4JCQA

Clpp1 from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
170
Chain Sequence
ILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into caseinolytic proteases reveal an unprecedented regulation principle of their catalytic triad.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 170
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4jcqA00
2FBMA 2FW2A 4ASIA 4K29A 3R9SA 1WDLA 1WZ8A 5DUCA 3ISAA 2Q34A 2J5IB 1Q52A 1OD4A 4JSBA 3STAA 3MT6A 3R6HA 2J5IA 3RSTA 2NP9A 3IAVA 3QXIA 2PPYA 3TT7A 3H81A 5KDRB 3H0UA 3SWXA 1XNYA 3KTHA 3Q1TA 2ZQQA 1RJMA 4IZCA 3T8AA 4ZU2A 4G2RA 2W3PA 1EF8A 3R9TA 5JBXA 3IB9A 2J5GD 1WDMA 3ZW8A 3ZWBA 4FN7A 3IBBA 1NZYB 3HE2A 1N6DA 1UYTA 4FJWD 2CBYA 1XO6A 4IZDA 4NNQA 3M6NA 1NZYA 1TYFA 1ON3A 3SLLA 2QQ3A 5INGA 1UYVA 2EJ5A 4Z0MA 4HNKA 4ZDEA 3KTJA 3KQFA 4EMLA 3V5IA 3HLN1 4B3HA 3Q7HA 4RYFH 2VSSF 2WTBA 1Y7OA 3RSIA 5DUFA 4JOTA 5DZKA 1FC7A 3BPPA 4U18A 3Q0JA 4FNDA 4GM2A 1HZDA 2VSSA 2VSSE 1O8UA 3HRXA 3OC7A 3DORA 3M6MA 2D3TA 4KNPA 2VSUC 2F6IA 3GKBA 3FF6A 3K8XA 5C90A 4EMPA 1SZOA 4JJTA 3K50A 1WDKA 2Q35A 2F9YB 2CE3A 4K2NA 5C9GA 3TVUA 3Q0GA 1X0UA 5DU8A 1FCFA 5DZKH 3QREA 4ZDCA 5KDRA 3OT6A 1MJ3A 5DKPA 3V5EA 3H0JA 4ZDDA 2ZL2A 3TLFA 3H0SA 4JVTA 3T3WA 4RYFA 3TDCA 2VSUE 4OG1A 2Q2XA 4MI2A 3MFMA 3T89A 2GTRA 2ZQRA 1N6EA 4Q0GA 5DTWA 2HW5A 4NEKA 5JBWA 1XNVA 4MOUA 4U0GA 4KWBA 2PG8A 4Q1IA 4L8KA 1UYRA 5CTCA 3HP0A 3R9QA 2FZSA 1J7XA 5DTPA 3H0QA 2UZFA 1RJNA 4JCQA 3T88A 3FDUA 4KD6A 1FC6A 3LAOA 4OLQA 4U19A 2ZL3A 3TT6A 3GF7A 4YLHA 4JFCA 4B3JA 5CTBA 3MOYA 3P5MA 3G64A 2A7KA 1JXZA 5MGBA 5INFA 1K39A 3PE8A 3TV5A 2VSUA 3LKEA 1W2XA 2DEOA 2X24A 4FZWA 3TZ3A 5FUSA 5G1QA 4DI1A 1YG6A 1EY3A 4FN8A 5DU4A 5INIA 3N6RB 1ON9A 3QYRA 2ZL4A 3DJAA 3QMJA 4MXIA 4ELWA 4JCSA 2C8TA 4JCRA 4ZDFA 1EF9A 4KPKA 4EMMA 1SG4A 2F6QA 2PBPA 3RRVA 3HINA 3PGQA 2J5II 2ZL0A 2A7SA 1VRGA 3P2LA 3KTGA 4OMRA 3NJDA 3GMAA 4I52A 1HNUA 1N6FA 2J5GA 2IEXA 3QXZA 2F9YA 4FNBA 4RCNA 5DL1A 1XX4A 3H02A 1UYSA 5G1RA 4U0HA 3QKAA 2A81A 4U1AA 3ZWAA 3ST9A 3U9TB 4HC8A 5IKLB 3TRRA 4QIIA 4JYJA 5FIFA 1OD2A 4ELXA 4WCZA 1K32A 4GHNA 3ZWCA 3WG5A 5G1SA 3L3SA 2X58A 4LK5A 1FC9A 2BZRA 