4JCQA

Clpp1 from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
170
Chain Sequence
ILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structural and functional insights into caseinolytic proteases reveal an unprecedented regulation principle of their catalytic triad.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4jcqA00
1FC7A 3GKBA 1NZYA 3NJBA 1N6FA 2F6IA 2ZL2A 4KD6A 1XNWA 4FB8A 4I52A 2ZQRA 3KQFA 4F47A 3R9TA 2J5II 3G64A 3FDUA 4L8KA 5C9GA 4GHNA 1N6EA 4FZWC 3K50A 4FNBA 3Q0JA 3OC7A 4HNKA 1RJNA 3H0QA 4QFEA 3L3SA 3LAOA 4B3IA 2FW2A 1Q52A 3N6RB 3QYRA 2VREA 3LKEA 1WZ8A 2A7KA 3GF3A 1Q51A 3BEZA 3TDCA 4JCSA 2CBYA 3T3WA 2DEOA 5INGA 4U19A 3FF6A 4JCRA 4QIIA 3ZWAA 3KTKA 4YLHA 3R0OA 4IZDA 3P2LA 3PEAA 2VSUA 3KTIA 3H0JA 3I47A 3STAA 3V5IA 5DZKH 2F9YB 3BPPA 4U0GA 2IEXA 4GM2A 4JSBA 3U9SB 3RRVA 5DU8A 2J5IB 2ZQQA 3QXIA 3HE2A 3T8AA 3ZW9A 1WDKA 4U18A 2GTRA 2J5GA 3MT6A 2ZL4A 2EJ5A 1K39A 2VSSE 3KTGA 1TYFA 4FNDA 2VSSF 4ZDEA 5MGBA 3HRXA 4JCTA 4ELSA 1FC6A 5FIFA 3WG5A 4MOUA 4U0GH 4NEKA 2F9IA 3M6NA 3ST9A 4OG1A 2PBPA 3KTJA 1HZDA 2BZRA 2WTBA 5INIA 1MJ3A 4ASIA 3TRRA 4U0HA 4I4ZA 3H0SA 3RSIA 4JFCA 3SLLA 2Q34A 1WDMA 3DORA 1K32A 4KWBA 2F9YA 1YG6A 5G1QA 4MXIA 4ELWA 4WCZA 2J5IA 1DUBA 3OT6A 5DZKA 3K8XA 3PZKA 1YG8A 4WZ8B 1FC9A 3BF0A 1O8UA 1FCFA 2UZFA 2F9IB 4ZU2A 3H02A 3ZW8A 3Q0GA 4FZWA 4RYFH 1JXZA 3T89A 3KTHA 1PJHA 1EY3A 2NP9A 3DJAA 1HNOA 2VSUE 2A81A 2VX2A 5C90A 3P85A 5CTCA 1UYSA 5DTWA 2FBMA 2A7SA 2ZL0A 2VSUF 1XNYA 5DUFA 5JBWA 4ZDDA 4DI1A 1UYTA 4KPKA 4EMLA 5JBXA 3MYBA 5DU4A 2X58A 2W3PA 4ZDCA 3HP0A 3U9RB 3IBBA 5E0NX 5DU6A 4Z0MA 3VIVA 4OLQA 4Q0GA 4LK5A 3GF7A 3QK8A 3PGQA 5KDRA 4G2RA 1N6DA 1TG6A 4U1AA 1ON3A 4FN8A 3NJDA 4FN7A 3V5EA 3MFMA 1OD2A 1J7XA 3R9SA 5CTBA 3R9QA 4ZDBA 4IZCA 3MOYA 2Q2XA 4B3HA 4K3WA 3QKAA 4RCNA 3TLFA 1UYRA 3TV5A 2QQ3A 1DCIA 4JWVA 4MI2A 4JCQA 5DUCA 4RYFA 4EMMA 4JYLA 3M6MA 4WYOB 3TT7A 4IZBA 4OMRA 1OD4A 2CE3A 4EMPA 2DUBA 2PPYA 5KDRB 3GMAA 3OMEA 4FJWD 1VRGA 1PIXA 3IB9A 3TVWA 1XNVA 3IAVA 5IKLB 2ZL3A 5FUSA 1RJMA 5KJPA 4B3JA 2FZSA 5G1SA 3JU1A 3GLMA 5DTPA 3ZWCA 4HC8A 3ZWBA 5G1RA 2VSUC 1WDLA 4ELXA 3QREA 3Q7HA 4JOTA 