I52A 5MGBA 3PZKA 5IKLB 3IBBA 2DUBA 3KTKA 4IZBA 4FB8A 3Q1TA 1FC9A 4JYLA 3H0QA 1FCFA 3MT6A 4OLQA 1K32A 4B3IA 1UYRA 3M6MA 4EMMA 3KTIA 3G64A 3MFMA 3L3SA 3Q7HA 4RYFH 2IEXA 1UYTA 2PG8A 3JU1A 2GTRA 4U1AA 3PGQA 3TVUA 5DKPA 5C90A 3T8BA 1Y7OA 3ST9A 1SG4A 4JYJA 1VRGA 5E0SA 2F9YA 4JVTA 4GM2A 4MXIA 4MI2A 3FDUA 1TG6A 4ZDCA 1WDMA 3QYRA 3U9TB 4JOTA 3SLLA 1UYVA 5CTCA 3GLMA 5DTWA 1NZYA 5JBXA 4GHNA 3ZW9A 3TLFA 1WDKA 2J5GD 3PE8A 5KDRA 1Q52A 2C8TA 3NJDA 3N6RB 4FNBA 1SZOA 4K3WA 2ZL4A 1DUBA 1YG8A 2ZL2A 3GKBA 1OD2A 3STAA 4FJWD 3BF0A 4OMRA 3RSIA 2PBPA 4JSBA 2UZFA 2FZSA 1HNOA 3KTJA 3QXIA 4Q1IA 2F9IB 2BZRA 4KWBA 5DUFA 4Q0GA 4FZWA 2NP9A 2CE3A 3R9TA 2F6QA 4YLHA 3K8XA 1PJHA 1WZ8A 5DUCA 1K39A 4RYFA 2FBMA 3QREA 3HINA 3WG5A 4ELSA 3P85A 5CTBA 2VX2A 1DCIA 3QXZA 4FNDA 3GF7A 5JBWA 4KNPA 2ZQQA 4U0GA
chains in the Genus database with same CATH superfamily
1EY3A 3V5IA 4EMPA 5KJPA 3T3WA 3IB9A 4QIJA 3KTHA 1EF9A 3R0OA 3OC7A 4HC8A 3Q0JA 4NNQA 4U18A 3TVWA 1PIXA 1O8UA 2J5GA 4Z0MA 3TZ3A 5FUSA 4ZU2A 3OT6A 2J5II 2PPYA 5DZKH 5DTPA 5C9GA 2J5IA 3M6NA 1RJNA 1XO6A 1WDLA 3MOYA 1N6DA 1RJMA 2A7KA 5G1SA 1XNVA 2Q35A 1MJ3A 4ASIA 2W3PA 3SWXA 2VSSA 1ON9A 3P5MA 3T8AA 5KDRB 1FC6A 4ZDEA 2ZL0A 4U19A 1EF8A 5DL1A 3I47A 5E0SH 5FIFA 3H0UA 3ZWAA 2HW5A 1OD4A 3QKAA 2QQ3A 1UIYA 2A7SA 5DU6A 4K2NA 2ZQRA 4KPKA 4QFEA 3HP0A 3R6HA 3U9RB 3T89A 3BPPA 3ZWBA 3Q0GA 4U0GH 3QK8A 1N6FA 3HLN1 4LK5A 1XNWA 2EJ5A 3RRVA 1HNUA 4WCZA 3ISAA 2ZL3A 1FC7A 3IAVA 1Q51A 4L6WA 2J5SA 3OMEA 4B3HA 4WYOB 2VSSF 3TT7A 2VSUC 3TRRA 2F9IA 3BEZA 4FZWC 3QWDA 4HDTA 4U0HA 3LAOA 3DORA 3P2LA 1X0UA 4RCNA 3R9QA 2VREA 4JFCA 5DU8A 3RSTA 2WTBA 5DU4A 5INIA 3H0SA 2VSSE 4I4ZA 1UYSA 5DZKA 5E0NX 3ZWCA 3VIVA 3TT6A 5HUQA 3K50A 1HZDA 4JCQA 4NEKA 4MOUA 3T88A 4G2RA 3KQFA 4NARA 4EMLA 4F47A 4K29A 4DI1A 1W2XA 4B3JA 4ZDDA 2F9YB 2Q34A 2VSUE 3HRXA 1ON3A 5G1QA 3ZW8A 4J2UA 1TYFA 3LKEA 3V5EA 5INFA 3H81A 1JXZA 2F6IA 3U9SB 2X24A 4L8KA 4ELWA 