4JCVE

Crystal structure of the recor complex in an open conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
214
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQESEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein RecR
publication title An 'open' structure of the RecOR complex supports ssDNA binding within the core of the complex.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
total genus 51
structure length 214
sequence length 224
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02565 RecO_C Recombination protein O C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4jcvE02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jcvE01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4jcvE03
1D8LA 2EIFA 3M3YH 3AFPA 4DV0Q 4OWTB 1X54A 3KDFA 4DV2Q 2E2JH 4L5RC 3PGZA 4LFBL 4TVAB 4UP7A 5IY0A 2GN5A 3F2DA 4X64Q 4DNIA 2D62A 2YV5A 4IPGA 3WWVA 3L2PA 1CKNA 1S72A 1NMGA 4A3EH 1XTDA 1NE3A 1O7IA 3CCSA 4QQBX 2PI2A 2GVAA 1HNZQ 4JI6L 2CKZB 5GADC 2MO1A 4PMWA 2UUCL 3HOUG 3S14H 1N32L 4AQYQ 1HJPA 4B3RL 1WFQA 4GNXB 4BY7H 3CAMA 2OQKA 1JE5A 2K5HA 3S1QH 4L5SA 1VQDA 2N8NA 2XTIA 1UE6A 3KF8B 3U58A 3PSIA 3I56A 3I4MH 1V1QA 2MNAA 4OWWB 4LF8Q 3H0GG 1EWIA 4IO9A 1Y1WG 1Z9FA 1TWHH 2I5LX 1JJGA 1YBYA 1M1KC 2CQOA 4AYBE 1XNRL 2V1CC 2F4VL 3U4ZA 1FJGL 2UU9L 1JB7A 3UDFA 4NXNQ 4YWMA 1EQQA 1SE8A 4C3HH 3K7UC 1SR3A 4DUYQ 2WB1G 3D0FA 4A93G 5M3MG 1K3RA 4LF7L 3EN2A 1SN8A 2IHEA 1Q8KA 2N78A 3S1NH 1PV4A 1X56A 5IP9H 4A3GG 1VQIA 2HQLA 3S15H 1QUQA 1KHIA 4NPSA 4YY3Q 4B3TL 4JI3L 4LW1A 1FGUA 4POFA 1CKNB 1B70B 3F2BA 4GOPB 3I4NH 2QA4A 1IBKL 1QVCA 3TREA 1IBLL 1X3FA 1Q1EA 1I50H 4LUZA 4DR3L 1PH3A 4RMFA 3HKZE 4JI1L 3PF5A 2R7FA 5FJ8H 4IPDA 4A3CG 1RL2A 4C2MH 2VUMH 4YCUA 5M3MH 3CCVA 1A62A 1Q86C 3HOXG 4JBMA 4HJ9A 5GQOA 5C44G 3KLWA 3CF5A 1MJCA 4DR1Q 4GLXA 1OXXK 4C3JH 2D0PA 2N3SA 3F8TA 3BJUA 2JA7H 4YWKA 4JI7Q 1EUJA 4B3MQ 2VL6A 4OO1G 4NXMQ 2ZJQA 4DV5L 4A3JG 2BH2A 1XPOA 1VQEA 4X66L 1I6HH 2UUBQ 3HOVG 2R93H 4GS3A 3PIOA 3D31A 5ELOA 1NY4A 4KI0A 4OWXB 4A3DG 4BBSH 4HIMA 3S17H 4LWCA 3CC7A 3W5OA 3S1RH 3BZCA 1N33L 2OTJA 1VQ4A 2VZAA 4HJ7A 1B8AA 1KD1C 2Q2TA 4JI5Q 3GO5A 4A3LH 2JA5H 4GNXC 2I0QA 4LFCQ 1YVCA 2MQHA 1CSQA 1G51A 3B6YA 4AYBG 1N9WA 4A3IG 1T9HA 4DR4L 4MNOA 2Q2HA 1Q81C 2HIVA 2EQSA 3PUZA 1KRTA 2E5LL 1VQBA 5IYDH 5GROA 3PO3H 4A3DH 1PH7A 3J80c 2Y0SE 1YNXA 3GTJH 2ZJPA 1L1OB 3SGIA 1UWVA 4DV7L 3W1GA 3J81i 4RG1A 2NN6I 4X62Q 4LF6Q 2MFIA 1XMQQ 3PUWA 2JE6I 3I7FA 4BBRG 2KHJA 3T1YQ 1CKMA 4JI0Q 3DLLA 4BXXG 3PUYA 4A3BG 4GKKQ 4IFDG 4KHPQ 5GAHC 2OQ0A 2I5HA 3HKZG 1WJJA 3M4QA 1VQ8A 4EQ5A 1E22A 2ZJRA 3K0XA 2ZM6Q 5JJLA 2UUAL 2K52A 3A0JA 3NEMA 4GNXA 2NN6G 4JI8Q 5IYBH 4LUVA 3FKIH 5IWAQ 2LSSA 4YCWA 1B7YB 4BBRH 1YJNA 1PH1A 2VY3A 1RIPA 1HNXL 1HZ9A 4OX9Q 2R92G 3IRBA 4MTNA 1Y1VH 5HY6A 3PO2G 4GN5A 3NBHB 3RN5A 1J6QA 3E0EA 5JEAG 4R4OA 5C3EG 2HHHL 3ERSX 1ASYA 2VS1A 2QGQA 5GAGC 4AQYL 1YITA 4LF4Q 4WJ4A 1TWAH 2K75A 3CMAA 1N36L 2NVYH 2UXDL 1OXTA 1MJEA 1XNQL 5FLMG 3CCRA 4DV3Q 4GLVB 3CCJA 4HIKA 4MZ9A 1IL2A 3HOZH 1A8VA 2JA8G 5LMNW 2K5NA 1PA6A 4NB3A 3UE0A 2K5VA 4A4IA 1WCMG 4Y52H 4R4IA 2ALYB 1VQHA 4EX5A 2D0OA 5IYCH 4A3FH 5LMNL 4DV1Q 3CC4A 4GOPA 1W3SA 2Y0SG 5C0XG 3RN2A 1KRSA 5DLQE 3PF4A 3UDXA 4NXNL 3K81C 1HR0Q 4HIDA 2RHSB 4LFAL 2Z6KA 1CUKA 5LMUL 2WFWA 5FLXc 2VQEL 5H1SE 3JAMc 1YJ9A 3CCLA 1Y14B 4JV5Q 4JI2Q 3U4VA 4DR6Q 2IX0A 1L1OC 1LUZA 1PVOA 1I94Q 4QJFA 2KCTA 2JQOA 3HFZB 1Z47A 5E7NA 4JOIA 4DUZL 1HNWL 1BVSA 2BA0A 1TXYA 3A5ZB 2A1AA 1E24A 4LF9L 3HOUH 3TS2A 2NVXH 3FHWA 4YHHQ 1CSPA 4UPAA 1J5EQ 3GTOH 3TRZA 1VQ6A 3GTLH 1VQ5A 4JG2A 2IX1A 1VS0A 2AWOA 1A0IA 1G291 1GKHA 4BY1G 2PQAB 2YU9H 2YTXA 3H0GH 1Y1WH 1PH5A 1U5KA 4B3SL 2B63G 4JI4Q 4LFBQ 3UDGA 3Q8DA 5AJ3L 4DK6C 4XTCS 3I55A 4B3ML 2VQFL 1S40A 1PH6A 1VQJA 4PZ8A 1X3GA 1WOCA 4KHZA 1DGSA 3G48A 4LF5L 4OO1I 1HZAA 3F1ZA 1XMOL 2KENA 4IFDJ 2BA1A 4JI6Q 3AEVA 2XGTA 3L0OA 1L1OA 4L5QA 3ICEA 3M4OH 3AYHB 1OXVA 2UUCQ 4A93H 3OYYA 5J3BA 3CCQA 1N32Q 1EOVA 2JA6G 3K80C 4ME3A 4GKJL 4B3RQ 1PYSB 3STBC 3S2DH 1HZBA 2E8GA 2JA9A 2KHIA 4QIWE 3CP0A 4A3GH 2B63H 2JJQA 5IP7G 3J80i 2KBNA 1YHQA 1KQSA 2NZHA 4X65Q 1H95A 4DR2L 3CD6A 4IJHA 4AH6A 1QVGA 2VNUD 4IOCA 1IBML 4JYAL 1FL0A 5IT9c 3W1BA 3G4SA 4A3CH 4WJ3M 4JC0A 3M9BA 2IT1A 4OONA 1XNRQ 2F4VQ 3HOXH 1FJGQ 1VQCA 2UU9Q 1LTLA 1C0AA 1GO3E 3K7AH 4X62L 5C44H 4YWLA 5BR8L 2ES2A 1VQKA 1X3EA 1IXRA 4LF7Q 4DR7L 3S2HH 4DR5L 4A3JH 4DV4L 4DV6L 2K4KA 1K73C 5HGQA 4B3TQ 3HOVH 2H5XA 4JI3Q 4IFDI 3VDYA 2IY5B 1PFSA 3GDEA 1KAWA 1KIXA 1G6PA 3HOWG 1IBKQ 4DK3C 1YEZA 1IBLQ 3UE1A 4GN3B 4DR3Q 4JI1Q 1I5FA 4UP9A 4HIOA 3BU2A 3OTOL 1Q46A 3TQYA 2NVTH 3S16H 2Q2UA 1SLJA 2Q2IA 4DAYB 4A3IH 1SFOH 3J7A5 2K14A 4LNQA 3T1HL 1U0LA 2UUAQ 1SROA 2DGYA 4UY8C 4K0KL 2ASBA 3A5UA 4R4CA 1E1TA 3JC66 1K0RA 2ZTCA 3RR5A 1X55A 1VQLA 3RLFA 3S24A 3F2CA 4DV0L 2PI2E 4DV5Q 1K83H 4GOPC 4X66Q 5C4XG 1KXLA 4DV2L 1WYDA 2PMZE 1L0WA 1P8LA 1N8RC 2B3GA 2E2HH 3KJOA 3HOYG 2Z6KC 4X64L 1N33Q 4DKAC 1JJ2A 3E9HA 1X9NA 4BXXH 1Q7YC 4A3BH 1NBWA 3CXCA 1VQGA 4QY7A 3GTMH 1LM0A 1GM5A 1YIJA 3JAMi 2A19A 4R1JA 1Q1BA 3AQQA 2UXCQ 1HNZL 2AKWB 1GVPA 4A75A 1Q82C 5C4XH 4JBJA 4JOIC 1VQFA 5C0XI 2EXDA 5M3FG 1VQPA 1R9TH 2E5LQ 1JJCB 4A3KG 4GN4B 1BBUA 3ULPA 4H02A 3GTKH 2UXBQ 4DV7Q 2R7ZG 2PQAA 3GTPH 1AH9A 4JCVE 3I2ZA 3ZJYC 4LF8L 2R92H 3PO2H 3PUXA 2CWAA 5IE8A 2L15A 4O0AA 1K9MC 5C3EH 3H3VI 4J15A 1VQNA 3CQZH 4GLAC 2OTLA 1LYLA 4JBWA 2JEBI 4A3EG 2OWOA 1EFWA 5EAYA 1HH2P 2ATWA 5FLMH 2LXKA 4A3KH 2DUDA 3G71A 4DUYL 1PHJA 4A3MG 3MXNB 1KL9A 4FDBA 2JA8H 5M5YH 1OXSC 2AHOB 1N34Q 1VCIA 2B29A 1S3OA 1WI5A 1WCMH 4R4QA 2PNHA 1HZCA 3KOJA 2QEXA 1W2BA 2R7ZH 1SMXA 4BY7G 3RLNA 3STBD 4YY3L 1GD7A 4JI4L 1VQMA 2ZTEA 1V9PA 1MKHA 3LGJA 3NELA 4HJ8A 1VQ9A 4HJAA 4QGUA 1NMFA 3ULLA 1HNXQ 2FXQA 3I4MG 3GTGH 3ER0A 1X65A 1YJWA 2NZOA 3KF6A 1TWCH 3RNUA 4A3MH 2HHHQ 1UE5A 3I4OA 2R6GA 3RLOA 2A8VA 1XJVA 5JJIA 3GD7A 5M5WH 2NVQH 1K8GA 1AE2A 1N36Q 2K50A 1I3QH 2UXDQ 1YI2A 1XNQQ 4DR1L 3PV0A 2N49A 2Z0SA 3H3VH 4O2DA 4X65L 4JI7L 5JJKA 4NXML 5IP9G 5GAEC 4IOAA 4TQUS 2UUBL 1NJIC 5LMNQ 4DAMA 2F52A 2IHFA 3CW2C 3DM3A 2JEAI 3I4NG 2MO0A 4P71A 1A63A 3PUVA 4P75A 3GTQH 4JBKA 3J7ZC 4JI5L 4R4TA 1UE1A 4LFAQ 1QVFA 4LFCL 1YHBA 3KDFB 4P72A 2RHQB 5FJ8G 2VQEQ 3TEHB 5LMUQ 4HJ5A 3MEFA 2CCZA 4BY1H 2LXJA 2VUMG 1YZ6A 4ALPA 3TS0A 1M90C 2WAQE 3A74A 1L2FA 3PCOB 2JA7G 4BA1I 1XPRA 1JMCA 3BZKA 1D7QA 3K8AA 3M85A 4DUZQ 1HNWQ 2CFMA 1AE3A 3KF6B 4LF9Q 2JA6H 2R93G 1EQRA 1IZ6A 5JEAJ 1CKOA 4POGA 2C35B 4UP8A 4LF6L 4BBSG 1XMQL 3HKSA 3NENA 3ULJA 5IP7H 1PH8A 1IYJB 2RCNA 4P73A 4XIGS 1ASZA 1VQAA 3T1YL 2WP8J 4JI0L 4A3LG 4GKKL 1QZGA 4KHPL 2JA5G 3EBEA 1PH9A 1MIUA 1BKBA 4B3SQ 2I5MX 1OTCA 3H15A 5K36G 2AWNA 5ELNA 5AJ3Q 1UE7A 3FP9A 1VQ7A 2ZM6L 4C3IH 2VQFQ 4KLKA 3CCUA 1FVIA 4LF5Q 4JI8L 5IYDG 3PO3G 1XMOQ 5C0XJ 5IWAL 3CPWA 3CCEA 4Y7NH 1E1OA 2R7DA 4OXPA 4PZ6A 4GKJQ 1X6OA 4OX9L 1E7ZA 4L5TA 1QUQB 4P74A 2OCEA 2UXCL 3KFUA 3M7NA 1OXUA 4DR2Q 1P16A 1QZHA 3HOWH 3OW2A 1PYBA 4LF4L 2KCMA 1IBMQ 1SRUA 1EIYB 4JYAQ 4YCVA 4DV3L 4LUOA 2WAQG 2UXBL 4QL5A 2HIXA 3PIPA 2GVBA 2ZTDA 4IPCA 2AMCB 3L7ZC 5IYBG 3CMEA 1NTGA 4IPHA 3UDIA 1K8AC 4PZ7A 3CCMA 3FKIG 2F3IA 3AFQA 5BR8Q 4DPGA 3J81j 4DV1L 1PH2A 1HR0W 1VQOA 2E2IH 1E3PA 4DR4Q 1UEBA 1XPUA 4DR7Q 3U50C 5M5XH 4DR5Q 1V43A 4DV4Q 4DV6Q 1TWGH 1Y1VG 1BBWA 1HR0L 2BH8A 3G6EA 4BA2I 2YTYA 1C9OA 4X6AH 4JV5L 4JI2L 3KYHC 2HT1A 1N34L 3HOYH 2JK8A 1YHAA 3EIVA 4A76A 1EYGA 3CPFA 3M4PA 3RZOH 4DR6L 1PH4A 1I94L 2RF4A 3RZDH 2YYZA 5C4JH 3OTOQ 3HOZG 2WB1E 1KC8C 1JT8A 2VW9A 2YTVA 1EIFA 3CC2A 4AIMA 3T1HQ 2ID0A 3E9IA 5IYCG 1TWFH 4A3FG 2CWPA 4PG3A 4APVA 4IJLA 3J81c 4YHHL 3KJPA 5M3FH 4K0KQ 1J5EL 1Q12A 1C7YA 3S1MH
chains in the Genus database with same CATH superfamily
3MEKA 2O4XA 5KNBA 4OWTB 2NB0A 2QW7A 4LFBL 4A24A 1SSOA 4H44C 2RDFA 2L12A 1K7VA 4M1UB 2V6EA 2L5TA 5IT9L 4IPGA 3WWVA 3L2PA 1EY4A 1BNZA 1RCVD 1KAAA 1RHPA 2K9HA 3QAHA 4QQBX 2GVAA 5F2DA 3SGQI 2B2UA 4PMWA 2F0MA 2ORVA 2AUKA 3FEWX 3MC0B 2GKRI 4WP4A 5I4DA 1JQOA 1LTSD 1DM0B 2PW5A 1AFPA 3TN2A 2N8NA 2XTIA 5IGCA 2RADA 1UE6A 2Z4HA 3CXLA 3I56A 2PZUA 4OWWB 1EWIA 1KMAA 1Z9FA 3VR4A 1TWHH 2F0KA 1YBYA 1S5CD 4Z9CB 2V1CC 3U4ZA 3TSSA 1DJRD 1FJGL 2XTQA 4DNCA 2UU9L 1JB7A 1R0RI 3UDFA 4NXNQ 3R5AA 4G57A 3OMGA 4CBVA 2RC4A 3R5BA 1QUQA 3P20A 1CM9A 4POFA 1Y8FA 1SYEA 2OD1A 2N55A 4NMZA 2BE5D 1X3FA 2NU3I 1EYAA 2EOTA 5JHWC 3KLSX 2R7FA 2WKCA 4IPDA 4FXKC 4A3CG 2VUMH 3OIPA 2JYYA 2SGQI 2ENNA 4JBMA 3HOUB 1SBBB 3VA9A 3Q6SA 5C44G 3CF5A 5CCMA 1MJCA 4DR1Q 1OXXK 4CDCC 4YWKA 2V1CA 2QQCA 1EUJA 1HFGA 2VL6A 4DV5L 1XPOA 2N71A 2A2CA 5KNDA 4HCEA 1I6HH 1XYIA 5JVG3 3HOVG 3TO6A 1A15A 5ELOA 4KI0A 2N52A 4BBSH 3HGBA 2OTJA 1N33L 2K04A 2LFNA 5G3LF 2B2WA 4HJ7A 1HUMA 1VQ4A 2Q2TA 4A3LH 2I0QA 2MQHA 2PW7A 3B6YA 1N9WA 4O42A 4J8QA 1SYFA 2SOBA 1V1IA 1Q81C 2BE5C 2C5CA 5DAUA 5IYDH 5GROA 5E3RA 4FF1A 1EY6A 1UUCA 2B2YA 1ET6A 1LT3D 3PUWA 4BBRG 3T1YQ 4JI0Q 1OVOA 1STNA 3DLLA 4KHPQ 1I4PA 3VYUA 1GUWA 2R61A 1WJJA 4M8AA 4PMBA 3A0JA 3NEMA 4LMQD 5IWAQ 2B2TC 1CGII 4YCWA 1B7YB 4BBRH 1WTOA 3MEHA 4OX9Q 3IRBA 4MTNA 4IUPA 2DNEA 4GN5A 2SGPI 3E0EA 3SEKC 5C3EG 3IL8A 2HHHL 1ASYA 2M00A 4WJ4A 2K75A 5CBAE 1TIID 3CMAA 4K6DA 3H3VC 1VF7A 1WD0A 1XNQL 3CCJA 3HOZH 2F0FA 1SGRI 2K5NA 1SJED 2K5VA 2D9UA 4Y52H 2LUYA 2ALYB 1RFHA 1ZYRC 5LMNL 3I9V1 1EWHA 1W3SA 3RN2A 4NXNL 5EBDA 3HKZB 2L8EA 4LFAL 4DAVA 1YJ9A 1EQVA 3JAMc 4QMGA 3LNNA 3U9OA 5EX0A 1TWGB 2IX0A 3QOJA 1I94Q 4H7BA 3KLSA 1Z6HA 2QDLA 2KCTA 3RZOB 2PZWA 2PNRC 1O7YA 4U68A 2F3VA 1CSPA 2F6MB 3TRZA 2BOSA 3OXGA 2ODDA 3DEPA 3VR6A 5EPLA 1WGTA 1JWMD 4H0LC 4G75A 1CK1A 2YU9H 3H0GH 4K2KA 1Y1WH 2B63G 1U5KA 3QTLD 3J7YW 1S40A 3C2PA 1FD7D 1WOCA 1MJAA 1SE4A 2RVLA 1H9KA 1M4VA 2KENA 4CKBA 1H9JA 2XGTA 3ICEA 4L5QA 4IURA 2E74C 5J3BA 3UI2A 3CCQA 4A3EB 4ME3A 4GKJL 4WFN3 2X69A 3STBC 2QZGA 3S2DH 2E8GA 4A3GH 4B3RQ 2CWHA 1TWCB 2B63H 2JJQA 1YHQA 3BDCA 2K03A 3CD6A 4AH6A 2RCFA 3TO9A 2VNUD 1A3UA 3TBIB 4RH6A 1PTOB 2RSOA 4X3SA 3KK7A 1GUOA 1YO7A 3TZDA 1VQCA 3TJQA 1LTLA 3MXGA 1SJ8A 5I9OA 2HQEA 1B4OA 4LF7Q 5DAEA 5I6WA 4C3HB 1CHOI 3C46A 2RBMA 4B3TQ 2A6EC 2X6LA 2H5XA 1BCPB 1JR0D 3EQLC 3VDYA 3EA6A 3OXLA 3TP6A 1KAWA 1I4HA 1IBKQ 1Z7TA 4GN3B 2JW6A 4DR3Q 1I5FA 1SNPA 2FMMA 1QWYA 3PIP3 3OTOL 3TQYA 2NVTH 2TSSA 5NUCA 1UAPA 4A3IH 3J7A5 2JA6B 2F1MA 1HFNA 4LNQA 3F2UA 3T1HL 2J4XA 1GUNA 4EQNA 3OSOA 4R4CA 3RR5A 3W2DA 1X55A 1VQLA 3A54A 3I4LA 3N6RA 5KIXA 4DV0L 1JOOA 2J87A 2EYMA 3K0YA 1L0WA 2NU4I 4HCSA 3K5MA 3KJOA 1UEAB 2Y0MA 2NU1I 2XWBB 1JJ2A 2R93B 1X9NA 4QY7A 5K5PA 3S17B 3S1RB 1V1PA 2M5XA 2NU0I 5FOBB 1HNZL 4A75A 2JA5B 1RF2D 4G7OC 1VQPA 5C0XI 2EXDA 1TBNA 3K5LA 5KEEA 2CWGA 1ILQA 4A3KG 1BBUA 1LV9A 2Z8LA 4Z7GA 2R7ZG 2PQAA 3GTPH 4JCVE 3ZJYC 3PUXA 3DWAA 3BJIA 4DU9A 3H3VI 2GSCA 1QILA 4RKLA 