3H81A 3TT6A 4Q1IA 3QMJA 1EF9A 5DKPA 1XX4A 1W2XA 2F6QA 3RSTA 3TVUA 1NZYB 2PG8A 3PE8A 4ZDFA 4QIJA 5DL1A 3QXZA 4KNPA 2J5SA 3H0UA 2X24A 1UYVA 3T88A 5INFA 4K2NA 1XO6A 5E0SA 4L6WA 3U9TB 1Y7OA 4NNQA 1HNUA 4JVTA 3ISAA 3TZ3A 2VSSA 3HINA 4JJTA 4K29A 4I42A 2J5GD 1EF8A 3HLN1 3Q1TA 1SG4A 3T8BA 2D3TA 1X0UA 4JYJA 3P5MA 3R6HA 1SZOA 2Q35A 3SWXA 2C8TA 5E0SH 2HW5A 1ON9A 3QWDA 1UIYA
chains in the Genus database with same CATH superfamily
1FC7A 3GKBA 1NZYA 3NJBA 1N6FA 2F6IA 2ZL2A 4KD6A 1XNWA 4FB8A 4I52A 2ZQRA 3KQFA 4F47A 3R9TA 2J5II 3G64A 3FDUA 4L8KA 5C9GA 4GHNA 1N6EA 4FZWC 3K50A 4FNBA 3Q0JA 3OC7A 4HNKA 1RJNA 3H0QA 4QFEA 3L3SA 3LAOA 4B3IA 2FW2A 1Q52A 3N6RB 3QYRA 2VREA 3LKEA 1WZ8A 2A7KA 3GF3A 1Q51A 3BEZA 3TDCA 4JCSA 2CBYA 3T3WA 2DEOA 5INGA 4U19A 3FF6A 4JCRA 4QIIA 3ZWAA 3KTKA 4YLHA 3R0OA 4IZDA 3P2LA 3PEAA 2VSUA 3KTIA 3H0JA 3I47A 3STAA 3V5IA 5DZKH 2F9YB 3BPPA 4U0GA 2IEXA 4GM2A 4JSBA 3U9SB 3RRVA 5DU8A 2J5IB 2ZQQA 3QXIA 3HE2A 3T8AA 3ZW9A 1WDKA 4U18A 2GTRA 2J5GA 3MT6A 2ZL4A 2EJ5A 1K39A 2VSSE 3KTGA 1TYFA 4FNDA 2VSSF 4ZDEA 5MGBA 3HRXA 4JCTA 4ELSA 1FC6A 5FIFA 3WG5A 4MOUA 4U0GH 4NEKA 2F9IA 3M6NA 3ST9A 4OG1A 2PBPA 3KTJA 1HZDA 2BZRA 2WTBA 5INIA 1MJ3A 4ASIA 3TRRA 4U0HA 4I4ZA 3H0SA 3RSIA 4JFCA 3SLLA 2Q34A 1WDMA 3DORA 1K32A 4KWBA 2F9YA 1YG6A 5G1QA 4MXIA 4ELWA 4WCZA 2J5IA 1DUBA 3OT6A 5DZKA 3K8XA 3PZKA 1YG8A 4WZ8B 1FC9A 3BF0A 1O8UA 1FCFA 2UZFA 2YJGA 2F9IB 4ZU2A 3H02A 3ZW8A 3Q0GA 4FZWA 4RYFH 1JXZA 3T89A 3KTHA 1PJHA 1EY3A 2NP9A 3DJAA 1HNOA 2VSUE 2A81A 4NARA 2VX2A 5C90A 3P85A 5CTCA 1UYSA 5DTWA 2FBMA 2A7SA 2ZL0A 2VSUF 1XNYA 5DUFA 5JBWA 4ZDDA 4DI1A 1UYTA 4KPKA 4EMLA 5JBXA 3MYBA 5DU4A 2X58A 2W3PA 4ZDCA 3HP0A 3U9RB 3IBBA 5E0NX 5DU6A 4Z0MA 3VIVA 4OLQA 4Q0GA 4LK5A 3GF7A 5HUQA 3QK8A 3PGQA 5KDRA 4G2RA 1N6DA 1TG6A 4U1AA 1ON3A 4FN8A 3NJDA 4FN7A 3V5EA 3MFMA 1OD2A 1J7XA 3R9SA 5CTBA 3R9QA 4ZDBA 4IZCA 3MOYA 2Q2XA 4B3HA 4K3WA 3QKAA 4RCNA 3TLFA 1UYRA 3TV5A 2QQ3A 1DCIA 4JWVA 4MI2A 4JCQA 5DUCA 4RYFA 4EMMA 4JYLA 3M6MA 4WYOB 3TT7A 4IZBA 4OMRA 1OD4A 2CE3A 4EMPA 2DUBA 2PPYA 5KDRB 3GMAA 3OMEA 3BPTA 4FJWD 1VRGA 1PIXA 3IB9A 3TVWA 1XNVA 3IAVA 5IKLB 2ZL3A 5FUSA 1RJMA 