4JCVE

Crystal structure of the recor complex in an open conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
214
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQESEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An 'open' structure of the RecOR complex supports ssDNA binding within the core of the complex.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
molecule keywords Recombination protein RecR
total genus 51
structure length 214
sequence length 224
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02565 RecO_C Recombination protein O C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4jcvE02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jcvE01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4jcvE03
4P73A 3D31A 4APVA 1Q81C 3HOVG 4C2MH 5FLXc 4IPGA 4YHHQ 4HIKA 4A3EG 3NEMA 1HNXL 3G4SA 3CCSA 1K0RA 4OO1G 4A3FG 4EX5A 3M4PA 1YHAA 3KDFB 5M5XH 1VQJA 1FGUA 2KBNA 3CPWA 4JI7Q 4IJHA 3GTOH 1WI5A 3K81C 2Y0SG 1N8RC 1MIUA 2R92G 2I5LX 4IJLA 4AQYL 2VY3A 3PUXA 1QVGA 4DKAC 1YIJA 4J15A 1W2BA 1CUKA 1I94Q 4XIGS 3CC2A 1N33L 4P74A 2AMCB 2I5MX 3GTPH 5C0XG 1QVCA 3STBC 2R93G 1Z47A 3CAMA 2KHIA 4BY1H 1Q8KA 3M7NA 1Y1WG 2JA6H 2NVQH 4KI0A 2FXQA 4DK6C 1FL0A 5M3MH 5ELNA 4JI0Q 5C3EH 3J7A5 3S2DH 1M90C 2PNHA 4BBSH 1MKHA 3CPFA 4R4OA 2VUMG 4TVAB 2E5LQ 1X3EA 4L5TA 3HOZG 1K3RA 1TXYA 2D62A 3E9HA 1IBLL 2PQAB 5EAYA 2BA1A 1X3GA 3CCLA 4YWMA 1SMXA 4OWWB 1VQ8A 1VQ6A 1X55A 3T1YQ 3GTQH 4LF4Q 2C35B 3HFZB 2UXCL 1TWGH 2R7DA 3I4NH 4A3JH 2Q2HA 5IYBG 4LF9L 3RZOH 4A3LH 3DM3A 2A1AA 4A93H 3U50C 3F2DA 1QUQB 5IP7H 1VQLA 3CCJA 2PMZE 4JI3Q 4GKJQ 2HHHL 5GAGC 4LFCQ 4LF5L 3CCRA 5DLQE 1HNWQ 1I50H 4DV3L 4GOPB 1XPUA 4BA1I 3HKSA 3M3YH 4DR4L 4BBRG 2WB1E 3OTOQ 1P16A 2NZHA 3F2BA 4DR5Q 1X65A 4A3MG 3K8AA 1SR3A 2BA0A 4LF5Q 1GKHA 3CC4A 3T1HQ 3JAMc 4K0KL 3PO2G 3A74A 2E8GA 3ZJYC 4DR5L 1I94L 4ALPA 3TS2A 1EQRA 3PO2H 2OTLA 5JJKA 1GD7A 4DR1L 3HOZH 2IY5B 1EWIA 4JI2Q 5M3FH 5IP9G 2VQEL 2QA4A 2B63G 3GTJH 4FDBA 3AEVA 1XPOA 