4JCQA

Clpp1 from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
170
Chain Sequence
b'ILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDGLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structural and functional insights into caseinolytic proteases reveal an unprecedented regulation principle of their catalytic triad.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4jcqA00
3GMAA 3BF0A 1DUBA 1FC7A 2Q35A 3P85A 3KTHA 1EF9A 5IKLB 4B3HA 4FNBA 4ELXA 3T8BA 1K32A 4K29A 3I47A 4FB8A 3IB9A 4MOUA 3ST9A 2Q34A 3IAVA 4FZWC 4QIJA 1TG6A 2F9YA 3RSTA 1NZYA 4ZDCA 4FN7A 4NEKA 3GLMA 3TDCA 4Q1IA 3T89A 1RJNA 3OMEA 3M6MA 3DJAA 2A7KA 3LAOA 4L8KA 2FBMA 4Q0GA 2F9YB 1NZYB 3MYBA 3ISAA 5MGBA 2J5GA 3OT6A 1PJHA 4GM2A 2VX2A 4I4ZA 2J5SA 3NJDA 3TV5A 3TT6A 5E0SH 1ON3A 4FJWD 4JCSA 4HC8A 3KTIA 2PG8A 2VSSE 3KQFA 4Z0MA 1UIYA 3QMJA 1N6EA 1UYSA 3QREA 4FNDA 1XNYA 5FUSA 5G1QA 5CTCA 3QXIA 4ELSA 2GTRA 3R9QA 3T88A 4I52A 4OMRA 4JCRA 3JU1A 3TVUA 1UYVA 4JYJA 4B3IA 3HRXA 3QKAA 4JFCA 3R9TA 3QYRA 4L6WA 4KNPA 3L3SA 1HZDA 2UZFA 4U0GA 2J5GD 3DORA 1N6FA 3H0SA 2F6QA 4NNQA 3MOYA 3RSIA 2A81A 4K3WA 4GHNA 2VSUA 3H81A 3H0QA 4F47A 4KWBA 2FW2A 5DUCA 5INGA 1FCFA 1O8UA 3T8AA 1HNUA 3H0JA 2FZSA 3TRRA 1ON9A 2BZRA 4U19A 3TVWA 5E0NX 1YG8A 4RYFH 3H02A 1SG4A 2ZL2A 3Q1TA 4U18A 3U9RB 3V5IA 3ZW9A 4ELWA 1UYTA 1YG6A 5KDRA 1OD2A 4EMLA 3Q0JA 4I42A 1Y7OA 3GKBA 3HINA 4IZCA 2HW5A 1Q51A 2PPYA 3STAA 4B3JA 3QK8A 3ZW8A 2Q2XA 4JCTA 4U1AA 3ZWCA 2J5II 3P2LA 4KD6A 5KDRB 2J5IA 3TLFA 3HP0A 2D3TA 5INFA 1HNOA 3QXZA 4OG1A 1Q52A 3RRVA 3NJBA 3SWXA 3K8XA 5DL1A 4MI2A 1RJMA 4G2RA 1EY3A 4YLHA 2NP9A 2J5IB 3Q0GA 5C90A 1UYRA 5DTPA 3M6NA 4DI1A 3KTGA 5JBXA 3HLN1 3PGQA 5DTWA 3GF3A 3OC7A 2ZQRA 1FC6A 3ZWAA 3R6HA 1WDLA 2VSSA 4JJTA 3HE2A 3VIVA 2F9IA 1XNWA 4ZDBA 3MT6A 4JWVA 1X0UA 1FC9A 2ZQQA 2A7SA 2F6IA 3SLLA 4U0HA 2X24A 3IBBA 4LK5A 4K2NA 4KPKA 5DZKA 3PEAA 2ZL3A 4JCQA 3R9SA 1XO6A 2ZL4A 3PZKA 2F9IB 3H0UA 1PIXA 2IEXA 5DKPA 4JSBA 5DU8A 3N6RB 4OLQA 2VSUF 3U9SB 4WCZA 2PBPA 3MFMA 4EMMA 2DEOA 3KTKA 4JVTA 1DCIA 4ZDFA 5DU6A 3FDUA 5G1SA 3BPPA 1WDKA 3KTJA 3T3WA 4WYOB 5E0SA 3GF7A 3V5EA 1WDMA 2EJ5A 2QQ3A 3U9TB 