5KJPA 4B3JA 2FZSA 4J2UA 5G1SA 3JU1A 3GLMA 5DTPA 3ZWCA 4HC8A 3ZWBA 5G1RA 2VSUC 1WDLA 4ELXA 3QREA 3Q7HA 4HDTA 4JOTA 3H81A 3TT6A 4Q1IA 3QMJA 1EF9A 5DKPA 1XX4A 1W2XA 2F6QA 3RSTA 3TVUA 1NZYB 2PG8A 3PE8A 4ZDFA 4QIJA 5DL1A 3QXZA 4KNPA 2J5SA 3H0UA 2X24A 1UYVA 3T88A 5INFA 4K2NA 1XO6A 5E0SA 4L6WA 3U9TB 1Y7OA 4NNQA 1HNUA 4JVTA 3ISAA 3TZ3A 2VSSA 3HINA 4JJTA 4K29A 4I42A 2J5GD 1EF8A 3HLN1 3Q1TA 1SG4A 3T8BA 2D3TA 1X0UA 4JYJA 3P5MA 3R6HA 1SZOA 2Q35A 3SWXA 2C8TA 5E0SH 2HW5A 1ON9A 3QWDA 1UIYA
chains in the Genus database with same CATH topology
1FC7A 3GKBA 1NZYA 3NJBA 1N6FA 2F6IA 2ZL2A 4KD6A 1XNWA 4FB8A 4I52A 2ZQRA 3KQFA 4F47A 3R9TA 2J5II 3G64A 3FDUA 4L8KA 5C9GA 4GHNA 1N6EA 4FZWC 3K50A 4FNBA 3Q0JA 3OC7A 4HNKA 1RJNA 3H0QA 4QFEA 3L3SA 3LAOA 4B3IA 2FW2A 1Q52A 3N6RB 3QYRA 2VREA 3LKEA 1WZ8A 2A7KA 3GF3A 1Q51A 3BEZA 3TDCA 4JCSA 2CBYA 3T3WA 2DEOA 5INGA 4U19A 3FF6A 4JCRA 4QIIA 3ZWAA 3KTKA 4YLHA 3R0OA 4IZDA 3P2LA 3PEAA 2VSUA 3KTIA 3H0JA 3I47A 3STAA 3V5IA 5DZKH 2F9YB 3BPPA 4U0GA 2IEXA 4GM2A 4JSBA 3U9SB 3RRVA 5DU8A 2J5IB 2ZQQA 3QXIA 3HE2A 3T8AA 3ZW9A 1WDKA 4U18A 2GTRA 2J5GA 3MT6A 2ZL4A 2EJ5A 1K39A 2VSSE 3KTGA 1TYFA 4FNDA 2VSSF 4ZDEA 5MGBA 3HRXA 4JCTA 4ELSA 1FC6A 5FIFA 3WG5A 4MOUA 4U0GH 4NEKA 2F9IA 3M6NA 3ST9A 4OG1A 2PBPA 3KTJA 1HZDA 2BZRA 2WTBA 5INIA 1MJ3A 4ASIA 3TRRA 4U0HA 4I4ZA 3H0SA 3RSIA 4JFCA 3SLLA 2Q34A 1WDMA 3DORA 1K32A 4KWBA 2F9YA 1YG6A 5G1QA 4MXIA 4ELWA 4WCZA 2J5IA 1DUBA 3OT6A 5DZKA 3K8XA 3PZKA 1YG8A 4WZ8B 1FC9A 3BF0A 1O8UA 1FCFA 2UZFA 2YJGA 2F9IB 4ZU2A 3H02A 3ZW8A 3Q0GA 4FZWA 4RYFH 1JXZA 3T89A 3KTHA 1PJHA 1EY3A 2NP9A 3DJAA 1HNOA 2VSUE 2A81A 4NARA 2VX2A 5C90A 3P85A 5CTCA 1UYSA 5DTWA 2FBMA 2A7SA 2ZL0A 2VSUF 1XNYA 5DUFA 5JBWA 4ZDDA 4DI1A 1UYTA 4KPKA 4EMLA 5JBXA 3MYBA 5DU4A 2X58A 2W3PA 4ZDCA 3HP0A 3U9RB 3IBBA 5E0NX 5DU6A 4Z0MA 3VIVA 4OLQA 4Q0GA 4LK5A 3GF7A 5HUQA 3QK8A 3PGQA 5KDRA 4G2RA 1N6DA 1TG6A 4U1AA 1ON3A 4FN8A 3NJDA 4FN7A 3V5EA 3MFMA 1OD2A 1J7XA 3R9SA 5CTBA 3R9QA 4ZDBA 4IZCA 3MOYA 2Q2XA 4B3HA 4K3WA 3QKAA 4RCNA 3TLFA 1UYRA 3TV5A 2QQ3A 1DCIA 4JWVA 4MI2A 4JCQA 5DUCA 4RYFA 4EMMA 4JYLA 3M6MA 4WYOB 3TT7A 4IZBA 4OMRA 1OD4A 