4QFEA 3NJBA 3U9RB 4QIJA 3KTKA 3OMEA 4U0GH 3PEAA 5E0SH 4IZBA 3JU1A 4F47A 3MYBA 2F9IB 4K3WA 4I4ZA 3QK8A 2J5SA 4JCTA 4I42A 2F9IA 3KTIA 4L6WA 3QWDA 3BEZA 3VIVA 4JWVA 1YG8A 4WZ8B 2VSUF 4ELSA 1Q51A 4ZDBA 1PJHA 3PZKA 3P85A 3I47A 5E0SA 2VX2A 1DCIA 3ZW9A 1XNWA 1DUBA 4FZWC 3T8BA 3TVWA 4B3IA 5KJPA 5E0NX 3R0OA 1TG6A 4JYLA 4WYOB 1UIYA 5DU6A 2VREA 1PIXA 4FB8A 3GLMA 3BF0A 1HNOA 2DUBA 3U9SB 3GF3A
chains in the Genus database with same CATH superfamily
2FBMA 2FW2A 4ASIA 4K29A 3R9SA 1WDLA 1WZ8A 5DUCA 3ISAA 2Q34A 2J5IB 1Q52A 1OD4A 4JSBA 3STAA 3MT6A 3R6HA 2J5IA 3RSTA 2NP9A 3IAVA 3QXIA 2PPYA 3TT7A 3H81A 5KDRB 3H0UA 3SWXA 1XNYA 3KTHA 3Q1TA 2ZQQA 1RJMA 4IZCA 3T8AA 4ZU2A 4G2RA 2W3PA 1EF8A 3R9TA 5JBXA 3IB9A 2J5GD 1WDMA 3ZW8A 3ZWBA 4FN7A 3IBBA 1NZYB 3HE2A 1N6DA 1UYTA 4FJWD 2CBYA 1XO6A 4IZDA 4NNQA 3M6NA 1NZYA 1TYFA 1ON3A 3SLLA 2QQ3A 5INGA 1UYVA 2EJ5A 4Z0MA 4HNKA 4ZDEA 3KTJA 3KQFA 4EMLA 3V5IA 3BPTA 3HLN1 4B3HA 3Q7HA 4RYFH 2VSSF 2WTBA 1Y7OA 3RSIA 5DUFA 4JOTA 5DZKA 1FC7A 3BPPA 4U18A 3Q0JA 4FNDA 4GM2A 1HZDA 2VSSA 2VSSE 1O8UA 3HRXA 3OC7A 3DORA 3M6MA 2D3TA 4KNPA 2VSUC 2F6IA 3GKBA 3FF6A 3K8XA 5C90A 4EMPA 1SZOA 4JJTA 3K50A 1WDKA 2Q35A 2F9YB 2CE3A 4K2NA 5C9GA 3TVUA 3Q0GA 1X0UA 5DU8A 5HUQA 1FCFA 5DZKH 3QREA 4ZDCA 5KDRA 3OT6A 1MJ3A 5DKPA 3V5EA 3H0JA 4ZDDA 2ZL2A 3TLFA 3H0SA 4JVTA 3T3WA 4RYFA 3TDCA 2VSUE 4OG1A 2Q2XA 4MI2A 3MFMA 3T89A 2GTRA 2ZQRA 1N6EA 4HDTA 4Q0GA 5DTWA 2HW5A 4NEKA 5JBWA 1XNVA 4MOUA 4U0GA 4KWBA 2PG8A 4Q1IA 4L8KA 1UYRA 5CTCA 3HP0A 3R9QA 2FZSA 1J7XA 5DTPA 3H0QA 2UZFA 1RJNA 4JCQA 3T88A 3FDUA 4KD6A 1FC6A 3LAOA 4OLQA 4U19A 2ZL3A 3TT6A 3GF7A 4YLHA 4JFCA 4B3JA 5CTBA 3MOYA 3P5MA 3G64A 2A7KA 1JXZA 5MGBA 5INFA 1K39A 3PE8A 3TV5A 2VSUA 3LKEA 2YJGA 1W2XA 2DEOA 2X24A 4FZWA 3TZ3A 5FUSA 5G1QA 4DI1A 1YG6A 1EY3A 4FN8A 5DU4A 5INIA 3N6RB 1ON9A 3QYRA 2ZL4A 3DJAA 4NARA 3QMJA 4MXIA 4ELWA 4JCSA 2C8TA 4JCRA 4ZDFA 1EF9A 4KPKA 4EMMA 1SG4A 2F6QA 2PBPA 3RRVA 3HINA 3PGQA 2J5II 2ZL0A 2A7SA 1VRGA 3P2LA 3KTGA 4OMRA 3NJDA 3GMAA 4I52A 1HNUA 1N6FA 2J5GA 2IEXA 3QXZA 2F9YA 4FNBA 4RCNA 5DL1A 1XX4A 3H02A 1UYSA 5G1RA 4U0HA 3QKAA 2A81A 4U1AA 3ZWAA 3ST9A 3U9TB 4HC8A 