3OYYA 4LF8L 4LFBL 3CCVA 1SFOH 5BR8Q 1WJJA 1VQMA 3F8TA 3F2CA 1B7YB 1X6OA 4YWKA 1EOVA 2A19A 4GLVB 1OXUA 4DV2Q 2KCTA 2K5NA 2CWAA 4X66Q 4PG3A 5M5YH 2MO0A 4LF6L 4HJ9A 3BJUA 4JBJA 1B70B 3J7ZC 1U0LA 3L0OA 1N32L 1HNXQ 1UE5A 2ZTDA 2IHEA 1SE8A 2HIXA 3AFPA 4LF6Q 4NXNQ 3UE1A 3KJOA 1VQAA 2AWOA 4A3JG 4JG2A 1L0WA 3MEFA 5FLMG 3A5UA 4JI7L 2RHQB 3J80i 1NE3A 1PH3A 4A75A 2ATWA 2JA9A 4DR2L 3LGJA 1PVOA 3ULLA 3I55A 3PF5A 4LUZA 1N34Q 2VNUD 3KJPA 2AKWB 3NENA 3EN2A 4DUZQ 2AHOB 4C3HH 5IYCG 1M1KC 1NTGA 1VQGA 2JJQA 5IY0A 1WOCA 2YTYA 2VQFQ 3D0FA 1XPRA 1N34L 1V9PA 1YBYA 4B3RQ 4JI6L 3L7ZC 1VQFA 4BY1G 2E2IH 1LM0A 3KF8B 1YJNA 4RMFA 5C4XH 1UE1A 3CXCA 3OW2A 1IBKQ 4JI4Q 4X64Q 4JI2L 1QVFA 4PZ6A 4A3KH 3CMAA 1IXRA 4DR6L 5C4XG 2HQLA 4DR3L 2K5HA 4A3GG 1PH8A 2N78A 2UUBQ 3S1NH 1VQEA 5LMNW 3S17H 1ASZA 5HGQA 1VQ4A 2R7ZG 2HT1A 2F4VL 4KHZA 1OTCA 4LF7L 4B3TL 3BZKA 3K7UC 1CSPA 5J3BA 4A3IH 2CQOA 3I56A 2NVTH 4OX9Q 1XNRL 2LXJA 5C44G 5JJLA 2VUMH 1BKBA 4A4IA 3G6EA 1BBUA 3FKIG 2KCMA 4LF7Q 1Z9FA 2WP8J 1KL9A 1YEZA 3CQZH 4A3FH 3GTKH 1NJIC 2UU9L 4LNQA 2LXKA 3M9BA 4A3EH 4JI1Q 4P75A 3W1BA 2HHHQ 3E0EA 1EFWA 5GAEC 5JJIA 1RL2A 1VQHA 4HJ8A 3AFQA 3TQYA 1I6HH 2JE6I 2OWOA 5JEAJ 1DGSA 4GNXB 1PH2A 1T9HA 1E24A 1GO3E 2NN6I 3PUYA 1JJCB 4R4IA 4DV7L 2R7ZH 4UP7A 1G51A 4AQYQ 3M85A 1Y1VH 1KXLA 2UUAQ 2E2JH 3K80C 3RLFA 4JBKA 4NB3A 5H1SE 1HR0Q 2IHFA 1Q1BA 1X56A 3EIVA 3J81c 1SLJA 1KAWA 2UUCL 4NXMQ 2IX0A 5IYCH 2IT1A 4YCVA 4JI6Q 4OXPA 2NN6G 3PCOB 1TWCH 2ES2A 2Q2UA 5C44H 4QQBX 4DR6Q 3ULJA 2Y0SE 1I5FA 4BY7G 4WJ3M 2Q2TA 1FVIA 4DR3Q 4A3IG 2ASBA 2AWNA 1PA6A 4B3SQ 4MZ9A 2UXBL 4OWXB 2VZAA 4L5QA 4GOPC 3RLNA 1X9NA 4DV0Q 1SROA 3CC7A 4LF9Q 3PUVA 2R93H 3B6YA 4LFAQ 4JCVE 1HZAA 1EYGA 2NVXH 4X6AH 2H5XA 4DNIA 3Q8DA 1CKNB 1E1OA 4B3SL 4IFDG 2UXBQ 4A3DH 4LFCL 4A3MH 3HOUH 2JA5H 1XMQL 2Z0SA 4DV3Q 3RNUA 1YJWA 1E3PA 3OTOL 1NMFA 2JEAI 2ID0A 1HNZQ 2UXDL 5K36G 2K52A 4JI3L 3J81i 5IWAQ 4X65L 4BXXH 1JT8A 2K75A 4IOCA 1J6QA 1EIFA 1YHBA 3CCQA 1S3OA 3U58A 2ZJPA 1R9TH 4QJFA 1YZ6A 3TEHB 4IPHA 5IWAL 