4JCTA

Clpp2 from listeria monocytogenes
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
184
Chain Sequence
LIPTVIEAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into caseinolytic proteases reveal an unprecedented regulation principle of their catalytic triad.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 63
structure length 184
sequence length 191
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4jctA00
4JYLA 5DZKH 2EJ5A 2Q2XA 1SZOA 5KDRB 5G1QA 3GF3A 4JSBA 4ASIA 4RYFH 4NEKA 3WG5A 4GHNA 3P85A 3HP0A 3BF0A 3LAOA 1XO6A 1SG4A 4KNPA 1FCFA 3KTGA 5CTCA 2F9YA 4MOUA 1MJ3A 4ZDDA 3R6HA 1XNVA 1O8UA 1TYFA 1YG8A 2BZRA 4YLHA 5KJPA 5E0SH 4ELSA 4WZ8B 1DCIA 1UYTA 3TV5A 1N6DA 4B3HA 3P5MA 4B3IA 3VIVA 1UIYA 2J5IA 3OT6A 2DEOA 1EY3A 4MI2A 3HE2A 5JBXA 1Y7OA 1XNYA 4IZBA 1UYVA 3H0JA 2A7KA 4ELWA 4IZCA 5KDRA 1WDLA 4ZDFA 2VSUF 1RJMA 4G2RA 3M6MA 3GLMA 4RYFA 2CBYA 2PG8A 3T8AA 4JJTA 4LK5A 3OC7A 2CE3A 2HW5A 2UZFA 3PGQA 3JU1A 3KQFA 1VRGA 5IKLB 3PEAA 1EF9A 3LKEA 2NP9A 4K3WA 4KD6A 3GF7A 3RSIA 5MGBA 3QKAA 3GMAA 4JCRA 2ZL4A 1WZ8A 1NZYB 2W3PA 4K2NA 3ZWBA 2VSSE 5G1RA 3HINA 3HRXA 1W2XA 3NJBA 5DL1A 3DORA 3T89A 2A7SA 3QXZA 1N6EA 5G1SA 3H02A 4RCNA 3TZ3A 2J5GD 2Q34A 4JWVA 3IB9A 4OG1A 3R9SA 5FUSA 4DI1A 3ZW8A 2X24A 4FJWD 2D3TA 2J5SA 5E0SA 3ISAA 2F6IA 4WCZA 4QFEA 4QIIA 4Z0MA 2ZQRA 4KWBA 1K39A 3IBBA 5DTWA 4GM2A 4K29A 1X0UA 3H0QA 1ON3A 3STAA 3Q0JA 1UYRA 1RJNA 4FN8A 3ZWAA 5JBWA 4JYJA 5DTPA 2FW2A 3K8XA 3T8BA 4EMLA 3Q0GA 1YG6A 2F9YB 3MFMA 4ZDCA 3SLLA 3GKBA 3U9RB 1UYSA 1Q52A 1PJHA 4HNKA 3RSTA 3V5EA 2GTRA 4I52A 3BEZA 4WYOB 5FIFA 3MOYA 2J5IB 4JVTA 4FB8A 1TG6A 3NJDA 3H81A 1Q51A 2FBMA 3KTKA 4FNDA 4FZWC 4FN7A 4Q0GA 2VREA 3TDCA 1WDKA 3KTJA 3ZWCA 4OLQA 2ZL2A 3PZKA 1K32A 4EMMA 3Q1TA 2Q35A 2VSUA 1EF8A 1JXZA 5DUFA 2J5GA 2ZL0A 4L8KA 3FF6A 4U0HA 2FZSA 3KTHA 4FNBA 3L3SA 3T88A 2IEXA 3G64A 3QMJA 4EMPA 4NNQA 2QQ3A 2VSUC 3HLN1 4JOTA 3TT6A 3ST9A 1FC9A 3ZW9A 1FC7A 5C9GA 3SWXA 3QREA 4ZDBA 3U9SB 5DKPA 2DUBA 1XX4A 1ON9A 3MT6A 4ELXA 5INFA 3TLFA 3TVWA 1DUBA 3Q7HA 2C8TA 1WDMA 4Q1IA 4KPKA 3QK8A 3R9QA 3I47A 4ZDEA 4JFCA 5E0NX 3QWDA 4JCQA 3R0OA 2WTBA 1OD4A 2X58A 2VSUE 