5DUFA 4FZWA 4U0GH 4ZU2A 5INIA 1J7XA 3QWDA 3P5MA 1MJ3A 5DZKH 2X58A 3PE8A 1VRGA 4ZDDA 4EMPA 4ZDEA 3TZ3A 2CE3A 4IZDA 4QIIA 4QFEA 1N6DA 5CTBA 4HNKA 1XNVA 2DUBA 4ASIA 5DU4A 3Q7HA 3WG5A 2C8TA 3R0OA 4JOTA 1JXZA 2ZL0A 3G64A 5JBWA 5FIFA 1XX4A 1TYFA 3BEZA 1SZOA 2VREA 4IZBA 3ZWBA 2WTBA 3TT7A 4MXIA 1OD4A 5C9GA 3FF6A 1WZ8A 4RCNA 3K50A 5KJPA 4RYFA 1K39A 2VSSF 1EF8A 3LKEA 2W3PA 2CBYA 5G1RA 4JYLA 1W2XA 2VSUE 4WZ8B 2VSUC 4FN8A
chains in the Genus database with same CATH superfamily
3GMAA 3BF0A 1DUBA 1FC7A 2Q35A 3P85A 3KTHA 1EF9A 5IKLB 4B3HA 4FNBA 4ELXA 3T8BA 1K32A 4K29A 3I47A 4FB8A 3IB9A 4MOUA 3ST9A 2Q34A 3IAVA 4FZWC 4QIJA 1TG6A 2F9YA 3RSTA 1NZYA 4ZDCA 4FN7A 4NEKA 3GLMA 3TDCA 4Q1IA 3T89A 1RJNA 3OMEA 3M6MA 3DJAA 2A7KA 3LAOA 4L8KA 2FBMA 4Q0GA 4HDTA 2F9YB 1NZYB 3MYBA 3ISAA 5MGBA 2J5GA 3OT6A 1PJHA 4GM2A 2VX2A 4I4ZA 2J5SA 3NJDA 3TV5A 3TT6A 5E0SH 1ON3A 4FJWD 4JCSA 4HC8A 3KTIA 2PG8A 2VSSE 3KQFA 4Z0MA 1UIYA 3QMJA 1N6EA 1UYSA 3QREA 4FNDA 1XNYA 5FUSA 5G1QA 5CTCA 3QXIA 4ELSA 2GTRA 3R9QA 3T88A 4I52A 4OMRA 4JCRA 3JU1A 3TVUA 1UYVA 4JYJA 4B3IA 3HRXA 3QKAA 4JFCA 3R9TA 3QYRA 4L6WA 4KNPA 4J2UA 3L3SA 1HZDA 2UZFA 4U0GA 2J5GD 3DORA 1N6FA 3H0SA 2F6QA 4NNQA 3MOYA 3RSIA 2A81A 4K3WA 4GHNA 2VSUA 3H81A 3H0QA 4F47A 4KWBA 2FW2A 5DUCA 2YJGA 5INGA 1FCFA 1O8UA 3T8AA 5HUQA 1HNUA 3H0JA 2FZSA 3TRRA 1ON9A 2BZRA 4U19A 3TVWA 5E0NX 1YG8A 4RYFH 3H02A 1SG4A 2ZL2A 3Q1TA 4U18A 3U9RB 3V5IA 3ZW9A 4ELWA 1UYTA 1YG6A 5KDRA 1OD2A 4EMLA 3Q0JA 4I42A 1Y7OA 3GKBA 3HINA 4IZCA 2HW5A 1Q51A 2PPYA 3STAA 4B3JA 3QK8A 3ZW8A 2Q2XA 4JCTA 4U1AA 3ZWCA 2J5II 3P2LA 4KD6A 5KDRB 2J5IA 3TLFA 3HP0A 2D3TA 5INFA 1HNOA 3QXZA 4OG1A 1Q52A 3RRVA 3NJBA 3SWXA 3K8XA 5DL1A 4MI2A 1RJMA 4G2RA 1EY3A 4YLHA 2NP9A 2J5IB 3Q0GA 5C90A 1UYRA 5DTPA 3M6NA 4DI1A 3KTGA 5JBXA 3HLN1 3PGQA 5DTWA 3GF3A 3OC7A 2ZQRA 1FC6A 3ZWAA 3R6HA 1WDLA 2VSSA 4JJTA 3HE2A 3VIVA 2F9IA 4NARA 1XNWA 4ZDBA 3MT6A 4JWVA 1X0UA 1FC9A 2ZQQA 2A7SA 2F6IA 3SLLA 4U0HA 2X24A 3IBBA 4LK5A 4K2NA 4KPKA 5DZKA 3PEAA 2ZL3A 4JCQA 3R9SA 1XO6A 2ZL4A 3PZKA 2F9IB 3H0UA 1PIXA 2IEXA 5DKPA 4JSBA 5DU8A 3N6RB 4OLQA 2VSUF 3U9SB 4WCZA 2PBPA 3MFMA 4EMMA 2DEOA 3KTKA 4JVTA 