4X65Q 1YNXA 4HIOA 4LWCA 5IYDG 4JC0A 4GOPA 2ZTEA 5FLMH 3I4MH 4GKKQ 1YJ9A 2WFWA 1C9OA 3VDYA 4UP9A 4LUVA 2XTIA 4Y7NH 2Z6KC 1NMGA 1HR0W 4NPSA 4GLAC 2CFMA 4X64L 1YVCA 2B29A 2UUCQ 3GTLH 1K73C 1VQIA 4JBMA 2IX1A 4DV4Q 4A3KG 1Y1WH 2JA6G 4DV6Q 1J5EL 1XMOL 2F4VQ 4GNXC 3W5OA 4PZ8A 4JI5L 4GNXA 1UWVA 5IT9c 5C0XI 2I5HA 1NBWA 1YITA 1A62A 2DUDA 4R4QA 4YHHL 1HZBA 4AYBE 4A3BH 4JV5L 1CKOA 3M4OH 3UDXA 1Q82C 4A93G 1PV4A 1Q12A 3PUZA 2ZM6Q 4L5SA 2R7FA 3CW2C 4IPDA 1MJCA 4B3MQ 1L1OB 1IZ6A 2NZOA 3U4VA 1XMQQ 1PHJA 4JV5Q 1I3QH 2JEBI 3KDFA 3BU2A 4P71A 4POGA 1A8VA 4DR4Q 1QZGA 3FKIH 5FJ8G 4R4TA 3STBD 4DUZL 4HJ7A 3IRBA 3G71A 2JA7H 3I4MG 2QGQA 3PGZA 4A3BG 5AJ3Q 1U5KA 1VCIA 1JJ2A 4BA2I 1E7ZA 3FP9A 2E5LL 2Q2IA 4DR7Q 1LTLA 1JB7A 1BBWA 4GKKL 3CF5A 1TWHH 1B8AA 3G48A 3UDGA 1D7QA 3W1GA 4DAMA 1V1QA 2XGTA 4DV2L 1G291 4JYAL 3CCUA 2OQKA 2PI2E 4B3RL 1WYDA 4MNOA 5HY6A 2MNAA 4A3DG 1H95A 1N32Q 4BY7H 1XJVA 1EQQA 3DLLA 1VQDA 2JA8H 1XMOQ 1KHIA 4OWTB 3J81j 3I4NG 2D0OA 5GROA 4X62Q 1CKNA 1IYJB 4BBSG 4PMWA 2MO1A 2D0PA 5GQOA 5M3MG 1ASYA 3HOWG 4R1JA 1FJGQ 5C4JH 2VW9A 4HJ5A 2OTJA 2VL6A 1IL2A 4X62L 3TS0A 3GD7A 4MTNA 1TWAH 4DV1L 3GTGH 2B3GA 4K0KQ 2HIVA 1HNWL 2ALYB 1PH7A 4BBRH 3HKZG 3S24A 5C3EG 1FJGL 4A3CG 2UXDQ 1L1OA 2UU9Q 1A63A 5IE8A 1Q7YC 2OCEA 3RN2A 2JA5G 1N33Q 4DV5Q 1HJPA 1HZ9A 4O0AA 5IP7G 4DUYQ 1O7IA 2UUAL 4Y52H 1AE2A 1E22A 4GN4B 3UE0A 4A3LG 3WWVA 3RN5A 3H3VI 1GVPA 4IO9A 1C7YA 3JAMi 1X54A 3S15H 2DGYA 1KRSA 4UY8C 3A0JA 4DUYL 3H0GG 4JI0L 3BZCA 1N9WA 3S1QH 3U4ZA 1RIPA 2I0QA 4YCUA 4H02A 1LYLA 1Q1EA 2PI2A 2YTXA 2MQHA 3SGIA 4X66L 4A3CH 4DPGA 1JE5A 4JI8Q 3GO5A 3PSIA 1HR0L 4QL5A 1IBKL 2CCZA 3I7FA 4JOIC 3HOVH 2JA8G 4JOIA 2GN5A 3CD6A 4JYAQ 1XNQQ 4POFA 1L2FA 4NXNL 5C0XJ 2F52A 1K9MC 5GADC 3K0XA 4ME3A 4QGUA 5LMUQ 5ELOA 1IBML 3HOYG 2N49A 4JI1L 4AH6A 1K83H 1OXTA 1OXSC 4UP8A 1QZHA 4OX9L 1XNRQ 3FHWA 1VQ9A 2N3SA 3CCEA 5LMNL 4KHPQ 3HOXH 1VQOA 3F1ZA 3RZDH 4A76A 1IBMQ 2PQAA 1P8LA 1PFSA 1K8GA 2YU9H 4AIMA 2ZM6L 3A5ZB 4IPCA 4OONA 1E1TA 4PZ7A 2BH8A 4XTCS 