1LYLA 2FU2A 3V05A 1EFWA 1HH2P 4ID6A 5FLMH 4A3KH 2DUDA 4KJOA 3G71A 4A3MG 3MXNB 4FDBA 5M5XB 1OXSC 1N34Q 1VCIA 2R7ZH 4R4QA 4QIWB 3RLNA 3MZ5A 1F9SA 4DXFA 1I4RA 2WAQB 1VQMA 1Z7KB 1MKHA 1ENAA 3NELA 5CORA 1EZ8A 1VQ9A 4QGUA 5HQ8A 1HNXQ 1BBXC 1MBYA 3QWPA 2RIOA 2J9RA 3ER0A 3Q0AA 1YJWA 3KF6A 1BO0A 4A3MH 2SGEI 3TOBA 2LEOA 2DN8A 5JJIA 3DM1A 1WTPA 5E3QA 3K5OA 1LT4D 2QQ0A 2NU2I 4HAEA 4IUUA 4X3TA 5FUYA 1WTXA 5CV4A 5GAEC 2LB7A 2F0DA 3GOXA 2F52A 2IHFA 3NP8A 2ARPF 4KK7A 3A8KE 4RA8A 4XYQA 5FJ8G 2FJ2A 4BY1H 2CCZA 3ND8A 2LXJA 1U4LA 2WAQE 3I8ZA 1L2FA 3PCOB 4FVMA 2JA7G 2UVOA 1D7QA 4C3IG 3KF6B 4LF9Q 2P22B 1RODA 3VR5A 4GI3C 4QUCA 1IZ6A 1CKOA 3L0IA 1XMQL 5IP7H 1PH8A 5E3PA 3IAS1 2DKVA 1IYJB 1CE3A 1VQAA 1HHVA 3NSWA 2L11A 2BDOA 3GTLB 3UGDA 3H15A 5C4HA 3FP9A 2VQFQ 4C3IH 1FVIA 4LF5Q 5LNK1 1NCVA 4JI8L 1XMOQ 4Q9VA 1D6EC 1MHWC 3VYTA 2OXPA 4YZCA 1DYQA 2QGMA 2R7DA 5D65A 1QOHA 3IAYA 1RJTA 1E7ZA 1F2ZA 1HRJA 4Z7HA 4DR2Q 2MUYA 3DHQA 3OW2A 4YCVA 5A35A 3WOFA 3O13A 4B6DA 2CVRA 3D3RA 1D5MC 1I6HB 2ZTDA 3CMEA 3I73A 4IPHA 1K8AC 2E73A 3FKIG 2CWFA 3J81j 4DR4Q 5C44B 4DR7Q 1IY5A 4DV4Q 3NHHA 4DV6Q 1AP0A 1TWGH 1Y1VG 1BBWA 1HR0L 2BH8A 3UGLA 4BA2I 1EYDA 2YTYA 5C4ZA 4JV5L 2HT1A 1N34L 3RZOH 2JK8A 1LTBD 1I4QA 1YHAA 3HOVB 3HS0C 2HCCA 5HGTA 1PH4A 3EFXD 4KN4C 5JAVA 3EJIA 3ONAB 1CT2I 3CKIB 3CC2A 3S16B 2IW3A 4F88A 1J5EL 4K0KQ 1SFOB 4HR7B 2XRCA 3DWQA 2F03A 2EIFA 1KNEA 2DB6A 3R3OA 2EVBA 2A2DA 4LK1C 4X3KA 4DV2Q 3X3NA 5IY0A 2GN5A 2Z9HA 1A2TA 2D62A 3TP7A 2KCXA 1EY7A 2NTTA 3N52A 2E2HB 1NMGA 2X6GA 4A3EH 4BBRB 4KHVA 3TOAA 3HRZC 4JI6L 2H1EA 1N13A 1M8CA 2MO1A 2UUCL 3GTMB 2A6HD 1LT5D 3SXHA 2L0CA 4BY7H 4HMIA 3I70A 1VQDA 4DAPA 5A2QL 3U58A 2SNSA 1PTOH 3MWYW 4JPBW 3HOZB 5IGDA 4FF3A 1AN8A 1UHAA 1PXUA 3GTKB 1F9RA 1M1KC 1CSOI 1XNRL 1E2VA 4EVOA 1QG7A 5FKAC 2F4VL 1HUNA 3FC3A 1NAPA 1HDLA 4IZ8A 4YWMA 1IW7C 1SE8A 1V8QA 2GA4B 1EQQA 4C3HH 5C3EB 1SR3A 2WB1G 3D0FA 4A93G 2WCYA 2R3ZA 1CT4I 1K3RA 3EN2A 1SN8A 1PRTC 2JXMB 1SGQI 1PV4A 1X56A 4KTAA 5IP9H 2HQLA 4YY3Q 4C56C 1STAA 4JI3L 1FGUA 5M5YB 4NV5A 3F2BA 4GOPB 2PZTA 2QA4A 3SVMA 1AZQA 1QVCA 2A6HC 3TREA 1IBLL 1I50H 4KY7A 1B50A 1E2ZA 3PF5A 4C1NK 4K5WA 4YCUA 1O80A 3HOXG 4HJ9A 2X52A 5GQOA 3KLWA 4FYDA 4GLXA 2OF1A 3F8TA 3BJUA 4JI7Q 5LL6S 1PZJD 1I3QB 1UVFA 4OO1G 2FNFX 4NXMQ 4A3JG 1WTVA 2YU9B 2F0WA 2EDGA 3BYYB 1T5XD 4GS3A 3D31A 2R93H 1YTPA 1NY4A 5D14A 4OWXB 4IUVA 5CV6A 4HIMA 3S17H 4LWCA 3S1RH 3W5OA 4JI5Q 1KD1C 3GO5A 2JA5H 1PPFI 2BL8A 1A2UA 3NTHA 4DR4L 2B8FA 2B39A 4MNOA 1GUGA 4U6RA 4ZUIA 2DIPA 4WORA 2HIVA 1B9NA 3P1HA 4G76A 2MP1A 2B63B 5IODA 2E5LL 5FUWA 3T13A 3PO3H 2XRSD 1EFID 1F9PA 3J80c 1HA5A 1TBRR 1YNXA 1L1OB 4K2LA 2XMXA 3W1GA 3J81i 4LF6Q 4YIJA 3I7FA 5CYUA 2KHJA 1NUBA 4A3BG 3MHBA 4IFDG 1S20A 2OQ0A 3LX0A 4K8IA 1E22A 2ZJRA 3K0XA 2ZM6Q 5JJLA 2RA4A 1BR9A 5I9PA 2UUAL 2K52A 2NN6G 3BZDB 4HEA1 1K0SA 2B2UC 4LUVA 2KUMA 2LSSA 4KJNA 1WTQA 1CTMA 1IYVA 2QPOA 2B0UC 4N9TA 1RIPA 5CC4A 2R92G 1ESRA 5HY6A 3PO2G 2NVTB 3NBHB 5JEAG 4R4OA 3ERSX 5GAGC 4LF4Q 2NN6H 4I7AA 1LR8A 2KEDA 1OXTA 3OWEB 2SEBD 4ZLTF 2E76C 4ILWA 5LMNW 2I46A 3NQIA 4NB3A 1SNMA 2O2LD 2XWJB 4EX5A 2D0OA 2JP1A 1QCBD 3IKJA 4DV1Q 2Y0SG 2J7ZA 5DLQE 4RHRA 2JB2A 1BF4A 3PF4A 1SYCA 3AJFA 4HIDA 2E2IB 5LMUL 4OAUC 2WFWA 2VQEL 5J8CA 3CCLA 1Y14B 3OWFA 4JI2Q 3I91A 1CA6A 2PQ8A 3A7LA 1CA5A 1SYBA 2GIVA 4DWLA 4EQOA 2JQOA 3HFZB 1EZ6A 1Z47A 4DUZL 1BVSA 1TY2A 2BA0A 4I65A 4XT1B 1TXYA 3GTPB 3VDUA 5C4JB 2NVXH 3FHWA 1XX6A 4YHHQ 4UPAA 1GHKA 2ROWA 3SGBI 3GTLH 3K59A 1VMPA 1C8CA 3AB9A 2KEEA 3G7LA 4DFAA 1GKHA 4A3KB 2B2WC 4B3SL 3GV3A 5C3XA 4JI4Q 3UDGA 1EIHA 4DK6C 1E2WA 4KMUC 4G7ZC 2R7ZB 4PZ8A 1X3GA 4KKTA 4PV1C 2EE1A 4KHZA 1DGSA 4R9WA 3B55A 1HZAA 1MGSA 1KLUD 4IFDJ 3AEVA 1SE2A 3M4OH 1OXVA 3MA2B 1N32Q 1JWSD 1EOVA 3K80C 3T53B 2JA9A 2KHIA 4DAYA 3CP0A 1FGBD 4A3MB 3FPPA 2WIIB 2B2YC 1EEFD 2KBNA 3AMUA 3UITA 1QVGA 4K14A 4OEMB 4IOCA 1IBML 5C5MA 2KMRA 5IT9c 4A3CH 4WJ3M 4JC0A 4OONA 5E4WC 1W4RA 2YFBA 4FNFA 5C44H 5IGFA 5BR8L 2HD3A 1Y8PB 3AU7A 2ZRRA 1X3EA 5C6AA 2WKDA 2GKTI 2VXWA 1RD9D 4BY1B 4WRDA 3HOVH 4TKOB 1S4ZA 1SDFA 3HOWG 3GQBA 3UFFA 4JI1Q 5JPNC 4UP9A 3BU2A 3S16H 4SGBI 2FUG1 2Q2IA 4DAYB 2GKVA 5AFWA 1SFOH 2K14A 1U0LA 1KBEA 1SROA 1ZYRD 1E1TA 5J39A 1S5FD 1TS2A 4XXEA 3RLFA 5C4XG 4X66Q 1WYDA 1KTKA 2B3GA 4C3IB 2E2HH 3HOYG 3LWUA 5HURA 3KY9A 1LTGD 3E9HA 3R2TA 5FO8B 1Q7YC 3CXCA 1JWUD 4AS2A 4N8X1 3GTMH 1TY0A 1LM0A 2EYPA 1YIJA 1GM5A 2RKSA 3JAMi 2A19A 4R1JA 2UXCQ 5JJZA 2RLDA 5C4XH 1Q82C 4JBJA 4ZCKA 2G9HD 4ZK9B 2XRQD 5M3FG 1MSHA 3VE5A 4ZQ3A 3HH2C 4RCOA 1G2SA 4ULLA 3ULPA 4H02A 4OGQC 4YZ9A 3GTKH 2NTSA 4JW0A 3BDOA 4DV7Q 1AH9A 4J1MA 3I2ZA 3IAM1 3GTJB 1DD2A 1K9MC 1BOSA 4RKBA 1SYGA 4J15A 5C3EH 1VQNA 1CT1D 4FF4A 1P9GA 4JBWA 4FO2A 2JEBI 4XYOA 2DJGC 4CKEA 1BCPC 5JPMC 3R93A 2FEFA 2LXKA 1KL9A 1I4GA 3SK8A 5M5YH 1S3OA 2B29A 1W2BA 3QJYA 3NUCA 1HZCA 3Q22A 4JVZA 3STBD 3KBGA 1TDPA 4G4KA 4JI4L 1ET9A 1V9PA 1TOTA 1SNOA 3I4MG 3FKIB 4IN3A 4MTKA 1JORA 2NZOA 3I4OA 2NVQH 3RU0A 1Y1VB 4ZUJA 2V4DA 1N36Q 1K8GA 3R8BA 1I3QH 2KQ3A 1YI2A 2UXDQ 2GVIA 4DR1L 3FVVA 2Z0SA 5JJKA 3QR8A 2A69D 2PYKA 4TQUS 1NJIC 5FLXE 3UOEA 3FPUB 2A6ED 2EYHA 3DM3A 2JEAI 3I4NG 4P71A 3CU7A 4JBKA 4O1NA 1OYVI 1LACA 4R4TA 1UE1A 2KHSA 2XSCA 1UUPA 1QVFA 3KDFB 4HJ5A 2RHQB 4H13C 1YZ6A 2YFAA 4ME5A 3A74A 5E4XA 4BY7B 2MJFB 1F2MA 2ENZA 4C3JG 2EPBA 1SXTA 2L1BA 3K8AA 3M85A 1HNWQ 3H6MA 1K8OA 4OHJA 2EY6A 1H0ZA 4POGA 2JAEA 2IL8A 3HKSA 3MXPA 3T1YL 4JI0L 3CRLC 2A69C 3I3CA 4KHPL 5ELCA 1MIUA 1JOKA 1BKBA 2V53A 1HTPA 2I5MX 5K36G 2AWNA 4PQXA 5AJ3Q 1E0BA 3VR2A 5CBEE 3KBXA 1STYA 2PO4A 4KLKA 3CCUA 1O7LA 3K5NA 4J6HA 2EJFC 3C1FA 5COYA 5IWAL 1I50B 4OXPA 4PZ6A 3R2IA 4OX9L 2WB1B 1TS3A 1YNJD 2UXCL 3KFUA 2ZXPA 1OXUA 4UAIA 5FLXL 3NTIA 1LR9A 1SRUA 1EIYB 1ONLA 4JYAQ 3MXNA 3OL0A 1LTRD 1I6VC 3D8GA 1K8MA 2RSNA 5KYLA 3OHXC 2NBFA 4XQJA 1G2TA 5IYBG 1NTGA 3UDIA 1TT2A 4PZ7A 1TBOA 1PH2A 1HR0W 2CJSC 1Y1BA 1VQOA 2E2IH 1E3PA 3K7AB 1L0XB 1XPUA 4DR5Q 3BVMA 5CR3A 3G6EA 5I6YA 3E0JA 4UHVA 4HFVA 3OOCA 2B8GA 3KYHC 4HEDA 4A76A 1EYGA 3CPFA 2IJ0A 3K57A 1I94L 3PO3B 2RF4A 1QJOA 4ZKCB 2YYZA 5C4JH 1YNJC 1SNDA 2WB1E 1X3PA 1JT8A 1EIFA 4N9PA 2SGDI 2ID0A 5IYCG 4A3FG 1EU3A 2CWPA 1XTCD 4PG3A 4K8JA 3AFPA 3FSXA 1X54A 5CV7A 3E5SA 4L5RC 3PGZA 4S3SA 2B8TA 4TVAB 4UP7A 1K83B 4X64Q 4UXHA 2KVMA 5FK9C 1CKNA 1D5XC 1XTDA 5EBCA 1NE3A 1O7IA 2QCPX 2PI2A 4A3BB 5GADC 4MN3A 1MSGA 3HOUG 1NUCA 1HJPA 4K5VA 1ICFB 4B3RL 1WFQA 4GNXB 3CAMA 4OIKA 1HXYD 4KY5A 1JE5A 3S1QH 4L5SA 1H9SB 3KF8B 4MHEA 1V1QA 1IHZA 4LF8Q 4K6LA 2I5LX 1JJGA 3RMHA 2F0PA 1B53A 2QF7A 3PO2B 2MPMA 1PYWD 2LS01 4EQPA 3K7UC 3CQZB 4DUYQ 3OPOA 4LF7L 3A56A 2K01A 1TU2B 1KHIA 4B3TL 1PCEA 4E1RA 1CQVA 1CKNB 2EYOA 1II3A 1NR4A 2JB1A 1PFMA 1IBKL 3UEJA 1IY6A 1Q1EA 4RFBA 4WJWA 4DR3L 1PH3A 3L9AX 3OXFA 2G9DA 5FJ8H 1KLGD 4C2MH 4XDXA 3CCVA 2NVXB 3NPPA 3OMCA 4XT3B 3G6JB 1SYDA 1J9OA 2YUUA 2WINB 2D0PA 4X3UA 2JA7H 2KMQA 1S5BD 3D4WA 4HSPA 2BH2A 2UUBQ 3FBVA 3RD4A 3X3MA 4A3DG 5J1ZA 3CC7A 3BZCA 1B8AA 4LFCQ 3TDQA 3FMCA 2QDBA 1CSQA 4Q0FA 3M4OB 1DOKA 1G51A 4AYBG 1T9HA 2SGFI 2Q2HA 3VYRA 2EQSA 1VQBA 4A3DH 1PJUA 1PH7A 2HDLA 1DOMA 1XWEA 1O78A 2Y0SE 3GTJH 2ZJPA 1A3TA 2L4NA 3V2TA 4IUQA 4RWSC 4RG1A 2NN6I 4X62Q 1D2BA 1AW7A 1Y8OB 1SMYD 2JE6I 4F8MA 3MXUA 1ULNA 1CKMA 4BXXG 4GKKQ 2UZ3A 2MJ8A 2I5HA 3HKZG 4ABNA 2Z6BA 1JC7A 1Q9BA 1ULMA 5J8FA 1EU4A 2VRWB 1HQMC 2A68C 2E5RA 2L7XA 3FKIH 2PPBC 4DNTB 2JA1A 1STGA 1PH1A 4CJ1B 2VY3A 2CQAA 1HNXL 1HZ9A 1BUVT 2Z1CA 3PDNA 1Y1VH 4Y7NB 1J6QA 1V1HA 2VS1A 2QGQA 2ELIA 1FNVA 2NVYH 1JE4A 1SE3A 1MJEA 9WGAA 3NWSA 3CCRA 4GLVB 4DV3Q 1IW7D 4MZ9A 1IL2A 1BDOA 2JA8G 1SMYC 3HOWB 2FHTA 1WCMG 2PQEA 4R4IA 1PRTD 1VQHA 3FSYA 3SHLA 3PMFA 3W3AA 4I1TA 1GUSA 2F0GA 3CC4A 4GOPA 5IIFA 1VF5C 5C0XG 1Q3LA 2CAZB 1KRSA 7WGAA 3K81C 2RHSB 3S9WA 2Z6KA 1CUKA 1K7UA 3E6ZX 5H1SE 1CQFA 2IPKD 5C4XB 2A5HA 3T16A 4OVOA 2I07B 3U4VA 4DR6Q 4GZYC 2OZUA 1L1OC 1LUZA 2Q8IB 3J81E 3Q23A 1FAQA 4FF2A 1WTRA 1DXMA 3IFDA 3FDTA 4JOIA 3MFYA 3A5ZB 2A1AA 1E24A 1B1ZA 3MVVA 4LF9L 3TS2A 4XQQA 1JB3A 1G91A 2F0HA 3GTOH 1IYUA 1DONA 1H9RA 1VQ6A 5EGTA 1VQ5A 2L55A 2CW0D 1TWFB 2IX1A 1VS0A 4HMJA 5M3FB 2JB3A 2K28A 1G291 2B2VA 4RGMA 4LFBQ 2YTXA 1H95A 3M3YB 1PH5A 5L37A 1QNKA 2VQFL 1PH6A 1VQJA 1D1KA 5D3IB 4IUTA 3G48A 4LF5L 1L0YB 1NXUA 5IGGA 3M4YA 2Q8TA 3F1ZA 1C48A 1XMOL 3ITPA 4ZAIA 3L0OA 1L1OA 4A93H 1CI3M 3AYHB 4QB4A 2KA7A 3H94A 4PNYA 3BDLA 2JA6G 5ELDA 1DS3I 2IP6A 5KNCA 3VDPA 3J80i 1KQSA 2ZXRA 2NVQB 3J7AV 4DR2L 4IJHA 1QNUA 1F2LA 3G4SA 3W1BA 3I4MB 1KDCA 2CW0C 3PIO3 3NQTA 1OO9B 2F66B 3HOXH 2C9OA 2PMZB 2UU9Q 1FJGQ 1TQOA 1GO3E 3K7AH 2EY5A 4OIJA 4X62L 4YWLA 2F3WA 4AS3A 2ES2A 3ND9A 1Y69U 1UVGA 3J81L 1D1IA 1PZKD 4F7XA 3VA7A 2K19A 2KOLA 1LO5D 4DR7L 4NW2A 4OO1H 4A3JH 5CV5A 3H91A 4DV4L 2K4KA 5T1IA 3NBHA 5HGQA 4DV6L 4NP5A 3S1NB 2IY5B 2F0UA 1EY5A 1PFSA 2LMCB 4L9MA 3D6WA 2FMCA 2JYOA 2L9HA 3D4DA 4HIOA 1MT1A 3ERQA 1Q46A 1M8BA 3P7JA 2O5JC 2HGKA 1SLJA 2F0OA 4QF4A 4BWGB 2KMPA 1H9MA 4RHSA 3H09A 5ELEA 4R8IA 4UY8C 4K0KL 2KCNA 3JC66 2F3CI 1K0RA 1RDPD 2ZTCA 3NE5B 4B08A 5FUXA 4DV5Q 3F2CA 2BDNA 1K83H 4C3JB 4DV2L 3SK4A 2PMZE 3K58A 1N8RC 1CZWA 2P6AC 4V190 1IL8A 2EJGC 1N33Q 4DKAC 4MPIA 2K6AA 1TUSA 3DA4A 4A3BH 4IFDH 1VQGA 2WACA 4NV2A 2CH4W 1Q1BA 1SGNI 1GVPA 4KY6A 2CH4A 4GN4B 3R5CA 4IUNA 2F0SA 2R92H 3PO2H 5IE8A 2K5DA 5JEAH 5LHY1 3SDJA 3CQZH 2OTLA 2QSBA 5I2YA 2OWOA 2A73B 5EAYA 3KLRA 3FRPB 1ESFA 3I72A 4V0BA 1WI5A 3LJ1A 3VYSA 2QEXA 1AZPA 1SMXA 3CRKC 2QKIC 4YY3L 1K28A 2O5IC 4TSSA 3CHBD 1WKXA 4G7HC 2JBWA 4FXDA 1NMFA 3ULLA 2FXQA 1TVXA 1XXGA 3GTGH 2ICIA 5EPKA 3BVZA 3QB3A 2HHHQ 2R6GA 3RLOA 3D4RA 1AE2A 2XVSA 2K50A 3GP7A 1WVLA 1XNQQ 5CV8A 4DXGA 3P75A 4LJZC 1S5DD 1V1OA 1TWAB 4JI7L 1EQTA 4HN7A 4NXML 1SJHD 2K1BA 2KCCA 4PL5A 5LMNQ 1HPCA 2L1LB 3JAME 1ILPA 2H4OA 1A63A 3UGIA 3PUVA 4P75A 4A3FB 1LTAD 2JN4A 3J7ZC 2VB2X 4JI5L 1F2YA 2ZT9C 4L6TB 5EKLA 1F77A 4LFAQ 3WDNA 3MTSA 2VUMG 3MEFA 3QG1A 4L63B 4BS9A 4DK0A 3S1QB 1Z2IA 2TMPA 1JMCA 3NWTA 2OU2A 1PMRA 1RKNA 2DJFC 1FYBA 4F87A 3EROA 2ENBA 5JEAJ 4U673 2C35B 4UP8A 4LF6L 4OELB 3M7GA 3ULJA 3NENA 3BS1A 4BBSG 1MJBA 2RCNA 4P73A 4XIGS 2F0TA 2G5DA 1SEBD 4A3LG 1QZGA 1KABA 3EBEA 1PH9A 1OTCA 2SNMA 2ZM6L 1SGPI 1LTID 1EY0A 5IYDG 1VDZA 3CPWA 3CCEA 2K5QA 4CDFC 4Y7NH 1G6ZA 1PTOD 1OMTA 4GKJQ 1KNAA 3J7AF 4C2MB 4L5TA 1J8IA 1QUQB 3M7NA 3GV6A 3A8IE 3JAML 3HOWH 4N8FA 1DS2I 4LF4L 1EY8A 2KCMA 2JA7B 1CZGA 1BCPD 3SK6A 1AN1I 4QL5A 2HIXA 3NXWA 4IPCA 3T51B 1OMUA 2AMCB 1SNQA 2EZVA 2EYLA 3CCMA 1TGSI 2F3IA 2IX3A 2AQ3B 4DV1L 2NYZD 1ZEQX 1MJ9A 4RGOS 3U50C 1V43A 1PDQA 4OL7A 3T56B 1C9OA 3S2HB 4JI2L 1W6KA 2K7VA 3P23A 1PTOC 3HOYH 3EIVA 2KECA 1YNND 2FFKB 4A3DB 3HOZG 4YZDA 3OTOQ 4ZRZA 1KC8C 2LKVA 2YTVA 1STBA 2NZ1D 4AIMA 3T1HQ 1TWFH 4APVA 5M3FH 4YHHL 4AYBB 1C7YA 1GJXA 