5IKLB 3TRRA 4QIIA 4JYJA 5FIFA 1OD2A 4ELXA 4WCZA 1K32A 4GHNA 3ZWCA 3WG5A 5G1SA 3L3SA 2X58A 4LK5A 1FC9A 2BZRA 4QFEA 3NJBA 3U9RB 4QIJA 3KTKA 3OMEA 4U0GH 3PEAA 5E0SH 4IZBA 3JU1A 4F47A 3MYBA 2F9IB 4K3WA 4I4ZA 3QK8A 2J5SA 4JCTA 4I42A 2F9IA 3KTIA 4L6WA 3QWDA 3BEZA 3VIVA 4JWVA 1YG8A 4WZ8B 2VSUF 4ELSA 1Q51A 4ZDBA 1PJHA 3PZKA 3P85A 3I47A 5E0SA 2VX2A 1DCIA 3ZW9A 1XNWA 1DUBA 4FZWC 3T8BA 3TVWA 4B3IA 5KJPA 5E0NX 3R0OA 1TG6A 4J2UA 4JYLA 4WYOB 1UIYA 5DU6A 2VREA 1PIXA 4FB8A 3GLMA 3BF0A 1HNOA 2DUBA 3U9SB 3GF3A
chains in the Genus database with same CATH topology
2FBMA 2FW2A 4ASIA 4K29A 3R9SA 1WDLA 1WZ8A 5DUCA 3ISAA 2Q34A 2J5IB 1Q52A 1OD4A 4JSBA 3STAA 3MT6A 3R6HA 2J5IA 3RSTA 2NP9A 3IAVA 3QXIA 2PPYA 3TT7A 3H81A 5KDRB 3H0UA 3SWXA 1XNYA 3KTHA 3Q1TA 2ZQQA 1RJMA 4IZCA 3T8AA 4ZU2A 4G2RA 2W3PA 1EF8A 3R9TA 5JBXA 3IB9A 2J5GD 1WDMA 3ZW8A 3ZWBA 4FN7A 3IBBA 1NZYB 3HE2A 1N6DA 1UYTA 4FJWD 2CBYA 1XO6A 4IZDA 4NNQA 3M6NA 1NZYA 1TYFA 1ON3A 3SLLA 2QQ3A 5INGA 1UYVA 2EJ5A 4Z0MA 4HNKA 4ZDEA 3KTJA 3KQFA 4EMLA 3V5IA 3BPTA 3HLN1 4B3HA 3Q7HA 4RYFH 2VSSF 2WTBA 1Y7OA 3RSIA 5DUFA 4JOTA 5DZKA 1FC7A 3BPPA 4U18A 3Q0JA 4FNDA 4GM2A 1HZDA 2VSSA 2VSSE 1O8UA 3HRXA 3OC7A 3DORA 3M6MA 2D3TA 4KNPA 2VSUC 2F6IA 3GKBA 3FF6A 3K8XA 5C90A 4EMPA 1SZOA 4JJTA 3K50A 1WDKA 2Q35A 2F9YB 2CE3A 4K2NA 5C9GA 3TVUA 3Q0GA 1X0UA 5DU8A 5HUQA 1FCFA 5DZKH 3QREA 4ZDCA 5KDRA 3OT6A 1MJ3A 5DKPA 3V5EA 3H0JA 4ZDDA 2ZL2A 3TLFA 3H0SA 4JVTA 3T3WA 4RYFA 3TDCA 2VSUE 4OG1A 2Q2XA 4MI2A 3MFMA 3T89A 2GTRA 2ZQRA 1N6EA 4HDTA 4Q0GA 5DTWA 2HW5A 4NEKA 5JBWA 1XNVA 4MOUA 4U0GA 4KWBA 2PG8A 4Q1IA 4L8KA 1UYRA 5CTCA 3HP0A 3R9QA 2FZSA 1J7XA 5DTPA 3H0QA 2UZFA 1RJNA 4JCQA 3T88A 3FDUA 4KD6A 1FC6A 3LAOA 4OLQA 4U19A 2ZL3A 3TT6A 3GF7A 4YLHA 4JFCA 4B3JA 5CTBA 3MOYA 3P5MA 3G64A 2A7KA 1JXZA 5MGBA 5INFA 1K39A 3PE8A 3TV5A 2VSUA 3LKEA 2YJGA 1W2XA 2DEOA 2X24A 4FZWA 3TZ3A 5FUSA 5G1QA 4DI1A 1YG6A 1EY3A 4FN8A 5DU4A 5INIA 3N6RB 1ON9A 3QYRA 2ZL4A 3DJAA 4NARA 3QMJA 4MXIA 4ELWA 4JCSA 2C8TA 4JCRA 4ZDFA 1EF9A 4KPKA 4EMMA 1SG4A 2F6QA 2PBPA 3RRVA 3HINA 3PGQA 2J5II 2ZL0A 2A7SA 1VRGA 3P2LA 3KTGA 4OMRA 3NJDA 3GMAA 4I52A 1HNUA 1N6FA 2J5GA 