2CE3A 4EMPA 2DUBA 2PPYA 5KDRB 3GMAA 3OMEA 3BPTA 4FJWD 1VRGA 1PIXA 3IB9A 3TVWA 1XNVA 3IAVA 5IKLB 2ZL3A 5FUSA 1RJMA 5KJPA 4B3JA 2FZSA 4J2UA 5G1SA 3JU1A 3GLMA 5DTPA 3ZWCA 4HC8A 3ZWBA 5G1RA 2VSUC 1WDLA 4ELXA 3QREA 3Q7HA 4HDTA 4JOTA 3H81A 3TT6A 4Q1IA 3QMJA 1EF9A 5DKPA 1XX4A 1W2XA 2F6QA 3RSTA 3TVUA 1NZYB 2PG8A 3PE8A 4ZDFA 4QIJA 5DL1A 3QXZA 4KNPA 2J5SA 3H0UA 2X24A 1UYVA 3T88A 5INFA 4K2NA 1XO6A 5E0SA 4L6WA 3U9TB 1Y7OA 4NNQA 1HNUA 4JVTA 3ISAA 3TZ3A 2VSSA 3HINA 4JJTA 4K29A 4I42A 2J5GD 1EF8A 3HLN1 3Q1TA 1SG4A 3T8BA 2D3TA 1X0UA 4JYJA 3P5MA 3R6HA 1SZOA 2Q35A 3SWXA 2C8TA 5E0SH 2HW5A 1ON9A 3QWDA 1UIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FC7 A;  3GKB A;  1NZY A;  3NJB A;  1N6F A;  2F6I A;  2ZL2 A;  4KD6 A;  1XNW A;  4FB8 A;  4I52 A;  2ZQR A;  3KQF A;  4F47 A;  3R9T A;  2J5I I;  3G64 A;  3FDU A;  4L8K A;  5C9G A;  4GHN A;  1N6E A;  4FZW C;  3K50 A;  4FNB A;  3Q0J A;  3OC7 A;  4HNK A;  1RJN A;  3H0Q A;  4QFE A;  3L3S A;  3LAO A;  4B3I A;  2FW2 A;  1Q52 A;  3N6R B;  3QYR A;  2VRE A;  3LKE A;  1WZ8 A;  2A7K A;  3GF3 A;  1Q51 A;  3BEZ A;  3TDC A;  4JCS A;  2CBY A;  3T3W A;  2DEO A;  5ING A;  4U19 A;  3FF6 A;  4JCR A;  4QII A;  3ZWA A;  3KTK A;  4YLH A;  3R0O A;  4IZD A;  3P2L A;  3PEA A;  2VSU A;  3KTI A;  3H0J A;  3I47 A;  3STA A;  3V5I A;  5DZK H;  2F9Y B;  3BPP A;  4U0G A;  2IEX A;  4GM2 A;  4JSB A;  3U9S B;  3RRV A;  5DU8 A;  2J5I B;  2ZQQ A;  3QXI A;  3HE2 A;  3T8A A;  3ZW9 A;  1WDK A;  4U18 A;  2GTR A;  2J5G A;  3MT6 A;  2ZL4 A;  2EJ5 A;  1K39 A;  2VSS E;  3KTG A;  1TYF A;  4FND A;  2VSS F;  4ZDE A;  5MGB A;  3HRX A;  4JCT A;  4ELS A;  1FC6 A;  5FIF A;  3WG5 A;  4MOU A;  4U0G H;  4NEK A;  2F9I A;  3M6N A;  3ST9 A;  4OG1 A;  2PBP A;  3KTJ A;  1HZD A;  2BZR A;  2WTB A;  5INI A;  1MJ3 A;  4ASI A;  3TRR A;  4U0H A;  4I4Z A;  3H0S A;  3RSI A;  4JFC A;  3SLL A;  2Q34 A;  1WDM A;  3DOR A;  1K32 A;  4KWB A;  2F9Y A;  1YG6 A;  5G1Q A;  4MXI A;  4ELW A;  4WCZ A;  2J5I A;  1DUB A;  3OT6 A;  5DZK A;  3K8X A;  3PZK A;  1YG8 A;  4WZ8 B;  1FC9 A;  3BF0 A;  1O8U A;  1FCF A;  2UZF A;  2F9I B;  4ZU2 A;  3H02 A;  3ZW8 