2YJGA 1J7XA 3PEAA 4FN7A 4IZCA 1XNYA 2X58A 3H02A 4KD6A 4JCRA 1N6EA 4ZDFA 3HE2A 4OG1A 2VSUF 3TDCA 3GMAA 4WZ8B 4ZDBA 1NZYB 4JCTA 4QIIA 2DEOA 3QMJA 3KTGA 4ELXA 5G1RA 3DJAA 2J5IB 4JCSA 1XX4A 4HNKA 2FW2A 3GF3A 4IZDA 4JJTA 3NJBA 3R9SA 3H0JA 2Q2XA 2A81A 3TV5A 2D3TA 4JWVA 3MYBA 4FN8A 2VSUA 4I42A 5INGA 3FF6A 2CBYA 1YG6A 4I52A 5MGBA 3PZKA 5IKLB 3IBBA 2DUBA 3KTKA 4IZBA 4FB8A 3Q1TA 1FC9A 4JYLA 3H0QA 1FCFA 3MT6A 4OLQA 1K32A 4B3IA 1UYRA 3M6MA 4EMMA 3KTIA 3G64A 3MFMA 3L3SA 3Q7HA 4RYFH 2IEXA 1UYTA 2PG8A 3JU1A 2GTRA 4U1AA 3PGQA 3TVUA 5DKPA 5C90A 3T8BA 1Y7OA 3ST9A 1SG4A 4JYJA 1VRGA 5E0SA 2F9YA 4JVTA 4GM2A 4MXIA 4MI2A 3FDUA 1TG6A 4ZDCA 1WDMA 3QYRA 3U9TB 4JOTA 3SLLA 1UYVA 5CTCA 3GLMA 5DTWA 1NZYA 5JBXA 4GHNA 3ZW9A 3TLFA 1WDKA 2J5GD 3PE8A 5KDRA 1Q52A 2C8TA 3NJDA 3N6RB 4FNBA 1SZOA 4K3WA 2ZL4A 1DUBA 1YG8A 2ZL2A 3GKBA 1OD2A 3STAA 4FJWD 3BF0A 4OMRA 3RSIA 2PBPA 4JSBA 2UZFA 2FZSA 1HNOA 3KTJA 3QXIA 4Q1IA 2F9IB 2BZRA 4KWBA 5DUFA 4Q0GA 4FZWA 2NP9A 2CE3A 3R9TA 2F6QA 4YLHA 3K8XA 1PJHA 1WZ8A 5DUCA 1K39A 4RYFA 2FBMA 3QREA 3BPTA 3HINA 3WG5A 4ELSA 3P85A 5CTBA 2VX2A 1DCIA 3QXZA 4FNDA 3GF7A 5JBWA 4KNPA 2ZQQA 4U0GA
chains in the Genus database with same CATH topology
1EY3A 3V5IA 4EMPA 5KJPA 3T3WA 3IB9A 4QIJA 3KTHA 1EF9A 3R0OA 3OC7A 4HC8A 3Q0JA 4NNQA 4U18A 3TVWA 1PIXA 1O8UA 2J5GA 4Z0MA 3TZ3A 5FUSA 4ZU2A 3OT6A 2J5II 2PPYA 5DZKH 5DTPA 5C9GA 2J5IA 3M6NA 1RJNA 1XO6A 1WDLA 3MOYA 1N6DA 1RJMA 2A7KA 5G1SA 1XNVA 2Q35A 1MJ3A 4ASIA 2W3PA 3SWXA 2VSSA 1ON9A 3P5MA 3T8AA 5KDRB 1FC6A 4ZDEA 2ZL0A 4U19A 1EF8A 5DL1A 3I47A 5E0SH 5FIFA 3H0UA 3ZWAA 2HW5A 1OD4A 3QKAA 2QQ3A 1UIYA 2A7SA 5DU6A 4K2NA 2ZQRA 4KPKA 4QFEA 3HP0A 3R6HA 3U9RB 3T89A 3BPPA 3ZWBA 3Q0GA 4U0GH 3QK8A 1N6FA 3HLN1 4LK5A 1XNWA 2EJ5A 3RRVA 1HNUA 4WCZA 3ISAA 2ZL3A 1FC7A 3IAVA 1Q51A 4L6WA 2J5SA 3OMEA 4B3HA 4WYOB 2VSSF 3TT7A 2VSUC 3TRRA 2F9IA 3BEZA 4FZWC 3QWDA 4HDTA 4U0HA 3LAOA 3DORA 3P2LA 1X0UA 4RCNA 