2IEXA 3QXZA 2F9YA 4FNBA 4RCNA 5DL1A 1XX4A 3H02A 1UYSA 5G1RA 4U0HA 3QKAA 2A81A 4U1AA 3ZWAA 3ST9A 3U9TB 4HC8A 5IKLB 3TRRA 4QIIA 4JYJA 5FIFA 1OD2A 4ELXA 4WCZA 1K32A 4GHNA 3ZWCA 3WG5A 5G1SA 3L3SA 2X58A 4LK5A 1FC9A 2BZRA 4QFEA 3NJBA 3U9RB 4QIJA 3KTKA 3OMEA 4U0GH 3PEAA 5E0SH 4IZBA 3JU1A 4F47A 3MYBA 2F9IB 4K3WA 4I4ZA 3QK8A 2J5SA 4JCTA 4I42A 2F9IA 3KTIA 4L6WA 3QWDA 3BEZA 3VIVA 4JWVA 1YG8A 4WZ8B 2VSUF 4ELSA 1Q51A 4ZDBA 1PJHA 3PZKA 3P85A 3I47A 5E0SA 2VX2A 1DCIA 3ZW9A 1XNWA 1DUBA 4FZWC 3T8BA 3TVWA 4B3IA 5KJPA 5E0NX 3R0OA 1TG6A 4J2UA 4JYLA 4WYOB 1UIYA 5DU6A 2VREA 1PIXA 4FB8A 3GLMA 3BF0A 1HNOA 2DUBA 3U9SB 3GF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBM A;  2FW2 A;  4ASI A;  4K29 A;  3R9S A;  1WDL A;  1WZ8 A;  5DUC A;  3ISA A;  2Q34 A;  2J5I B;  1Q52 A;  1OD4 A;  4JSB A;  3STA A;  3MT6 A;  3R6H A;  2J5I A;  3RST A;  2NP9 A;  3IAV A;  3QXI A;  2PPY A;  3TT7 A;  3H81 A;  5KDR B;  3H0U A;  3SWX A;  1XNY A;  3KTH A;  3Q1T A;  2ZQQ A;  1RJM A;  4IZC A;  3T8A A;  4ZU2 A;  4G2R A;  2W3P A;  1EF8 A;  3R9T A;  5JBX A;  3IB9 A;  2J5G D;  1WDM A;  3ZW8 A;  3ZWB A;  4FN7 A;  3IBB A;  1NZY B;  3HE2 A;  1N6D A;  1UYT A;  4FJW D;  2CBY A;  1XO6 A;  4IZD A;  4NNQ A;  3M6N A;  1NZY A;  1TYF A;  1ON3 A;  3SLL A;  2QQ3 A;  5ING A;  1UYV A;  2EJ5 A;  4Z0M A;  4HNK A;  4ZDE A;  3KTJ A;  3KQF A;  4EML A;  3V5I A;  3HLN 1;  4B3H A;  3Q7H A;  4RYF H;  2VSS F;  2WTB A;  1Y7O A;  3RSI A;  5DUF A;  4JOT A;  5DZK A;  1FC7 A;  3BPP A;  4U18 A;  3Q0J A;  4FND A;  4GM2 A;  1HZD A;  2VSS A;  2VSS E;  1O8U A;  3HRX A;  3OC7 A;  3DOR A;  3M6M A;  2D3T A;  4KNP A;  2VSU C;  2F6I A;  3GKB A;  3FF6 A;  3K8X A;  5C90 A;  4EMP A;  1SZO A;  4JJT A;  3K50 A;  1WDK A;  2Q35 A;  2F9Y B;  2CE3 A;  4K2N A;  5C9G A;  3TVU A;  3Q0G A;  1X0U A;  5DU8 A;  1FCF A;  5DZK H;  3QRE A;  4ZDC A;  5KDR A;  3OT6 A;  1MJ3 A;  5DKP A;  3V5E A;  3H0J A;  4ZDD A;  2ZL2 A;  3TLF A;  3H0S A;  4JVT A;  3T3W A;  4RYF A;  3TDC A;  2VSU E;  4OG1 A;  2Q2X A;  4MI2 A;  3MFM A;  3T89 A;  2GTR A;  2ZQR A;  1N6E A;  4Q0G A;  5DTW A;  2HW5 A;  4NEK A;  5JBW A;  1XNV A;  4MOU