A;  3Q0G A;  4FZW A;  4RYF H;  1JXZ A;  3T89 A;  3KTH A;  1PJH A;  1EY3 A;  2NP9 A;  3DJA A;  1HNO A;  2VSU E;  2A81 A;  2VX2 A;  5C90 A;  3P85 A;  5CTC A;  1UYS A;  5DTW A;  2FBM A;  2A7S A;  2ZL0 A;  2VSU F;  1XNY A;  5DUF A;  5JBW A;  4ZDD A;  4DI1 A;  1UYT A;  4KPK A;  4EML A;  5JBX A;  3MYB A;  5DU4 A;  2X58 A;  2W3P A;  4ZDC A;  3HP0 A;  3U9R B;  3IBB A;  5E0N X;  5DU6 A;  4Z0M A;  3VIV A;  4OLQ A;  4Q0G A;  4LK5 A;  3GF7 A;  3QK8 A;  3PGQ A;  5KDR A;  4G2R A;  1N6D A;  1TG6 A;  4U1A A;  1ON3 A;  4FN8 A;  3NJD A;  4FN7 A;  3V5E A;  3MFM A;  1OD2 A;  1J7X A;  3R9S A;  5CTB A;  3R9Q A;  4ZDB A;  4IZC A;  3MOY A;  2Q2X A;  4B3H A;  4K3W A;  3QKA A;  4RCN A;  3TLF A;  1UYR A;  3TV5 A;  2QQ3 A;  1DCI A;  4JWV A;  4MI2 A;  4JCQ A;  5DUC A;  4RYF A;  4EMM A;  4JYL A;  3M6M A;  4WYO B;  3TT7 A;  4IZB A;  4OMR A;  1OD4 A;  2CE3 A;  4EMP A;  2DUB A;  2PPY A;  5KDR B;  3GMA A;  3OME A;  4FJW D;  1VRG A;  1PIX A;  3IB9 A;  3TVW A;  1XNV A;  3IAV A;  5IKL B;  2ZL3 A;  5FUS A;  1RJM A;  5KJP A;  4B3J A;  2FZS A;  5G1S A;  3JU1 A;  3GLM A;  5DTP A;  3ZWC A;  4HC8 A;  3ZWB A;  5G1R A;  2VSU C;  1WDL A;  4ELX A;  3QRE A;  3Q7H A;  4JOT A;  3H81 A;  3TT6 A;  4Q1I A;  3QMJ A;  1EF9 A;  5DKP A;  1XX4 A;  1W2X A;  2F6Q A;  3RST A;  3TVU A;  1NZY B;  2PG8 A;  3PE8 A;  4ZDF A;  4QIJ A;  5DL1 A;  3QXZ A;  4KNP A;  2J5S A;  3H0U A;  2X24 A;  1UYV A;  3T88 A;  5INF A;  4K2N A;  1XO6 A;  5E0S A;  4L6W A;  3U9T B;  1Y7O A;  4NNQ A;  1HNU A;  4JVT A;  3ISA A;  3TZ3 A;  2VSS A;  3HIN A;  4JJT A;  4K29 A;  4I42 A;  2J5G D;  1EF8 A;  3HLN 1;  3Q1T A;  1SG4 A;  3T8B A;  2D3T A;  1X0U A;  4JYJ A;  3P5M A;  3R6H A;  1SZO A;  2Q35 A;  3SWX A;  2C8T A;  5E0S H;  2HW5 A;  1ON9 A;  3QWD A;  1UIY A; 
#chains in the Genus database with same CATH topology