1M8AA 5DM63 1D8LA 3M3YH 4O1OA 4DV0Q 1K7TA 1DZ1A 3MAQA 4KV6A 3E3XA 3KDFA 2E2JH 1R4PB 5FUVA 4DN4M 1VMCA 3C1EA 3OIQA 3F2DA 1TR5A 4DNIA 2YV5A 5EX3A 1X32A 3JSBA 2E75C 3QIAA 4P2CB 3K6OA 3SE0A 4C1NI 1S72A 1TKWB 1GHJA 5D3DA 2KJXA 3CCSA 1HNZQ 2CKZB 1F9QA 1NR2A 3S14H 1N32L 4E6IA 1YNNC 4AQYQ 2ORWA 2B2TA 3LJ2A 3URYA 2EYFA 5FO9B 2QILA 5CGKA 2OQKA 5E3FA 1Y1CA 2K5HA 4UXJA 1JOQA 1PRTF 1X74A 1R9TB 2ICEC 1FNWA 2D2CC 2NVYB 3PSIA 3I4MH 2MNAA 1FYCA 1U4PA 3H0GG 4IO9A 1Y1WG 2P5ZX 1W6JA 2CQOA 2Z4IA 4KD3A 4AYBE 2K05A 2F0IA 1A3VA 1ICWA 1HEVA 1SAPA 5M3MG 1ML0D 3S1NH 2YQPA 2N78A 2IHEA 1IKLA 1Q8KA 4KKUA 4CJ2C 1SNCA 4A3GG 1VQIA 2JZMA 3S15H 3KUPA 4NPSA 2JA8B 4HTHA 4DF7A 4LW1A 4GXTA 2PCFB 3QO2A 2MGSA 1WCMB 1B70B 3I4NH 3HEJA 4DA2A 4RGTA 5KRUA 2NWGA 4LUZA 1Q8IA 4RMFA 3HKZE 4JI1L 1SGDI 1RL2A 1S5ED 1TURA 1Q86C 5M3MH 1A62A 1HQRD 3SEBA 1KDAA 1LT6D 4QUFA 2BL7A 3GTOB 4CKCA 3E59A 4C3JH 2N3SA 5M5WB 5LL6X 4B3MQ 2ZJQA 1VQEA 1WD1A 3UEYA 4X66L 5DM73 1ULKA 2F0EA 3U9SA 4KD4A 5KYIA 3PIOA 2J0TD 2K32A 4NKLA 4FP5D 3TP8A 2VZAA 1STHA 4O1PA 4GNXC 5EPJA 1YVCA 2BCOA 3GTQB 4A93B 5K36H 2QQEA 4A3IG 2EY2A 4CDEC 5EJWA 2XTRA 2JSOA 3PUZA 1CFMA 1KRTA 1LR7A 4IQZA 5C5LA 3TO7A 2HDMA 2EY1A 1UNSA 3SGIA 1UWVA 2A20A 3A7AB 4DV7L 2OEOA 2DNCA 2MFIA 3VA5A 1XMQQ 4UXIA 2E2DC 5CV9A 3HOXB 3HG9A 3PUYA 3TZUA 5GAHC 3M4QA 4UDUC 1VQ8A 4EQ5A 2XN9C 4A3JB 2DY7A 4GNXA 2SDFA 4JI8Q 5IYBH 1WGCA 3FVQA 2WGCA 2KMOA 1H9SA 3KF8A 4ZKBB 1YJNA 4DGZA 3F4MA 1B3QA 2WV6D 2QQDA 1TBQR 3RN5A 5KGUA 1G8ZD 4AQYL 1YITA 1TWAH 1N36L 2UXDL 2KKMA 3DUZA 1STEA 5FLMG 5J22A 2CHBD 3BYTB 4HIKA 1A8VA 1HJAI 1PA6A 2IWHA 3UE0A 2N1AB 4A4IA 1Q90A 1SGYI 4PL4A 3DMUA 5IYCH 4A3FH 1HPTA 3T4AC 5BN4A 4L8JA 2F0NA 1CHQD 1PFBA 4RAUC 3UDXA 1HR0Q 5FLXc 1GOZA 4JV5Q 2EXZA 1EIGA 2OT2A 3D00A 1XBTA 1PVOA 4EGVA 1NNXA 1FR3A 4QJFA 2HUGA 2ETDA 5E7NA 2K33A 1V1PB 1HNWL 3SDZA 3RZDB 3HOUH 1QE6A 3RUZA 2R92B 2WVJA 1J5EQ 1SGEI 2BUSA 4B9WA 5IOCA 4JG2A 1FY7A 2AWOA 1TS4A 1A0IA 1C4QA 4MIUA 5IGBA 4BY1G 3S1MB 2PQAB 1BXTA 3OW7A 1TIHA 4B3ML 3Q8DA 5AJ3L 1O7ZA 4XTCS 3I55A 2ZXOA 1EEID 3WOEA 4OO1I 3OVOA 3E2IA 2F0QA 2BA1A 4JI6Q 2Y0SB 2UUCQ 3OYYA 1PYSB 3GTGB 1HZBA 4QIWE 5G3LD 5EQ0A 2AQ1B 5ELFA 5IP7G 2N17A 2NZHA 3HZXA 4X65Q 3LJ0A 5ELBA 3NTKA 2RDHA 4DNRB 4JYAL 5DNFA 1D5ZC 3D6CA 1FL0A 1B9MA 1XNRQ 3M9BA 2IT1A 2F4VQ 4DK1A 2A68D 1TWHB 2RDGA 1C0AA 3A55A 3DO9A 1DCZA 1VQKA 3KP9A 2MHVA 5TSSA 2ERWA 1IXRA 3DA3A 5I2XA 3S2HH 4DR5L 1K73C 4JI3Q 4IFDI 3GDEA 1G6PA 1KIXA 4DK3C 1YEZA 1IBLQ 2HCIA 3UE1A 1GXDC 4OAVB 5EKKA 1U4MA 5IGEA 2F0JA 2D5DA 5CCLA 2Q2UA 4KN7C 5M9OA 4B9XA 1ENCA 1JQYD 2VUMB 2DGYA 4NDXA 2ASBA 3A5UA 1U9RA 1MI2A 3S24A 4GOPC 1XX8A 2PI2E 4Q5VA 4QCLA 1KXLA 3V96A 1VDDA 1P8LA 5HI7A 2F4IA 1PTOF 1YU6C 2EYJA 2NUCA 3NBIA 2Z6KC 4X64L 4BXXH 1NBWA 3FNBA 4BBSB 1R79A 5FO7B 5A2QE 4AMLA 5C3WA 1JICA 3J80E 3AQQA 5T1GA 2AKWB 1BQQT 3LWEA 4JOIC 1VQFA 4K5XA 1BCPF 1R9TH 1Y8NB 1JJCB 5CMDA 3I90A 2E5LQ 1PLFA 1DOLA 1ZKOA 4TRDA 2N88A 2AQ2B 5DEHA 2UXBQ 4R8NA 3B4VC 3A8JE 4E1PA 1EL0A 1QB5D 3TMEA 4LF8L 2Q8RE 1LTTD 2CWAA 2B2VC 2L15A 3ZYYX 4O0AA 5HGIA 4GLAC 3C3LA 4A3EG 2ATWA 3DXJC 1PHJA 3PQIA 4DUYL 2JA8H 1CHPD 1WTJA 2AHOB 2UUAQ 1WCMH 4RCNA 2PNHA 3KOJA 5EKIA 2RIJA 4BY7G 1GD7A 2XNAC 3HP3A 2FINB 2ZTEA 5E1FA 3HOYB 4IALA 3LGJA 3TP5A 4HJ8A 5C0XH 4HJAA 2OVOA 1GUTA 1X65A 1TWCH 1X3QA 3RNUA 1UE5A 1B3AA 2A8VA 1CT0I 1XJVA 3GD7A 5M5WH 3SK5A 1U4RA 3QWNA 4C3HG 2W0TA 3BG3A 1PZID 2N49A 3PV0A 3H3VH 4JK1C 4O2DA 1JCKB 4CGYB 4X65L 5JOBA 1R4QB 2AUJD 5IP9G 3J80L 4IOAA 2E2JB 1T5EA 2X3TA 2UUBL 1B44D 1HTLD 2VB3X 1K3BC 4DAMA 4KKSA 4ZYSA 3L3OC 3CW2C 2MO0A 3BVGA 4I7ZC 3GTQH 5ISRA 4RGNA 1EWCA 2A74C 1EY9A 1NSNS 2QEJC 1HCZA 4LFCL 1YHBA 4P72A 5LMUQ 2XIWA 2VQEQ 3TEHB 4CHTB 2EJMA 3S14B 4ALPA 3TS0A 3Q24A 1M90C 4PMCA 5JVH3 4FXGC 2F0LA 1FARA 2M9VA 4BA1I 1XPRA 3BZKA 4DUZQ 2CFMA 1AE3A 1ENFA 3EVQA 4CDDC 2JA6H 2K5WA 1EQRA 1LABA 2R93G 1PFNA 3DEOA 1FNUA 1ASZA 3SR1A 2WP8J 4GKKL 3MFGA 2JA5G 5BN3A 1BUSA 3VR3A 4B3SQ 3DWPA 1RTOA 1KBFA 1EOTA 1X4SA 5ELNA 1UE7A 1VQ7A 4XQNA 3S15B 3H0GB 1Y1WB 1XA6A 3PO3G 5C0XJ 1HA6A 3I4NB 1BMOA 1E1OA 1AEXA 2JXDA 1X6OA 1A6XA 5M3MB 4P74A 2OCEA 5IT9E 1P9ZA 1P16A 1QZHA 4A3GB 3S2DB 1PTQA 1PYBA 1WTWA 1ZXTA 1IBMQ 4DV3L 2RQXA 3R5DA 4LUOA 2WAQG 2UXBL 3PIPA 2GVBA 3L7ZC 2M2LA 3NK9A 2DY8A 1PTRA 5BR8Q 3AFQA 4DPGA 4PL3A 1IKMA 2LY7A 1IW4A 1UEBA 5M5XH 2F0VA 2ZW3A 1TS5A 4HSVA 4LAAA 4X6AH 1B2TA 4FKDA 4CJ0B 4DR6L 1PRTB 3M4PA 1KDBA 3QOLA 1I4XA 3RZDH 1RTNA 1LLRD 4ODGA 4HGUA 2VW9A 3IFTA 3E9IA 1MD2D 3J81c 4IJLA 3KJPA 4A3IB 5BN5A 1EYCA 1Q12A 1WTHA 1CGJI 3S1MH
chains in the Genus database with same CATH topology
3MEKA 4OWTB 4LFBL 4A24A 2V6EA 4IPGA 3WWVA 3L2PA 2K9HA 4QQBX 2GVAA 3SGQI 4PMWA 2ORVA 2GKRI 2N8NA 2XTIA 1UE6A 3CXLA 3I56A 4OWWB 1EWIA 1KMAA 1Z9FA 1TWHH 1YBYA 2V1CC 3U4ZA 1FJGL 2XTQA 2UU9L 1JB7A 1R0RI 3UDFA 4NXNQ 1QUQA 4POFA 1Y8FA 2OD1A 1X3FA 2NU3I 5JHWC 2R7FA 4IPDA 4A3CG 2VUMH 2JYYA 2SGQI 2ENNA 4JBMA 3VA9A 5C44G 3CF5A 5CCMA 1MJCA 4DR1Q 1OXXK 4YWKA 2V1CA 2QQCA 1EUJA 2VL6A 4DV5L 1XPOA 2N71A 2A2CA 1I6HH 3HOVG 5ELOA 4KI0A 2N52A 4BBSH 2OTJA 1N33L 1VQ4A 4HJ7A 2Q2TA 4A3LH 2I0QA 2MQHA 3B6YA 1N9WA 1V1IA 1Q81C 5IYDH 5GROA 1UUCA 3PUWA 4BBRG 3T1YQ 4JI0Q 1OVOA 3DLLA 4KHPQ 1WJJA 3A0JA 3NEMA 5IWAQ 1CGII 4YCWA 1B7YB 4BBRH 4OX9Q 3IRBA 4MTNA 4GN5A 2SGPI 3E0EA 3SEKC 5C3EG 2HHHL 1ASYA 4WJ4A 2K75A 3CMAA 1XNQL 3CCJA 3HOZH 1SGRI 2K5NA 2K5VA 4Y52H 2LUYA 2ALYB 1RFHA 5LMNL 3I9V1 1W3SA 3RN2A 4NXNL 2L8EA 4LFAL 1YJ9A 3JAMc 5EX0A 2IX0A 1I94Q 2KCTA 1CSPA 2F6MB 3TRZA 3OXGA 2ODDA 4G75A 2YU9H 3H0GH 1Y1WH 2B63G 1U5KA 3QTLD 1S40A 1WOCA 2KENA 2XGTA 3ICEA 4L5QA 5J3BA 3CCQA 4ME3A 4GKJL 4B3RQ 3STBC 3S2DH 4A3GH 2E8GA 2B63H 2JJQA 1YHQA 3CD6A 4AH6A 2VNUD 1YO7A 1VQCA 3TJQA 1LTLA 1SJ8A 4LF7Q 5DAEA 1CHOI 4B3TQ 2H5XA 3VDYA 3OXLA 1KAWA 1IBKQ 4GN3B 2JW6A 4DR3Q 1I5FA 3OTOL 3TQYA 2NVTH 4A3IH 3J7A5 4LNQA 3T1HL 4R4CA 3RR5A 1X55A 1VQLA 4DV0L 2J87A 1L0WA 2NU4I 3KJOA 2NU1I 1JJ2A 1X9NA 4QY7A 2M5XA 2NU0I 1HNZL 4A75A 1VQPA 5C0XI 2EXDA 1TBNA 4A3KG 1BBUA 4Z7GA 2R7ZG 2PQAA 3GTPH 4JCVE 3ZJYC 3PUXA 3BJIA 3H3VI 1LYLA 1EFWA 1HH2P 5FLMH 4A3KH 2DUDA 3G71A 4A3MG 3MXNB 4FDBA 1OXSC 1N34Q 1VCIA 2R7ZH 4R4QA 3RLNA 1VQMA 1Z7KB 1MKHA 3NELA 1VQ9A 4QGUA 5HQ8A 1HNXQ 3QWPA 2RIOA 2J9RA 3ER0A 1YJWA 3KF6A 4A3MH 2SGEI 2LEOA 5JJIA 2QQ0A 2NU2I 5FUYA 5GAEC 3GOXA 2F52A 2IHFA 2ARPF 5FJ8G 4BY1H 2CCZA 2LXJA 2WAQE 1L2FA 3PCOB 2JA7G 1D7QA 3KF6B 4LF9Q 2P22B 4GI3C 1IZ6A 1CKOA 3L0IA 1PH8A 1XMQL 5IP7H 1CE3A 3IAS1 1IYJB 1VQAA 3UGDA 3H15A 3FP9A 2VQFQ 4C3IH 1FVIA 4LF5Q 5LNK1 4JI8L 1XMOQ 4Q9VA 4YZCA 2R7DA 1E7ZA 4Z7HA 4DR2Q 3OW2A 4YCVA 4B6DA 2ZTDA 3CMEA 4IPHA 1K8AC 2E73A 3FKIG 3J81j 4DR4Q 4DR7Q 1IY5A 4DV4Q 4DV6Q 1TWGH 1Y1VG 1BBWA 1HR0L 2BH8A 3UGLA 4BA2I 2YTYA 4JV5L 2HT1A 3RZOH 1N34L 2JK8A 1YHAA 1PH4A 1CT2I 3CC2A 4K0KQ 1J5EL 2XRCA 2EIFA 2DB6A 2A2DA 4DV2Q 5IY0A 2GN5A 2D62A 2KCXA 1NMGA 4A3EH 4JI6L 1N13A 1M8CA 2MO1A 2UUCL 4BY7H 1VQDA 3U58A 1M1KC 1CSOI 1XNRL 3FC3A 2F4VL 1HDLA 4YWMA 1EQQA 1SE8A 4C3HH 1SR3A 2WB1G 3D0FA 4A93G 2WCYA 1CT4I 1K3RA 3EN2A 1SN8A 1SGQI 1PV4A 1X56A 5IP9H 2HQLA 4YY3Q 4JI3L 1FGUA 4NV5A 3F2BA 4GOPB 2QA4A 1QVCA 3TREA 1IBLL 1I50H 3PF5A 4YCUA 3HOXG 4HJ9A 5GQOA 3KLWA 4GLXA 3F8TA 3BJUA 4JI7Q 1UVFA 4OO1G 2FNFX 4NXMQ 4A3JG 2R93H 1YTPA 4GS3A 3D31A 1NY4A 4OWXB 4HIMA 3S17H 4LWCA 3S1RH 3W5OA 4JI5Q 1KD1C 3GO5A 2JA5H 1PPFI 4DR4L 4MNOA 4U6RA 2DIPA 2HIVA 5FUWA 4G76A 2E5LL 3PO3H 3J80c 1TBRR 1YNXA 1L1OB 2XMXA 3W1GA 3J81i 4LF6Q 3I7FA 2KHJA 1NUBA 4A3BG 4IFDG 2OQ0A 1E22A 2ZJRA 3K0XA 2ZM6Q 5JJLA 2UUAL 2K52A 2NN6G 4HEA1 4LUVA 2LSSA 2QPOA 2B0UC 1RIPA 2R92G 5HY6A 3PO2G 3NBHB 5JEAG 4R4OA 3ERSX 5GAGC 4LF4Q 1LR8A 1OXTA 5LMNW 4NB3A 4EX5A 2D0OA 4DV1Q 2Y0SG 5DLQE 2JB2A 3PF4A 3AJFA 4HIDA 5LMUL 4OAUC 2WFWA 2VQEL 3CCLA 1Y14B 4JI2Q 4DWLA 2JQOA 3HFZB 1Z47A 4DUZL 1BVSA 2BA0A 3VDUA 1TXYA 2NVXH 3FHWA 1XX6A 4YHHQ 4UPAA 2ROWA 3SGBI 3GTLH 1GKHA 4B3SL 4JI4Q 3UDGA 4DK6C 4PZ8A 1X3GA 4KHZA 1DGSA 1HZAA 4IFDJ 3AEVA 3M4OH 1OXVA 1N32Q 1EOVA 3K80C 2JA9A 2KHIA 3CP0A 2KBNA 3UITA 1QVGA 4IOCA 1IBML 2KMRA 5IT9c 4A3CH 4WJ3M 4JC0A 4OONA 1W4RA 2YFBA 5C44H 5BR8L 2ZRRA 1X3EA 2GKTI 3HOVH 3HOWG 3UFFA 4JI1Q 4UP9A 3BU2A 3S16H 4SGBI 2FUG1 2Q2IA 4DAYB 2GKVA 1SFOH 2K14A 1U0LA 1KBEA 1SROA 1E1TA 3RLFA 5C4XG 4X66Q 1WYDA 2B3GA 2E2HH 3HOYG 3KY9A 3E9HA 1Q7YC 3CXCA 4AS2A 3GTMH 1LM0A 1GM5A 1YIJA 3JAMi 2A19A 4R1JA 2UXCQ 1Q82C 5C4XH 4JBJA 5M3FG 3VE5A 3HH2C 3ULPA 4H02A 3GTKH 4YZ9A 4DV7Q 1AH9A 3I2ZA 3IAM1 1K9MC 5C3EH 4J15A 1VQNA 4JBWA 2JEBI 2LXKA 1KL9A 5M5YH 2B29A 1S3OA 1W2BA 1HZCA 3STBD 4JI4L 1V9PA 1TOTA 3I4MG 2NZOA 3I4OA 2NVQH 3RU0A 1K8GA 1N36Q 2UXDQ 1I3QH 1YI2A 2GVIA 4DR1L 2Z0SA 5JJKA 4TQUS 1NJIC 2JEAI 3DM3A 3I4NG 4P71A 4JBKA 1OYVI 4R4TA 1UE1A 1QVFA 3KDFB 4HJ5A 2RHQB 1YZ6A 2YFAA 3A74A 2MJFB 2ENZA 3K8AA 3M85A 1HNWQ 1H0ZA 4POGA 2JAEA 3HKSA 3T1YL 4JI0L 4KHPL 1MIUA 2V53A 1BKBA 2I5MX 5K36G 2AWNA 5AJ3Q 4KLKA 3CCUA 5IWAL 4OXPA 4PZ6A 4OX9L 2UXCL 3KFUA 1OXUA 1LR9A 1SRUA 1EIYB 4JYAQ 3OL0A 5IYBG 1NTGA 3UDIA 4PZ7A 1TBOA 1PH2A 1HR0W 2CJSC 1Y1BA 1VQOA 2E2IH 1E3PA 1XPUA 4DR5Q 3G6EA 4HFVA 3KYHC 4A76A 1EYGA 3CPFA 1I94L 2RF4A 2YYZA 5C4JH 2WB1E 1JT8A 1EIFA 2SGDI 2ID0A 5IYCG 4A3FG 2CWPA 4PG3A 3AFPA 1X54A 4L5RC 3PGZA 2B8TA 4TVAB 4UP7A 4UXHA 4X64Q 1CKNA 1XTDA 1NE3A 1O7IA 2PI2A 5GADC 3HOUG 1HJPA 4B3RL 1WFQA 4GNXB 3CAMA 1JE5A 3S1QH 4L5SA 3KF8B 1V1QA 4LF8Q 2I5LX 1JJGA 3K7UC 4DUYQ 4LF7L 1KHIA 4B3TL 1PCEA 4E1RA 1CKNB 2JB1A 1IBKL 3UEJA 1IY6A 1Q1EA 4DR3L 1PH3A 3OXFA 5FJ8H 4C2MH 3CCVA 2YUUA 2D0PA 2JA7H 2KMQA 2BH2A 2UUBQ 3FBVA 4A3DG 3CC7A 3BZCA 1B8AA 4LFCQ 1CSQA 1G51A 4AYBG 1T9HA 2SGFI 2Q2HA 2EQSA 1VQBA 4A3DH 1PJUA 1PH7A 2Y0SE 3GTJH 2ZJPA 4RG1A 2NN6I 4X62Q 2JE6I 1CKMA 4BXXG 4GKKQ 2UZ3A 2I5HA 3HKZG 2VRWB 2E5RA 2L7XA 3FKIH 2JA1A 1PH1A 2VY3A 1HNXL 1HZ9A 3PDNA 1Y1VH 1J6QA 1V1HA 2VS1A 2QGQA 2ELIA 2NVYH 1MJEA 3CCRA 4DV3Q 4GLVB 1IL2A 4MZ9A 2JA8G 1WCMG 4R4IA 1VQHA 4I1TA 3CC4A 4GOPA 5C0XG 2CAZB 1KRSA 3K81C 2RHSB 2Z6KA 1CUKA 5H1SE 4OVOA 3U4VA 4DR6Q 1L1OC 1LUZA 1FAQA 4JOIA 3A5ZB 2A1AA 1E24A 4LF9L 3TS2A 3GTOH 1VQ6A 1VQ5A 2IX1A 1VS0A 2JB3A 1G291 4LFBQ 2YTXA 1H95A 1PH5A 2VQFL 1PH6A 1VQJA 3G48A 4LF5L 3F1ZA 1XMOL 3L0OA 1L1OA 4A93H 3AYHB 2JA6G 1DS3I 2IP6A 3VDPA 3J80i 1KQSA 4DR2L 4IJHA 3G4SA 3W1BA 3HOXH 2F66B 1FJGQ 2UU9Q 1GO3E 3K7AH 4X62L 4YWLA 4AS3A 2ES2A 1UVGA 2K19A 4DR7L 4A3JH 4DV4L 4DV6L 2K4KA 5HGQA 2IY5B 1PFSA 4L9MA 4HIOA 1MT1A 1Q46A 1M8BA 1SLJA 2KMPA 4UY8C 4K0KL 3JC66 2F3CI 1K0RA 2ZTCA 5FUXA 4DV5Q 3F2CA 1K83H 4DV2L 2PMZE 1N8RC 2P6AC 1N33Q 4DKAC 1TUSA 3DA4A 4A3BH 1VQGA 4NV2A 1Q1BA 1SGNI 1GVPA 4GN4B 2R92H 3PO2H 5IE8A 3SDJA 3CQZH 2OTLA 2OWOA 5EAYA 1WI5A 3LJ1A 2QEXA 1SMXA 4YY3L 1NMFA 3ULLA 2FXQA 3GTGH 2HHHQ 2R6GA 3RLOA 1AE2A 2K50A 1XNQQ 