A;  4U0G A;  4KWB A;  2PG8 A;  4Q1I A;  4L8K A;  1UYR A;  5CTC A;  3HP0 A;  3R9Q A;  2FZS A;  1J7X A;  5DTP A;  3H0Q A;  2UZF A;  1RJN A;  4JCQ A;  3T88 A;  3FDU A;  4KD6 A;  1FC6 A;  3LAO A;  4OLQ A;  4U19 A;  2ZL3 A;  3TT6 A;  3GF7 A;  4YLH A;  4JFC A;  4B3J A;  5CTB A;  3MOY A;  3P5M A;  3G64 A;  2A7K A;  1JXZ A;  5MGB A;  5INF A;  1K39 A;  3PE8 A;  3TV5 A;  2VSU A;  3LKE A;  1W2X A;  2DEO A;  2X24 A;  4FZW A;  3TZ3 A;  5FUS A;  5G1Q A;  4DI1 A;  1YG6 A;  1EY3 A;  4FN8 A;  5DU4 A;  5INI A;  3N6R B;  1ON9 A;  3QYR A;  2ZL4 A;  3DJA A;  3QMJ A;  4MXI A;  4ELW A;  4JCS A;  2C8T A;  4JCR A;  4ZDF A;  1EF9 A;  4KPK A;  4EMM A;  1SG4 A;  2F6Q A;  2PBP A;  3RRV A;  3HIN A;  3PGQ A;  2J5I I;  2ZL0 A;  2A7S A;  1VRG A;  3P2L A;  3KTG A;  4OMR A;  3NJD A;  3GMA A;  4I52 A;  1HNU A;  1N6F A;  2J5G A;  2IEX A;  3QXZ A;  2F9Y A;  4FNB A;  4RCN A;  5DL1 A;  1XX4 A;  3H02 A;  1UYS A;  5G1R A;  4U0H A;  3QKA A;  2A81 A;  4U1A A;  3ZWA A;  3ST9 A;  3U9T B;  4HC8 A;  5IKL B;  3TRR A;  4QII A;  4JYJ A;  5FIF A;  1OD2 A;  4ELX A;  4WCZ A;  1K32 A;  4GHN A;  3ZWC A;  3WG5 A;  5G1S A;  3L3S A;  2X58 A;  4LK5 A;  1FC9 A;  2BZR A;  4QFE A;  3NJB A;  3U9R B;  4QIJ A;  3KTK A;  3OME A;  4U0G H;  3PEA A;  5E0S H;  4IZB A;  3JU1 A;  4F47 A;  3MYB A;  2F9I B;  4K3W A;  4I4Z A;  3QK8 A;  2J5S A;  4JCT A;  4I42 A;  2F9I A;  3KTI A;  4L6W A;  3QWD A;  3BEZ A;  3VIV A;  4JWV A;  1YG8 A;  4WZ8 B;  2VSU F;  4ELS A;  1Q51 A;  4ZDB A;  1PJH A;  3PZK A;  3P85 A;  3I47 A;  5E0S A;  2VX2 A;  1DCI A;  3ZW9 A;  1XNW A;  1DUB A;  4FZW C;  3T8B A;  3TVW A;  4B3I A;  5KJP A;  5E0N X;  3R0O A;  1TG6 A;  4JYL A;  4WYO B;  1UIY A;  5DU6 A;  2VRE A;  1PIX A;  4FB8 A;  3GLM A;  3BF0 A;  1HNO A;  2DUB A;  3U9S B;  3GF3 A; 
#chains in the Genus database with same CATH topology