4DV1Q 4GN5A 1VQCA 2RCNA 4IFDI 2L15A 3H3VH 2JK8A 2EXDA 1X3FA 3PV0A 2ZTCA 4DV7Q 4LFBQ 4KLKA 2BH2A 4JBWA 2RHSB 2ZJQA 2V1CC 2GVAA 4GS3A 3K7AH 2UUBL 2VQFL 3ER0A 2CWPA 2R6GA 2VQEQ 2LSSA 2KHJA 5FJ8H 2MFIA 3ERSX 1S72A 3HKZE 5IYDH 2NVYH 3GDEA 3PUWA 2YV5A 3MXNB 4RG1A 4GKJL 1IBLQ 2WAQE 1CKMA 3GTMH 4DV6L 1J5EQ 2EQSA 4OO1I 4DAYB 3T1YL 3RR5A 3S1RH 3KLWA 3M4QA 2UXCQ 4JI8L 3RLOA 3PIOA 4GLXA 4JI5Q 4O2DA 1C0AA 4EQ5A 3KOJA 3CMEA 1JJGA 1CSQA 1EUJA 1XNQL 4DV4L 1SN8A 1UE7A 4DK3C 3PO3H 1JMCA 1BVSA 4LW1A 1KC8C 2YYZA 5JEAG 3HOXG 4IOAA 4YY3Q 2JA7G 4QY7A 5M3FG 1NY4A 3JC66 2E2HH 4LFAL 3AYHB 5IYBH 4DR1Q 3PIPA 5LMNQ 2KENA 4C3JH 4KHPL 4IFDJ 4L5RC 1WCMH 1PH9A 2A8VA 1VQNA 4YCWA 2Z6KA 2QEXA 4YY3L 1WCMG 4QIWE 2B63H 1XTDA 2JQOA 1Q46A 4JI4L 5BR8L 2N8NA 4BXXG 5AJ3L 3UDFA 1AH9A 1YHQA 3KFUA 2K50A 3KF6B 1Y14B 4GN3B 1OXXK 3PO3G 4C3IH 4B3TQ 3S2HH 2WAQG 1LUZA 4HJAA 1MJEA 4LF8Q 3TRZA 4YWLA 3HOUG 3ICEA 3L2PA 2YTVA 4WJ4A 4AYBG 2K5VA 4LF4L 2WB1G 1SRUA 3J80c 4P72A 4LUOA 1VQPA 3UDIA 1PYBA 1S40A 2K4KA 5IP9H 3S1MH 2GVBA 1HH2P 3I2ZA 5E7NA 3PF4A 3S16H 1QUQA 1VS0A 3CP0A 4HIMA 5LMUL 1VQBA 4HIDA 1KD1C 3E9IA 1PYSB 2RF4A 4DV0L 1HNZL 1Q86C 1VQ7A 3S14H 1G6PA 4TQUS 1KRTA 3EBEA 4B3ML 1AE3A 3KYHC 1KIXA 1GM5A 3H0GH 1V43A 2CKZB 4R4CA 3T1HL 4DR2Q 1PH4A 1UE6A 1HZCA 3TREA 1OXVA 3I4OA 1YI2A 2EIFA 1EIYB 1VQKA 3CCMA 5GAHC 4NXML 1D8LA 5M5WH 1WFQA 2OQ0A 4DR7L 1K8AC 4A3GH 1PH6A 1UEBA 2R92H 1TWFH 1Y1VG 4UPAA 3KF6A 1N36L 3HOYH 2K14A 3NBHB 4DV5L 1PH1A 3AQQA 1W3SA 3NELA 2ZJRA 1A0IA 3H15A 2F3IA 3ULPA 1PH5A 1KQSA 2VS1A 3HOWH 1N36Q 1L1OC 1VQ5A
chains in the Genus database with same CATH superfamily
4P73A 3D31A 2YFAA 4IPGA 4MTKA 2CH4W 3NEMA 1HNXL 2RQXA 3G4SA 1EOTA 3O13A 4EX5A 4A3FG 4IURA 1K7UA 2PZTA 2E2DC 1NSNS 2KBNA 4DA2A 1CT2I 2XRCA 2X3TA 1SYBA 1LTRD 2ROWA 1JQYD 1N8RC 2R92G 1LTSD 3I4MB 3PUXA 2PQEA 4ZUJA 2QDLA 4J15A 4HEA1 5J8FA 1W2BA 3K6OA 3CC2A 3FVVA 2FMMA 3OSOA 1RJTA 1K28A 1QVCA 1PPFI 5FOBB 3DA4A 4BY1H 1I3QB 1Y1WG 2JA6H 1XBTA 3E59A 5KGUA 4KI0A 2N52A 4DK6C 