4JI7L 4NXML 4PL5A 5LMNQ 2L1LB 1A63A 3UGIA 3PUVA 4P75A 3J7ZC 4JI5L 4LFAQ 2VUMG 3MEFA 1JMCA 1FYBA 5JEAJ 2C35B 4UP8A 4LF6L 4BBSG 3ULJA 3NENA 2RCNA 4P73A 4XIGS 4A3LG 1QZGA 3EBEA 1PH9A 1OTCA 2ZM6L 1SGPI 5IYDG 3CPWA 3CCEA 4Y7NH 1OMTA 4GKJQ 4L5TA 1QUQB 3M7NA 3HOWH 1DS2I 4LF4L 2KCMA 1AN1I 4QL5A 2HIXA 4IPCA 1OMUA 2AMCB 1TGSI 3CCMA 2F3IA 4DV1L 3U50C 1V43A 1C9OA 4JI2L 3P23A 3HOYH 3EIVA 3HOZG 4YZDA 3OTOQ 1KC8C 2YTVA 4AIMA 3T1HQ 1TWFH 4APVA 5M3FH 4YHHL 1C7YA 1D8LA 3M3YH 4O1OA 4DV0Q 3KDFA 2E2JH 5FUVA 3F2DA 4DNIA 5EX3A 2YV5A 3JSBA 1S72A 3CCSA 1HNZQ 2CKZB 3S14H 1N32L 4AQYQ 2ORWA 3LJ2A 2OQKA 1Y1CA 2K5HA 4UXJA 1X74A 3PSIA 3I4MH 2MNAA 3H0GG 4IO9A 1Y1WG 2CQOA 4AYBE 5M3MG 3S1NH 2YQPA 2N78A 2IHEA 1Q8KA 4A3GG 1VQIA 2JZMA 3S15H 4NPSA 4LW1A 4GXTA 1B70B 3I4NH 4LUZA 4RMFA 3HKZE 4JI1L 1SGDI 1RL2A 1TURA 1Q86C 5M3MH 1A62A 3E59A 4C3JH 2N3SA 4B3MQ 2ZJQA 1VQEA 3UEYA 4X66L 3PIOA 2VZAA 4O1PA 4GNXC 1YVCA 2QQEA 4A3IG 2XTRA 1LR7A 3PUZA 1KRTA 3SGIA 1UWVA 2A20A 4DV7L 2MFIA 1XMQQ 4UXIA 3PUYA 5GAHC 3M4QA 1VQ8A 4EQ5A 4GNXA 4JI8Q 5IYBH 2KMOA 1YJNA 3F4MA 2QQDA 1TBQR 3RN5A 4AQYL 1YITA 1TWAH 1N36L 2UXDL 2KKMA 5FLMG 4HIKA 1A8VA 1HJAI 1PA6A 3UE0A 2N1AB 4A4IA 1SGYI 4PL4A 5IYCH 4A3FH 1HPTA 3UDXA 1HR0Q 5FLXc 4JV5Q 3D00A 1XBTA 1PVOA 4QJFA 5E7NA 1HNWL 3HOUH 2WVJA 1J5EQ 1SGEI 2BUSA 4JG2A 2AWOA 1A0IA 4BY1G 2PQAB 1TIHA 4B3ML 3Q8DA 5AJ3L 3I55A 4XTCS 4OO1I 3OVOA 3E2IA 2BA1A 4JI6Q 2UUCQ 3OYYA 1PYSB 1HZBA 4QIWE 5IP7G 2N17A 2NZHA 4X65Q 3LJ0A 4JYAL 1FL0A 1XNRQ 3M9BA 2IT1A 2F4VQ 1C0AA 3DO9A 1VQKA 3KP9A 2ERWA 1IXRA 3DA3A 3S2HH 4DR5L 1K73C 4JI3Q 4IFDI 3GDEA 1G6PA 1KIXA 4DK3C 1YEZA 1IBLQ 3UE1A 4OAVB 5CCLA 2Q2UA 2DGYA 2ASBA 3A5UA 3S24A 4GOPC 2PI2E 1KXLA 1VDDA 1P8LA 5HI7A 1YU6C 2Z6KC 4X64L 4BXXH 1NBWA 1R79A 3AQQA 2AKWB 4JOIC 1VQFA 1R9TH 2E5LQ 1JJCB 2UXBQ 3B4VC 4E1PA 4LF8L 2CWAA 2L15A 4O0AA 5HGIA 4GLAC 4A3EG 2ATWA 1PHJA 4DUYL 2JA8H 2AHOB 2UUAQ 1WCMH 2PNHA 3KOJA 4BY7G 1GD7A 2ZTEA 3LGJA 4HJ8A 4HJAA 2OVOA 1X65A 1TWCH 3RNUA 1UE5A 2A8VA 1CT0I 1XJVA 3GD7A 5M5WH 2W0TA 3PV0A 2N49A 3H3VH 4O2DA 4X65L 5IP9G 4IOAA 2UUBL 4DAMA 3CW2C 2MO0A 3GTQH 4LFCL 1YHBA 4P72A 5LMUQ 2VQEQ 3TEHB 4ALPA 3TS0A 1M90C 1FARA 4BA1I 1XPRA 3BZKA 4DUZQ 2CFMA 1AE3A 2JA6H 2R93G 1EQRA 1ASZA 2WP8J 4GKKL 2JA5G 1BUSA 4B3SQ 1KBFA 1X4SA 5ELNA 1UE7A 1VQ7A 1XA6A 3PO3G 5C0XJ 1BMOA 1E1OA 2JXDA 1X6OA 4P74A 2OCEA 1P16A 1QZHA 1PTQA 1PYBA 1IBMQ 4DV3L 4LUOA 2WAQG 2UXBL 3PIPA 2GVBA 3L7ZC 1PTRA 5BR8Q 3AFQA 4DPGA 4PL3A 1IW4A 1UEBA 5M5XH 4X6AH 4FKDA 4DR6L 3M4PA 3RZDH 4HGUA 2VW9A 3E9IA 3J81c 4IJLA 3KJPA 1Q12A 1CGJI 3S1MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8L A;  2EIF A;  3M3Y H;  3AFP A;  4DV0 Q;  4OWT B;  1X54 A;  3KDF A;  4DV2 Q;  2E2J H;  4L5R C;  3PGZ A;  4LFB L;  4TVA B;  4UP7 A;  5IY0 A;  2GN5 A;  3F2D A;  4X64 Q;  4DNI A;  2D62 A;  2YV5 A;  4IPG A;  3WWV A;  3L2P A;  1CKN A;  1S72 A;  1NMG A;  4A3E H;  1XTD A;  1NE3 A;  1O7I A;  3CCS A;  4QQB X;  2PI2 A;  2GVA A;  1HNZ Q;  4JI6 L;  2CKZ B;  5GAD C;  2MO1 A;  4PMW A;  2UUC L;  3HOU G;  3S14 H;  1N32 L;  4AQY Q;  1HJP A;  4B3R L;  1WFQ A;  4GNX B;  4BY7 H;  3CAM A;  2OQK A;  1JE5 A;  2K5H A;  3S1Q H;  4L5S A;  1VQD A;  2N8N A;  2XTI A;  1UE6 A;  3KF8 B;  3U58 A;  3PSI A;  3I56 A;  3I4M H;  1V1Q A;  2MNA A;  4OWW B;  4LF8 Q;  3H0G G;  1EWI A;  4IO9 A;  1Y1W G;  1Z9F A;  1TWH H;  2I5L X;  1JJG A;  1YBY A;  1M1K C;  2CQO A;  4AYB E;  1XNR L;  2V1C C;  2F4V L;  3U4Z A;  1FJG L;  2UU9 L;  1JB7 A;  3UDF A;  4NXN Q;  4YWM A;  1EQQ A;  1SE8 A;  4C3H H;  3K7U C;  1SR3 A;  4DUY Q;  2WB1 G;  3D0F A;  4A93 G;  5M3M G;  1K3R A;  4LF7 L;  3EN2 A;  1SN8 A;  2IHE A;  1Q8K A;  2N78 A;  3S1N H;  1PV4 A;  1X56 A;  5IP9 H;  4A3G G;  1VQI A;  2HQL A;  3S15 H;  1QUQ A;  1KHI A;  4NPS A;  4YY3 Q;  4B3T L;  4JI3 L;  4LW1 A;  1FGU A;  4POF A;  1CKN B;  1B70 B;  3F2B A;  4GOP B;  3I4N H;  2QA4 A;  1IBK L;  1QVC A;  3TRE A;  1IBL L;  1X3F A;  1Q1E A;  1I50 H;  4LUZ A;  4DR3 L;  1PH3 A;  4RMF A;  3HKZ E;  4JI1 L;  3PF5 A;  2R7F A;  5FJ8 H;  4IPD A;  4A3C G;  1RL2 A;  4C2M H;  2VUM H;  4YCU A;  5M3M H;  3CCV A;  1A62 A;  1Q86 C;  3HOX G;  4JBM A;  4HJ9 A;  5GQO A;  5C44 G;  3KLW A;  3CF5 A;  1MJC A;  4DR1 Q;  4GLX A;  1OXX K;  4C3J H;  2D0P A;  2N3S A;  3F8T A;  3BJU A;  2JA7 H;  4YWK A;  4JI7 Q;  1EUJ A;  4B3M Q;  2VL6 A;  4OO1 G;  4NXM Q;  2ZJQ A;  4DV5 L;  4A3J G;  2BH2 A;  1XPO A;  1VQE A;  4X66 L;  1I6H H;  2UUB Q;  3HOV G;  2R93 H;  4GS3 A;  3PIO A;  3D31 A;  5ELO A;  1NY4 A;  4KI0 A;  4OWX B;  4A3D G;  4BBS H;  4HIM A;  3S17 H;  4LWC A;  3CC7 A;  3W5O A;  3S1R H;  3BZC A;  1N33 L;  2OTJ A;  1VQ4 A;  2VZA A;  4HJ7 A;  1B8A A;  1KD1 C;  2Q2T A;  4JI5 Q;  3GO5 A;  4A3L H;  2JA5 H;  4GNX C;  2I0Q A;  4LFC Q;  1YVC A;  2MQH A;  1CSQ A;  1G51 A;  3B6Y A;  4AYB G;  1N9W A;  4A3I G;  1T9H A;  4DR4 L;  4MNO A;  2Q2H A;  1Q81 C;  2HIV A;  2EQS A;  3PUZ A;  1KRT A;  2E5L L;  1VQB A;  5IYD H;  5GRO A;  3PO3 H;  4A3D H;  1PH7 A;  3J80 c;  2Y0S E;  1YNX A;  3GTJ H;  2ZJP A;  1L1O B;  3SGI A;  1UWV A;  4DV7 L;  3W1G A;  3J81 i;  4RG1 A;  2NN6 I;  4X62 Q;  4LF6 Q;  2MFI A;  1XMQ Q;  3PUW A;  2JE6 I;  3I7F A;  4BBR G;  2KHJ A;  3T1Y Q;  1CKM A;  4JI0 Q;  3DLL A;  4BXX G;  3PUY A;  4A3B G;  4GKK Q;  4IFD G;  4KHP Q;  5GAH C;  2OQ0 A;  2I5H A;  3HKZ G;  1WJJ A;  3M4Q A;  1VQ8 A;  4EQ5 A;  1E22 A;  2ZJR A;  3K0X A;  2ZM6 Q;  5JJL A;  2UUA L;  2K52 A;  3A0J A;  3NEM A;  4GNX A;  2NN6 G;  4JI8 Q;  5IYB H;  4LUV A;  3FKI H;  5IWA Q;  2LSS A;  4YCW A;  1B7Y B;  4BBR H;  1YJN A;  1PH1 A;  2VY3 A;  1RIP A;  1HNX L;  1HZ9 A;  4OX9 Q;  2R92 G;  3IRB A;  4MTN A;  1Y1V H;  5HY6 A;  3PO2 G;  4GN5 A;  3NBH B;  3RN5 A;  1J6Q A;  3E0E A;  5JEA G;  4R4O A;  5C3E G;  2HHH L;  3ERS X;  1ASY A;  2VS1 A;  2QGQ A;  5GAG C;  4AQY L;  1YIT A;  4LF4 Q;  4WJ4 A;  1TWA H;  2K75 A;  3CMA A;  1N36 L;  2NVY H;  2UXD L;  1OXT A;  1MJE A;  1XNQ L;  5FLM G;  3CCR A;  4DV3 Q;  4GLV B;  3CCJ A;  4HIK A;  4MZ9 A;  1IL2 A;  3HOZ H;  1A8V A;  2JA8 G;  5LMN W;  2K5N A;  1PA6 A;  4NB3 A;  3UE0 A;  2K5V A;  4A4I A;  1WCM G;  4Y52 H;  4R4I A;  2ALY B;  1VQH A;  4EX5 A;  2D0O A;  5IYC H;  4A3F H;  5LMN L;  4DV1 Q;  3CC4 A;  4GOP A;  1W3S A;  2Y0S G;  5C0X G;  3RN2 A;  1KRS A;  5DLQ E;  3PF4 A;  3UDX A;  4NXN L;  3K81 C;  1HR0 Q;  4HID A;  2RHS B;  4LFA L;  2Z6K A;  1CUK A;  5LMU L;  2WFW A;  5FLX c;  2VQE L;  5H1S E;  3JAM c;  1YJ9 A;  3CCL A;  1Y14 B;  4JV5 Q;  4JI2 Q;  3U4V A;  4DR6 Q;  2IX0 A;  1L1O C;  1LUZ A;  1PVO A;  1I94 Q;  4QJF A;  2KCT A;  2JQO A;  3HFZ B;  1Z47 A;  5E7N A;  4JOI A;  4DUZ L;  1HNW L;  1BVS A;  2BA0 A;  1TXY A;  3A5Z B;  2A1A A;  1E24 A;  4LF9 L;  3HOU H;  3TS2 A;  2NVX H;  3FHW A;  4YHH Q;  1CSP A;  4UPA A;  1J5E Q;  3GTO H;  3TRZ A;  1VQ6 A;  3GTL H;  1VQ5 A;  4JG2 A;  2IX1 A;  1VS0 A;  2AWO A;  1A0I A;  1G29 1;  1GKH A;  4BY1 G;  2PQA B;  2YU9 H;  2YTX A;  3H0G H;  1Y1W H;  1PH5 A;  1U5K A;  4B3S L;  2B63 G;  4JI4 Q;  4LFB Q;  3UDG A;  3Q8D A;  5AJ3 L;  4DK6 C;  4XTC S;  3I55 A;  4B3M L;  2VQF L;  1S40 A;  1PH6 A;  1VQJ A;  4PZ8 A;  1X3G A;  1WOC A;  4KHZ A;  1DGS A;  3G48 A;  4LF5 L;  4OO1 I;  1HZA A;  3F1Z A;  1XMO L;  2KEN A;  4IFD J;  2BA1 A;  4JI6 Q;  3AEV A;  2XGT A;  3L0O A;  1L1O A;  4L5Q A;  3ICE A;  3M4O H;  3AYH B;  1OXV A;  2UUC Q;  4A93 H;  3OYY A;  5J3B A;  3CCQ A;  1N32 Q;  1EOV A;  2JA6 G;  3K80 C;  4ME3 A;  4GKJ L;  4B3R Q;  1PYS B;  3STB C;  3S2D H;  1HZB A;  2E8G A;  2JA9 A;  2KHI A;  4QIW E;  3CP0 A;  4A3G H;  2B63 H;  2JJQ A;  5IP7 G;  3J80 i;  2KBN A;  1YHQ A;  1KQS A;  2NZH A;  4X65 Q;  1H95 A;  4DR2 L;  3CD6 A;  4IJH A;  4AH6 A;  1QVG A;  2VNU D;  4IOC A;  1IBM L;  4JYA L;  1FL0 A;  5IT9 c;  3W1B A;  3G4S A;  4A3C H;  4WJ3 M;  4JC0 A;  3M9B A;  2IT1 A;  4OON A;  1XNR Q;  2F4V Q;  3HOX H;  1FJG Q;  1VQC A;  2UU9 Q;  1LTL A;  1C0A A;  1GO3 E;  3K7A H;  4X62 L;  5C44 H;  4YWL A;  5BR8 L;  2ES2 A;  1VQK A;  1X3E A;  1IXR A;  4LF7 Q;  4DR7 L;  3S2H H;  4DR5 L;  4A3J H;  4DV4 L;  4DV6 L;  2K4K A;  1K73 C;  5HGQ A;  4B3T Q;  3HOV H;  2H5X A;  4JI3 Q;  4IFD I;  3VDY A;  2IY5 B;  1PFS A;  3GDE A;  1KAW A;  1KIX A;  1G6P A;  3HOW G;  1IBK Q;  4DK3 C;  1YEZ A;  1IBL Q;  3UE1 A;  4GN3 B;  4DR3 Q;  4JI1 Q;  1I5F A;  4UP9 A;  4HIO A;  3BU2 A;  3OTO L;  1Q46 A;  3TQY A;  2NVT H;  3S16 H;  2Q2U A;  1SLJ A;  2Q2I A;  4DAY B;  4A3I H;  1SFO H;  3J7A 5;  2K14 A;  4LNQ A;  3T1H L;  1U0L A;  2UUA Q;  1SRO A;  2DGY A;  4UY8 C;  4K0K L;  2ASB A;  3A5U A;  4R4C A;  1E1T A;  3JC6 6;  1K0R A;  2ZTC A;  3RR5 A;  1X55 A;  1VQL A;  3RLF A;  3S24 A;  3F2C A;  4DV0 L;  2PI2 E;  4DV5 Q;  1K83 H;  4GOP C;  4X66 Q;  5C4X G;  1KXL A;  4DV2 L;  1WYD A;  2PMZ E;  1L0W A;  1P8L A;  1N8R C;  2B3G A;  2E2H H;  3KJO A;  3HOY G;  2Z6K C;  4X64 L;  1N33 Q;  4DKA C;  1JJ2 A;  3E9H A;  1X9N A;  4BXX H;  1Q7Y C;  4A3B H;  1NBW A;  3CXC A;  1VQG A;  4QY7 A;  3GTM H;  1LM0 A;  1GM5 A;  1YIJ A;  3JAM i;  2A19 A;  4R1J A;  1Q1B A;  3AQQ A;  2UXC Q;  1HNZ L;  2AKW B;  1GVP A;  4A75 A;  1Q82 C;  5C4X H;  4JBJ A;  4JOI C;  1VQF A;  5C0X I;  2EXD A;  5M3F G;  1VQP A;  1R9T H;  2E5L Q;  1JJC B;  4A3K G;  4GN4 B;  1BBU A;  3ULP A;  4H02 A;  3GTK H;  2UXB Q;  4DV7 Q;  2R7Z G;  2PQA A;  3GTP H;  1AH9 A;  4JCV E;  3I2Z A;  3ZJY C;  4LF8 L;  2R92 H;  3PO2 H;  3PUX A;  2CWA A;  5IE8 A;  2L15 A;  4O0A A;  1K9M C;  5C3E H;  3H3V I;  4J15 A;  1VQN A;  3CQZ H;  4GLA C;  2OTL A;  1LYL A;  4JBW A;  2JEB I;  4A3E G;  2OWO A;  1EFW A;  5EAY A;  1HH2 P;  2ATW A;  5FLM H;  2LXK A;  4A3K H;  2DUD A;  3G71 A;  4DUY L;  1PHJ A;  4A3M G;  3MXN B;  1KL9 A;  4FDB A;  2JA8 H;  5M5Y H;  1OXS C;  2AHO B;  1N34 Q;  1VCI A;  2B29 A;  1S3O A;  1WI5 A;  1WCM H;  4R4Q A;  2PNH A;  1HZC A;  3KOJ A;  2QEX A;  1W2B A;  2R7Z H;  1SMX A;  4BY7 G;  3RLN A;  3STB D;  4YY3 L;  1GD7 A;  4JI4 L;  1VQM A;  2ZTE A;  1V9P A;  1MKH A;  3LGJ A;  3NEL A;  4HJ8 A;  1VQ9 A;  4HJA A;  4QGU A;  1NMF A;  3ULL A;  1HNX Q;  2FXQ A;  3I4M G;  3GTG H;  3ER0 A;  1X65 A;  1YJW A;  2NZO A;  3KF6 A;  1TWC H;  3RNU A;  4A3M H;  2HHH Q;  1UE5 A;  3I4O A;  2R6G A;  3RLO A;  2A8V A;  1XJV A;  5JJI A;  3GD7 A;  5M5W H;  2NVQ H;  1K8G A;  1AE2 A;  1N36 Q;  2K50 A;  1I3Q H;  2UXD Q;  1YI2 A;  1XNQ Q;  4DR1 L;  3PV0 A;  2N49 A;  2Z0S A;  3H3V H;  4O2D A;  4X65 L;  4JI7 L;  5JJK A;  4NXM L;  5IP9 G;  5GAE C;  4IOA A;  4TQU S;  2UUB L;  1NJI C;  5LMN Q;  4DAM A;  2F52 A;  2IHF A;  3CW2 C;  3DM3 A;  2JEA I;  3I4N G;  2MO0 A;  4P71 A;  1A63 A;  3PUV A;  4P75 A;  3GTQ H;  4JBK A;  3J7Z C;  4JI5 L;  