3M6NA 4F47A 4L6WA 5DU8A 4MXIA 3KTIA 2F9IB 1NZYA 4IZDA 4U18A 2A81A 1HZDA 5INGA 2PBPA 3PE8A 3TRRA 4FZWA 4B3JA 2ZQQA 3BPPA 3N6RB 5CTBA 3R9TA 5C90A 3H0UA 4U0GH 3IAVA 3MYBA 1FC6A 2PPYA 5DU6A 4JCTA 1OD2A 3K50A 3T3WA 3P2LA 2VSSF 2VX2A 2ZL3A 3U9TB 1HNUA 5DZKA 3V5IA 1PIXA 5DUCA 3FDUA 3QXIA 2F6QA 4U1AA 2VSSA 4I42A 4U19A 3H0SA 1XNWA 3TVUA 3OMEA 1N6FA 2J5II 4U0GA 3RRVA 4QIJA 1HNOA 3QYRA 5DU4A 3DJAA 5INIA 4OMRA 4JCSA 3TT7A 4I4ZA 1J7XA 2F9IA 4ZU2A 4HC8A
chains in the Genus database with same CATH superfamily
4JYLA 5DZKH 2EJ5A 2Q2XA 1SZOA 5KDRB 5G1QA 3GF3A 4JSBA 4ASIA 4RYFH 4NEKA 3WG5A 4GHNA 3P85A 3HP0A 3BF0A 3LAOA 1XO6A 1SG4A 4KNPA 1FCFA 3KTGA 5CTCA 2F9YA 4MOUA 1MJ3A 4ZDDA 3R6HA 1XNVA 1O8UA 1TYFA 1YG8A 2BZRA 4YLHA 5KJPA 2YJGA 5E0SH 4ELSA 4WZ8B 1DCIA 1UYTA 3TV5A 1N6DA 4B3HA 3P5MA 4B3IA 3VIVA 1UIYA 2J5IA 3OT6A 5HUQA 2DEOA 1EY3A 4MI2A 3HE2A 5JBXA 1Y7OA 1XNYA 4IZBA 1UYVA 3H0JA 2A7KA 4ELWA 4IZCA 5KDRA 1WDLA 4ZDFA 2VSUF 1RJMA 4G2RA 3M6MA 3GLMA 4RYFA 2CBYA 2PG8A 3T8AA 4JJTA 4LK5A 3OC7A 2CE3A 2HW5A 2UZFA 3PGQA 3JU1A 3KQFA 1VRGA 5IKLB 3PEAA 1EF9A 3LKEA 2NP9A 4K3WA 4KD6A 3GF7A 4J2UA 3RSIA 5MGBA 3QKAA 3GMAA 4JCRA 2ZL4A 1WZ8A 1NZYB 2W3PA 4K2NA 3ZWBA 2VSSE 5G1RA 3HINA 3HRXA 1W2XA 3NJBA 5DL1A 3DORA 3T89A 2A7SA 3QXZA 1N6EA 5G1SA 3H02A 4RCNA 3TZ3A 2J5GD 2Q34A 4JWVA 4HDTA 3IB9A 4OG1A 3R9SA 5FUSA 4DI1A 3ZW8A 2X24A 4FJWD 2D3TA 2J5SA 5E0SA 3ISAA 2F6IA 4WCZA 4QFEA 4QIIA 4Z0MA 2ZQRA 4KWBA 1K39A 3IBBA 5DTWA 4GM2A 4K29A 1X0UA 3H0QA 1ON3A 3STAA 3Q0JA 1UYRA 1RJNA 4FN8A 3ZWAA 5JBWA 4JYJA 5DTPA 2FW2A 3K8XA 3T8BA 4EMLA 3Q0GA 1YG6A 2F9YB 3MFMA 4ZDCA 3SLLA 3GKBA 3U9RB 1UYSA 1Q52A 1PJHA 4HNKA 3RSTA 3V5EA 2GTRA 4I52A 3BEZA 4WYOB 5FIFA 3MOYA 2J5IB 4JVTA 4FB8A 1TG6A 3NJDA 3H81A 1Q51A 2FBMA 3KTKA 4FNDA 4FZWC 4FN7A 4Q0GA 2VREA 3TDCA 1WDKA 3KTJA 3ZWCA 4OLQA 2ZL2A 3PZKA 1K32A 4EMMA 3Q1TA 2Q35A 2VSUA 1EF8A 1JXZA 5DUFA 2J5GA 2ZL0A 4L8KA 3FF6A 4U0HA 2FZSA 3KTHA 4FNBA 3L3SA 3T88A 2IEXA 3G64A 3QMJA 4EMPA 4NNQA 2QQ3A 2VSUC 3HLN1 4JOTA 3TT6A 3ST9A 1FC9A 3ZW9A 1FC7A 5C9GA 3SWXA 3QREA 4ZDBA 3U9SB 5DKPA 2DUBA 1XX4A 1ON9A 3MT6A 4ELXA 5INFA 3TLFA 3TVWA 1DUBA 3Q7HA 2C8TA 