1LACA 2NVYB 5C3EH 2E74C 3S2DH 2X52A 1MKHA 4IUVA 4CJ1B 2VUMG 2K03A 1TUSA 5JVG3 2XSCA 1IBLL 2X6GA 2PQAB 2H4OA 5EAYA 2BA1A 3CCLA 3JSBA 1VQ8A 2Q8IB 4SGBI 2UXCL 1TWGH 3I4NH 2ETDA 1SNDA 5IYBG 1SE2A 2IL8A 4A93H 3U50C 1QUQB 5IP7H 2OXPA 2PMZE 3MHBA 5GAGC 4LF5L 1KABA 3B4VC 3RU0A 1JOOA 1I50H 1SGRI 3CRLC 1M8BA 3F2BA 3M3YB 4C1NI 3T1HQ 4IALA 1YNND 3J80E 4DNRB 3S1QB 1EQRA 3FRPB 5JJKA 1GD7A 1X74A 2ICEC 4DR1L 3MC0B 2IY5B 1EWIA 5EJWA 2EYOA 2K5WA 3P75A 1Y1BA 2E76C 2VQEL 2ARPF 3GTJH 3S2DB 3OYYA 1HXYD 4LF8L 3V05A 1SFOH 4I65A 1VQMA 3BJIA 1FNUA 1HQMC 5FUVA 2QCPX 4GLVB 1OXUA 2EY2A 5M5YH 2QQ0A 3L9AX 1A15A 2NZ1D 4HJ9A 5E4WC 1B70B 4RH6A 3J7ZC 3L0OA 4DF7A 1WGTA 1F2ZA 1MD2D 5EX3A 4A3JG 4JG2A 5EGTA 1L0WA 5FLMG 3JAME 4JI7L 2FHTA 1NE3A 2ATWA 2V1CA 3SK5A 3DXJC 3K58A 1I4HA 4TSSA 1FYCA 4XDXA 1CTMA 2AHOB 4C56C 2WKDA 1QNUA 1NTGA 3U9SA 2JJQA 2VQFQ 1M90C 1FNWA 2QQDA 1N34L 1V9PA 2A73B 3DMUA 3K5LA 1LM0A 5IOCA 1YJNA 4A3BB 1UE1A 3CXCA 4HMJA 4KY7A 4A3KH 4DR6L 5KIXA 5I6YA 1OYVI 3S1NH 1A3TA 1VDDA 5IGGA 2HCIA 1ASZA 5HGQA 2LFNA 1H9SA 2F4VL 4LF7L 3BZKA 3K7UC 5J3BA 2CWFA 2NVTH 1CA5A 1OMTA 4DWLA 3D6WA 5C44G 2CVRA 1B50A 2MGSA 1ZKOA 1Z9FA 5EKIA 2QILA 1NJIC 4LNQA 1YU6C 1B9MA 1EIHA 2QZGA 3AFQA 3E5SA 2OWOA 1CHPD 4GNXB 2KMQA 1T9HA 3KLSA 1GO3E 4DV7L 3ZYYX 2Z4IA 2VXWA 2DY8A 1QG7A 1B2TA 5IGDA 4AQYQ 1Y1VH 2KMOA 4CDCC 3IL8A 2SGDI 2UUAQ 3RLFA 4JBKA 2LY7A 4EVOA 3TOAA 1ESFA 4IUUA 1F2LA 2IX0A 4E6IA 2IT1A 4YCVA 1Q3LA 1R4QB 3PCOB 3ULJA 1FVIA 4A3IG 2ASBA 2AWNA 2N1AB 4MZ9A 2VZAA 4CGYB 4F88A 2ERWA 3PUVA 1DZ1A 3B6YA 2NVXH 4X6AH 3BVMA 1A2UA 1GHKA 4B3SL 4IFDG 1D1KA 4YZDA 4LK1C 2JA5H 3D4RA 1EFID 2Z0SA 1CA6A 1E3PA 7WGAA 4OGQC 2JEAI 2ID0A 3VYRA 2EYHA 2UXDL 5K36G 2MHVA 1NAPA 4KD4A 5IWAQ 5C44B 1JT8A 3SGBI 1EIFA 3CCQA 1E2WA 4QJFA 2W0TA 1YNXA 4LWCA 5IGFA 2ZTEA 5FLMH 3I4MH 1YJ9A 1STYA 4UP9A 4LUVA 1RODA 2FNFX 3GTLH 1D6EC 5COYA 2IX1A 4DV4Q 4A3KG 1Y1WH 2JA6G 3HOYB 2ZXOA 2QF7A 2JA7B 4GNXA 3NBHA 3HH2C 3RMHA 4XYQA 1NBWA 3LWUA 4R4QA 4YHHL 1HZBA 4RHSA 1WKXA 2NU1I 