1DCIA 4ZDFA 5DU6A 3FDUA 5G1SA 3BPPA 1WDKA 3KTJA 3T3WA 4WYOB 5E0SA 3GF7A 3V5EA 1WDMA 2EJ5A 2QQ3A 3U9TB 5DUFA 4FZWA 4U0GH 4ZU2A 5INIA 1J7XA 3QWDA 3P5MA 1MJ3A 5DZKH 2X58A 3PE8A 1VRGA 4ZDDA 4EMPA 4ZDEA 3TZ3A 2CE3A 4IZDA 4QIIA 4QFEA 1N6DA 5CTBA 4HNKA 1XNVA 2DUBA 4ASIA 5DU4A 3Q7HA 3WG5A 2C8TA 3BPTA 3R0OA 4JOTA 1JXZA 2ZL0A 3G64A 5JBWA 5FIFA 1XX4A 1TYFA 3BEZA 1SZOA 2VREA 4IZBA 3ZWBA 2WTBA 3TT7A 4MXIA 1OD4A 5C9GA 3FF6A 1WZ8A 4RCNA 3K50A 5KJPA 4RYFA 1K39A 2VSSF 1EF8A 3LKEA 2W3PA 2CBYA 5G1RA 4JYLA 1W2XA 2VSUE 4WZ8B 2VSUC 4FN8A
chains in the Genus database with same CATH topology
3GMAA 3BF0A 1DUBA 1FC7A 2Q35A 3P85A 3KTHA 1EF9A 5IKLB 4B3HA 4FNBA 4ELXA 3T8BA 1K32A 4K29A 3I47A 4FB8A 3IB9A 4MOUA 3ST9A 2Q34A 3IAVA 4FZWC 4QIJA 1TG6A 2F9YA 3RSTA 1NZYA 4ZDCA 4FN7A 4NEKA 3GLMA 3TDCA 4Q1IA 3T89A 1RJNA 3OMEA 3M6MA 3DJAA 2A7KA 3LAOA 4L8KA 2FBMA 4Q0GA 4HDTA 2F9YB 1NZYB 3MYBA 3ISAA 5MGBA 2J5GA 3OT6A 1PJHA 4GM2A 2VX2A 4I4ZA 2J5SA 3NJDA 3TV5A 3TT6A 5E0SH 1ON3A 4FJWD 4JCSA 4HC8A 3KTIA 2PG8A 2VSSE 3KQFA 4Z0MA 1UIYA 3QMJA 1N6EA 1UYSA 3QREA 4FNDA 1XNYA 5FUSA 5G1QA 5CTCA 3QXIA 4ELSA 2GTRA 3R9QA 3T88A 4I52A 4OMRA 4JCRA 3JU1A 3TVUA 1UYVA 4JYJA 4B3IA 3HRXA 3QKAA 4JFCA 3R9TA 3QYRA 4L6WA 4KNPA 4J2UA 3L3SA 1HZDA 2UZFA 4U0GA 2J5GD 3DORA 1N6FA 3H0SA 2F6QA 4NNQA 3MOYA 3RSIA 2A81A 4K3WA 4GHNA 2VSUA 3H81A 3H0QA 4F47A 4KWBA 2FW2A 5DUCA 2YJGA 5INGA 1FCFA 1O8UA 3T8AA 5HUQA 1HNUA 3H0JA 2FZSA 3TRRA 1ON9A 2BZRA 4U19A 3TVWA 5E0NX 1YG8A 4RYFH 3H02A 1SG4A 2ZL2A 3Q1TA 4U18A 3U9RB 3V5IA 3ZW9A 4ELWA 1UYTA 1YG6A 5KDRA 1OD2A 4EMLA 3Q0JA 4I42A 1Y7OA 3GKBA 3HINA 4IZCA 2HW5A 1Q51A 2PPYA 3STAA 4B3JA 3QK8A 3ZW8A 2Q2XA 4JCTA 4U1AA 3ZWCA 2J5II 3P2LA 4KD6A 5KDRB 2J5IA 3TLFA 3HP0A 2D3TA 5INFA 1HNOA 3QXZA 4OG1A 1Q52A 3RRVA 3NJBA 3SWXA 3K8XA 5DL1A 4MI2A 1RJMA 4G2RA 1EY3A 4YLHA 2NP9A 2J5IB 3Q0GA 5C90A 1UYRA 5DTPA 3M6NA 4DI1A 3KTGA 5JBXA 3HLN1 3PGQA 5DTWA 3GF3A 3OC7A 2ZQRA 1FC6A 3ZWAA 3R6HA 1WDLA 2VSSA 4JJTA 3HE2A 3VIVA 2F9IA 4NARA 1XNWA 4ZDBA 3MT6A 4JWVA 1X0UA 1FC9A 2ZQQA 2A7SA 2F6IA 3SLLA 4U0HA 2X24A 3IBBA 4LK5A 4K2NA 4KPKA 5DZKA 3PEAA 2ZL3A 4JCQA 3R9SA 1XO6A 2ZL4A 3PZKA 