4R4T A;  1UE1 A;  4LFA Q;  1QVF A;  4LFC L;  1YHB A;  3KDF B;  4P72 A;  2RHQ B;  5FJ8 G;  2VQE Q;  3TEH B;  5LMU Q;  4HJ5 A;  3MEF A;  2CCZ A;  4BY1 H;  2LXJ A;  2VUM G;  1YZ6 A;  4ALP A;  3TS0 A;  1M90 C;  2WAQ E;  3A74 A;  1L2F A;  3PCO B;  2JA7 G;  4BA1 I;  1XPR A;  1JMC A;  3BZK A;  1D7Q A;  3K8A A;  3M85 A;  4DUZ Q;  1HNW Q;  2CFM A;  1AE3 A;  3KF6 B;  4LF9 Q;  2JA6 H;  2R93 G;  1EQR A;  1IZ6 A;  5JEA J;  1CKO A;  4POG A;  2C35 B;  4UP8 A;  4LF6 L;  4BBS G;  1XMQ L;  3HKS A;  3NEN A;  3ULJ A;  5IP7 H;  1PH8 A;  1IYJ B;  2RCN A;  4P73 A;  4XIG S;  1ASZ A;  1VQA A;  3T1Y L;  2WP8 J;  4JI0 L;  4A3L G;  4GKK L;  1QZG A;  4KHP L;  2JA5 G;  3EBE A;  1PH9 A;  1MIU A;  1BKB A;  4B3S Q;  2I5M X;  1OTC A;  3H15 A;  5K36 G;  2AWN A;  5ELN A;  5AJ3 Q;  1UE7 A;  3FP9 A;  1VQ7 A;  2ZM6 L;  4C3I H;  2VQF Q;  4KLK A;  3CCU A;  1FVI A;  4LF5 Q;  4JI8 L;  5IYD G;  3PO3 G;  1XMO Q;  5C0X J;  5IWA L;  3CPW A;  3CCE A;  4Y7N H;  1E1O A;  2R7D A;  4OXP A;  4PZ6 A;  4GKJ Q;  1X6O A;  4OX9 L;  1E7Z A;  4L5T A;  1QUQ B;  4P74 A;  2OCE A;  2UXC L;  3KFU A;  3M7N A;  1OXU A;  4DR2 Q;  1P16 A;  1QZH A;  3HOW H;  3OW2 A;  1PYB A;  4LF4 L;  2KCM A;  1IBM Q;  1SRU A;  1EIY B;  4JYA Q;  4YCV A;  4DV3 L;  4LUO A;  2WAQ G;  2UXB L;  4QL5 A;  2HIX A;  3PIP A;  2GVB A;  2ZTD A;  4IPC A;  2AMC B;  3L7Z C;  5IYB G;  3CME A;  1NTG A;  4IPH A;  3UDI A;  1K8A C;  4PZ7 A;  3CCM A;  3FKI G;  2F3I A;  3AFQ A;  5BR8 Q;  4DPG A;  3J81 j;  4DV1 L;  1PH2 A;  1HR0 W;  1VQO A;  2E2I H;  1E3P A;  4DR4 Q;  1UEB A;  1XPU A;  4DR7 Q;  3U50 C;  5M5X H;  4DR5 Q;  1V43 A;  4DV4 Q;  4DV6 Q;  1TWG H;  1Y1V G;  1BBW A;  1HR0 L;  2BH8 A;  3G6E A;  4BA2 I;  2YTY A;  1C9O A;  4X6A H;  4JV5 L;  4JI2 L;  3KYH C;  2HT1 A;  1N34 L;  3HOY H;  2JK8 A;  1YHA A;  3EIV A;  4A76 A;  1EYG A;  3CPF A;  3M4P A;  3RZO H;  4DR6 L;  1PH4 A;  1I94 L;  2RF4 A;  3RZD H;  2YYZ A;  5C4J H;  3OTO Q;  3HOZ G;  2WB1 E;  1KC8 C;  1JT8 A;  2VW9 A;  2YTV A;  1EIF A;  3CC2 A;  4AIM A;  3T1H Q;  2ID0 A;  3E9I A;  5IYC G;  1TWF H;  4A3F G;  2CWP A;  4PG3 A;  4APV A;  4IJL A;  3J81 c;  4YHH L;  3KJP A;  5M3F H;  4K0K Q;  1J5E L;  1Q12 A;  1C7Y A;  3S1M H; 
#chains in the Genus database with same CATH topology
 3MEK A;  2O4X A;  5KNB A;  4OWT B;  2NB0 A;  2QW7 A;  4LFB L;  4A24 A;  1SSO A;  4H44 C;  2RDF A;  2L12 A;  1K7V A;  4M1U B;  2V6E A;  2L5T A;  5IT9 L;  4IPG A;  3WWV A;  3L2P A;  1EY4 A;  1BNZ A;  1RCV D;  1KAA A;  1RHP A;  2K9H A;  3QAH A;  4QQB X;  2GVA A;  5F2D A;  3SGQ I;  2B2U A;  4PMW A;  2F0M A;  2ORV A;  2AUK A;  3FEW X;  3MC0 B;  2GKR I;  4WP4 A;  5I4D A;  1JQO A;  1LTS D;  1DM0 B;  2PW5 A;  1AFP A;  3TN2 A;  2N8N A;  2XTI A;  5IGC A;  2RAD A;  1UE6 A;  2Z4H A;  3CXL A;  3I56 A;  2PZU A;  4OWW B;  1EWI A;  1KMA A;  1Z9F A;  3VR4 A;  1TWH H;  2F0K A;  1YBY A;  1S5C D;  4Z9C B;  2V1C C;  3U4Z A;  3TSS A;  1DJR D;  1FJG L;  2XTQ A;  4DNC A;  2UU9 L;  1JB7 A;  1R0R I;  3UDF A;  4NXN Q;  3R5A A;  4G57 A;  3OMG A;  4CBV A;  2RC4 A;  3R5B A;  1QUQ A;  3P20 A;  1CM9 A;  4POF A;  1Y8F A;  1SYE A;  2OD1 A;  2N55 A;  4NMZ A;  2BE5 D;  1X3F A;  2NU3 I;  1EYA A;  2EOT A;  5JHW C;  3KLS X;  2R7F A;  2WKC A;  4IPD A;  4FXK C;  4A3C G;  2VUM H;  3OIP A;  2JYY A;  2SGQ I;  2ENN A;  4JBM A;  3HOU B;  1SBB B;  3VA9 A;  3Q6S A;  5C44 G;  3CF5 A;  5CCM A;  1MJC A;  4DR1 Q;  1OXX K;  4CDC C;  4YWK A;  2V1C A;  2QQC A;  1EUJ A;  1HFG A;  2VL6 A;  4DV5 L;  1XPO A;  2N71 A;  2A2C A;  5KND A;  4HCE A;  1I6H H;  1XYI A;  5JVG 3;  3HOV G;  3TO6 A;  1A15 A;  5ELO A;  4KI0 A;  2N52 A;  4BBS H;  3HGB A;  2OTJ A;  1N33 L;  2K04 A;  2LFN A;  5G3L F;  2B2W A;  4HJ7 A;  1HUM A;  1VQ4 A;  2Q2T A;  4A3L H;  2I0Q A;  2MQH A;  2PW7 A;  3B6Y A;  1N9W A;  4O42 A;  4J8Q A;  1SYF A;  2SOB A;  1V1I A;  1Q81 C;  2BE5 C;  2C5C A;  5DAU A;  5IYD H;  5GRO A;  5E3R A;  4FF1 A;  1EY6 A;  1UUC A;  2B2Y A;  1ET6 A;  1LT3 D;  3PUW A;  4BBR G;  3T1Y Q;  4JI0 Q;  1OVO A;  1STN A;  3DLL A;  4KHP Q;  1I4P A;  3VYU A;  1GUW A;  2R61 A;  1WJJ A;  4M8A A;  4PMB A;  3A0J A;  3NEM A;  4LMQ D;  5IWA Q;  2B2T C;  1CGI I;  4YCW A;  1B7Y B;  4BBR H;  1WTO A;  3MEH A;  4OX9 Q;  3IRB A;  4MTN A;  4IUP A;  2DNE A;  4GN5 A;  2SGP I;  3E0E A;  3SEK C;  5C3E G;  3IL8 A;  2HHH L;  1ASY A;  2M00 A;  4WJ4 A;  2K75 A;  5CBA E;  1TII D;  3CMA A;  4K6D A;  3H3V C;  1VF7 A;  1WD0 A;  1XNQ L;  3CCJ A;  3HOZ H;  2F0F A;  1SGR I;  2K5N A;  1SJE D;  2K5V A;  2D9U A;  4Y52 H;  2LUY A;  2ALY B;  1RFH A;  1ZYR C;  5LMN L;  3I9V 1;  1EWH A;  1W3S A;  3RN2 A;  4NXN L;  5EBD A;  3HKZ B;  2L8E A;  4LFA L;  4DAV A;  1YJ9 A;  1EQV A;  3JAM c;  4QMG A;  3LNN A;  3U9O A;  5EX0 A;  1TWG B;  2IX0 A;  3QOJ A;  1I94 Q;  4H7B A;  3KLS A;  1Z6H A;  2QDL A;  2KCT A;  3RZO B;  2PZW A;  2PNR C;  1O7Y A;  4U68 A;  2F3V A;  1CSP A;  2F6M B;  3TRZ A;  2BOS A;  3OXG A;  2ODD A;  3DEP A;  3VR6 A;  5EPL A;  1WGT A;  1JWM D;  4H0L C;  4G75 A;  1CK1 A;  2YU9 H;  3H0G H;  4K2K A;  1Y1W H;  2B63 G;  1U5K A;  3QTL D;  3J7Y W;  1S40 A;  3C2P A;  1FD7 D;  1WOC A;  1MJA A;  1SE4 A;  2RVL A;  1H9K A;  1M4V A;  2KEN A;  4CKB A;  1H9J A;  2XGT A;  3ICE A;  4L5Q A;  4IUR A;  2E74 C;  5J3B A;  3UI2 A;  3CCQ A;  4A3E B;  4ME3 A;  4GKJ L;  4WFN 3;  2X69 A;  3STB C;  2QZG A;  3S2D H;  2E8G A;  4A3G H;  4B3R Q;  2CWH A;  1TWC B;  2B63 H;  2JJQ A;  1YHQ A;  3BDC A;  2K03 A;  3CD6 A;  4AH6 A;  2RCF A;  3TO9 A;  2VNU D;  1A3U A;  3TBI B;  4RH6 A;  1PTO B;  2RSO A;  4X3S A;  3KK7 A;  1GUO A;  1YO7 A;  3TZD A;  1VQC A;  3TJQ A;  1LTL A;  3MXG A;  1SJ8 A;  5I9O A;  2HQE A;  1B4O A;  4LF7 Q;  5DAE A;  5I6W A;  4C3H B;  1CHO I;  3C46 A;  2RBM A;  4B3T Q;  2A6E C;  2X6L A;  2H5X A;  1BCP B;  1JR0 D;  3EQL C;  3VDY A;  3EA6 A;  3OXL A;  3TP6 A;  1KAW A;  1I4H A;  1IBK Q;  1Z7T A;  4GN3 B;  2JW6 A;  4DR3 Q;  1I5F A;  1SNP A;  2FMM A;  1QWY A;  3PIP 3;  3OTO L;  3TQY A;  2NVT H;  2TSS A;  5NUC A;  1UAP A;  4A3I H;  3J7A 5;  2JA6 B;  2F1M A;  1HFN A;  4LNQ A;  3F2U A;  3T1H L;  2J4X A;  1GUN A;  4EQN A;  3OSO A;  4R4C A;  3RR5 A;  3W2D A;  1X55 A;  1VQL A;  3A54 A;  3I4L A;  3N6R A;  5KIX A;  4DV0 L;  1JOO A;  2J87 A;  2EYM A;  3K0Y A;  1L0W A;  2NU4 I;  4HCS A;  3K5M A;  3KJO A;  1UEA B;  2Y0M A;  2NU1 I;  2XWB B;  1JJ2 A;  2R93 B;  1X9N A;  4QY7 A;  5K5P A;  3S17 B;  3S1R B;  1V1P A;  2M5X A;  2NU0 I;  5FOB B;  1HNZ L;  4A75 A;  2JA5 B;  1RF2 D;  4G7O C;  1VQP A;  5C0X I;  2EXD A;  1TBN A;  3K5L A;  5KEE A;  2CWG A;  1ILQ A;  4A3K G;  1BBU A;  1LV9 A;  2Z8L A;  4Z7G A;  2R7Z G;  2PQA A;  3GTP H;  4JCV E;  3ZJY C;  3PUX A;  3DWA A;  3BJI A;  4DU9 A;  3H3V I;  2GSC A;  1QIL A;  4RKL A;  1LYL A;  2FU2 A;  3V05 A;  1EFW A;  1HH2 P;  4ID6 A;  5FLM H;  4A3K H;  2DUD A;  4KJO A;  3G71 A;  4A3M G;  3MXN B;  4FDB A;  5M5X B;  1OXS C;  1N34 Q;  1VCI A;  2R7Z H;  4R4Q A;  4QIW B;  3RLN A;  3MZ5 A;  1F9S A;  4DXF A;  1I4R A;  2WAQ B;  1VQM A;  1Z7K B;  1MKH A;  1ENA A;  3NEL A;  5COR A;  1EZ8 A;  1VQ9 A;  4QGU A;  5HQ8 A;  1HNX Q;  1BBX C;  1MBY A;  3QWP A;  2RIO A;  2J9R A;  3ER0 A;  3Q0A A;  1YJW A;  3KF6 A;  1BO0 A;  4A3M H;  2SGE I;  3TOB A;  2LEO A;  2DN8 A;  5JJI A;  3DM1 A;  1WTP A;  5E3Q A;  3K5O A;  1LT4 D;  2QQ0 A;  2NU2 I;  4HAE A;  4IUU A;  4X3T A;  5FUY A;  1WTX A;  5CV4 A;  5GAE C;  2LB7 A;  2F0D A;  3GOX A;  2F52 A;  2IHF A;  3NP8 A;  2ARP F;  4KK7 A;  3A8K E;  4RA8 A;  4XYQ A;  5FJ8 G;  2FJ2 A;  4BY1 H;  2CCZ A;  3ND8 A;  2LXJ A;  1U4L A;  2WAQ E;  3I8Z A;  1L2F A;  3PCO B;  4FVM A;  2JA7 G;  2UVO A;  1D7Q A;  4C3I G;  3KF6 B;  4LF9 Q;  2P22 B;  1ROD A;  3VR5 A;  4GI3 C;  4QUC A;  1IZ6 A;  1CKO A;  3L0I A;  1XMQ L;  5IP7 H;  1PH8 A;  5E3P A;  3IAS 1;  2DKV A;  1IYJ B;  1CE3 A;  1VQA A;  1HHV A;  3NSW A;  2L11 A;  2BDO A;  3GTL B;  3UGD A;  3H15 A;  5C4H A;  3FP9 A;  2VQF Q;  4C3I H;  1FVI A;  4LF5 Q;  5LNK 1;  1NCV A;  4JI8 L;  1XMO Q;  4Q9V A;  1D6E C;  1MHW C;  3VYT A;  2OXP A;  4YZC A;  1DYQ A;  2QGM A;  2R7D A;  5D65 A;  1QOH A;  3IAY A;  1RJT A;  1E7Z A;  1F2Z A;  1HRJ A;  4Z7H A;  4DR2 Q;  2MUY A;  3DHQ A;  3OW2 A;  4YCV A;  5A35 A;  3WOF A;  3O13 A;  4B6D A;  2CVR A;  3D3R A;  1D5M C;  1I6H B;  2ZTD A;  3CME A;  3I73 A;  4IPH A;  1K8A C;  2E73 A;  3FKI G;  2CWF A;  3J81 j;  4DR4 Q;  5C44 B;  4DR7 Q;  1IY5 A;  4DV4 Q;  3NHH A;  4DV6 Q;  1AP0 A;  1TWG H;  1Y1V G;  1BBW A;  1HR0 L;  2BH8 A;  3UGL A;  4BA2 I;  1EYD A;  2YTY A;  5C4Z A;  4JV5 L;  2HT1 A;  1N34 L;  3RZO H;  2JK8 A;  1LTB D;  1I4Q A;  1YHA A;  3HOV B;  3HS0 C;  2HCC A;  5HGT A;  1PH4 A;  3EFX D;  4KN4 C;  5JAV A;  3EJI A;  3ONA B;  1CT2 I;  3CKI B;  3CC2 A;  3S16 B;  2IW3 A;  4F88 A;  1J5E L;  4K0K Q;  1SFO B;  4HR7 B;  2XRC A;  3DWQ A;  2F03 A;  2EIF A;  1KNE A;  2DB6 A;  3R3O A;  2EVB A;  2A2D A;  4LK1 C;  4X3K A;  4DV2 Q;  3X3N A;  5IY0 A;  2GN5 A;  2Z9H A;  1A2T A;  2D62 A;  3TP7 A;  2KCX A;  1EY7 A;  2NTT A;  3N52 A;  2E2H B;  1NMG A;  2X6G A;  4A3E H;  4BBR B;  4KHV A;  3TOA A;  3HRZ C;  4JI6 L;  2H1E A;  1N13 A;  1M8C A;  2MO1 A;  2UUC L;  3GTM B;  2A6H D;  1LT5 D;  3SXH A;  2L0C A;  4BY7 H;  4HMI A;  3I70 A;  1VQD A;  4DAP A;  5A2Q L;  3U58 A;  2SNS A;  1PTO H;  3MWY W;  4JPB W;  3HOZ B;  5IGD A;  4FF3 A;  1AN8 A;  1UHA A;  1PXU A;  3GTK B;  1F9R A;  1M1K C;  1CSO I;  1XNR L;  1E2V A;  4EVO A;  1QG7 A;  5FKA C;  2F4V L;  1HUN A;  3FC3 A;  1NAP A;  1HDL A;  4IZ8 A;  4YWM A;  1IW7 C;  1SE8 A;  1V8Q A;  2GA4 B;  1EQQ A;  4C3H H;  5C3E B;  1SR3 A;  2WB1 G;  3D0F A;  4A93 G;  2WCY A;  2R3Z A;  1CT4 I;  1K3R A;  3EN2 A;  1SN8 A;  1PRT C;  2JXM B;  1SGQ I;  1PV4 A;  1X56 A;  4KTA A;  5IP9 H;  2HQL A;  4YY3 Q;  4C56 C;  1STA A;  4JI3 L;  1FGU A;  5M5Y B;  4NV5 A;  3F2B A;  4GOP B;  2PZT A;  2QA4 A;  3SVM A;  1AZQ A;  1QVC A;  2A6H C;  3TRE A;  1IBL L;  1I50 H;  4KY7 A;  1B50 A;  1E2Z A;  3PF5 A;  4C1N K;  4K5W A;  4YCU A;  1O80 A;  3HOX G;  4HJ9 A;  2X52 A;  5GQO A;  3KLW A;  4FYD A;  4GLX A;  2OF1 A;  3F8T A;  3BJU A;  4JI7 Q;  5LL6 S;  1PZJ D;  1I3Q B;  1UVF A;  4OO1 G;  2FNF X;  4NXM Q;  4A3J G;  1WTV A;  2YU9 B;  2F0W A;  2EDG A;  3BYY B;  1T5X D;  4GS3 A;  3D31 A;  2R93 H;  1YTP A;  1NY4 A;  5D14 A;  4OWX B;  4IUV A;  5CV6 A;  4HIM A;  3S17 H;  4LWC A;  3S1R H;  3W5O A;  4JI5 Q;  1KD1 C;  3GO5 A;  2JA5 H;  1PPF I;  2BL8 A;  1A2U A;  3NTH A;  4DR4 L;  2B8F A;  2B39 A;  4MNO A;  1GUG A;  4U6R A;  4ZUI A;  2DIP A;  4WOR A;  2HIV A;  1B9N A;  3P1H A;  4G76 A;  2MP1 A;  2B63 B;  5IOD A;  2E5L L;  5FUW A;  3T13 A;  3PO3 