3M4OH 1Q82C 1X4SA 5A2QL 2F6MB 1TS2A 1O78A 1UUPA 2R7FA 4C2MB 4B3MQ 1IZ6A 3U4VA 2NZOA 4DNCA 3KDFA 4KJOA 4G7ZC 1TS4A 3WOEA 3FKIH 5EKKA 3V96A 1QWYA 3IRBA 3G71A 3PGZA 2B2TC 4FF3A 5AJ3Q 5FO7B 5G3LF 2WB1B 2Z6BA 4ABNA 2IX3A 1BR9A 3UOEA 1LTLA 4RGMA 3NPPA 1D7QA 1TDPA 3W1GA 4DAMA 2E2IB 4EQPA 1KMAA 4C3IG 4DV2L 5M5XB 1L0XB 3CCUA 4B3RL 2V6EA 2X6LA 1KDAA 3WDNA 1W6KA 2EYPA 1N32Q 4BY7H 4XYOA 4BBRB 1ICWA 1EQQA 3DLLA 3J81j 4KTAA 4OWTB 1CKNA 2BDNA 2XWJB 2ZXRA 5E4XA 2MO1A 4BBSG 2D0PA 3GTJB 3VE5A 5GQOA 5M3MG 1FJGQ 3E0JA 3KLRA 2VL6A 1IL2A 4X62L 3TS0A 1EQTA 3GD7A 1S20A 1TWAH 1TGSI 2ALYB 2P6AC 1EYDA 2BCOA 4X3SA 2AQ1B 3PIO3 2M5XA 2EJFC 2UU9Q 2J9RA 1A63A 2DNEA 4DV5Q 1HJPA 1A3VA 4Y52H 4GN4B 3UE0A 4A3LG 3RN5A 1GVPA 1A3UA 4IUNA 1C7YA 5E3FA 4UY8C 5IGEA 4DUYL 3S1QH 3U4ZA 4NP5A 1SYDA 4YCUA 1LYLA 1Q1EA 2PI2A 4A3CH 4DPGA 1WTVA 4HCSA 3I91A 2NB0A 3PSIA 4JI8Q 3I7FA 1PRTD 1K0SA 2KCCA 3A8JE 1XNQQ 1EEID 4POFA 3I90A 5C0XJ 1GUWA 1RCVD 5DAEA 5ELOA 4GXTA 3VYUA 2N49A 1XNRQ 3OWFA 3OWEB 4A3IB 1LV9A 3TJQA 2K04A 9WGAA 1VQOA 2D5DA 4WFN3 4CBVA 4A76A 3S1NB 4I7AA 1P8LA 4OONA 2HDMA 2KA7A 4A93B 2BH8A 2G5DA 2RCNA 1WD0A 4IFDI 2AUJD 1SE4A 2AQ3B 4LFBQ 4DV7Q 4KLKA 2BH2A 1PTOF 3TOBA 3ER0A 4FXDA 3I9V1 3ERSX 1GXDC 1PZID 3FC3A 2NVYH 3F2UA 3PUWA 2YV5A 3H09A 3UI2A 3UGDA 3HGBA 1RTNA 3M7GA 3FMCA 3S1RH 3K5MA 2K5QA 4Q0FA 1C0AA 2EVBA 2D9UA 1PRTF 1D1IA 1TY0A 1CSQA 1XNQL 1SNPA 1QJOA 2B8TA 1Q90A 4LW1A 5JEAG 4JK1C 4ZYSA 3I4LA 2JA7G 4CKCA 2RBMA 1SGPI 5I4DA 1EZ8A 4ZLTF 2CH4A 3HOWB 3TBIB 3S2HB 5I9PA 1RHPA 2Z6KA 1WCMG 2B63H 4N9PA 3CHBD 1ML0D 3Q23A 3UDFA 3VA7A 4DGZA 5DM63 1YHQA 2DY7A 5K36H 2K1BA 1JWSD 1OXXK 1V1IA 1YO7A 4FVMA 3KY9A 2WAQG 1MJEA 4IQZA 2MUYA 4WJ4A 3A8KE 1QILA 2V4DA 1CGJI 3KP9A 4U673 1SRUA 5CV5A 3ITPA 1PYBA 1BOSA 1S40A 5LL6S 3S16H 3E6ZX 3CP0A 4XXEA 1KD1C 1VQBA 1TWCB 2RF4A 1HNZL 1Q86C 1FGBD 4TQUS 2FJ2A 1AE3A 1KIXA 1GM5A 1I6HB 1GJXA 3R5AA 1E2ZA 3T1HL 1WTPA 3TP8A 4IUPA 4BBSB 1PJUA 3SGQI 2L1LB 3RZOB 1YI2A 3CRKC 1VQKA 1UAPA 2K28A 4F8MA 4NXML 5GAHC 1UHAA 