1WDMA 4Q1IA 4KPKA 3QK8A 3R9QA 3I47A 4ZDEA 4JFCA 5E0NX 3QWDA 4JCQA 3R0OA 2WTBA 1OD4A 2X58A 2VSUE 3M6NA 4F47A 4L6WA 5DU8A 4MXIA 3KTIA 2F9IB 1NZYA 4IZDA 4U18A 2A81A 1HZDA 5INGA 2PBPA 3PE8A 3TRRA 4FZWA 4B3JA 2ZQQA 3BPPA 3N6RB 5CTBA 3R9TA 5C90A 3H0UA 4U0GH 3IAVA 3MYBA 1FC6A 2PPYA 5DU6A 4JCTA 1OD2A 3K50A 3T3WA 3P2LA 2VSSF 2VX2A 4NARA 2ZL3A 3U9TB 1HNUA 5DZKA 3V5IA 1PIXA 5DUCA 3FDUA 3QXIA 2F6QA 4U1AA 2VSSA 4I42A 4U19A 3H0SA 1XNWA 3TVUA 3OMEA 1N6FA 4U0GA 2J5II 3BPTA 3RRVA 4QIJA 1HNOA 3QYRA 5DU4A 3DJAA 5INIA 4OMRA 4JCSA 3TT7A 4I4ZA 1J7XA 2F9IA 4ZU2A 4HC8A
chains in the Genus database with same CATH topology
4JYLA 5DZKH 2EJ5A 2Q2XA 1SZOA 5KDRB 5G1QA 3GF3A 4JSBA 4ASIA 4RYFH 4NEKA 3WG5A 4GHNA 3P85A 3HP0A 3BF0A 3LAOA 1XO6A 1SG4A 4KNPA 1FCFA 3KTGA 5CTCA 2F9YA 4MOUA 1MJ3A 4ZDDA 3R6HA 1XNVA 1O8UA 1TYFA 1YG8A 2BZRA 4YLHA 5KJPA 2YJGA 5E0SH 4ELSA 4WZ8B 1DCIA 1UYTA 3TV5A 1N6DA 4B3HA 3P5MA 4B3IA 3VIVA 1UIYA 2J5IA 3OT6A 5HUQA 2DEOA 1EY3A 4MI2A 3HE2A 5JBXA 1Y7OA 1XNYA 4IZBA 1UYVA 3H0JA 2A7KA 4ELWA 4IZCA 5KDRA 1WDLA 4ZDFA 2VSUF 1RJMA 4G2RA 3M6MA 3GLMA 4RYFA 2CBYA 2PG8A 3T8AA 4JJTA 4LK5A 3OC7A 2CE3A 2HW5A 2UZFA 3PGQA 3JU1A 3KQFA 1VRGA 5IKLB 3PEAA 1EF9A 3LKEA 2NP9A 4K3WA 4KD6A 3GF7A 4J2UA 3RSIA 5MGBA 3QKAA 3GMAA 4JCRA 2ZL4A 1WZ8A 1NZYB 2W3PA 4K2NA 3ZWBA 2VSSE 5G1RA 3HINA 3HRXA 1W2XA 3NJBA 5DL1A 3DORA 3T89A 2A7SA 3QXZA 1N6EA 5G1SA 3H02A 4RCNA 3TZ3A 2J5GD 2Q34A 4JWVA 4HDTA 3IB9A 4OG1A 3R9SA 5FUSA 4DI1A 3ZW8A 2X24A 4FJWD 2D3TA 2J5SA 5E0SA 3ISAA 2F6IA 4WCZA 4QFEA 4QIIA 4Z0MA 2ZQRA 4KWBA 1K39A 3IBBA 5DTWA 4GM2A 4K29A 1X0UA 3H0QA 1ON3A 3STAA 3Q0JA 1UYRA 1RJNA 4FN8A 3ZWAA 5JBWA 4JYJA 5DTPA 2FW2A 3K8XA 3T8BA 4EMLA 3Q0GA 1YG6A 2F9YB 3MFMA 4ZDCA 3SLLA 3GKBA 3U9RB 1UYSA 1Q52A 1PJHA 4HNKA 3RSTA 3V5EA 2GTRA 4I52A 3BEZA 4WYOB 5FIFA 3MOYA 2J5IB 4JVTA 4FB8A 1TG6A 3NJDA 3H81A 1Q51A 2FBMA 3KTKA 4FNDA 4FZWC 4FN7A 4Q0GA 2VREA 3TDCA 1WDKA 3KTJA 3ZWCA 4OLQA 2ZL2A 3PZKA 1K32A 4EMMA 3Q1TA 2Q35A 2VSUA 1EF8A 1JXZA 5DUFA 2J5GA 2ZL0A 4L8KA 3FF6A 4U0HA 2FZSA 3KTHA 4FNBA 3L3SA 3T88A 2IEXA 3G64A 3QMJA 4EMPA 4NNQA 2QQ3A 2VSUC 3HLN1 4JOTA 3TT6A 3ST9A 1FC9A 3ZW9A 1FC7A 5C9GA 