H;  2XRS D;  1EFI D;  1F9P A;  3J80 c;  1HA5 A;  1TBR R;  1YNX A;  1L1O B;  4K2L A;  2XMX A;  3W1G A;  3J81 i;  4LF6 Q;  4YIJ A;  3I7F A;  5CYU A;  2KHJ A;  1NUB A;  4A3B G;  3MHB A;  4IFD G;  1S20 A;  2OQ0 A;  3LX0 A;  4K8I A;  1E22 A;  2ZJR A;  3K0X A;  2ZM6 Q;  5JJL A;  2RA4 A;  1BR9 A;  5I9P A;  2UUA L;  2K52 A;  2NN6 G;  3BZD B;  4HEA 1;  1K0S A;  2B2U C;  4LUV A;  2KUM A;  2LSS A;  4KJN A;  1WTQ A;  1CTM A;  1IYV A;  2QPO A;  2B0U C;  4N9T A;  1RIP A;  5CC4 A;  2R92 G;  1ESR A;  5HY6 A;  3PO2 G;  2NVT B;  3NBH B;  5JEA G;  4R4O A;  3ERS X;  5GAG C;  4LF4 Q;  2NN6 H;  4I7A A;  1LR8 A;  2KED A;  1OXT A;  3OWE B;  2SEB D;  4ZLT F;  2E76 C;  4ILW A;  5LMN W;  2I46 A;  3NQI A;  4NB3 A;  1SNM A;  2O2L D;  2XWJ B;  4EX5 A;  2D0O A;  2JP1 A;  1QCB D;  3IKJ A;  4DV1 Q;  2Y0S G;  2J7Z A;  5DLQ E;  4RHR A;  2JB2 A;  1BF4 A;  3PF4 A;  1SYC A;  3AJF A;  4HID A;  2E2I B;  5LMU L;  4OAU C;  2WFW A;  2VQE L;  5J8C A;  3CCL A;  1Y14 B;  3OWF A;  4JI2 Q;  3I91 A;  1CA6 A;  2PQ8 A;  3A7L A;  1CA5 A;  1SYB A;  2GIV A;  4DWL A;  4EQO A;  2JQO A;  3HFZ B;  1EZ6 A;  1Z47 A;  4DUZ L;  1BVS A;  1TY2 A;  2BA0 A;  4I65 A;  4XT1 B;  1TXY A;  3GTP B;  3VDU A;  5C4J B;  2NVX H;  3FHW A;  1XX6 A;  4YHH Q;  4UPA A;  1GHK A;  2ROW A;  3SGB I;  3GTL H;  3K59 A;  1VMP A;  1C8C A;  3AB9 A;  2KEE A;  3G7L A;  4DFA A;  1GKH A;  4A3K B;  2B2W C;  4B3S L;  3GV3 A;  5C3X A;  4JI4 Q;  3UDG A;  1EIH A;  4DK6 C;  1E2W A;  4KMU C;  4G7Z C;  2R7Z B;  4PZ8 A;  1X3G A;  4KKT A;  4PV1 C;  2EE1 A;  4KHZ A;  1DGS A;  4R9W A;  3B55 A;  1HZA A;  1MGS A;  1KLU D;  4IFD J;  3AEV A;  1SE2 A;  3M4O H;  1OXV A;  3MA2 B;  1N32 Q;  1JWS D;  1EOV A;  3K80 C;  3T53 B;  2JA9 A;  2KHI A;  4DAY A;  3CP0 A;  1FGB D;  4A3M B;  3FPP A;  2WII B;  2B2Y C;  1EEF D;  2KBN A;  3AMU A;  3UIT A;  1QVG A;  4K14 A;  4OEM B;  4IOC A;  1IBM L;  5C5M A;  2KMR A;  5IT9 c;  4A3C H;  4WJ3 M;  4JC0 A;  4OON A;  5E4W C;  1W4R A;  2YFB A;  4FNF A;  5C44 H;  5IGF A;  5BR8 L;  2HD3 A;  1Y8P B;  3AU7 A;  2ZRR A;  1X3E A;  5C6A A;  2WKD A;  2GKT I;  2VXW A;  1RD9 D;  4BY1 B;  4WRD A;  3HOV H;  4TKO B;  1S4Z A;  1SDF A;  3HOW G;  3GQB A;  3UFF A;  4JI1 Q;  5JPN C;  4UP9 A;  3BU2 A;  3S16 H;  4SGB I;  2FUG 1;  2Q2I A;  4DAY B;  2GKV A;  5AFW A;  1SFO H;  2K14 A;  1U0L A;  1KBE A;  1SRO A;  1ZYR D;  1E1T A;  5J39 A;  1S5F D;  1TS2 A;  4XXE A;  3RLF A;  5C4X G;  4X66 Q;  1WYD A;  1KTK A;  2B3G A;  4C3I B;  2E2H H;  3HOY G;  3LWU A;  5HUR A;  3KY9 A;  1LTG D;  3E9H A;  3R2T A;  5FO8 B;  1Q7Y C;  3CXC A;  1JWU D;  4AS2 A;  4N8X 1;  3GTM H;  1TY0 A;  1LM0 A;  2EYP A;  1YIJ A;  1GM5 A;  2RKS A;  3JAM i;  2A19 A;  4R1J A;  2UXC Q;  5JJZ A;  2RLD A;  5C4X H;  1Q82 C;  4JBJ A;  4ZCK A;  2G9H D;  4ZK9 B;  2XRQ D;  5M3F G;  1MSH A;  3VE5 A;  4ZQ3 A;  3HH2 C;  4RCO A;  1G2S A;  4ULL A;  3ULP A;  4H02 A;  4OGQ C;  4YZ9 A;  3GTK H;  2NTS A;  4JW0 A;  3BDO A;  4DV7 Q;  1AH9 A;  4J1M A;  3I2Z A;  3IAM 1;  3GTJ B;  1DD2 A;  1K9M C;  1BOS A;  4RKB A;  1SYG A;  4J15 A;  5C3E H;  1VQN A;  1CT1 D;  4FF4 A;  1P9G A;  4JBW A;  4FO2 A;  2JEB I;  4XYO A;  2DJG C;  4CKE A;  1BCP C;  5JPM C;  3R93 A;  2FEF A;  2LXK A;  1KL9 A;  1I4G A;  3SK8 A;  5M5Y H;  1S3O A;  2B29 A;  1W2B A;  3QJY A;  3NUC A;  1HZC A;  3Q22 A;  4JVZ A;  3STB D;  3KBG A;  1TDP A;  4G4K A;  4JI4 L;  1ET9 A;  1V9P A;  1TOT A;  1SNO A;  3I4M G;  3FKI B;  4IN3 A;  4MTK A;  1JOR A;  2NZO A;  3I4O A;  2NVQ H;  3RU0 A;  1Y1V B;  4ZUJ A;  2V4D A;  1N36 Q;  1K8G A;  3R8B A;  1I3Q H;  2KQ3 A;  1YI2 A;  2UXD Q;  2GVI A;  4DR1 L;  3FVV A;  2Z0S A;  5JJK A;  3QR8 A;  2A69 D;  2PYK A;  4TQU S;  1NJI C;  5FLX E;  3UOE A;  3FPU B;  2A6E D;  2EYH A;  3DM3 A;  2JEA I;  3I4N G;  4P71 A;  3CU7 A;  4JBK A;  4O1N A;  1OYV I;  1LAC A;  4R4T A;  1UE1 A;  2KHS A;  2XSC A;  1UUP A;  1QVF A;  3KDF B;  4HJ5 A;  2RHQ B;  4H13 C;  1YZ6 A;  2YFA A;  4ME5 A;  3A74 A;  5E4X A;  4BY7 B;  2MJF B;  1F2M A;  2ENZ A;  4C3J G;  2EPB A;  1SXT A;  2L1B A;  3K8A A;  3M85 A;  1HNW Q;  3H6M A;  1K8O A;  4OHJ A;  2EY6 A;  1H0Z A;  4POG A;  2JAE A;  2IL8 A;  3HKS A;  3MXP A;  3T1Y L;  4JI0 L;  3CRL C;  2A69 C;  3I3C A;  4KHP L;  5ELC A;  1MIU A;  1JOK A;  1BKB A;  2V53 A;  1HTP A;  2I5M X;  5K36 G;  2AWN A;  4PQX A;  5AJ3 Q;  1E0B A;  3VR2 A;  5CBE E;  3KBX A;  1STY A;  2PO4 A;  4KLK A;  3CCU A;  1O7L A;  3K5N A;  4J6H A;  2EJF C;  3C1F A;  5COY A;  5IWA L;  1I50 B;  4OXP A;  4PZ6 A;  3R2I A;  4OX9 L;  2WB1 B;  1TS3 A;  1YNJ D;  2UXC L;  3KFU A;  2ZXP A;  1OXU A;  4UAI A;  5FLX L;  3NTI A;  1LR9 A;  1SRU A;  1EIY B;  1ONL A;  4JYA Q;  3MXN A;  3OL0 A;  1LTR D;  1I6V C;  3D8G A;  1K8M A;  2RSN A;  5KYL A;  3OHX C;  2NBF A;  4XQJ A;  1G2T A;  5IYB G;  1NTG A;  3UDI A;  1TT2 A;  4PZ7 A;  1TBO A;  1PH2 A;  1HR0 W;  2CJS C;  1Y1B A;  1VQO A;  2E2I H;  1E3P A;  3K7A B;  1L0X B;  1XPU A;  4DR5 Q;  3BVM A;  5CR3 A;  3G6E A;  5I6Y A;  3E0J A;  4UHV A;  4HFV A;  3OOC A;  2B8G A;  3KYH C;  4HED A;  4A76 A;  1EYG A;  3CPF A;  2IJ0 A;  3K57 A;  1I94 L;  3PO3 B;  2RF4 A;  1QJO A;  4ZKC B;  2YYZ A;  5C4J H;  1YNJ C;  1SND A;  2WB1 E;  1X3P A;  1JT8 A;  1EIF A;  4N9P A;  2SGD I;  2ID0 A;  5IYC G;  4A3F G;  1EU3 A;  2CWP A;  1XTC D;  4PG3 A;  4K8J A;  3AFP A;  3FSX A;  1X54 A;  5CV7 A;  3E5S A;  4L5R C;  3PGZ A;  4S3S A;  2B8T A;  4TVA B;  4UP7 A;  1K83 B;  4X64 Q;  4UXH A;  2KVM A;  5FK9 C;  1CKN A;  1D5X C;  1XTD A;  5EBC A;  1NE3 A;  1O7I A;  2QCP X;  2PI2 A;  4A3B B;  5GAD C;  4MN3 A;  1MSG A;  3HOU G;  1NUC A;  1HJP A;  4K5V A;  1ICF B;  4B3R L;  1WFQ A;  4GNX B;  3CAM A;  4OIK A;  1HXY D;  4KY5 A;  1JE5 A;  3S1Q H;  4L5S A;  1H9S B;  3KF8 B;  4MHE A;  1V1Q A;  1IHZ A;  4LF8 Q;  4K6L A;  2I5L X;  1JJG A;  3RMH A;  2F0P A;  1B53 A;  2QF7 A;  3PO2 B;  2MPM A;  1PYW D;  2LS0 1;  4EQP A;  3K7U C;  3CQZ B;  4DUY Q;  3OPO A;  4LF7 L;  3A56 A;  2K01 A;  1TU2 B;  1KHI A;  4B3T L;  1PCE A;  4E1R A;  1CQV A;  1CKN B;  2EYO A;  1II3 A;  1NR4 A;  2JB1 A;  1PFM A;  1IBK L;  3UEJ A;  1IY6 A;  1Q1E A;  4RFB A;  4WJW A;  4DR3 L;  1PH3 A;  3L9A X;  3OXF A;  2G9D A;  5FJ8 H;  1KLG D;  4C2M H;  4XDX A;  3CCV A;  2NVX B;  3NPP A;  3OMC A;  4XT3 B;  3G6J B;  1SYD A;  1J9O A;  2YUU A;  2WIN B;  2D0P A;  4X3U A;  2JA7 H;  2KMQ A;  1S5B D;  3D4W A;  4HSP A;  2BH2 A;  2UUB Q;  3FBV A;  3RD4 A;  3X3M A;  4A3D G;  5J1Z A;  3CC7 A;  3BZC A;  1B8A A;  4LFC Q;  3TDQ A;  3FMC A;  2QDB A;  1CSQ A;  4Q0F A;  3M4O B;  1DOK A;  1G51 A;  4AYB G;  1T9H A;  2SGF I;  2Q2H A;  3VYR A;  2EQS A;  1VQB A;  4A3D H;  1PJU A;  1PH7 A;  2HDL A;  1DOM A;  1XWE A;  1O78 A;  2Y0S E;  3GTJ H;  2ZJP A;  1A3T A;  2L4N A;  3V2T A;  4IUQ A;  4RWS C;  4RG1 A;  2NN6 I;  4X62 Q;  1D2B A;  1AW7 A;  1Y8O B;  1SMY D;  2JE6 I;  4F8M A;  3MXU A;  1ULN A;  1CKM A;  4BXX G;  4GKK Q;  2UZ3 A;  2MJ8 A;  2I5H A;  3HKZ G;  4ABN A;  2Z6B A;  1JC7 A;  1Q9B A;  1ULM A;  5J8F A;  1EU4 A;  2VRW B;  1HQM C;  2A68 C;  2E5R A;  2L7X A;  3FKI H;  2PPB C;  4DNT B;  2JA1 A;  1STG A;  1PH1 A;  4CJ1 B;  2VY3 A;  2CQA A;  1HNX L;  1HZ9 A;  1BUV T;  2Z1C A;  3PDN A;  1Y1V H;  4Y7N B;  1J6Q A;  1V1H A;  2VS1 A;  2QGQ A;  2ELI A;  1FNV A;  2NVY H;  1JE4 A;  1SE3 A;  1MJE A;  9WGA A;  3NWS A;  3CCR A;  4GLV B;  4DV3 Q;  1IW7 D;  4MZ9 A;  1IL2 A;  1BDO A;  2JA8 G;  1SMY C;  3HOW B;  2FHT A;  1WCM G;  2PQE A;  4R4I A;  1PRT D;  1VQH A;  3FSY A;  3SHL A;  3PMF A;  3W3A A;  4I1T A;  1GUS A;  2F0G A;  3CC4 A;  4GOP A;  5IIF A;  1VF5 C;  5C0X G;  1Q3L A;  2CAZ B;  1KRS A;  7WGA A;  3K81 C;  2RHS B;  3S9W A;  2Z6K A;  1CUK A;  1K7U A;  3E6Z X;  5H1S E;  1CQF A;  2IPK D;  5C4X B;  2A5H A;  3T16 A;  4OVO A;  2I07 B;  3U4V A;  4DR6 Q;  4GZY C;  2OZU A;  1L1O C;  1LUZ A;  2Q8I B;  3J81 E;  3Q23 A;  1FAQ A;  4FF2 A;  1WTR A;  1DXM A;  3IFD A;  3FDT A;  4JOI A;  3MFY A;  3A5Z B;  2A1A A;  1E24 A;  1B1Z A;  3MVV A;  4LF9 L;  3TS2 A;  4XQQ A;  1JB3 A;  1G91 A;  2F0H A;  3GTO H;  1IYU A;  1DON A;  1H9R A;  1VQ6 A;  5EGT A;  1VQ5 A;  2L55 A;  2CW0 D;  1TWF B;  2IX1 A;  1VS0 A;  4HMJ A;  5M3F B;  2JB3 A;  2K28 A;  1G29 1;  2B2V A;  4RGM A;  4LFB Q;  2YTX A;  1H95 A;  3M3Y B;  1PH5 A;  5L37 A;  1QNK A;  2VQF L;  1PH6 A;  1VQJ A;  1D1K A;  5D3I B;  4IUT A;  3G48 A;  4LF5 L;  1L0Y B;  1NXU A;  5IGG A;  3M4Y A;  2Q8T A;  3F1Z A;  1C48 A;  1XMO L;  3ITP A;  4ZAI A;  3L0O A;  1L1O A;  4A93 H;  1CI3 M;  3AYH B;  4QB4 A;  2KA7 A;  3H94 A;  4PNY A;  3BDL A;  2JA6 G;  5ELD A;  1DS3 I;  2IP6 A;  5KNC A;  3VDP A;  3J80 i;  1KQS A;  2ZXR A;  2NVQ B;  3J7A V;  4DR2 L;  4IJH A;  1QNU A;  1F2L A;  3G4S A;  3W1B A;  3I4M B;  1KDC A;  2CW0 C;  3PIO 3;  3NQT A;  1OO9 B;  2F66 B;  3HOX H;  2C9O A;  2PMZ B;  2UU9 Q;  1FJG Q;  1TQO A;  1GO3 E;  3K7A H;  2EY5 A;  4OIJ A;  4X62 L;  4YWL A;  2F3W A;  4AS3 A;  2ES2 A;  3ND9 A;  1Y69 U;  1UVG A;  3J81 L;  1D1I A;  1PZK D;  4F7X A;  3VA7 A;  2K19 A;  2KOL A;  1LO5 D;  4DR7 L;  4NW2 A;  4OO1 H;  4A3J H;  5CV5 A;  3H91 A;  4DV4 L;  2K4K A;  5T1I A;  3NBH A;  5HGQ A;  4DV6 L;  4NP5 A;  3S1N B;  2IY5 B;  2F0U A;  1EY5 A;  1PFS A;  2LMC B;  4L9M A;  3D6W A;  2FMC A;  2JYO A;  2L9H A;  3D4D A;  4HIO A;  1MT1 A;  3ERQ A;  1Q46 A;  1M8B A;  3P7J A;  2O5J C;  2HGK A;  1SLJ A;  2F0O A;  4QF4 A;  4BWG B;  2KMP A;  1H9M A;  4RHS A;  3H09 A;  5ELE A;  4R8I A;  4UY8 C;  4K0K L;  2KCN A;  3JC6 6;  2F3C I;  1K0R A;  1RDP D;  2ZTC A;  3NE5 B;  4B08 A;  5FUX A;  4DV5 Q;  3F2C A;  2BDN A;  1K83 H;  4C3J B;  4DV2 L;  3SK4 A;  2PMZ E;  3K58 A;  1N8R C;  1CZW A;  2P6A C;  4V19 0;  1IL8 A;  2EJG C;  1N33 Q;  4DKA C;  4MPI A;  2K6A A;  1TUS A;  3DA4 A;  4A3B H;  4IFD H;  1VQG A;  2WAC A;  4NV2 A;  2CH4 W;  1Q1B A;  1SGN I;  1GVP A;  4KY6 A;  2CH4 A;  4GN4 B;  3R5C A;  4IUN A;  2F0S A;  2R92 H;  3PO2 H;  5IE8 A;  2K5D A;  5JEA H;  5LHY 1;  3SDJ A;  3CQZ H;  2OTL A;  2QSB A;  5I2Y A;  2OWO A;  2A73 B;  5EAY A;  3KLR A;  3FRP B;  1ESF A;  3I72 A;  4V0B A;  1WI5 A;  3LJ1 A;  3VYS A;  2QEX A;  1AZP A;  1SMX A;  3CRK C;  2QKI C;  4YY3 L;  1K28 A;  2O5I C;  4TSS A;  3CHB D;  1WKX A;  4G7H C;  2JBW A;  4FXD A;  1NMF A;  3ULL A;  2FXQ A;  1TVX A;  1XXG A;  3GTG H;  2ICI A;  5EPK A;  3BVZ A;  3QB3 A;  2HHH Q;  2R6G A;  3RLO A;  3D4R A;  1AE2 A;  2XVS A;  2K50 A;  3GP7 A;  1WVL A;  1XNQ Q;  5CV8 A;  4DXG A;  3P75 A;  4LJZ C;  1S5D D;  1V1O A;  1TWA B;  4JI7 L;  1EQT A;  4HN7 A;  4NXM L;  1SJH D;  2K1B A;  2KCC A;  4PL5 A;  5LMN Q;  1HPC A;  2L1L B;  3JAM E;  1ILP A;  2H4O A;  1A63 A;  3UGI A;  3PUV