3R9QA 2VREA 4JFCA 5DU8A 3RSTA 2WTBA 5DU4A 5INIA 3H0SA 2VSSE 4I4ZA 1UYSA 5DZKA 5E0NX 3ZWCA 3VIVA 3TT6A 5HUQA 3K50A 1HZDA 4JCQA 4NEKA 4MOUA 3T88A 4G2RA 3KQFA 4NARA 4EMLA 4F47A 4K29A 4DI1A 1W2XA 4B3JA 4ZDDA 2F9YB 2Q34A 2VSUE 3HRXA 1ON3A 5G1QA 3ZW8A 4J2UA 1TYFA 3LKEA 3V5EA 5INFA 3H81A 1JXZA 2F6IA 3U9SB 2X24A 4L8KA 4ELWA 2YJGA 1J7XA 3PEAA 4FN7A 4IZCA 1XNYA 2X58A 3H02A 4KD6A 4JCRA 1N6EA 4ZDFA 3HE2A 4OG1A 2VSUF 3TDCA 3GMAA 4WZ8B 4ZDBA 1NZYB 4JCTA 4QIIA 2DEOA 3QMJA 3KTGA 4ELXA 5G1RA 3DJAA 2J5IB 4JCSA 1XX4A 4HNKA 2FW2A 3GF3A 4IZDA 4JJTA 3NJBA 3R9SA 3H0JA 2Q2XA 2A81A 3TV5A 2D3TA 4JWVA 3MYBA 4FN8A 2VSUA 4I42A 5INGA 3FF6A 2CBYA 1YG6A 4I52A 5MGBA 3PZKA 5IKLB 3IBBA 2DUBA 3KTKA 4IZBA 4FB8A 3Q1TA 1FC9A 4JYLA 3H0QA 1FCFA 3MT6A 4OLQA 1K32A 4B3IA 1UYRA 3M6MA 4EMMA 3KTIA 3G64A 3MFMA 3L3SA 3Q7HA 4RYFH 2IEXA 1UYTA 2PG8A 3JU1A 2GTRA 4U1AA 3PGQA 3TVUA 5DKPA 5C90A 3T8BA 1Y7OA 3ST9A 1SG4A 4JYJA 1VRGA 5E0SA 2F9YA 4JVTA 4GM2A 4MXIA 4MI2A 3FDUA 1TG6A 4ZDCA 1WDMA 3QYRA 3U9TB 4JOTA 3SLLA 1UYVA 5CTCA 3GLMA 5DTWA 1NZYA 5JBXA 4GHNA 3ZW9A 3TLFA 1WDKA 2J5GD 3PE8A 5KDRA 1Q52A 2C8TA 3NJDA 3N6RB 4FNBA 1SZOA 4K3WA 2ZL4A 1DUBA 1YG8A 2ZL2A 3GKBA 1OD2A 3STAA 4FJWD 3BF0A 4OMRA 3RSIA 2PBPA 4JSBA 2UZFA 2FZSA 1HNOA 3KTJA 3QXIA 4Q1IA 2F9IB 2BZRA 4KWBA 5DUFA 4Q0GA 4FZWA 2NP9A 2CE3A 3R9TA 2F6QA 4YLHA 3K8XA 1PJHA 1WZ8A 5DUCA 1K39A 4RYFA 2FBMA 3QREA 3BPTA 3HINA 3WG5A 4ELSA 3P85A 5CTBA 2VX2A 1DCIA 3QXZA 4FNDA 3GF7A 5JBWA 4KNPA 2ZQQA 4U0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY3 A;  3V5I A;  4EMP A;  5KJP A;  3T3W A;  3IB9 A;  4QIJ A;  3KTH A;  1EF9 A;  3R0O A;  3OC7 A;  4HC8 A;  3Q0J A;  4NNQ A;  4U18 A;  3TVW A;  1PIX A;  1O8U A;  2J5G A;  4Z0M A;  3TZ3 A;  5FUS A;  4ZU2 A;  3OT6 A;  2J5I I;  2PPY A;  5DZK H;  5DTP A;  5C9G A;  2J5I A;  3M6N A;  1RJN A;  1XO6 A;  1WDL A;  3MOY A;  1N6D A;  1RJM A;  2A7K A;  5G1S A;  1XNV A;  2Q35 A;  1MJ3 