 1FC7 A;  3GKB A;  1NZY A;  3NJB A;  1N6F A;  2F6I A;  2ZL2 A;  4KD6 A;  1XNW A;  4FB8 A;  4I52 A;  2ZQR A;  3KQF A;  4F47 A;  3R9T A;  2J5I I;  3G64 A;  3FDU A;  4L8K A;  5C9G A;  4GHN A;  1N6E A;  4FZW C;  3K50 A;  4FNB A;  3Q0J A;  3OC7 A;  4HNK A;  1RJN A;  3H0Q A;  4QFE A;  3L3S A;  3LAO A;  4B3I A;  2FW2 A;  1Q52 A;  3N6R B;  3QYR A;  2VRE A;  3LKE A;  1WZ8 A;  2A7K A;  3GF3 A;  1Q51 A;  3BEZ A;  3TDC A;  4JCS A;  2CBY A;  3T3W A;  2DEO A;  5ING A;  4U19 A;  3FF6 A;  4JCR A;  4QII A;  3ZWA A;  3KTK A;  4YLH A;  3R0O A;  4IZD A;  3P2L A;  3PEA A;  2VSU A;  3KTI A;  3H0J A;  3I47 A;  3STA A;  3V5I A;  5DZK H;  2F9Y B;  3BPP A;  4U0G A;  2IEX A;  4GM2 A;  4JSB A;  3U9S B;  3RRV A;  5DU8 A;  2J5I B;  2ZQQ A;  3QXI A;  3HE2 A;  3T8A A;  3ZW9 A;  1WDK A;  4U18 A;  2GTR A;  2J5G A;  3MT6 A;  2ZL4 A;  2EJ5 A;  1K39 A;  2VSS E;  3KTG A;  1TYF A;  4FND A;  2VSS F;  4ZDE A;  5MGB A;  3HRX A;  4JCT A;  4ELS A;  1FC6 A;  5FIF A;  3WG5 A;  4MOU A;  4U0G H;  4NEK A;  2F9I A;  3M6N A;  3ST9 A;  4OG1 A;  2PBP A;  3KTJ A;  1HZD A;  2BZR A;  2WTB A;  5INI A;  1MJ3 A;  4ASI A;  3TRR A;  4U0H A;  4I4Z A;  3H0S A;  3RSI A;  4JFC A;  3SLL A;  2Q34 A;  1WDM A;  3DOR A;  1K32 A;  4KWB A;  2F9Y A;  1YG6 A;  5G1Q A;  4MXI A;  4ELW A;  4WCZ A;  2J5I A;  1DUB A;  3OT6 A;  5DZK A;  3K8X A;  3PZK A;  1YG8 A;  4WZ8 B;  1FC9 A;  3BF0 A;  1O8U A;  1FCF A;  2UZF A;  2YJG A;  2F9I B;  4ZU2 A;  3H02 A;  3ZW8 A;  3Q0G A;  4FZW A;  4RYF H;  1JXZ A;  3T89 A;  3KTH A;  1PJH A;  1EY3 A;  2NP9 A;  3DJA A;  1HNO A;  2VSU E;  2A81 A;  4NAR A;  2VX2 A;  5C90 A;  3P85 A;  5CTC A;  1UYS A;  5DTW A;  2FBM A;  2A7S A;  2ZL0 A;  2VSU F;  1XNY A;  5DUF A;  5JBW A;  4ZDD A;  4DI1 A;  1UYT A;  4KPK A;  4EML A;  5JBX A;  3MYB A;  5DU4 A;  2X58 A;  2W3P A;  4ZDC A;  3HP0 A;  3U9R B;  3IBB A;  5E0N X;  5DU6 A;  4Z0M A;  3VIV A;  4OLQ A;  4Q0G A;  4LK5 A;  3GF7 A;  5HUQ A;  3QK8 A;  3PGQ A;  5KDR A;  4G2R A;  1N6D A;  1TG6 A;  4U1A A;  1ON3 A;  4FN8 A;  3NJD A;  4FN7 A;  3V5E A;  3MFM A;  1OD2 A;  1J7X A;  3R9S A;  5CTB A;  3R9Q A;  4ZDB A;  4IZC A;  3MOY A;  2Q2X A;  4B3H A;  4K3W A;  3QKA A;  4RCN A;  3TLF A;  1UYR A;  3TV5 A;  2QQ3 A;  1DCI A;  4JWV A;  4MI2 A;  4JCQ A;  5DUC A;  4RYF A;  4EMM A;  4JYL A;  3M6M A;  4WYO B;  3TT7 A;  4IZB A;  4OMR A;  1OD4 A;  2CE3 A;  4EMP A;  2DUB A;  2PPY A;  5KDR B;  3GMA A;  3OME A;  3BPT