A;  4P75 A;  4A3F B;  1LTA D;  2JN4 A;  3J7Z C;  2VB2 X;  4JI5 L;  1F2Y A;  2ZT9 C;  4L6T B;  5EKL A;  1F77 A;  4LFA Q;  3WDN A;  3MTS A;  2VUM G;  3MEF A;  3QG1 A;  4L63 B;  4BS9 A;  4DK0 A;  3S1Q B;  1Z2I A;  2TMP A;  1JMC A;  3NWT A;  2OU2 A;  1PMR A;  1RKN A;  2DJF C;  1FYB A;  4F87 A;  3ERO A;  2ENB A;  5JEA J;  4U67 3;  2C35 B;  4UP8 A;  4LF6 L;  4OEL B;  3M7G A;  3ULJ A;  3NEN A;  3BS1 A;  4BBS G;  1MJB A;  2RCN A;  4P73 A;  4XIG S;  2F0T A;  2G5D A;  1SEB D;  4A3L G;  1QZG A;  1KAB A;  3EBE A;  1PH9 A;  1OTC A;  2SNM A;  2ZM6 L;  1SGP I;  1LTI D;  1EY0 A;  5IYD G;  1VDZ A;  3CPW A;  3CCE A;  2K5Q A;  4CDF C;  4Y7N H;  1G6Z A;  1PTO D;  1OMT A;  4GKJ Q;  1KNA A;  3J7A F;  4C2M B;  4L5T A;  1J8I A;  1QUQ B;  3M7N A;  3GV6 A;  3A8I E;  3JAM L;  3HOW H;  4N8F A;  1DS2 I;  4LF4 L;  1EY8 A;  2KCM A;  2JA7 B;  1CZG A;  1BCP D;  3SK6 A;  1AN1 I;  4QL5 A;  2HIX A;  3NXW A;  4IPC A;  3T51 B;  1OMU A;  2AMC B;  1SNQ A;  2EZV A;  2EYL A;  3CCM A;  1TGS I;  2F3I A;  2IX3 A;  2AQ3 B;  4DV1 L;  2NYZ D;  1ZEQ X;  1MJ9 A;  4RGO S;  3U50 C;  1V43 A;  1PDQ A;  4OL7 A;  3T56 B;  1C9O A;  3S2H B;  4JI2 L;  1W6K A;  2K7V A;  3P23 A;  1PTO C;  3HOY H;  3EIV A;  2KEC A;  1YNN D;  2FFK B;  4A3D B;  3HOZ G;  4YZD A;  3OTO Q;  4ZRZ A;  1KC8 C;  2LKV A;  2YTV A;  1STB A;  2NZ1 D;  4AIM A;  3T1H Q;  1TWF H;  4APV A;  5M3F H;  4YHH L;  4AYB B;  1C7Y A;  1GJX A;  1M8A A;  5DM6 3;  1D8L A;  3M3Y H;  4O1O A;  4DV0 Q;  1K7T A;  1DZ1 A;  3MAQ A;  4KV6 A;  3E3X A;  3KDF A;  2E2J H;  1R4P B;  5FUV A;  4DN4 M;  1VMC A;  3C1E A;  3OIQ A;  3F2D A;  1TR5 A;  4DNI A;  2YV5 A;  5EX3 A;  1X32 A;  3JSB A;  2E75 C;  3QIA A;  4P2C B;  3K6O A;  3SE0 A;  4C1N I;  1S72 A;  1TKW B;  1GHJ A;  5D3D A;  2KJX A;  3CCS A;  1HNZ Q;  2CKZ B;  1F9Q A;  1NR2 A;  3S14 H;  1N32 L;  4E6I A;  1YNN C;  4AQY Q;  2ORW A;  2B2T A;  3LJ2 A;  3URY A;  2EYF A;  5FO9 B;  2QIL A;  5CGK A;  2OQK A;  5E3F A;  1Y1C A;  2K5H A;  4UXJ A;  1JOQ A;  1PRT F;  1X74 A;  1R9T B;  2ICE C;  1FNW A;  2D2C C;  2NVY B;  3PSI A;  3I4M H;  2MNA A;  1FYC A;  1U4P A;  3H0G G;  4IO9 A;  1Y1W G;  2P5Z X;  1W6J A;  2CQO A;  2Z4I A;  4KD3 A;  4AYB E;  2K05 A;  2F0I A;  1A3V A;  1ICW A;  1HEV A;  1SAP A;  5M3M G;  1ML0 D;  3S1N H;  2YQP A;  2N78 A;  2IHE A;  1IKL A;  1Q8K A;  4KKU A;  4CJ2 C;  1SNC A;  4A3G G;  1VQI A;  2JZM A;  3S15 H;  3KUP A;  4NPS A;  2JA8 B;  4HTH A;  4DF7 A;  4LW1 A;  4GXT A;  2PCF B;  3QO2 A;  2MGS A;  1WCM B;  1B70 B;  3I4N H;  3HEJ A;  4DA2 A;  4RGT A;  5KRU A;  2NWG A;  4LUZ A;  1Q8I A;  4RMF A;  3HKZ E;  4JI1 L;  1SGD I;  1RL2 A;  1S5E D;  1TUR A;  1Q86 C;  5M3M H;  1A62 A;  1HQR D;  3SEB A;  1KDA A;  1LT6 D;  4QUF A;  2BL7 A;  3GTO B;  4CKC A;  3E59 A;  4C3J H;  2N3S A;  5M5W B;  5LL6 X;  4B3M Q;  2ZJQ A;  1VQE A;  1WD1 A;  3UEY A;  4X66 L;  5DM7 3;  1ULK A;  2F0E A;  3U9S A;  4KD4 A;  5KYI A;  3PIO A;  2J0T D;  2K32 A;  4NKL A;  4FP5 D;  3TP8 A;  2VZA A;  1STH A;  4O1P A;  4GNX C;  5EPJ A;  1YVC A;  2BCO A;  3GTQ B;  4A93 B;  5K36 H;  2QQE A;  4A3I G;  2EY2 A;  4CDE C;  5EJW A;  2XTR A;  2JSO A;  3PUZ A;  1CFM A;  1KRT A;  1LR7 A;  4IQZ A;  5C5L A;  3TO7 A;  2HDM A;  2EY1 A;  1UNS A;  3SGI A;  1UWV A;  2A20 A;  3A7A B;  4DV7 L;  2OEO A;  2DNC A;  2MFI A;  3VA5 A;  1XMQ Q;  4UXI A;  2E2D C;  5CV9 A;  3HOX B;  3HG9 A;  3PUY A;  3TZU A;  5GAH C;  3M4Q A;  4UDU C;  1VQ8 A;  4EQ5 A;  2XN9 C;  4A3J B;  2DY7 A;  4GNX A;  2SDF A;  4JI8 Q;  5IYB H;  1WGC A;  3FVQ A;  2WGC A;  2KMO A;  1H9S A;  3KF8 A;  4ZKB B;  1YJN A;  4DGZ A;  3F4M A;  1B3Q A;  2WV6 D;  2QQD A;  1TBQ R;  3RN5 A;  5KGU A;  1G8Z D;  4AQY L;  1YIT A;  1TWA H;  1N36 L;  2UXD L;  2KKM A;  3DUZ A;  1STE A;  5FLM G;  5J22 A;  2CHB D;  3BYT B;  4HIK A;  1A8V A;  1HJA I;  1PA6 A;  2IWH A;  3UE0 A;  2N1A B;  4A4I A;  1Q90 A;  1SGY I;  4PL4 A;  3DMU A;  5IYC H;  4A3F H;  1HPT A;  3T4A C;  5BN4 A;  4L8J A;  2F0N A;  1CHQ D;  1PFB A;  4RAU C;  3UDX A;  1HR0 Q;  5FLX c;  1GOZ A;  4JV5 Q;  2EXZ A;  1EIG A;  2OT2 A;  3D00 A;  1XBT A;  1PVO A;  4EGV A;  1NNX A;  1FR3 A;  4QJF A;  2HUG A;  2ETD A;  5E7N A;  2K33 A;  1V1P B;  1HNW L;  3SDZ A;  3RZD B;  3HOU H;  1QE6 A;  3RUZ A;  2R92 B;  2WVJ A;  1J5E Q;  1SGE I;  2BUS A;  4B9W A;  5IOC A;  4JG2 A;  1FY7 A;  2AWO A;  1TS4 A;  1A0I A;  1C4Q A;  4MIU A;  5IGB A;  4BY1 G;  3S1M B;  2PQA B;  1BXT A;  3OW7 A;  1TIH A;  4B3M L;  3Q8D A;  5AJ3 L;  1O7Z A;  4XTC S;  3I55 A;  2ZXO A;  1EEI D;  3WOE A;  4OO1 I;  3OVO A;  3E2I A;  2F0Q A;  2BA1 A;  4JI6 Q;  2Y0S B;  2UUC Q;  3OYY A;  1PYS B;  3GTG B;  1HZB A;  4QIW E;  5G3L D;  5EQ0 A;  2AQ1 B;  5ELF A;  5IP7 G;  2N17 A;  2NZH A;  3HZX A;  4X65 Q;  3LJ0 A;  5ELB A;  3NTK A;  2RDH A;  4DNR B;  4JYA L;  5DNF A;  1D5Z C;  3D6C A;  1FL0 A;  1B9M A;  1XNR Q;  3M9B A;  2IT1 A;  2F4V Q;  4DK1 A;  2A68 D;  1TWH B;  2RDG A;  1C0A A;  3A55 A;  3DO9 A;  1DCZ A;  1VQK A;  3KP9 A;  2MHV A;  5TSS A;  2ERW A;  1IXR A;  3DA3 A;  5I2X A;  3S2H H;  4DR5 L;  1K73 C;  4JI3 Q;  4IFD I;  3GDE A;  1G6P A;  1KIX A;  4DK3 C;  1YEZ A;  1IBL Q;  2HCI A;  3UE1 A;  1GXD C;  4OAV B;  5EKK A;  1U4M A;  5IGE A;  2F0J A;  2D5D A;  5CCL A;  2Q2U A;  4KN7 C;  5M9O A;  4B9X A;  1ENC A;  1JQY D;  2VUM B;  2DGY A;  4NDX A;  2ASB A;  3A5U A;  1U9R A;  1MI2 A;  3S24 A;  4GOP C;  1XX8 A;  2PI2 E;  4Q5V A;  4QCL A;  1KXL A;  3V96 A;  1VDD A;  1P8L A;  5HI7 A;  2F4I A;  1PTO F;  1YU6 C;  2EYJ A;  2NUC A;  3NBI A;  2Z6K C;  4X64 L;  4BXX H;  1NBW A;  3FNB A;  4BBS B;  1R79 A;  5FO7 B;  5A2Q E;  4AML A;  5C3W A;  1JIC A;  3J80 E;  3AQQ A;  5T1G A;  2AKW B;  1BQQ T;  3LWE A;  4JOI C;  1VQF A;  4K5X A;  1BCP F;  1R9T H;  1Y8N B;  1JJC B;  5CMD A;  3I90 A;  2E5L Q;  1PLF A;  1DOL A;  1ZKO A;  4TRD A;  2N88 A;  2AQ2 B;  5DEH A;  2UXB Q;  4R8N A;  3B4V C;  3A8J E;  4E1P A;  1EL0 A;  1QB5 D;  3TME A;  4LF8 L;  2Q8R E;  1LTT D;  2CWA A;  2B2V C;  2L15 A;  3ZYY X;  4O0A A;  5HGI A;  4GLA C;  3C3L A;  4A3E G;  2ATW A;  3DXJ C;  1PHJ A;  3PQI A;  4DUY L;  2JA8 H;  1CHP D;  1WTJ A;  2AHO B;  2UUA Q;  1WCM H;  4RCN A;  2PNH A;  3KOJ A;  5EKI A;  2RIJ A;  4BY7 G;  1GD7 A;  2XNA C;  3HP3 A;  2FIN B;  2ZTE A;  5E1F A;  3HOY B;  4IAL A;  3LGJ A;  3TP5 A;  4HJ8 A;  5C0X H;  4HJA A;  2OVO A;  1GUT A;  1X65 A;  1TWC H;  1X3Q A;  3RNU A;  1UE5 A;  1B3A A;  2A8V A;  1CT0 I;  1XJV A;  3GD7 A;  5M5W H;  3SK5 A;  1U4R A;  3QWN A;  4C3H G;  2W0T A;  3BG3 A;  1PZI D;  2N49 A;  3PV0 A;  3H3V H;  4JK1 C;  4O2D A;  1JCK B;  4CGY B;  4X65 L;  5JOB A;  1R4Q B;  2AUJ D;  5IP9 G;  3J80 L;  4IOA A;  2E2J B;  1T5E A;  2X3T A;  2UUB L;  1B44 D;  1HTL D;  2VB3 X;  1K3B C;  4DAM A;  4KKS A;  4ZYS A;  3L3O C;  3CW2 C;  2MO0 A;  3BVG A;  4I7Z C;  3GTQ H;  5ISR A;  4RGN A;  1EWC A;  2A74 C;  1EY9 A;  1NSN S;  2QEJ C;  1HCZ A;  4LFC L;  1YHB A;  4P72 A;  5LMU Q;  2XIW A;  2VQE Q;  3TEH B;  4CHT B;  2EJM A;  3S14 B;  4ALP A;  3TS0 A;  3Q24 A;  1M90 C;  4PMC A;  5JVH 3;  4FXG C;  2F0L A;  1FAR A;  2M9V A;  4BA1 I;  1XPR A;  3BZK A;  4DUZ Q;  2CFM A;  1AE3 A;  1ENF A;  3EVQ A;  4CDD C;  2JA6 H;  2K5W A;  1EQR A;  1LAB A;  2R93 G;  1PFN A;  3DEO A;  1FNU A;  1ASZ A;  3SR1 A;  2WP8 J;  4GKK L;  3MFG A;  2JA5 G;  5BN3 A;  1BUS A;  3VR3 A;  4B3S Q;  3DWP A;  1RTO A;  1KBF A;  1EOT A;  1X4S A;  5ELN A;  1UE7 A;  1VQ7 A;  4XQN A;  3S15 B;  3H0G B;  1Y1W B;  1XA6 A;  3PO3 G;  5C0X J;  1HA6 A;  3I4N B;  1BMO A;  1E1O A;  1AEX A;  2JXD A;  1X6O A;  1A6X A;  5M3M B;  4P74 A;  2OCE A;  5IT9 E;  1P9Z A;  1P16 A;  1QZH A;  4A3G B;  3S2D B;  1PTQ A;  1PYB A;  1WTW A;  1ZXT A;  1IBM Q;  4DV3 L;  2RQX A;  3R5D A;  4LUO A;  2WAQ G;  2UXB L;  3PIP A;  2GVB A;  3L7Z C;  2M2L A;  3NK9 A;  2DY8 A;  1PTR A;  5BR8 Q;  3AFQ A;  4DPG A;  4PL3 A;  1IKM A;  2LY7 A;  1IW4 A;  1UEB A;  5M5X H;  2F0V A;  2ZW3 A;  1TS5 A;  4HSV A;  4LAA A;  4X6A H;  1B2T A;  4FKD A;  4CJ0 B;  4DR6 L;  1PRT B;  3M4P A;  1KDB A;  3QOL A;  1I4X A;  3RZD H;  1RTN A;  1LLR D;  4ODG A;  4HGU A;  2VW9 A;  3IFT A;  3E9I A;  1MD2 D;  3J81 c;  4IJL A;  3KJP A;  4A3I B;  5BN5 A;  1EYC A;  1Q12 A;  1WTH A;  1CGJ I;  3S1M H; 
#chains in the Genus database with same CATH homology
 3MEK A;  4OWT B;  4LFB L;  4A24 A;  2V6E A;  4IPG A;  3WWV A;  3L2P A;  2K9H A;  4QQB X;  2GVA A;  3SGQ I;  4PMW A;  2ORV A;  2GKR I;  2N8N A;  2XTI A;  1UE6 A;  3CXL A;  3I56 A;  4OWW B;  1EWI A;  1KMA A;  1Z9F A;  1TWH H;  1YBY A;  2V1C C;  3U4Z A;  1FJG L;  2XTQ A;  2UU9 L;  1JB7 A;  1R0R I;  3UDF A;  4NXN Q;  1QUQ A;  4POF A;  1Y8F A;  2OD1 A;  1X3F A;  2NU3 I;  5JHW C;  2R7F A;  4IPD A;  4A3C G;  2VUM H;  2JYY A;  2SGQ I;  2ENN A;  4JBM A;  3VA9 A;  5C44 G;  3CF5 A;  5CCM A;  1MJC A;  4DR1 Q;  1OXX K;  4YWK A;  2V1C A;  2QQC A;  1EUJ A;  2VL6 A;  4DV5 L;  1XPO A;  2N71 A;  2A2C A;  1I6H H;  3HOV G;  5ELO A;  4KI0 A;  2N52 A;  4BBS H;  2OTJ A;  1N33 L;  1VQ4 A;  4HJ7 A;  2Q2T A;  4A3L H;  2I0Q A;  2MQH A;  3B6Y A;  1N9W A;  1V1I A;  1Q81 C;  5IYD H;  5GRO A;  1UUC A;  3PUW A;  4BBR G;  3T1Y Q;  4JI0 Q;  1OVO A;  3DLL A;  4KHP Q;  1WJJ A;  3A0J A;  3NEM A;  5IWA Q;  1CGI I;  4YCW A;  1B7Y B;  4BBR H;  4OX9 Q;  3IRB A;  4MTN A;  4GN5 A;  2SGP I;  3E0E A;  3SEK C;  5C3E G;  2HHH L;  1ASY A;  4WJ4 A;  2K75 A;  3CMA A;  1XNQ L;  3CCJ A;  3HOZ H;  1SGR I;  2K5N A;  2K5V A;  4Y52 H;  2LUY A;  2ALY B;  1RFH A;  5LMN L;  3I9V 1;  1W3S A;  3RN2 A;  4NXN L;  2L8E A;  4LFA L;  1YJ9 A;  3JAM c;  5EX0 A;  2IX0 A;  1I94 Q;  2KCT A;  1CSP A;  2F6M B;  3TRZ A;  3OXG A;  2ODD A;  4G75 A;  2YU9 H;  3H0G H;  1Y1W H;  2B63 G;  1U5K A;  3QTL D;  1S40 A;  1WOC A;  2KEN A;  2XGT A;  3ICE A;  4L5Q A;  5J3B A;  3CCQ A;  4ME3 A;  4GKJ L;  4B3R Q;  3STB C;  3S2D H;  4A3G H;  2E8G A;  2B63 H;  2JJQ A;  1YHQ A;  3CD6 A;  4AH6 A;  2VNU D;  1YO7 A;  1VQC A;  3TJQ A;  1LTL A;  1SJ8 A;  4LF7 Q;  5DAE A;  1CHO I;  4B3T Q;  2H5X A;  3VDY A;  3OXL A;  1KAW A;  1IBK Q;  4GN3 B;  2JW6 A;  4DR3 Q;  1I5F A;  3OTO L;  3TQY A;  2NVT H;  4A3I H;  3J7A 5;  4LNQ A;  3T1H L;  4R4C A;  3RR5 A;  1X55 A;  1VQL A;  4DV0 L;  2J87 A;  1L0W A;  2NU4 I;  3KJO A;  2NU1 I;  1JJ2 A;  1X9N A;  4QY7 A;  2M5X A;  2NU0 I;  1HNZ L;  4A75 A;  1VQP A;  5C0X I;  2EXD A;  1TBN A;  4A3K G;  1BBU A;  4Z7G A;  2R7Z G;  2PQA A;  3GTP H;  4JCV E;  3ZJY C;  3PUX A;  3BJI A;  3H3V I;  1LYL A;  1EFW A;  1HH2 P;  5FLM H;  4A3K H;  2DUD A;  3G71 A;  4A3M G;  3MXN B;  4FDB A;  1OXS C;  1N34 Q;  1VCI A;  2R7Z H;  4R4Q A;  3RLN A;  1VQM A;  1Z7K B;  1MKH A;  3NEL