 2FBM A;  2FW2 A;  4ASI A;  4K29 A;  3R9S A;  1WDL A;  1WZ8 A;  5DUC A;  3ISA A;  2Q34 A;  2J5I B;  1Q52 A;  1OD4 A;  4JSB A;  3STA A;  3MT6 A;  3R6H A;  2J5I A;  3RST A;  2NP9 A;  3IAV A;  3QXI A;  2PPY A;  3TT7 A;  3H81 A;  5KDR B;  3H0U A;  3SWX A;  1XNY A;  3KTH A;  3Q1T A;  2ZQQ A;  1RJM A;  4IZC A;  3T8A A;  4ZU2 A;  4G2R A;  2W3P A;  1EF8 A;  3R9T A;  5JBX A;  3IB9 A;  2J5G D;  1WDM A;  3ZW8 A;  3ZWB A;  4FN7 A;  3IBB A;  1NZY B;  3HE2 A;  1N6D A;  1UYT A;  4FJW D;  2CBY A;  1XO6 A;  4IZD A;  4NNQ A;  3M6N A;  1NZY A;  1TYF A;  1ON3 A;  3SLL A;  2QQ3 A;  5ING A;  1UYV A;  2EJ5 A;  4Z0M A;  4HNK A;  4ZDE A;  3KTJ A;  3KQF A;  4EML A;  3V5I A;  3BPT A;  3HLN 1;  4B3H A;  3Q7H A;  4RYF H;  2VSS F;  2WTB A;  1Y7O A;  3RSI A;  5DUF A;  4JOT A;  5DZK A;  1FC7 A;  3BPP A;  4U18 A;  3Q0J A;  4FND A;  4GM2 A;  1HZD A;  2VSS A;  2VSS E;  1O8U A;  3HRX A;  3OC7 A;  3DOR A;  3M6M A;  2D3T A;  4KNP A;  2VSU C;  2F6I A;  3GKB A;  3FF6 A;  3K8X A;  5C90 A;  4EMP A;  1SZO A;  4JJT A;  3K50 A;  1WDK A;  2Q35 A;  2F9Y B;  2CE3 A;  4K2N A;  5C9G A;  3TVU A;  3Q0G A;  1X0U A;  5DU8 A;  5HUQ A;  1FCF A;  5DZK H;  3QRE A;  4ZDC A;  5KDR A;  3OT6 A;  1MJ3 A;  5DKP A;  3V5E A;  3H0J A;  4ZDD A;  2ZL2 A;  3TLF A;  3H0S A;  4JVT A;  3T3W A;  4RYF A;  3TDC A;  2VSU E;  4OG1 A;  2Q2X A;  4MI2 A;  3MFM A;  3T89 A;  2GTR A;  2ZQR A;  1N6E A;  4HDT A;  4Q0G A;  5DTW A;  2HW5 A;  4NEK A;  5JBW A;  1XNV A;  4MOU A;  4U0G A;  4KWB A;  2PG8 A;  4Q1I A;  4L8K A;  1UYR A;  5CTC A;  3HP0 A;  3R9Q A;  2FZS A;  1J7X A;  5DTP A;  3H0Q A;  2UZF A;  1RJN A;  4JCQ A;  3T88 A;  3FDU A;  4KD6 A;  1FC6 A;  3LAO A;  4OLQ A;  4U19 A;  2ZL3 A;  3TT6 A;  3GF7 A;  4YLH A;  4JFC A;  4B3J A;  5CTB A;  3MOY A;  3P5M A;  3G64 A;  2A7K A;  1JXZ A;  5MGB A;  5INF A;  1K39 A;  3PE8 A;  3TV5 A;  2VSU A;  3LKE A;  2YJG A;  1W2X A;  2DEO A;  2X24 A;  4FZW A;  3TZ3 A;  5FUS A;  5G1Q A;  4DI1 A;  1YG6 A;  1EY3 A;  4FN8 A;  5DU4 A;  5INI A;  3N6R B;  1ON9 A;  3QYR A;  2ZL4 A;  3DJA A;  4NAR A;  3QMJ A;  4MXI A;  4ELW A;  4JCS A;  2C8T A;  4JCR A;  4ZDF A;  1EF9 A;  4KPK A;  4EMM A;  1SG4 A;  2F6Q A;  2PBP A;  3RRV A;  3HIN A;  3PGQ A;  2J5I I;  2ZL0 A;  2A7S A;  1VRG A;  3P2L A;  3KTG A;  4OMR A;  3NJD A;  3GMA A;  4I52 A;  1HNU A;  1N6F A;  2J5G A;  2IEX A;  3QXZ A;  2F9Y A;  4FNB A;  4RCN A;  5DL1 A;  1XX4 A;  3H02 A;  1UYS A;  