A;  4FJW D;  1VRG A;  1PIX A;  3IB9 A;  3TVW A;  1XNV A;  3IAV A;  5IKL B;  2ZL3 A;  5FUS A;  1RJM A;  5KJP A;  4B3J A;  2FZS A;  4J2U A;  5G1S A;  3JU1 A;  3GLM A;  5DTP A;  3ZWC A;  4HC8 A;  3ZWB A;  5G1R A;  2VSU C;  1WDL A;  4ELX A;  3QRE A;  3Q7H A;  4HDT A;  4JOT A;  3H81 A;  3TT6 A;  4Q1I A;  3QMJ A;  1EF9 A;  5DKP A;  1XX4 A;  1W2X A;  2F6Q A;  3RST A;  3TVU A;  1NZY B;  2PG8 A;  3PE8 A;  4ZDF A;  4QIJ A;  5DL1 A;  3QXZ A;  4KNP A;  2J5S A;  3H0U A;  2X24 A;  1UYV A;  3T88 A;  5INF A;  4K2N A;  1XO6 A;  5E0S A;  4L6W A;  3U9T B;  1Y7O A;  4NNQ A;  1HNU A;  4JVT A;  3ISA A;  3TZ3 A;  2VSS A;  3HIN A;  4JJT A;  4K29 A;  4I42 A;  2J5G D;  1EF8 A;  3HLN 1;  3Q1T A;  1SG4 A;  3T8B A;  2D3T A;  1X0U A;  4JYJ A;  3P5M A;  3R6H A;  1SZO A;  2Q35 A;  3SWX A;  2C8T A;  5E0S H;  2HW5 A;  1ON9 A;  3QWD A;  1UIY A; 
#chains in the Genus database with same CATH homology
 1FC7 A;  3GKB A;  1NZY A;  3NJB A;  1N6F A;  2F6I A;  2ZL2 A;  4KD6 A;  1XNW A;  4FB8 A;  4I52 A;  2ZQR A;  3KQF A;  4F47 A;  3R9T A;  2J5I I;  3G64 A;  3FDU A;  4L8K A;  5C9G A;  4GHN A;  1N6E A;  4FZW C;  3K50 A;  4FNB A;  3Q0J A;  3OC7 A;  4HNK A;  1RJN A;  3H0Q A;  4QFE A;  3L3S A;  3LAO A;  4B3I A;  2FW2 A;  1Q52 A;  3N6R B;  3QYR A;  2VRE A;  3LKE A;  1WZ8 A;  2A7K A;  3GF3 A;  1Q51 A;  3BEZ A;  3TDC A;  4JCS A;  2CBY A;  3T3W A;  2DEO A;  5ING A;  4U19 A;  3FF6 A;  4JCR A;  4QII A;  3ZWA A;  3KTK A;  4YLH A;  3R0O A;  4IZD A;  3P2L A;  3PEA A;  2VSU A;  3KTI A;  3H0J A;  3I47 A;  3STA A;  3V5I A;  5DZK H;  2F9Y B;  3BPP A;  4U0G A;  2IEX A;  4GM2 A;  4JSB A;  3U9S B;  3RRV A;  5DU8 A;  2J5I B;  2ZQQ A;  3QXI A;  3HE2 A;  3T8A A;  3ZW9 A;  1WDK A;  4U18 A;  2GTR A;  2J5G A;  3MT6 A;  2ZL4 A;  2EJ5 A;  1K39 A;  2VSS E;  3KTG A;  1TYF A;  4FND A;  2VSS F;  4ZDE A;  5MGB A;  3HRX A;  4JCT A;  4ELS A;  1FC6 A;  5FIF A;  3WG5 A;  4MOU A;  4U0G H;  4NEK A;  2F9I A;  3M6N A;  3ST9 A;  4OG1 A;  2PBP A;  3KTJ A;  1HZD A;  2BZR A;  2WTB A;  5INI A;  1MJ3 A;  4ASI A;  3TRR A;  4U0H A;  4I4Z A;  3H0S A;  3RSI A;  4JFC A;  3SLL A;  2Q34 A;  1WDM