3SWXA 3QREA 4ZDBA 3U9SB 5DKPA 2DUBA 1XX4A 1ON9A 3MT6A 4ELXA 5INFA 3TLFA 3TVWA 1DUBA 3Q7HA 2C8TA 1WDMA 4Q1IA 4KPKA 3QK8A 3R9QA 3I47A 4ZDEA 4JFCA 5E0NX 3QWDA 4JCQA 3R0OA 2WTBA 1OD4A 2X58A 2VSUE 3M6NA 4F47A 4L6WA 5DU8A 4MXIA 3KTIA 2F9IB 1NZYA 4IZDA 4U18A 2A81A 1HZDA 5INGA 2PBPA 3PE8A 3TRRA 4FZWA 4B3JA 2ZQQA 3BPPA 3N6RB 5CTBA 3R9TA 5C90A 3H0UA 4U0GH 3IAVA 3MYBA 1FC6A 2PPYA 5DU6A 4JCTA 1OD2A 3K50A 3T3WA 3P2LA 2VSSF 2VX2A 4NARA 2ZL3A 3U9TB 1HNUA 5DZKA 3V5IA 1PIXA 5DUCA 3FDUA 3QXIA 2F6QA 4U1AA 2VSSA 4I42A 4U19A 3H0SA 1XNWA 3TVUA 3OMEA 1N6FA 4U0GA 2J5II 3BPTA 3RRVA 4QIJA 1HNOA 3QYRA 5DU4A 3DJAA 5INIA 4OMRA 4JCSA 3TT7A 4I4ZA 1J7XA 2F9IA 4ZU2A 4HC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYL A;  5DZK H;  2EJ5 A;  2Q2X A;  1SZO A;  5KDR B;  5G1Q A;  3GF3 A;  4JSB A;  4ASI A;  4RYF H;  4NEK A;  3WG5 A;  4GHN A;  3P85 A;  3HP0 A;  3BF0 A;  3LAO A;  1XO6 A;  1SG4 A;  4KNP A;  1FCF A;  3KTG A;  5CTC A;  2F9Y A;  4MOU A;  1MJ3 A;  4ZDD A;  3R6H A;  1XNV A;  1O8U A;  1TYF A;  1YG8 A;  2BZR A;  4YLH A;  5KJP A;  5E0S H;  4ELS A;  4WZ8 B;  1DCI A;  1UYT A;  3TV5 A;  1N6D A;  4B3H A;  3P5M A;  4B3I A;  3VIV A;  1UIY A;  2J5I A;  3OT6 A;  2DEO A;  1EY3 A;  4MI2 A;  3HE2 A;  5JBX A;  1Y7O A;  1XNY A;  4IZB A;  1UYV A;  3H0J A;  2A7K A;  4ELW A;  4IZC A;  5KDR A;  1WDL A;  4ZDF A;  2VSU F;  1RJM A;  4G2R A;  3M6M A;  3GLM A;  4RYF A;  2CBY A;  2PG8 A;  3T8A A;  4JJT A;  4LK5 A;  3OC7 A;  2CE3 A;  2HW5 A;  2UZF A;  3PGQ A;  3JU1 A;  3KQF A;  1VRG A;  5IKL B;  3PEA A;  1EF9 A;  3LKE A;  2NP9 A;  4K3W A;  4KD6 A;  3GF7 A;  3RSI A;  5MGB A;  3QKA A;  3GMA A;  4JCR A;  2ZL4 A;  1WZ8 A;  1NZY B;  2W3P A;  4K2N A;  3ZWB A;  2VSS E;  5G1R A;  3HIN A;  3HRX A;  1W2X A;  3NJB A;  5DL1 A;  3DOR A;  3T89 A;  2A7S A;  3QXZ A;  1N6E A;  5G1S A;  3H02 A;  4RCN A;  3TZ3 A;  2J5G D;  2Q34 A;  4JWV A;  3IB9 A;  4OG1 A;  3R9S A;  5FUS A;  4DI1 A;  3ZW8 A;  2X24 A;  4FJW D;  2D3T A;  2J5S A;  5E0S A;  3ISA A;  2F6I A;  4WCZ A;  4QFE A;  4QII A;  4Z0M A;  2ZQR A;  4KWB A;  1K39 A;  3IBB A;  5DTW A;  4GM2 A;  4K29 A;  1X0U A;  3H0Q A;  1ON3 