2F9IB 3H0UA 1PIXA 2IEXA 5DKPA 4JSBA 5DU8A 3N6RB 4OLQA 2VSUF 3U9SB 4WCZA 2PBPA 3MFMA 4EMMA 2DEOA 3KTKA 4JVTA 1DCIA 4ZDFA 5DU6A 3FDUA 5G1SA 3BPPA 1WDKA 3KTJA 3T3WA 4WYOB 5E0SA 3GF7A 3V5EA 1WDMA 2EJ5A 2QQ3A 3U9TB 5DUFA 4FZWA 4U0GH 4ZU2A 5INIA 1J7XA 3QWDA 3P5MA 1MJ3A 5DZKH 2X58A 3PE8A 1VRGA 4ZDDA 4EMPA 4ZDEA 3TZ3A 2CE3A 4IZDA 4QIIA 4QFEA 1N6DA 5CTBA 4HNKA 1XNVA 2DUBA 4ASIA 5DU4A 3Q7HA 3WG5A 2C8TA 3BPTA 3R0OA 4JOTA 1JXZA 2ZL0A 3G64A 5JBWA 5FIFA 1XX4A 1TYFA 3BEZA 1SZOA 2VREA 4IZBA 3ZWBA 2WTBA 3TT7A 4MXIA 1OD4A 5C9GA 3FF6A 1WZ8A 4RCNA 3K50A 5KJPA 4RYFA 1K39A 2VSSF 1EF8A 3LKEA 2W3PA 2CBYA 5G1RA 4JYLA 1W2XA 2VSUE 4WZ8B 2VSUC 4FN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMA A;  3BF0 A;  1DUB A;  1FC7 A;  2Q35 A;  3P85 A;  3KTH A;  1EF9 A;  5IKL B;  4B3H A;  4FNB A;  4ELX A;  3T8B A;  1K32 A;  4K29 A;  3I47 A;  4FB8 A;  3IB9 A;  4MOU A;  3ST9 A;  2Q34 A;  3IAV A;  4FZW C;  4QIJ A;  1TG6 A;  2F9Y A;  3RST A;  1NZY A;  4ZDC A;  4FN7 A;  4NEK A;  3GLM A;  3TDC A;  4Q1I A;  3T89 A;  1RJN A;  3OME A;  3M6M A;  3DJA A;  2A7K A;  3LAO A;  4L8K A;  2FBM A;  4Q0G A;  2F9Y B;  1NZY B;  3MYB A;  3ISA A;  5MGB A;  2J5G A;  3OT6 A;  1PJH A;  4GM2 A;  2VX2 A;  4I4Z A;  2J5S A;  3NJD A;  3TV5 A;  3TT6 A;  5E0S H;  1ON3 A;  4FJW D;  4JCS A;  4HC8 A;  3KTI A;  2PG8 A;  2VSS E;  3KQF A;  4Z0M A;  1UIY A;  3QMJ A;  1N6E A;  1UYS A;  3QRE A;  4FND A;  1XNY A;  5FUS A;  5G1Q A;  5CTC A;  3QXI A;  4ELS A;  2GTR A;  3R9Q A;  3T88 A;  4I52 A;  4OMR A;  4JCR A;  3JU1 A;  3TVU A;  1UYV A;  4JYJ A;  4B3I A;  3HRX A;  3QKA A;  4JFC A;  3R9T A;  3QYR A;  4L6W A;  4KNP A;  3L3S A;  1HZD A;  2UZF A;  4U0G A;  2J5G D;  3DOR A;  1N6F A;  3H0S A;  2F6Q A;  4NNQ A;  3MOY A;  3RSI A;  2A81 A;  4K3W A;  4GHN A;  2VSU A;  3H81 A;  3H0Q A;  4F47 A;  4KWB A;  2FW2 A;  5DUC A;  5ING A;  1FCF A;  1O8U A;  3T8A A;  1HNU A;  3H0J A;  2FZS A;  3TRR A;  1ON9 A;  2BZR A;  4U19 A;  3TVW A;  5E0N X;  1YG8 A;  4RYF H;  3H02 A;  1SG4 A;  2ZL2 A;  3Q1T A;  4U18 A;  3U9R B;  3V5I A;  3ZW9 A;  4ELW A;  1UYT A;  1YG6 A;  5KDR A;  1OD2 A;  4EML A;  3Q0J A;  4I42 