A;  4ASI A;  2W3P A;  3SWX A;  2VSS A;  1ON9 A;  3P5M A;  3T8A A;  5KDR B;  1FC6 A;  4ZDE A;  2ZL0 A;  4U19 A;  1EF8 A;  5DL1 A;  3I47 A;  5E0S H;  5FIF A;  3H0U A;  3ZWA A;  2HW5 A;  1OD4 A;  3QKA A;  2QQ3 A;  1UIY A;  2A7S A;  5DU6 A;  4K2N A;  2ZQR A;  4KPK A;  4QFE A;  3HP0 A;  3R6H A;  3U9R B;  3T89 A;  3BPP A;  3ZWB A;  3Q0G A;  4U0G H;  3QK8 A;  1N6F A;  3HLN 1;  4LK5 A;  1XNW A;  2EJ5 A;  3RRV A;  1HNU A;  4WCZ A;  3ISA A;  2ZL3 A;  1FC7 A;  3IAV A;  1Q51 A;  4L6W A;  2J5S A;  3OME A;  4B3H A;  4WYO B;  2VSS F;  3TT7 A;  2VSU C;  3TRR A;  2F9I A;  3BEZ A;  4FZW C;  3QWD A;  4U0H A;  3LAO A;  3DOR A;  3P2L A;  1X0U A;  4RCN A;  3R9Q A;  2VRE A;  4JFC A;  5DU8 A;  3RST A;  2WTB A;  5DU4 A;  5INI A;  3H0S A;  2VSS E;  4I4Z A;  1UYS A;  5DZK A;  5E0N X;  3ZWC A;  3VIV A;  3TT6 A;  3K50 A;  1HZD A;  4JCQ A;  4NEK A;  4MOU A;  3T88 A;  4G2R A;  3KQF A;  4EML A;  4F47 A;  4K29 A;  4DI1 A;  1W2X A;  4B3J A;  4ZDD A;  2F9Y B;  2Q34 A;  2VSU E;  3HRX A;  1ON3 A;  5G1Q A;  3ZW8 A;  1TYF A;  3LKE A;  3V5E A;  5INF A;  3H81 A;  1JXZ A;  2F6I A;  3U9S B;  2X24 A;  4L8K A;  4ELW A;  1J7X A;  3PEA A;  4FN7 A;  4IZC A;  1XNY A;  2X58 A;  3H02 A;  4KD6 A;  4JCR A;  1N6E A;  4ZDF A;  3HE2 A;  4OG1 A;  2VSU F;  3TDC A;  3GMA A;  4WZ8 B;  4ZDB A;  1NZY B;  4JCT A;  4QII A;  2DEO A;  3QMJ A;  3KTG A;  4ELX A;  5G1R A;  3DJA A;  2J5I B;  4JCS A;  1XX4 A;  4HNK A;  2FW2 A;  3GF3 A;  4IZD A;  4JJT A;  3NJB A;  3R9S A;  3H0J A;  2Q2X A;  2A81 A;  3TV5 A;  2D3T A;  4JWV A;  3MYB A;  4FN8 A;  2VSU A;  4I42 A;  5ING A;  3FF6 A;  2CBY A;  1YG6 A;  4I52 A;  5MGB A;  3PZK A;  5IKL B;  3IBB A;  2DUB A;  3KTK A;  4IZB A;  4FB8 A;  3Q1T A;  1FC9 A;  4JYL A;  3H0Q A;  1FCF A;  3MT6 A;  4OLQ A;  1K32 A;  4B3I A;  1UYR A;  3M6M A;  4EMM A;  3KTI A;  3G64 A;  3MFM A;  3L3S A;  3Q7H A;  4RYF H;  2IEX A;  1UYT A;  2PG8 A;  3JU1 A;  