A;  3STA A;  3Q0J A;  1UYR A;  1RJN A;  4FN8 A;  3ZWA A;  5JBW A;  4JYJ A;  5DTP A;  2FW2 A;  3K8X A;  3T8B A;  4EML A;  3Q0G A;  1YG6 A;  2F9Y B;  3MFM A;  4ZDC A;  3SLL A;  3GKB A;  3U9R B;  1UYS A;  1Q52 A;  1PJH A;  4HNK A;  3RST A;  3V5E A;  2GTR A;  4I52 A;  3BEZ A;  4WYO B;  5FIF A;  3MOY A;  2J5I B;  4JVT A;  4FB8 A;  1TG6 A;  3NJD A;  3H81 A;  1Q51 A;  2FBM A;  3KTK A;  4FND A;  4FZW C;  4FN7 A;  4Q0G A;  2VRE A;  3TDC A;  1WDK A;  3KTJ A;  3ZWC A;  4OLQ A;  2ZL2 A;  3PZK A;  1K32 A;  4EMM A;  3Q1T A;  2Q35 A;  2VSU A;  1EF8 A;  1JXZ A;  5DUF A;  2J5G A;  2ZL0 A;  4L8K A;  3FF6 A;  4U0H A;  2FZS A;  3KTH A;  4FNB A;  3L3S A;  3T88 A;  2IEX A;  3G64 A;  3QMJ A;  4EMP A;  4NNQ A;  2QQ3 A;  2VSU C;  3HLN 1;  4JOT A;  3TT6 A;  3ST9 A;  1FC9 A;  3ZW9 A;  1FC7 A;  5C9G A;  3SWX A;  3QRE A;  4ZDB A;  3U9S B;  5DKP A;  2DUB A;  1XX4 A;  1ON9 A;  3MT6 A;  4ELX A;  5INF A;  3TLF A;  3TVW A;  1DUB A;  3Q7H A;  2C8T A;  1WDM A;  4Q1I A;  4KPK A;  3QK8 A;  3R9Q A;  3I47 A;  4ZDE A;  4JFC A;  5E0N X;  3QWD A;  4JCQ A;  3R0O A;  2WTB A;  1OD4 A;  2X58 A;  2VSU E;  3M6N A;  4F47 A;  4L6W A;  5DU8 A;  4MXI A;  3KTI A;  2F9I B;  1NZY A;  4IZD A;  4U18 A;  2A81 A;  1HZD A;  5ING A;  2PBP A;  3PE8 A;  3TRR A;  4FZW A;  4B3J A;  2ZQQ A;  3BPP A;  3N6R B;  5CTB A;  3R9T A;  5C90 A;  3H0U A;  4U0G H;  3IAV A;  3MYB A;  1FC6 A;  2PPY A;  5DU6 A;  4JCT A;  1OD2 A;  3K50 A;  3T3W A;  3P2L A;  2VSS F;  2VX2 A;  2ZL3 A;  3U9T B;  1HNU A;  5DZK A;  3V5I A;  1PIX A;  5DUC A;  3FDU A;  3QXI A;  2F6Q A;  4U1A A;  2VSS A;  4I42 A;  4U19 A;  3H0S A;  1XNW A;  3TVU A;  3OME A;  1N6F A;  2J5I I;  4U0G A;  3RRV A;  4QIJ A;  1HNO A;  3QYR A;  5DU4 A;  3DJA A;  5INI A;  4OMR A;  4JCS A;  3TT7 A;  4I4Z A;  1J7X A;  2F9I A;  4ZU2 A;  4HC8 A; 
#chains in the Genus database with same CATH topology