A;  1Y7O A;  3GKB A;  3HIN A;  4IZC A;  2HW5 A;  1Q51 A;  2PPY A;  3STA A;  4B3J A;  3QK8 A;  3ZW8 A;  2Q2X A;  4JCT A;  4U1A A;  3ZWC A;  2J5I I;  3P2L A;  4KD6 A;  5KDR B;  2J5I A;  3TLF A;  3HP0 A;  2D3T A;  5INF A;  1HNO A;  3QXZ A;  4OG1 A;  1Q52 A;  3RRV A;  3NJB A;  3SWX A;  3K8X A;  5DL1 A;  4MI2 A;  1RJM A;  4G2R A;  1EY3 A;  4YLH A;  2NP9 A;  2J5I B;  3Q0G A;  5C90 A;  1UYR A;  5DTP A;  3M6N A;  4DI1 A;  3KTG A;  5JBX A;  3HLN 1;  3PGQ A;  5DTW A;  3GF3 A;  3OC7 A;  2ZQR A;  1FC6 A;  3ZWA A;  3R6H A;  1WDL A;  2VSS A;  4JJT A;  3HE2 A;  3VIV A;  2F9I A;  1XNW A;  4ZDB A;  3MT6 A;  4JWV A;  1X0U A;  1FC9 A;  2ZQQ A;  2A7S A;  2F6I A;  3SLL A;  4U0H A;  2X24 A;  3IBB A;  4LK5 A;  4K2N A;  4KPK A;  5DZK A;  3PEA A;  2ZL3 A;  4JCQ A;  3R9S A;  1XO6 A;  2ZL4 A;  3PZK A;  2F9I B;  3H0U A;  1PIX A;  2IEX A;  5DKP A;  4JSB A;  5DU8 A;  3N6R B;  4OLQ A;  2VSU F;  3U9S B;  4WCZ A;  2PBP A;  3MFM A;  4EMM A;  2DEO A;  3KTK A;  4JVT A;  1DCI A;  4ZDF A;  5DU6 A;  3FDU A;  5G1S A;  3BPP A;  1WDK A;  3KTJ A;  3T3W A;  4WYO B;  5E0S A;  3GF7 A;  3V5E A;  1WDM A;  2EJ5 A;  2QQ3 A;  3U9T B;  5DUF A;  4FZW A;  4U0G H;  4ZU2 A;  5INI A;  1J7X A;  3QWD A;  3P5M A;  1MJ3 A;  5DZK H;  2X58 A;  3PE8 A;  1VRG A;  4ZDD A;  4EMP A;  4ZDE A;  3TZ3 A;  2CE3 A;  4IZD A;  4QII A;  4QFE A;  1N6D A;  5CTB A;  4HNK A;  1XNV A;  2DUB A;  4ASI A;  5DU4 A;  3Q7H A;  3WG5 A;  2C8T A;  3R0O A;  4JOT A;  1JXZ A;  2ZL0 A;  3G64 A;  5JBW A;  5FIF A;  1XX4 A;  1TYF A;  3BEZ A;  1SZO A;  2VRE A;  4IZB A;  3ZWB A;  2WTB A;  3TT7 A;  4MXI A;  1OD4 A;  5C9G A;  3FF6 A;  1WZ8 A;  4RCN A;  3K50 A;  5KJP A;  4RYF A;  1K39 A;  2VSS F;  1EF8 A;  3LKE A;  2W3P A;  2CBY A;  5G1R A;  4JYL A;  1W2X A;  2VSU E;  4WZ8 B;  2VSU C;  4FN8 A; 
#chains in the Genus database with same CATH topology