A;  3DOR A;  1K32 A;  4KWB A;  2F9Y A;  1YG6 A;  5G1Q A;  4MXI A;  4ELW A;  4WCZ A;  2J5I A;  1DUB A;  3OT6 A;  5DZK A;  3K8X A;  3PZK A;  1YG8 A;  4WZ8 B;  1FC9 A;  3BF0 A;  1O8U A;  1FCF A;  2UZF A;  2YJG A;  2F9I B;  4ZU2 A;  3H02 A;  3ZW8 A;  3Q0G A;  4FZW A;  4RYF H;  1JXZ A;  3T89 A;  3KTH A;  1PJH A;  1EY3 A;  2NP9 A;  3DJA A;  1HNO A;  2VSU E;  2A81 A;  4NAR A;  2VX2 A;  5C90 A;  3P85 A;  5CTC A;  1UYS A;  5DTW A;  2FBM A;  2A7S A;  2ZL0 A;  2VSU F;  1XNY A;  5DUF A;  5JBW A;  4ZDD A;  4DI1 A;  1UYT A;  4KPK A;  4EML A;  5JBX A;  3MYB A;  5DU4 A;  2X58 A;  2W3P A;  4ZDC A;  3HP0 A;  3U9R B;  3IBB A;  5E0N X;  5DU6 A;  4Z0M A;  3VIV A;  4OLQ A;  4Q0G A;  4LK5 A;  3GF7 A;  5HUQ A;  3QK8 A;  3PGQ A;  5KDR A;  4G2R A;  1N6D A;  1TG6 A;  4U1A A;  1ON3 A;  4FN8 A;  3NJD A;  4FN7 A;  3V5E A;  3MFM A;  1OD2 A;  1J7X A;  3R9S A;  5CTB A;  3R9Q A;  4ZDB A;  4IZC A;  3MOY A;  2Q2X A;  4B3H A;  4K3W A;  3QKA A;  4RCN A;  3TLF A;  1UYR A;  3TV5 A;  2QQ3 A;  1DCI A;  4JWV A;  4MI2 A;  4JCQ A;  5DUC A;  4RYF A;  4EMM A;  4JYL A;  3M6M A;  4WYO B;  3TT7 A;  4IZB A;  4OMR A;  1OD4 A;  2CE3 A;  4EMP A;  2DUB A;  2PPY A;  5KDR B;  3GMA A;  3OME A;  3BPT A;  4FJW D;  1VRG A;  1PIX A;  3IB9 A;  3TVW A;  1XNV A;  3IAV A;  5IKL B;  2ZL3 A;  5FUS A;  1RJM A;  5KJP A;  4B3J A;  2FZS A;  4J2U A;  5G1S A;  3JU1 A;  3GLM A;  5DTP A;  3ZWC A;  4HC8 A;  3ZWB A;  5G1R A;  2VSU C;  1WDL A;  4ELX A;  3QRE A;  3Q7H A;  4HDT A;  4JOT A;  3H81 A;  3TT6 A;  4Q1I A;  3QMJ A;  1EF9 A;  5DKP A;  1XX4 A;  1W2X A;  2F6Q A;  3RST A;  3TVU A;  1NZY B;  2PG8 A;  3PE8 A;  4ZDF A;  4QIJ A;  5DL1 A;  3QXZ A;  4KNP A;  2J5S A;  3H0U A;  2X24 A;  1UYV A;  3T88 A;  5INF A;  4K2N A;  1XO6 A;  5E0S A;  4L6W A;  3U9T B;  1Y7O A;  4NNQ A;  1HNU A;  4JVT A;  3ISA A;  3TZ3 A;  2VSS A;  3HIN A;  4JJT A;  4K29 A;  4I42 A;  2J5G D;  1EF8 A;  3HLN 1;  3Q1T A;  1SG4 A;  3T8B A;  2D3T A;  1X0U A;  4JYJ A;  3P5M A;  3R6H A;  1SZO A;  2Q35 A;  3SWX A;  2C8T A;  5E0S H;  2HW5 A;  1ON9 A;  3QWD A;  1UIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...