 4JYL A;  5DZK H;  2EJ5 A;  2Q2X A;  1SZO A;  5KDR B;  5G1Q A;  3GF3 A;  4JSB A;  4ASI A;  4RYF H;  4NEK A;  3WG5 A;  4GHN A;  3P85 A;  3HP0 A;  3BF0 A;  3LAO A;  1XO6 A;  1SG4 A;  4KNP A;  1FCF A;  3KTG A;  5CTC A;  2F9Y A;  4MOU A;  1MJ3 A;  4ZDD A;  3R6H A;  1XNV A;  1O8U A;  1TYF A;  1YG8 A;  2BZR A;  4YLH A;  5KJP A;  2YJG A;  5E0S H;  4ELS A;  4WZ8 B;  1DCI A;  1UYT A;  3TV5 A;  1N6D A;  4B3H A;  3P5M A;  4B3I A;  3VIV A;  1UIY A;  2J5I A;  3OT6 A;  5HUQ A;  2DEO A;  1EY3 A;  4MI2 A;  3HE2 A;  5JBX A;  1Y7O A;  1XNY A;  4IZB A;  1UYV A;  3H0J A;  2A7K A;  4ELW A;  4IZC A;  5KDR A;  1WDL A;  4ZDF A;  2VSU F;  1RJM A;  4G2R A;  3M6M A;  3GLM A;  4RYF A;  2CBY A;  2PG8 A;  3T8A A;  4JJT A;  4LK5 A;  3OC7 A;  2CE3 A;  2HW5 A;  2UZF A;  3PGQ A;  3JU1 A;  3KQF A;  1VRG A;  5IKL B;  3PEA A;  1EF9 A;  3LKE A;  2NP9 A;  4K3W A;  4KD6 A;  3GF7 A;  4J2U A;  3RSI A;  5MGB A;  3QKA A;  3GMA A;  4JCR A;  2ZL4 A;  1WZ8 A;  1NZY B;  2W3P A;  4K2N A;  3ZWB A;  2VSS E;  5G1R A;  3HIN A;  3HRX A;  1W2X A;  3NJB A;  5DL1 A;  3DOR A;  3T89 A;  2A7S A;  3QXZ A;  1N6E A;  5G1S A;  3H02 A;  4RCN A;  3TZ3 A;  2J5G D;  2Q34 A;  4JWV A;  4HDT A;  3IB9 A;  4OG1 A;  3R9S A;  5FUS A;  4DI1 A;  3ZW8 A;  2X24 A;  4FJW D;  2D3T A;  2J5S A;  5E0S A;  3ISA A;  2F6I A;  4WCZ A;  4QFE A;  4QII A;  4Z0M A;  2ZQR A;  4KWB A;  1K39 A;  3IBB A;  5DTW A;  4GM2 A;  4K29 A;  1X0U A;  3H0Q A;  1ON3 A;  3STA A;  3Q0J A;  1UYR A;  1RJN A;  4FN8 A;  3ZWA A;  5JBW A;  4JYJ A;  5DTP A;  2FW2 A;  3K8X A;  3T8B A;  4EML A;  3Q0G A;  1YG6 A;  2F9Y B;  3MFM A;  4ZDC A;  3SLL A;  3GKB A;  3U9R B;  1UYS A;  1Q52 A;  1PJH A;  4HNK A;  3RST A;  3V5E A;  2GTR A;  4I52 A;  3BEZ A;  4WYO B;  5FIF A;  3MOY A;  2J5I B;  4JVT A;  4FB8 A;  1TG6 A;  3NJD A;  3H81 A;  1Q51 A;  2FBM A;  3KTK A;  4FND A;  4FZW C;  4FN7 A;  4Q0G A;  2VRE A;  3TDC A;  1WDK A;  3KTJ A;  3ZWC A;  4OLQ A;  2ZL2 A;  3PZK A;  1K32 A;  4EMM A;  3Q1T A;  2Q35 A;  2VSU A;  1EF8 A;  1JXZ A;  5DUF A;  2J5G A;  2ZL0 A;  4L8K A;  3FF6 A;  4U0H A;  2FZS A;  3KTH A;  4FNB A;  3L3S A;  3T88 A;  2IEX A;  3G64 A;  3QMJ A;  4EMP A;  4NNQ A;  2QQ3 A;  2VSU C;  3HLN 1;  4JOT A;  3TT6 A;  3ST9 A;  1FC9 A;  3ZW9 A;  1FC7 A;  5C9G A;  3SWX A;  3QRE A;  4ZDB A;  3U9S B;  5DKP A;  2DUB A;  1XX4 A;  1ON9 A;  3MT6 A;  4ELX A;  5INF A;  3TLF A;  3TVW A;  1DUB A;  