 3GMA A;  3BF0 A;  1DUB A;  1FC7 A;  2Q35 A;  3P85 A;  3KTH A;  1EF9 A;  5IKL B;  4B3H A;  4FNB A;  4ELX A;  3T8B A;  1K32 A;  4K29 A;  3I47 A;  4FB8 A;  3IB9 A;  4MOU A;  3ST9 A;  2Q34 A;  3IAV A;  4FZW C;  4QIJ A;  1TG6 A;  2F9Y A;  3RST A;  1NZY A;  4ZDC A;  4FN7 A;  4NEK A;  3GLM A;  3TDC A;  4Q1I A;  3T89 A;  1RJN A;  3OME A;  3M6M A;  3DJA A;  2A7K A;  3LAO A;  4L8K A;  2FBM A;  4Q0G A;  4HDT A;  2F9Y B;  1NZY B;  3MYB A;  3ISA A;  5MGB A;  2J5G A;  3OT6 A;  1PJH A;  4GM2 A;  2VX2 A;  4I4Z A;  2J5S A;  3NJD A;  3TV5 A;  3TT6 A;  5E0S H;  1ON3 A;  4FJW D;  4JCS A;  4HC8 A;  3KTI A;  2PG8 A;  2VSS E;  3KQF A;  4Z0M A;  1UIY A;  3QMJ A;  1N6E A;  1UYS A;  3QRE A;  4FND A;  1XNY A;  5FUS A;  5G1Q A;  5CTC A;  3QXI A;  4ELS A;  2GTR A;  3R9Q A;  3T88 A;  4I52 A;  4OMR A;  4JCR A;  3JU1 A;  3TVU A;  1UYV A;  4JYJ A;  4B3I A;  3HRX A;  3QKA A;  4JFC A;  3R9T A;  3QYR A;  4L6W A;  4KNP A;  4J2U A;  3L3S A;  1HZD A;  2UZF A;  4U0G A;  2J5G D;  3DOR A;  1N6F A;  3H0S A;  2F6Q A;  4NNQ A;  3MOY A;  3RSI A;  2A81 A;  4K3W A;  4GHN A;  2VSU A;  3H81 A;  3H0Q A;  4F47 A;  4KWB A;  2FW2 A;  5DUC A;  2YJG A;  5ING A;  1FCF A;  1O8U A;  3T8A A;  5HUQ A;  1HNU A;  3H0J A;  2FZS A;  3TRR A;  1ON9 A;  2BZR A;  4U19 A;  3TVW A;  5E0N X;  1YG8 A;  4RYF H;  3H02 A;  1SG4 A;  2ZL2 A;  3Q1T A;  4U18 A;  3U9R B;  3V5I A;  3ZW9 A;  4ELW A;  1UYT A;  1YG6 A;  5KDR A;  1OD2 A;  4EML A;  3Q0J A;  4I42 A;  1Y7O A;  3GKB A;  3HIN A;  4IZC A;  2HW5 A;  1Q51 A;  2PPY A;  3STA A;  4B3J A;  3QK8 A;  3ZW8 A;  2Q2X A;  4JCT A;  4U1A A;  3ZWC A;  2J5I I;  3P2L A;  4KD6 A;  5KDR B;  2J5I A;  3TLF A;  3HP0 A;  2D3T A;  5INF A;  1HNO A;  3QXZ A;  4OG1 A;  1Q52 A;  3RRV A;  3NJB A;  3SWX A;  3K8X A;  5DL1 A;  4MI2 A;  1RJM A;  4G2R A;  1EY3 A;  4YLH A;  2NP9 A;  2J5I B;  3Q0G A;  5C90 A;  1UYR A;  5DTP A;  3M6N A;  4DI1 A;  3KTG A;  5JBX A;  3HLN 1;  3PGQ A;  5DTW A;  3GF3 A;  3OC7 A;  2ZQR A;  1FC6 A;  3ZWA A;  3R6H A;  1WDL A;  2VSS A;  4JJT A;  3HE2 A;  3VIV A;  2F9I A;  4NAR A;  1XNW A;  4ZDB A;  3MT6 A;  4JWV A;  1X0U A;  1FC9 A;  2ZQQ A;  2A7S A;  2F6I A;  3SLL A;  4U0H A;  2X24 A;  3IBB A;  4LK5 A;  4K2N A;  4KPK A;  5DZK A;  3PEA A;  2ZL3 A;  4JCQ A;  3R9S A;  1XO6 A;  2ZL4 A;  3PZK A;  2F9I B;  3H0U A;  1PIX A;  2IEX A;  5DKP A;  4JSB A;  5DU8 A;  3N6R B;  4OLQ A;  2VSU F;  3U9S B;  4WCZ A;  