1XA6A 1WFQA 2OQ0A 2EXZA 3BVGA 4A3KB 4A3GH 1MGSA 1UEBA 4FXGC 4UPAA 1NR2A 1SNQA 1X3QA 3NELA 4KJNA 3WOFA 2B2YA 2NVTB 3ULPA 3Q6SA 3HOWH 2XMXA 2F0OA 3J81E 1OMUA 4APVA 1Q81C 3HOVG 3DEOA 4C2MH 1G2TA 2QQEA 2RIJA 4YHHQ 2F0QA 3QOJA 4QUFA 2A2CA 3C46A 3HEJA 1Y8PB 3J7AF 2B8GA 3H91A 2RC4A 2ENBA 3CPWA 4JI7Q 3K81C 2PZWA 3GP7A 1QVGA 4AQYL 1CHOI 1J8IA 5JEAH 2PCFB 5IT9L 1BQQT 3DO9A 4XIGS 1SNCA 4CKBA 4P74A 2AMCB 2I5MX 3CXLA 2P5ZX 1IW4A 1KLUD 2R93G 1Z47A 3CAMA 2C5CA 3K7AB 1Q8KA 1ULNA 1SFOB 1PRTC 2P22B 2FMCA 3J7A5 1NNXA 2PNHA 2BOSA 3V2TA 3CPFA 4R4OA 2NU2I 4TVAB 3LJ2A 2F0FA 2R3ZA 2WIIB 3D6CA 1TXYA 5TSSA 1TOTA 1X55A 4HEDA 2JYOA 2C35B 2R7DA 4ME5A 2Q2HA 1V1OA 4LF9L 4A3LH 3DM3A 2A1AA 1HJAI 4NMZA 1VQLA 2XWBB 3QTLD 2F0KA 4LFCQ 3CCRA 1HNWQ 3IKJA 1XPUA 4DR5Q 1P16A 2L11A 1X65A 3S14B 3FSXA 1SR3A 2BA0A 4LF5Q 2YFBA 4EQNA 3CC4A 2NU0I 1G2SA 1JC7A 4P2CB 3A74A 1HUMA 1T5EA 2E8GA 3ZJYC 4C1NK 2WACA 5CR3A 3PO2H 1SJED 3RUZA 3RD4A 3QIAA 5IP9G 4MHEA 1V1HA 4NW2A 1EYCA 2K6AA 1NUBA 1JOQA 5T1GA 3F2CA 1B7YB 2HQEA 2B63B 2A19A 2L0CA 1EQVA 4DV2Q 4LF6L 3BJUA 2WAQB 4JBJA 1U0LA 5D65A 2ELIA 1HNXQ 2ZTDA 4HAEA 5E3QA 1PFMA 3AFPA 4FF1A 4NXNQ 1VQAA 2AWOA 4ODGA 1Y8OB 3MEFA 2RHQB 1DXMA 1JB3A 4H13C 1PVOA 1VDZA 3I55A 3U9OA 3PF5A 4LUZA 1O7LA 5HGTA 5CBAE 1N34Q 2VNUD 4MIUA 3KJPA 1B44D 2AKWB 2NN6H 1SYEA 4K8IA 3FEWX 1SGYI 3MXNA 1VQGA 5IY0A 1XPRA 5I9OA 1M8AA 3NK9A 4B3RQ 4JI6L 1KNEA 2E2IH 1WVLA 4RMFA 4ZKBB 1IBKQ 4UHVA 2H1EA 4PZ6A 3CMAA 1IXRA 5C4XG 4DR3L 1TIID 2K5HA 2F0IA 4A3GG 1YTPA 3T56B 1IW7C 1JWUD 3MZ5A 5LMNW 3S17H 4QB4A 2L7XA 3Q22A 3NQIA 2HT1A 2OVOA 5CC4A 3GV6A 5ELCA 4A3GB 3QO2A 2VUMH 3Q0AA 2Y0SB 3NTIA 2KCMA 4L9MA 4CJ2C 2UU9L 2LXKA 3M9BA 3OHXC 2JB3A 1K8MA 3E0EA 1EFWA 4OAVB 1JQOA 4HJ8A 2QSBA 4PL3A 1LTGD 1DGSA 4CHTB 1HRJA 2NTTA 4CDDC 3PUYA 1FR3A 4JVZA 2R7ZH 1JJCB 3T4AC 4UP7A 3NTKA 1G51A 3QG1A 3M85A 2F03A 1KXLA 3E2IA 2E2JH 1PYWD 3AB9A 1DM0B 2TSSA 1RKNA 2IHFA 3T13A 3EIVA 3J81c 1SLJA 1KAWA 4OEMB 2UUCL 3HOZB 4NXMQ 3UGLA 1OVOA 4ZCKA 2RVLA 4OIKA 2B0UC 