3Q7H A;  2C8T A;  1WDM A;  4Q1I A;  4KPK A;  3QK8 A;  3R9Q A;  3I47 A;  4ZDE A;  4JFC A;  5E0N X;  3QWD A;  4JCQ A;  3R0O A;  2WTB A;  1OD4 A;  2X58 A;  2VSU E;  3M6N A;  4F47 A;  4L6W A;  5DU8 A;  4MXI A;  3KTI A;  2F9I B;  1NZY A;  4IZD A;  4U18 A;  2A81 A;  1HZD A;  5ING A;  2PBP A;  3PE8 A;  3TRR A;  4FZW A;  4B3J A;  2ZQQ A;  3BPP A;  3N6R B;  5CTB A;  3R9T A;  5C90 A;  3H0U A;  4U0G H;  3IAV A;  3MYB A;  1FC6 A;  2PPY A;  5DU6 A;  4JCT A;  1OD2 A;  3K50 A;  3T3W A;  3P2L A;  2VSS F;  2VX2 A;  4NAR A;  2ZL3 A;  3U9T B;  1HNU A;  5DZK A;  3V5I A;  1PIX A;  5DUC A;  3FDU A;  3QXI A;  2F6Q A;  4U1A A;  2VSS A;  4I42 A;  4U19 A;  3H0S A;  1XNW A;  3TVU A;  3OME A;  1N6F A;  4U0G A;  2J5I I;  3BPT A;  3RRV A;  4QIJ A;  1HNO A;  3QYR A;  5DU4 A;  3DJA A;  5INI A;  4OMR A;  4JCS A;  3TT7 A;  4I4Z A;  1J7X A;  2F9I A;  4ZU2 A;  4HC8 A; 
#chains in the Genus database with same CATH homology
 4JYL A;  5DZK H;  2EJ5 A;  2Q2X A;  1SZO A;  5KDR B;  5G1Q A;  3GF3 A;  4JSB A;  4ASI A;  4RYF H;  4NEK A;  3WG5 A;  4GHN A;  3P85 A;  3HP0 A;  3BF0 A;  3LAO A;  1XO6 A;  1SG4 A;  4KNP A;  1FCF A;  3KTG A;  5CTC A;  2F9Y A;  4MOU A;  1MJ3 A;  4ZDD A;  3R6H A;  1XNV A;  1O8U A;  1TYF A;  1YG8 A;  2BZR A;  4YLH A;  5KJP A;  2YJG A;  5E0S H;  4ELS A;  4WZ8 B;  1DCI A;  1UYT A;  3TV5 A;  1N6D A;  4B3H A;  3P5M A;  4B3I A;  3VIV A;  1UIY A;  2J5I A;  3OT6 A;  5HUQ A;  2DEO A;  1EY3 A;  4MI2 A;  3HE2 A;  5JBX A;  1Y7O A;  1XNY A;  4IZB A;  1UYV A;  3H0J A;  2A7K A;  4ELW A;  4IZC A;  5KDR A;  1WDL A;  4ZDF A;  2VSU F;  1RJM A;  4G2R A;  3M6M A;  3GLM A;  4RYF A;  2CBY A;  2PG8 A;  3T8A A;  4JJT A;  4LK5 A;  3OC7 A;  2CE3 A;  2HW5 A;  2UZF A;  3PGQ A;  3JU1 A;  3KQF A;  1VRG A;  5IKL B;  3PEA A;  1EF9 A;  3LKE A;  2NP9 A;  4K3W A;  4KD6 A;  3GF7 A;  4J2U A;  3RSI A;  5MGB A;  3QKA A;  3GMA A;  4JCR A;  2ZL4 A;  1WZ8 A;  1NZY B;  2W3P A;  4K2N A;  3ZWB A;  2VSS E;  5G1R A;  3HIN A;  3HRX A;  1W2X A;  3NJB A;  5DL1 A;  3DOR A;  3T89 A;  2A7S A;  3QXZ A;  1N6E A;  5G1S A;  3H02 A;  4RCN A;  3TZ3 A;  2J5G D;  2Q34 A;  4JWV A;  4HDT A;  