A;  1VQ9 A;  4QGU A;  5HQ8 A;  1HNX Q;  3QWP A;  2RIO A;  2J9R A;  3ER0 A;  1YJW A;  3KF6 A;  4A3M H;  2SGE I;  2LEO A;  5JJI A;  2QQ0 A;  2NU2 I;  5FUY A;  5GAE C;  3GOX A;  2F52 A;  2IHF A;  2ARP F;  5FJ8 G;  4BY1 H;  2CCZ A;  2LXJ A;  2WAQ E;  1L2F A;  3PCO B;  2JA7 G;  1D7Q A;  3KF6 B;  4LF9 Q;  2P22 B;  4GI3 C;  1IZ6 A;  1CKO A;  3L0I A;  1PH8 A;  1XMQ L;  5IP7 H;  1CE3 A;  3IAS 1;  1IYJ B;  1VQA A;  3UGD A;  3H15 A;  3FP9 A;  2VQF Q;  4C3I H;  1FVI A;  4LF5 Q;  5LNK 1;  4JI8 L;  1XMO Q;  4Q9V A;  4YZC A;  2R7D A;  1E7Z A;  4Z7H A;  4DR2 Q;  3OW2 A;  4YCV A;  4B6D A;  2ZTD A;  3CME A;  4IPH A;  1K8A C;  2E73 A;  3FKI G;  3J81 j;  4DR4 Q;  4DR7 Q;  1IY5 A;  4DV4 Q;  4DV6 Q;  1TWG H;  1Y1V G;  1BBW A;  1HR0 L;  2BH8 A;  3UGL A;  4BA2 I;  2YTY A;  4JV5 L;  2HT1 A;  3RZO H;  1N34 L;  2JK8 A;  1YHA A;  1PH4 A;  1CT2 I;  3CC2 A;  4K0K Q;  1J5E L;  2XRC A;  2EIF A;  2DB6 A;  2A2D A;  4DV2 Q;  5IY0 A;  2GN5 A;  2D62 A;  2KCX A;  1NMG A;  4A3E H;  4JI6 L;  1N13 A;  1M8C A;  2MO1 A;  2UUC L;  4BY7 H;  1VQD A;  3U58 A;  1M1K C;  1CSO I;  1XNR L;  3FC3 A;  2F4V L;  1HDL A;  4YWM A;  1EQQ A;  1SE8 A;  4C3H H;  1SR3 A;  2WB1 G;  3D0F A;  4A93 G;  2WCY A;  1CT4 I;  1K3R A;  3EN2 A;  1SN8 A;  1SGQ I;  1PV4 A;  1X56 A;  5IP9 H;  2HQL A;  4YY3 Q;  4JI3 L;  1FGU A;  4NV5 A;  3F2B A;  4GOP B;  2QA4 A;  1QVC A;  3TRE A;  1IBL L;  1I50 H;  3PF5 A;  4YCU A;  3HOX G;  4HJ9 A;  5GQO A;  3KLW A;  4GLX A;  3F8T A;  3BJU A;  4JI7 Q;  1UVF A;  4OO1 G;  2FNF X;  4NXM Q;  4A3J G;  2R93 H;  1YTP A;  4GS3 A;  3D31 A;  1NY4 A;  4OWX B;  4HIM A;  3S17 H;  4LWC A;  3S1R H;  3W5O A;  4JI5 Q;  1KD1 C;  3GO5 A;  2JA5 H;  1PPF I;  4DR4 L;  4MNO A;  4U6R A;  2DIP A;  2HIV A;  5FUW A;  4G76 A;  2E5L L;  3PO3 H;  3J80 c;  1TBR R;  1YNX A;  1L1O B;  2XMX A;  3W1G A;  3J81 i;  4LF6 Q;  3I7F A;  2KHJ A;  1NUB A;  4A3B G;  4IFD G;  2OQ0 A;  1E22 A;  2ZJR A;  3K0X A;  2ZM6 Q;  5JJL A;  2UUA L;  2K52 A;  2NN6 G;  4HEA 1;  4LUV A;  2LSS A;  2QPO A;  2B0U C;  1RIP A;  2R92 G;  5HY6 A;  3PO2 G;  3NBH B;  5JEA G;  4R4O A;  3ERS X;  5GAG C;  4LF4 Q;  1LR8 A;  1OXT A;  5LMN W;  4NB3 A;  4EX5 A;  2D0O A;  4DV1 Q;  2Y0S G;  5DLQ E;  2JB2 A;  3PF4 A;  3AJF A;  4HID A;  5LMU L;  4OAU C;  2WFW A;  2VQE L;  3CCL A;  1Y14 B;  4JI2 Q;  4DWL A;  2JQO A;  3HFZ B;  1Z47 A;  4DUZ L;  1BVS A;  2BA0 A;  3VDU A;  1TXY A;  2NVX H;  3FHW A;  1XX6 A;  4YHH Q;  4UPA A;  2ROW A;  3SGB I;  3GTL H;  1GKH A;  4B3S L;  4JI4 Q;  3UDG A;  4DK6 C;  4PZ8 A;  1X3G A;  4KHZ A;  1DGS A;  1HZA A;  4IFD J;  3AEV A;  3M4O H;  1OXV A;  1N32 Q;  1EOV A;  3K80 C;  2JA9 A;  2KHI A;  3CP0 A;  2KBN A;  3UIT A;  1QVG A;  4IOC A;  1IBM L;  2KMR A;  5IT9 c;  4A3C H;  4WJ3 M;  4JC0 A;  4OON A;  1W4R A;  2YFB A;  5C44 H;  5BR8 L;  2ZRR A;  1X3E A;  2GKT I;  3HOV H;  3HOW G;  3UFF A;  4JI1 Q;  4UP9 A;  3BU2 A;  3S16 H;  4SGB I;  2FUG 1;  2Q2I A;  4DAY B;  2GKV A;  1SFO H;  2K14 A;  1U0L A;  1KBE A;  1SRO A;  1E1T A;  3RLF A;  5C4X G;  4X66 Q;  1WYD A;  2B3G A;  2E2H H;  3HOY G;  3KY9 A;  3E9H A;  1Q7Y C;  3CXC A;  4AS2 A;  3GTM H;  1LM0 A;  1GM5 A;  1YIJ A;  3JAM i;  2A19 A;  4R1J A;  2UXC Q;  1Q82 C;  5C4X H;  4JBJ A;  5M3F G;  3VE5 A;  3HH2 C;  3ULP A;  4H02 A;  3GTK H;  4YZ9 A;  4DV7 Q;  1AH9 A;  3I2Z A;  3IAM 1;  1K9M C;  5C3E H;  4J15 A;  1VQN A;  4JBW A;  2JEB I;  2LXK A;  1KL9 A;  5M5Y H;  2B29 A;  1S3O A;  1W2B A;  1HZC A;  3STB D;  4JI4 L;  1V9P A;  1TOT A;  3I4M G;  2NZO A;  3I4O A;  2NVQ H;  3RU0 A;  1K8G A;  1N36 Q;  2UXD Q;  1I3Q H;  1YI2 A;  2GVI A;  4DR1 L;  2Z0S A;  5JJK A;  4TQU S;  1NJI C;  2JEA I;  3DM3 A;  3I4N G;  4P71 A;  4JBK A;  1OYV I;  4R4T A;  1UE1 A;  1QVF A;  3KDF B;  4HJ5 A;  2RHQ B;  1YZ6 A;  2YFA A;  3A74 A;  2MJF B;  2ENZ A;  3K8A A;  3M85 A;  1HNW Q;  1H0Z A;  4POG A;  2JAE A;  3HKS A;  3T1Y L;  4JI0 L;  4KHP L;  1MIU A;  2V53 A;  1BKB A;  2I5M X;  5K36 G;  2AWN A;  5AJ3 Q;  4KLK A;  3CCU A;  5IWA L;  4OXP A;  4PZ6 A;  4OX9 L;  2UXC L;  3KFU A;  1OXU A;  1LR9 A;  1SRU A;  1EIY B;  4JYA Q;  3OL0 A;  5IYB G;  1NTG A;  3UDI A;  4PZ7 A;  1TBO A;  1PH2 A;  1HR0 W;  2CJS C;  1Y1B A;  1VQO A;  2E2I H;  1E3P A;  1XPU A;  4DR5 Q;  3G6E A;  4HFV A;  3KYH C;  4A76 A;  1EYG A;  3CPF A;  1I94 L;  2RF4 A;  2YYZ A;  5C4J H;  2WB1 E;  1JT8 A;  1EIF A;  2SGD I;  2ID0 A;  5IYC G;  4A3F G;  2CWP A;  4PG3 A;  3AFP A;  1X54 A;  4L5R C;  3PGZ A;  2B8T A;  4TVA B;  4UP7 A;  4UXH A;  4X64 Q;  1CKN A;  1XTD A;  1NE3 A;  1O7I A;  2PI2 A;  5GAD C;  3HOU G;  1HJP A;  4B3R L;  1WFQ A;  4GNX B;  3CAM A;  1JE5 A;  3S1Q H;  4L5S A;  3KF8 B;  1V1Q A;  4LF8 Q;  2I5L X;  1JJG A;  3K7U C;  4DUY Q;  4LF7 L;  1KHI A;  4B3T L;  1PCE A;  4E1R A;  1CKN B;  2JB1 A;  1IBK L;  3UEJ A;  1IY6 A;  1Q1E A;  4DR3 L;  1PH3 A;  3OXF A;  5FJ8 H;  4C2M H;  3CCV A;  2YUU A;  2D0P A;  2JA7 H;  2KMQ A;  2BH2 A;  2UUB Q;  3FBV A;  4A3D G;  3CC7 A;  3BZC A;  1B8A A;  4LFC Q;  1CSQ A;  1G51 A;  4AYB G;  1T9H A;  2SGF I;  2Q2H A;  2EQS A;  1VQB A;  4A3D H;  1PJU A;  1PH7 A;  2Y0S E;  3GTJ H;  2ZJP A;  4RG1 A;  2NN6 I;  4X62 Q;  2JE6 I;  1CKM A;  4BXX G;  4GKK Q;  2UZ3 A;  2I5H A;  3HKZ G;  2VRW B;  2E5R A;  2L7X A;  3FKI H;  2JA1 A;  1PH1 A;  2VY3 A;  1HNX L;  1HZ9 A;  3PDN A;  1Y1V H;  1J6Q A;  1V1H A;  2VS1 A;  2QGQ A;  2ELI A;  2NVY H;  1MJE A;  3CCR A;  4DV3 Q;  4GLV B;  1IL2 A;  4MZ9 A;  2JA8 G;  1WCM G;  4R4I A;  1VQH A;  4I1T A;  3CC4 A;  4GOP A;  5C0X G;  2CAZ B;  1KRS A;  3K81 C;  2RHS B;  2Z6K A;  1CUK A;  5H1S E;  4OVO A;  3U4V A;  4DR6 Q;  1L1O C;  1LUZ A;  1FAQ A;  4JOI A;  3A5Z B;  2A1A A;  1E24 A;  4LF9 L;  3TS2 A;  3GTO H;  1VQ6 A;  1VQ5 A;  2IX1 A;  1VS0 A;  2JB3 A;  1G29 1;  4LFB Q;  2YTX A;  1H95 A;  1PH5 A;  2VQF L;  1PH6 A;  1VQJ A;  3G48 A;  4LF5 L;  3F1Z A;  1XMO L;  3L0O A;  1L1O A;  4A93 H;  3AYH B;  2JA6 G;  1DS3 I;  2IP6 A;  3VDP A;  3J80 i;  1KQS A;  4DR2 L;  4IJH A;  3G4S A;  3W1B A;  3HOX H;  2F66 B;  1FJG Q;  2UU9 Q;  1GO3 E;  3K7A H;  4X62 L;  4YWL A;  4AS3 A;  2ES2 A;  1UVG A;  2K19 A;  4DR7 L;  4A3J H;  4DV4 L;  4DV6 L;  2K4K A;  5HGQ A;  2IY5 B;  1PFS A;  4L9M A;  4HIO A;  1MT1 A;  1Q46 A;  1M8B A;  1SLJ A;  2KMP A;  4UY8 C;  4K0K L;  3JC6 6;  2F3C I;  1K0R A;  2ZTC A;  5FUX A;  4DV5 Q;  3F2C A;  1K83 H;  4DV2 L;  2PMZ E;  1N8R C;  2P6A C;  1N33 Q;  4DKA C;  1TUS A;  3DA4 A;  4A3B H;  1VQG A;  4NV2 A;  1Q1B A;  1SGN I;  1GVP A;  4GN4 B;  2R92 H;  3PO2 H;  5IE8 A;  3SDJ A;  3CQZ H;  2OTL A;  2OWO A;  5EAY A;  1WI5 A;  3LJ1 A;  2QEX A;  1SMX A;  4YY3 L;  1NMF A;  3ULL A;  2FXQ A;  3GTG H;  2HHH Q;  2R6G A;  3RLO A;  1AE2 A;  2K50 A;  1XNQ Q;  4JI7 L;  4NXM L;  4PL5 A;  5LMN Q;  2L1L B;  1A63 A;  3UGI A;  3PUV A;  4P75 A;  3J7Z C;  4JI5 L;  4LFA Q;  2VUM G;  3MEF A;  1JMC A;  1FYB A;  5JEA J;  2C35 B;  4UP8 A;  4LF6 L;  4BBS G;  3ULJ A;  3NEN A;  2RCN A;  4P73 A;  4XIG S;  4A3L G;  1QZG A;  3EBE A;  1PH9 A;  1OTC A;  2ZM6 L;  1SGP I;  5IYD G;  3CPW A;  3CCE A;  4Y7N H;  1OMT A;  4GKJ Q;  4L5T A;  1QUQ B;  3M7N A;  3HOW H;  1DS2 I;  4LF4 L;  2KCM A;  1AN1 I;  4QL5 A;  2HIX A;  4IPC A;  1OMU A;  2AMC B;  1TGS I;  3CCM A;  2F3I A;  4DV1 L;  3U50 C;  1V43 A;  1C9O A;  4JI2 L;  3P23 A;  3HOY H;  3EIV A;  3HOZ G;  4YZD A;  3OTO Q;  1KC8 C;  2YTV A;  4AIM A;  3T1H Q;  1TWF H;  4APV A;  5M3F H;  4YHH L;  1C7Y A;  1D8L A;  3M3Y H;  4O1O A;  4DV0 Q;  3KDF A;  2E2J H;  5FUV A;  3F2D A;  4DNI A;  5EX3 A;  2YV5 A;  3JSB A;  1S72 A;  3CCS A;  1HNZ Q;  2CKZ B;  3S14 H;  1N32 L;  4AQY Q;  2ORW A;  3LJ2 A;  2OQK A;  1Y1C A;  2K5H A;  4UXJ A;  1X74 A;  3PSI A;  3I4M H;  2MNA A;  3H0G G;  4IO9 A;  1Y1W G;  2CQO A;  4AYB E;  5M3M G;  3S1N H;  2YQP A;  2N78 A;  2IHE A;  1Q8K A;  4A3G G;  1VQI A;  2JZM A;  3S15 H;  4NPS A;  4LW1 A;  4GXT A;  1B70 B;  3I4N H;  4LUZ A;  4RMF A;  3HKZ E;  4JI1 L;  1SGD I;  1RL2 A;  1TUR A;  1Q86 C;  5M3M H;  1A62 A;  3E59 A;  4C3J H;  2N3S A;  4B3M Q;  2ZJQ A;  1VQE A;  3UEY A;  4X66 L;  3PIO A;  2VZA A;  4O1P A;  4GNX C;  1YVC A;  2QQE A;  4A3I G;  2XTR A;  1LR7 A;  3PUZ A;  1KRT A;  3SGI A;  1UWV A;  2A20 A;  4DV7 L;  2MFI A;  1XMQ Q;  4UXI A;  3PUY A;  5GAH C;  3M4Q A;  1VQ8 A;  4EQ5 A;  4GNX A;  4JI8 Q;  5IYB H;  2KMO A;  1YJN A;  3F4M A;  2QQD A;  1TBQ R;  3RN5 A;  4AQY L;  1YIT A;  1TWA H;  1N36 L;  2UXD L;  2KKM A;  5FLM G;  4HIK A;  1A8V A;  1HJA I;  1PA6 A;  3UE0 A;  2N1A B;  4A4I A;  1SGY I;  4PL4 A;  5IYC H;  4A3F H;  1HPT A;  3UDX A;  1HR0 Q;  5FLX c;  4JV5 Q;  3D00 A;  1XBT A;  1PVO A;  4QJF A;  5E7N A;  1HNW L;  3HOU H;  2WVJ A;  1J5E Q;  1SGE I;  2BUS A;  4JG2 A;  2AWO A;  1A0I A;  4BY1 G;  2PQA B;  1TIH A;  4B3M L;  3Q8D A;  5AJ3 L;  3I55 A;  4XTC S;  4OO1 I;  3OVO A;  3E2I A;  2BA1 A;  4JI6 Q;  2UUC Q;  3OYY A;  1PYS B;  1HZB A;  4QIW E;  5IP7 G;  2N17 A;  2NZH A;  4X65 Q;  3LJ0 A;  4JYA L;  1FL0 A;  1XNR Q;  3M9B A;  2IT1 A;  2F4V Q;  1C0A A;  3DO9 A;  1VQK A;  3KP9 A;  2ERW A;  1IXR A;  3DA3 A;  3S2H H;  4DR5 L;  1K73 C;  4JI3 Q;  4IFD I;  3GDE A;  1G6P A;  1KIX A;  4DK3 C;  1YEZ A;  1IBL Q;  3UE1 A;  4OAV B;  5CCL A;  2Q2U A;  2DGY A;  2ASB A;  3A5U A;  3S24 A;  4GOP C;  2PI2 E;  1KXL A;  1VDD A;  1P8L A;  5HI7 A;  1YU6 C;  2Z6K C;  4X64 L;  4BXX H;  1NBW A;  1R79 A;  3AQQ A;  2AKW B;  4JOI C;  1VQF A;  1R9T H;  2E5L Q;  1JJC B;  2UXB Q;  3B4V C;  4E1P A;  4LF8 L;  2CWA A;  2L15 A;  4O0A A;  5HGI A;  4GLA C;  4A3E G;  2ATW A;  1PHJ A;  4DUY L;  2JA8 H;  2AHO B;  2UUA Q;  1WCM H;  2PNH A;  3KOJ A;  4BY7 G;  1GD7 A;  2ZTE A;  3LGJ A;  4HJ8 A;  4HJA A;  2OVO A;  1X65 A;  1TWC H;  3RNU A;  1UE5 A;  2A8V A;  1CT0 I;  1XJV A;  3GD7 A;  5M5W H;  2W0T A;  3PV0 A;  2N49 A;  3H3V H;  4O2D A;  4X65 L;  5IP9 G;  4IOA A;  2UUB L;  4DAM A;  3CW2 C;  2MO0 A;  3GTQ H;  4LFC L;  1YHB A;  4P72 A;  5LMU Q;  2VQE Q;  3TEH B;  4ALP A;  3TS0 A;  1M90 C;  1FAR A;  4BA1 I;  1XPR A;  3BZK A;  4DUZ Q;  2CFM A;  1AE3 A;  2JA6 H;  2R93 G;  1EQR A;  1ASZ A;  2WP8 J;  4GKK L;  2JA5 G;  1BUS A;  4B3S Q;  1KBF A;  1X4S A;  5ELN A;  1UE7 A;  1VQ7 A;  1XA6 A;  3PO3 G;  5C0X J;  1BMO A;  1E1O A;  2JXD A;  1X6O A;  4P74 A;  2OCE A;  1P16 A;  1QZH A;  1PTQ A;  1PYB A;  1IBM Q;  4DV3 L;  4LUO A;  2WAQ G;  2UXB L;  3PIP A;  2GVB A;  3L7Z C;  1PTR A;  5BR8 Q;  3AFQ A;  4DPG A;  4PL3 A;  1IW4 A;  1UEB A;  5M5X H;  4X6A H;  4FKD A;  4DR6 L;  3M4P A;  3RZD H;  4HGU A;  2VW9 A;  3E9I A;  3J81 c;  4IJL A;  3KJP A;  1Q12 A;  1CGJ I;  3S1M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...