2GTR A;  4U1A A;  3PGQ A;  3TVU A;  5DKP A;  5C90 A;  3T8B A;  1Y7O A;  3ST9 A;  1SG4 A;  4JYJ A;  1VRG A;  5E0S A;  2F9Y A;  4JVT A;  4GM2 A;  4MXI A;  4MI2 A;  3FDU A;  1TG6 A;  4ZDC A;  1WDM A;  3QYR A;  3U9T B;  4JOT A;  3SLL A;  1UYV A;  5CTC A;  3GLM A;  5DTW A;  1NZY A;  5JBX A;  4GHN A;  3ZW9 A;  3TLF A;  1WDK A;  2J5G D;  3PE8 A;  5KDR A;  1Q52 A;  2C8T A;  3NJD A;  3N6R B;  4FNB A;  1SZO A;  4K3W A;  2ZL4 A;  1DUB A;  1YG8 A;  2ZL2 A;  3GKB A;  1OD2 A;  3STA A;  4FJW D;  3BF0 A;  4OMR A;  3RSI A;  2PBP A;  4JSB A;  2UZF A;  2FZS A;  1HNO A;  3KTJ A;  3QXI A;  4Q1I A;  2F9I B;  2BZR A;  4KWB A;  5DUF A;  4Q0G A;  4FZW A;  2NP9 A;  2CE3 A;  3R9T A;  2F6Q A;  4YLH A;  3K8X A;  1PJH A;  1WZ8 A;  5DUC A;  1K39 A;  4RYF A;  2FBM A;  3QRE A;  3HIN A;  3WG5 A;  4ELS A;  3P85 A;  5CTB A;  2VX2 A;  1DCI A;  3QXZ A;  4FND A;  3GF7 A;  5JBW A;  4KNP A;  2ZQQ A;  4U0G A; 
#chains in the Genus database with same CATH topology
 1EY3 A;  3V5I A;  4EMP A;  5KJP A;  3T3W A;  3IB9 A;  4QIJ A;  3KTH A;  1EF9 A;  3R0O A;  3OC7 A;  4HC8 A;  3Q0J A;  4NNQ A;  4U18 A;  3TVW A;  1PIX A;  1O8U A;  2J5G A;  4Z0M A;  3TZ3 A;  5FUS A;  4ZU2 A;  3OT6 A;  2J5I I;  2PPY A;  5DZK H;  5DTP A;  5C9G A;  2J5I A;  3M6N A;  1RJN A;  1XO6 A;  1WDL A;  3MOY A;  1N6D A;  1RJM A;  2A7K A;  5G1S A;  1XNV A;  2Q35 A;  1MJ3 A;  4ASI A;  2W3P A;  3SWX A;  2VSS A;  1ON9 A;  3P5M A;  3T8A A;  5KDR B;  1FC6 A;  4ZDE A;  2ZL0 A;  4U19 A;  1EF8 A;  5DL1 A;  3I47 A;  5E0S H;  5FIF A;  3H0U A;  3ZWA A;  2HW5 A;  1OD4 A;  3QKA A;  2QQ3 A;  1UIY A;  2A7S A;  5DU6 A;  4K2N A;  2ZQR A;  4KPK A;  4QFE A;  3HP0 A;  3R6H A;  3U9R B;  3T89 A;  3BPP A;  3ZWB A;  3Q0G A;  4U0G H;  3QK8 A;  1N6F A;  3HLN 1;  4LK5 A;  1XNW A;  2EJ5 A;  3RRV A;  1HNU A;  4WCZ A;  3ISA A;  2ZL3 A;  1FC7 A;  3IAV A;  1Q51 A;  4L6W A;  2J5S A;  3OME A;  4B3H A;  4WYO B;  2VSS