5G1R A;  4U0H A;  3QKA A;  2A81 A;  4U1A A;  3ZWA A;  3ST9 A;  3U9T B;  4HC8 A;  5IKL B;  3TRR A;  4QII A;  4JYJ A;  5FIF A;  1OD2 A;  4ELX A;  4WCZ A;  1K32 A;  4GHN A;  3ZWC A;  3WG5 A;  5G1S A;  3L3S A;  2X58 A;  4LK5 A;  1FC9 A;  2BZR A;  4QFE A;  3NJB A;  3U9R B;  4QIJ A;  3KTK A;  3OME A;  4U0G H;  3PEA A;  5E0S H;  4IZB A;  3JU1 A;  4F47 A;  3MYB A;  2F9I B;  4K3W A;  4I4Z A;  3QK8 A;  2J5S A;  4JCT A;  4I42 A;  2F9I A;  3KTI A;  4L6W A;  3QWD A;  3BEZ A;  3VIV A;  4JWV A;  1YG8 A;  4WZ8 B;  2VSU F;  4ELS A;  1Q51 A;  4ZDB A;  1PJH A;  3PZK A;  3P85 A;  3I47 A;  5E0S A;  2VX2 A;  1DCI A;  3ZW9 A;  1XNW A;  1DUB A;  4FZW C;  3T8B A;  3TVW A;  4B3I A;  5KJP A;  5E0N X;  3R0O A;  1TG6 A;  4J2U A;  4JYL A;  4WYO B;  1UIY A;  5DU6 A;  2VRE A;  1PIX A;  4FB8 A;  3GLM A;  3BF0 A;  1HNO A;  2DUB A;  3U9S B;  3GF3 A; 
#chains in the Genus database with same CATH homology
 2FBM A;  2FW2 A;  4ASI A;  4K29 A;  3R9S A;  1WDL A;  1WZ8 A;  5DUC A;  3ISA A;  2Q34 A;  2J5I B;  1Q52 A;  1OD4 A;  4JSB A;  3STA A;  3MT6 A;  3R6H A;  2J5I A;  3RST A;  2NP9 A;  3IAV A;  3QXI A;  2PPY A;  3TT7 A;  3H81 A;  5KDR B;  3H0U A;  3SWX A;  1XNY A;  3KTH A;  3Q1T A;  2ZQQ A;  1RJM A;  4IZC A;  3T8A A;  4ZU2 A;  4G2R A;  2W3P A;  1EF8 A;  3R9T A;  5JBX A;  3IB9 A;  2J5G D;  1WDM A;  3ZW8 A;  3ZWB A;  4FN7 A;  3IBB A;  1NZY B;  3HE2 A;  1N6D A;  1UYT A;  4FJW D;  2CBY A;  1XO6 A;  4IZD A;  4NNQ A;  3M6N A;  1NZY A;  1TYF A;  1ON3 A;  3SLL A;  2QQ3 A;  5ING A;  1UYV A;  2EJ5 A;  4Z0M A;  4HNK A;  4ZDE A;  3KTJ A;  3KQF A;  4EML A;  3V5I A;  3BPT A;  3HLN 1;  4B3H A;  3Q7H A;  4RYF H;  2VSS F;  2WTB A;  1Y7O A;  3RSI A;  5DUF A;  4JOT A;  5DZK A;  1FC7 A;  3BPP A;  4U18 A;  3Q0J A;  4FND A;  4GM2 A;  1HZD A;  2VSS A;  2VSS E;  1O8U A;  3HRX A;  3OC7 A;  3DOR A;  3M6M A;  2D3T A;  4KNP A;  2VSU C;  2F6I A;  3GKB A;  3FF6 A;  3K8X A;  5C90 A;  4EMP A;  1SZO A;  4JJT A;  3K50 A;  1WDK A;  2Q35 A;  2F9Y B;  2CE3 A;  4K2N A;  5C9G A;  3TVU A;  3Q0G A;  1X0U A;  5DU8 A;  5HUQ A;  1FCF A;  5DZK H;  3QRE A;  4ZDC A;  5KDR A;  3OT6 A;  