2PBP A;  3MFM A;  4EMM A;  2DEO A;  3KTK A;  4JVT A;  1DCI A;  4ZDF A;  5DU6 A;  3FDU A;  5G1S A;  3BPP A;  1WDK A;  3KTJ A;  3T3W A;  4WYO B;  5E0S A;  3GF7 A;  3V5E A;  1WDM A;  2EJ5 A;  2QQ3 A;  3U9T B;  5DUF A;  4FZW A;  4U0G H;  4ZU2 A;  5INI A;  1J7X A;  3QWD A;  3P5M A;  1MJ3 A;  5DZK H;  2X58 A;  3PE8 A;  1VRG A;  4ZDD A;  4EMP A;  4ZDE A;  3TZ3 A;  2CE3 A;  4IZD A;  4QII A;  4QFE A;  1N6D A;  5CTB A;  4HNK A;  1XNV A;  2DUB A;  4ASI A;  5DU4 A;  3Q7H A;  3WG5 A;  2C8T A;  3BPT A;  3R0O A;  4JOT A;  1JXZ A;  2ZL0 A;  3G64 A;  5JBW A;  5FIF A;  1XX4 A;  1TYF A;  3BEZ A;  1SZO A;  2VRE A;  4IZB A;  3ZWB A;  2WTB A;  3TT7 A;  4MXI A;  1OD4 A;  5C9G A;  3FF6 A;  1WZ8 A;  4RCN A;  3K50 A;  5KJP A;  4RYF A;  1K39 A;  2VSS F;  1EF8 A;  3LKE A;  2W3P A;  2CBY A;  5G1R A;  4JYL A;  1W2X A;  2VSU E;  4WZ8 B;  2VSU C;  4FN8 A; 
#chains in the Genus database with same CATH homology
 3GMA A;  3BF0 A;  1DUB A;  1FC7 A;  2Q35 A;  3P85 A;  3KTH A;  1EF9 A;  5IKL B;  4B3H A;  4FNB A;  4ELX A;  3T8B A;  1K32 A;  4K29 A;  3I47 A;  4FB8 A;  3IB9 A;  4MOU A;  3ST9 A;  2Q34 A;  3IAV A;  4FZW C;  4QIJ A;  1TG6 A;  2F9Y A;  3RST A;  1NZY A;  4ZDC A;  4FN7 A;  4NEK A;  3GLM A;  3TDC A;  4Q1I A;  3T89 A;  1RJN A;  3OME A;  3M6M A;  3DJA A;  2A7K A;  3LAO A;  4L8K A;  2FBM A;  4Q0G A;  4HDT A;  2F9Y B;  1NZY B;  3MYB A;  3ISA A;  5MGB A;  2J5G A;  3OT6 A;  1PJH A;  4GM2 A;  2VX2 A;  4I4Z A;  2J5S A;  3NJD A;  3TV5 A;  3TT6 A;  5E0S H;  1ON3 A;  4FJW D;  4JCS A;  4HC8 A;  3KTI A;  2PG8 A;  2VSS E;  3KQF A;  4Z0M A;  1UIY A;  3QMJ A;  1N6E A;  1UYS A;  3QRE A;  4FND A;  1XNY A;  5FUS A;  5G1Q A;  5CTC A;  3QXI A;  4ELS A;  2GTR A;  3R9Q A;  3T88 A;  4I52 A;  4OMR A;  4JCR A;  3JU1 A;  3TVU A;  1UYV A;  4JYJ A;  4B3I A;  3HRX A;  3QKA A;  4JFC A;  3R9T A;  3QYR A;  4L6W A;  4KNP A;  4J2U A;  3L3S A;  1HZD A;  2UZF A;  4U0G A;  2J5G D;  3DOR A;  1N6F A;  3H0S A;  2F6Q A;  4NNQ A;  3MOY A;  3RSI A;  2A81 A;  4K3W A;  4GHN A;  2VSU A;  3H81 A;  3H0Q A;  4F47 A;  4KWB A;  2FW2 A;  5DUC A;  2YJG A;  5ING A;  1FCF A;  1O8U A;  3T8A