F;  3TT7 A;  2VSU C;  3TRR A;  2F9I A;  3BEZ A;  4FZW C;  3QWD A;  4HDT A;  4U0H A;  3LAO A;  3DOR A;  3P2L A;  1X0U A;  4RCN A;  3R9Q A;  2VRE A;  4JFC A;  5DU8 A;  3RST A;  2WTB A;  5DU4 A;  5INI A;  3H0S A;  2VSS E;  4I4Z A;  1UYS A;  5DZK A;  5E0N X;  3ZWC A;  3VIV A;  3TT6 A;  5HUQ A;  3K50 A;  1HZD A;  4JCQ A;  4NEK A;  4MOU A;  3T88 A;  4G2R A;  3KQF A;  4NAR A;  4EML A;  4F47 A;  4K29 A;  4DI1 A;  1W2X A;  4B3J A;  4ZDD A;  2F9Y B;  2Q34 A;  2VSU E;  3HRX A;  1ON3 A;  5G1Q A;  3ZW8 A;  4J2U A;  1TYF A;  3LKE A;  3V5E A;  5INF A;  3H81 A;  1JXZ A;  2F6I A;  3U9S B;  2X24 A;  4L8K A;  4ELW A;  2YJG A;  1J7X A;  3PEA A;  4FN7 A;  4IZC A;  1XNY A;  2X58 A;  3H02 A;  4KD6 A;  4JCR A;  1N6E A;  4ZDF A;  3HE2 A;  4OG1 A;  2VSU F;  3TDC A;  3GMA A;  4WZ8 B;  4ZDB A;  1NZY B;  4JCT A;  4QII A;  2DEO A;  3QMJ A;  3KTG A;  4ELX A;  5G1R A;  3DJA A;  2J5I B;  4JCS A;  1XX4 A;  4HNK A;  2FW2 A;  3GF3 A;  4IZD A;  4JJT A;  3NJB A;  3R9S A;  3H0J A;  2Q2X A;  2A81 A;  3TV5 A;  2D3T A;  4JWV A;  3MYB A;  4FN8 A;  2VSU A;  4I42 A;  5ING A;  3FF6 A;  2CBY A;  1YG6 A;  4I52 A;  5MGB A;  3PZK A;  5IKL B;  3IBB A;  2DUB A;  3KTK A;  4IZB A;  4FB8 A;  3Q1T A;  1FC9 A;  4JYL A;  3H0Q A;  1FCF A;  3MT6 A;  4OLQ A;  1K32 A;  4B3I A;  1UYR A;  3M6M A;  4EMM A;  3KTI A;  3G64 A;  3MFM A;  3L3S A;  3Q7H A;  4RYF H;  2IEX A;  1UYT A;  2PG8 A;  3JU1 A;  2GTR A;  4U1A A;  3PGQ A;  3TVU A;  5DKP A;  5C90 A;  3T8B A;  1Y7O A;  3ST9 A;  1SG4 A;  4JYJ A;  1VRG A;  5E0S A;  2F9Y A;  4JVT A;  4GM2 A;  4MXI A;  4MI2 A;  3FDU A;  1TG6 A;  4ZDC A;  1WDM A;  3QYR A;  3U9T B;  4JOT A;  3SLL A;  1UYV A;  5CTC A;  3GLM A;  5DTW A;  1NZY A;  5JBX A;  4GHN A;  3ZW9 A;  3TLF A;  1WDK A;  2J5G D;  3PE8 A;  5KDR A;  1Q52 A;  2C8T A;  3NJD A;  3N6R B;  4FNB A;  1SZO A;  4K3W A;  2ZL4 A;  1DUB A;  1YG8 A;  2ZL2 A;  3GKB A;  1OD2 A;  3STA A;  