1MJ3 A;  5DKP A;  3V5E A;  3H0J A;  4ZDD A;  2ZL2 A;  3TLF A;  3H0S A;  4JVT A;  3T3W A;  4RYF A;  3TDC A;  2VSU E;  4OG1 A;  2Q2X A;  4MI2 A;  3MFM A;  3T89 A;  2GTR A;  2ZQR A;  1N6E A;  4HDT A;  4Q0G A;  5DTW A;  2HW5 A;  4NEK A;  5JBW A;  1XNV A;  4MOU A;  4U0G A;  4KWB A;  2PG8 A;  4Q1I A;  4L8K A;  1UYR A;  5CTC A;  3HP0 A;  3R9Q A;  2FZS A;  1J7X A;  5DTP A;  3H0Q A;  2UZF A;  1RJN A;  4JCQ A;  3T88 A;  3FDU A;  4KD6 A;  1FC6 A;  3LAO A;  4OLQ A;  4U19 A;  2ZL3 A;  3TT6 A;  3GF7 A;  4YLH A;  4JFC A;  4B3J A;  5CTB A;  3MOY A;  3P5M A;  3G64 A;  2A7K A;  1JXZ A;  5MGB A;  5INF A;  1K39 A;  3PE8 A;  3TV5 A;  2VSU A;  3LKE A;  2YJG A;  1W2X A;  2DEO A;  2X24 A;  4FZW A;  3TZ3 A;  5FUS A;  5G1Q A;  4DI1 A;  1YG6 A;  1EY3 A;  4FN8 A;  5DU4 A;  5INI A;  3N6R B;  1ON9 A;  3QYR A;  2ZL4 A;  3DJA A;  4NAR A;  3QMJ A;  4MXI A;  4ELW A;  4JCS A;  2C8T A;  4JCR A;  4ZDF A;  1EF9 A;  4KPK A;  4EMM A;  1SG4 A;  2F6Q A;  2PBP A;  3RRV A;  3HIN A;  3PGQ A;  2J5I I;  2ZL0 A;  2A7S A;  1VRG A;  3P2L A;  3KTG A;  4OMR A;  3NJD A;  3GMA A;  4I52 A;  1HNU A;  1N6F A;  2J5G A;  2IEX A;  3QXZ A;  2F9Y A;  4FNB A;  4RCN A;  5DL1 A;  1XX4 A;  3H02 A;  1UYS A;  5G1R A;  4U0H A;  3QKA A;  2A81 A;  4U1A A;  3ZWA A;  3ST9 A;  3U9T B;  4HC8 A;  5IKL B;  3TRR A;  4QII A;  4JYJ A;  5FIF A;  1OD2 A;  4ELX A;  4WCZ A;  1K32 A;  4GHN A;  3ZWC A;  3WG5 A;  5G1S A;  3L3S A;  2X58 A;  4LK5 A;  1FC9 A;  2BZR A;  4QFE A;  3NJB A;  3U9R B;  4QIJ A;  3KTK A;  3OME A;  4U0G H;  3PEA A;  5E0S H;  4IZB A;  3JU1 A;  4F47 A;  3MYB A;  2F9I B;  4K3W A;  4I4Z A;  3QK8 A;  2J5S A;  4JCT A;  4I42 A;  2F9I A;  3KTI A;  4L6W A;  3QWD A;  3BEZ A;  3VIV A;  4JWV A;  1YG8 A;  4WZ8 B;  2VSU F;  4ELS A;  1Q51 A;  4ZDB A;  1PJH A;  3PZK A;  3P85 A;  3I47 A;  5E0S A;  2VX2 A;  1DCI A;  3ZW9 A;  1XNW A;  1DUB A;  4FZW C;  3T8B A;  3TVW A;  4B3I A;  5KJP A;  5E0N X;  3R0O A;  1TG6 A;  4J2U A;  4JYL A;  4WYO B;  1UIY A;  5DU6 A;  2VRE A;  1PIX A;  4FB8 A;  3GLM A;  3BF0 A;  1HNO A;  2DUB A;  3U9S B;  3GF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...