A;  5HUQ A;  1HNU A;  3H0J A;  2FZS A;  3TRR A;  1ON9 A;  2BZR A;  4U19 A;  3TVW A;  5E0N X;  1YG8 A;  4RYF H;  3H02 A;  1SG4 A;  2ZL2 A;  3Q1T A;  4U18 A;  3U9R B;  3V5I A;  3ZW9 A;  4ELW A;  1UYT A;  1YG6 A;  5KDR A;  1OD2 A;  4EML A;  3Q0J A;  4I42 A;  1Y7O A;  3GKB A;  3HIN A;  4IZC A;  2HW5 A;  1Q51 A;  2PPY A;  3STA A;  4B3J A;  3QK8 A;  3ZW8 A;  2Q2X A;  4JCT A;  4U1A A;  3ZWC A;  2J5I I;  3P2L A;  4KD6 A;  5KDR B;  2J5I A;  3TLF A;  3HP0 A;  2D3T A;  5INF A;  1HNO A;  3QXZ A;  4OG1 A;  1Q52 A;  3RRV A;  3NJB A;  3SWX A;  3K8X A;  5DL1 A;  4MI2 A;  1RJM A;  4G2R A;  1EY3 A;  4YLH A;  2NP9 A;  2J5I B;  3Q0G A;  5C90 A;  1UYR A;  5DTP A;  3M6N A;  4DI1 A;  3KTG A;  5JBX A;  3HLN 1;  3PGQ A;  5DTW A;  3GF3 A;  3OC7 A;  2ZQR A;  1FC6 A;  3ZWA A;  3R6H A;  1WDL A;  2VSS A;  4JJT A;  3HE2 A;  3VIV A;  2F9I A;  4NAR A;  1XNW A;  4ZDB A;  3MT6 A;  4JWV A;  1X0U A;  1FC9 A;  2ZQQ A;  2A7S A;  2F6I A;  3SLL A;  4U0H A;  2X24 A;  3IBB A;  4LK5 A;  4K2N A;  4KPK A;  5DZK A;  3PEA A;  2ZL3 A;  4JCQ A;  3R9S A;  1XO6 A;  2ZL4 A;  3PZK A;  2F9I B;  3H0U A;  1PIX A;  2IEX A;  5DKP A;  4JSB A;  5DU8 A;  3N6R B;  4OLQ A;  2VSU F;  3U9S B;  4WCZ A;  2PBP A;  3MFM A;  4EMM A;  2DEO A;  3KTK A;  4JVT A;  1DCI A;  4ZDF A;  5DU6 A;  3FDU A;  5G1S A;  3BPP A;  1WDK A;  3KTJ A;  3T3W A;  4WYO B;  5E0S A;  3GF7 A;  3V5E A;  1WDM A;  2EJ5 A;  2QQ3 A;  3U9T B;  5DUF A;  4FZW A;  4U0G H;  4ZU2 A;  5INI A;  1J7X A;  3QWD A;  3P5M A;  1MJ3 A;  5DZK H;  2X58 A;  3PE8 A;  1VRG A;  4ZDD A;  4EMP A;  4ZDE A;  3TZ3 A;  2CE3 A;  4IZD A;  4QII A;  4QFE A;  1N6D A;  5CTB A;  4HNK A;  1XNV A;  2DUB A;  4ASI A;  5DU4 A;  3Q7H A;  3WG5 A;  2C8T A;  3BPT A;  3R0O A;  4JOT A;  1JXZ A;  2ZL0 A;  3G64 A;  5JBW A;  5FIF A;  1XX4 A;  1TYF A;  3BEZ A;  1SZO A;  2VRE A;  4IZB A;  3ZWB A;  2WTB A;  3TT7 A;  4MXI A;  1OD4 A;  5C9G A;  3FF6 A;  1WZ8 A;  4RCN A;  3K50 A;  5KJP A;  4RYF A;  1K39 A;  2VSS F;  1EF8 A;  3LKE A;  2W3P A;  2CBY A;  5G1R A;  4JYL A;  1W2X A;  2VSU E;  4WZ8 B;  2VSU C;  4FN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...