4FJW D;  3BF0 A;  4OMR A;  3RSI A;  2PBP A;  4JSB A;  2UZF A;  2FZS A;  1HNO A;  3KTJ A;  3QXI A;  4Q1I A;  2F9I B;  2BZR A;  4KWB A;  5DUF A;  4Q0G A;  4FZW A;  2NP9 A;  2CE3 A;  3R9T A;  2F6Q A;  4YLH A;  3K8X A;  1PJH A;  1WZ8 A;  5DUC A;  1K39 A;  4RYF A;  2FBM A;  3QRE A;  3BPT A;  3HIN A;  3WG5 A;  4ELS A;  3P85 A;  5CTB A;  2VX2 A;  1DCI A;  3QXZ A;  4FND A;  3GF7 A;  5JBW A;  4KNP A;  2ZQQ A;  4U0G A; 
#chains in the Genus database with same CATH homology
 1EY3 A;  3V5I A;  4EMP A;  5KJP A;  3T3W A;  3IB9 A;  4QIJ A;  3KTH A;  1EF9 A;  3R0O A;  3OC7 A;  4HC8 A;  3Q0J A;  4NNQ A;  4U18 A;  3TVW A;  1PIX A;  1O8U A;  2J5G A;  4Z0M A;  3TZ3 A;  5FUS A;  4ZU2 A;  3OT6 A;  2J5I I;  2PPY A;  5DZK H;  5DTP A;  5C9G A;  2J5I A;  3M6N A;  1RJN A;  1XO6 A;  1WDL A;  3MOY A;  1N6D A;  1RJM A;  2A7K A;  5G1S A;  1XNV A;  2Q35 A;  1MJ3 A;  4ASI A;  2W3P A;  3SWX A;  2VSS A;  1ON9 A;  3P5M A;  3T8A A;  5KDR B;  1FC6 A;  4ZDE A;  2ZL0 A;  4U19 A;  1EF8 A;  5DL1 A;  3I47 A;  5E0S H;  5FIF A;  3H0U A;  3ZWA A;  2HW5 A;  1OD4 A;  3QKA A;  2QQ3 A;  1UIY A;  2A7S A;  5DU6 A;  4K2N A;  2ZQR A;  4KPK A;  4QFE A;  3HP0 A;  3R6H A;  3U9R B;  3T89 A;  3BPP A;  3ZWB A;  3Q0G A;  4U0G H;  3QK8 A;  1N6F A;  3HLN 1;  4LK5 A;  1XNW A;  2EJ5 A;  3RRV A;  1HNU A;  4WCZ A;  3ISA A;  2ZL3 A;  1FC7 A;  3IAV A;  1Q51 A;  4L6W A;  2J5S A;  3OME A;  4B3H A;  4WYO B;  2VSS F;  3TT7 A;  2VSU C;  3TRR A;  2F9I A;  3BEZ A;  4FZW C;  3QWD A;  4HDT A;  4U0H A;  3LAO A;  3DOR A;  3P2L A;  1X0U A;  4RCN A;  3R9Q A;  2VRE A;  4JFC A;  5DU8 A;  3RST A;  2WTB A;  5DU4 A;  5INI A;  3H0S A;  2VSS E;  4I4Z A;  1UYS A;  5DZK A;  5E0N X;  3ZWC A;  3VIV A;  3TT6 A;  5HUQ A;  3K50 A;  1HZD A;  4JCQ A;  4NEK A;  4MOU A;  3T88 A;  4G2R A;  3KQF A;  4NAR A;  4EML A;  4F47 A;  4K29 A;  4DI1 A;  1W2X A;  4B3J A;  4ZDD A;  2F9Y B;  2Q34 A;  2VSU E;  