3IB9 A;  4OG1 A;  3R9S A;  5FUS A;  4DI1 A;  3ZW8 A;  2X24 A;  4FJW D;  2D3T A;  2J5S A;  5E0S A;  3ISA A;  2F6I A;  4WCZ A;  4QFE A;  4QII A;  4Z0M A;  2ZQR A;  4KWB A;  1K39 A;  3IBB A;  5DTW A;  4GM2 A;  4K29 A;  1X0U A;  3H0Q A;  1ON3 A;  3STA A;  3Q0J A;  1UYR A;  1RJN A;  4FN8 A;  3ZWA A;  5JBW A;  4JYJ A;  5DTP A;  2FW2 A;  3K8X A;  3T8B A;  4EML A;  3Q0G A;  1YG6 A;  2F9Y B;  3MFM A;  4ZDC A;  3SLL A;  3GKB A;  3U9R B;  1UYS A;  1Q52 A;  1PJH A;  4HNK A;  3RST A;  3V5E A;  2GTR A;  4I52 A;  3BEZ A;  4WYO B;  5FIF A;  3MOY A;  2J5I B;  4JVT A;  4FB8 A;  1TG6 A;  3NJD A;  3H81 A;  1Q51 A;  2FBM A;  3KTK A;  4FND A;  4FZW C;  4FN7 A;  4Q0G A;  2VRE A;  3TDC A;  1WDK A;  3KTJ A;  3ZWC A;  4OLQ A;  2ZL2 A;  3PZK A;  1K32 A;  4EMM A;  3Q1T A;  2Q35 A;  2VSU A;  1EF8 A;  1JXZ A;  5DUF A;  2J5G A;  2ZL0 A;  4L8K A;  3FF6 A;  4U0H A;  2FZS A;  3KTH A;  4FNB A;  3L3S A;  3T88 A;  2IEX A;  3G64 A;  3QMJ A;  4EMP A;  4NNQ A;  2QQ3 A;  2VSU C;  3HLN 1;  4JOT A;  3TT6 A;  3ST9 A;  1FC9 A;  3ZW9 A;  1FC7 A;  5C9G A;  3SWX A;  3QRE A;  4ZDB A;  3U9S B;  5DKP A;  2DUB A;  1XX4 A;  1ON9 A;  3MT6 A;  4ELX A;  5INF A;  3TLF A;  3TVW A;  1DUB A;  3Q7H A;  2C8T A;  1WDM A;  4Q1I A;  4KPK A;  3QK8 A;  3R9Q A;  3I47 A;  4ZDE A;  4JFC A;  5E0N X;  3QWD A;  4JCQ A;  3R0O A;  2WTB A;  1OD4 A;  2X58 A;  2VSU E;  3M6N A;  4F47 A;  4L6W A;  5DU8 A;  4MXI A;  3KTI A;  2F9I B;  1NZY A;  4IZD A;  4U18 A;  2A81 A;  1HZD A;  5ING A;  2PBP A;  3PE8 A;  3TRR A;  4FZW A;  4B3J A;  2ZQQ A;  3BPP A;  3N6R B;  5CTB A;  3R9T A;  5C90 A;  3H0U A;  4U0G H;  3IAV A;  3MYB A;  1FC6 A;  2PPY A;  5DU6 A;  4JCT A;  1OD2 A;  3K50 A;  3T3W A;  3P2L A;  2VSS F;  2VX2 A;  4NAR A;  2ZL3 A;  3U9T B;  1HNU A;  5DZK A;  3V5I A;  1PIX A;  5DUC A;  3FDU A;  3QXI A;  2F6Q A;  4U1A A;  2VSS A;  4I42 A;  4U19 A;  3H0S A;  1XNW A;  3TVU A;  3OME A;  1N6F A;  4U0G A;  2J5I I;  3BPT A;  3RRV A;  4QIJ A;  1HNO A;  3QYR A;  5DU4 A;  3DJA A;  5INI A;  4OMR A;  4JCS A;  3TT7 A;  4I4Z A;  1J7X A;  2F9I A;  4ZU2 A;  4HC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...