3HRX A;  1ON3 A;  5G1Q A;  3ZW8 A;  4J2U A;  1TYF A;  3LKE A;  3V5E A;  5INF A;  3H81 A;  1JXZ A;  2F6I A;  3U9S B;  2X24 A;  4L8K A;  4ELW A;  2YJG A;  1J7X A;  3PEA A;  4FN7 A;  4IZC A;  1XNY A;  2X58 A;  3H02 A;  4KD6 A;  4JCR A;  1N6E A;  4ZDF A;  3HE2 A;  4OG1 A;  2VSU F;  3TDC A;  3GMA A;  4WZ8 B;  4ZDB A;  1NZY B;  4JCT A;  4QII A;  2DEO A;  3QMJ A;  3KTG A;  4ELX A;  5G1R A;  3DJA A;  2J5I B;  4JCS A;  1XX4 A;  4HNK A;  2FW2 A;  3GF3 A;  4IZD A;  4JJT A;  3NJB A;  3R9S A;  3H0J A;  2Q2X A;  2A81 A;  3TV5 A;  2D3T A;  4JWV A;  3MYB A;  4FN8 A;  2VSU A;  4I42 A;  5ING A;  3FF6 A;  2CBY A;  1YG6 A;  4I52 A;  5MGB A;  3PZK A;  5IKL B;  3IBB A;  2DUB A;  3KTK A;  4IZB A;  4FB8 A;  3Q1T A;  1FC9 A;  4JYL A;  3H0Q A;  1FCF A;  3MT6 A;  4OLQ A;  1K32 A;  4B3I A;  1UYR A;  3M6M A;  4EMM A;  3KTI A;  3G64 A;  3MFM A;  3L3S A;  3Q7H A;  4RYF H;  2IEX A;  1UYT A;  2PG8 A;  3JU1 A;  2GTR A;  4U1A A;  3PGQ A;  3TVU A;  5DKP A;  5C90 A;  3T8B A;  1Y7O A;  3ST9 A;  1SG4 A;  4JYJ A;  1VRG A;  5E0S A;  2F9Y A;  4JVT A;  4GM2 A;  4MXI A;  4MI2 A;  3FDU A;  1TG6 A;  4ZDC A;  1WDM A;  3QYR A;  3U9T B;  4JOT A;  3SLL A;  1UYV A;  5CTC A;  3GLM A;  5DTW A;  1NZY A;  5JBX A;  4GHN A;  3ZW9 A;  3TLF A;  1WDK A;  2J5G D;  3PE8 A;  5KDR A;  1Q52 A;  2C8T A;  3NJD A;  3N6R B;  4FNB A;  1SZO A;  4K3W A;  2ZL4 A;  1DUB A;  1YG8 A;  2ZL2 A;  3GKB A;  1OD2 A;  3STA A;  4FJW D;  3BF0 A;  4OMR A;  3RSI A;  2PBP A;  4JSB A;  2UZF A;  2FZS A;  1HNO A;  3KTJ A;  3QXI A;  4Q1I A;  2F9I B;  2BZR A;  4KWB A;  5DUF A;  4Q0G A;  4FZW A;  2NP9 A;  2CE3 A;  3R9T A;  2F6Q A;  4YLH A;  3K8X A;  1PJH A;  1WZ8 A;  5DUC A;  1K39 A;  4RYF A;  2FBM A;  3QRE A;  3BPT A;  3HIN A;  3WG5 A;  4ELS A;  3P85 A;  5CTB A;  2VX2 A;  1DCI A;  3QXZ A;  4FND A;  3GF7 A;  5JBW A;  4KNP A;  2ZQQ A;  4U0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...