1TWCH 4QQBX 3AJFA 2Y0SE 2Q2TA 4AS3A 2L55A 5E3RA 2UXBL 4UXJA 2R61A 2O5IC 4OWXB 5DM73 4GOPC 2KUMA 3RLNA 2LUYA 3NUCA 1X9NA 4LF9Q 5LHY1 3LJ1A 1CZGA 1EYGA 2ZRRA 5C0XH 4DNIA 1W4RA 3Q8DA 1CKNB 1E1OA 3HKZB 1NUCA 1TVXA 4A3MH 4DV3Q 2GIVA 5EX0A 3OTOL 2E2JB 1RF2D 2IP6A 2D2CC 2ZT9C 2CWGA 4JI3L 4DK0A 2KVMA 3EVQA 2JZMA 2K75A 1H9RA 4O1PA 1PFBA 4RCNA 1S3OA 4ULLA 3U58A 3AU7A 2ZJPA 4S3SA 3TEHB 1II3A 4IPHA 5IWAL 3UEYA 4GKKQ 3P7JA 3QAHA 2Q8TA 2WFWA 1C9OA 1WTJA 1FAQA 5JHWC 1SJ8A 1I50B 4NPSA 4GLAC 2GSCA 2CFMA 4X64L 1U4PA 4H7BA 4E1PA 3AMUA 1UNSA 1SGNI 3I70A 2F4VQ 3NSWA 5EPLA 4GNXC 4JI5L 3OIPA 2RIOA 2FU2A 5LNK1 2DUDA 3A55A 4A3BH 1QNKA 4A93G 2A20A 4G75A 2JXMB 1PV4A 2DIPA 4YIJA 2PW7A 1F2YA 3FKIB 3H94A 3FPPA 4X3UA 2RDHA 2EPBA 1FARA 5C3XA 1MJCA 3H0GB 3LX0A 4PL4A 4POGA 1S4ZA 4DR4Q 4HJ7A 3STBD 2JA7H 1U5KA 1BF4A 1JJ2A 2E5LL 2JP1A 1BBWA 3CF5A 3KUPA 1IYUA 1BDOA 3UDGA 2E73A 4WJWA 1V1QA 2KCNA 1SJHD 1R9TB 4JYAL 4O1NA 4G7OC 1LT5D 4KN4C 5M9OA 2JA8H 1VQDA 1KHIA 1YNNC 5GROA 3PIP3 1IYJB 2EZVA 3HOWG 4R1JA 5A2QE 2OTJA 4MTNA 2J0TD 4K0KQ 1MI2A 2BDOA 3FPUB 3S15B 2EY6A 5CV7A 1CQVA 5CV9A 1HA6A 5C3EG 1FJGL 4A3CG 1MJBA 4CDEC 4OIJA 1D5ZC 3BG3A 4K14A 3J80L 1N33Q 4O0AA 3K5NA 5IP7G 4DUYQ 1F9PA 5C4JB 3WWVA 3TDQA 1G91A 4IO9A 3MTSA 3SK8A 2TMPA 2Z8LA 4N8X1 3A0JA 1N9WA 1RIPA 4CKEA 3SGIA 2MQHA 5T1IA 3EFXD 2OZUA 4FKDA 1A2TA 3P20A 3A7LA 4DN4M 1EIGA 5I2YA 3K57A 1L2FA 4QUCA 4NXNL 2F52A 1TKWB 4ME3A 4ZAIA 1EWCA 1BBXC 2HUGA 1K83H 1OXSC 5J8CA 2CQAA 2LEOA 2UVOA 2NTSA 4A3FB 3NBIA 3HOXH 3LWEA 1DOLA 2F66B 3RZDH 1O80A 2YU9H 2QGMA 2A6EC 1H0ZA 4IPCA 2B2WC 2A69D 4DAVA 4DV1Q 3R3OA 3M4OB 1VQCA 2VUMB 1K7TA 3S17B 3I73A 3H3VH 2JK8A 4B9XA 1X3FA 4H0LC 4C3HG 2F0JA 1EY8A 2RSOA 3K7AH 3FDTA 2R6GA 5FLXL 2LSSA 2KHJA 3IAYA 4TKOB 1S72A 5IYDH 1EU3A 3GDEA 2JB2A 3MXNB 3LJ0A 4GKJL 3GTMH 1VMCA 4DV6L 1J5EQ 4RFBA 4DAYB 3T1YL 3RR5A 4OO1I 3KLWA 3M4QA 2UXCQ 3HRZC 3PIOA 2B2VC 3D00A 3CMEA 2M2LA 3ND9A 4UAIA 5C4HA 4DV4L 2EYMA 4G4KA 3PMFA 2A6ED 1LTID 3IAM1 2KHSA 2E2HH 4LFAL 4Z7HA 2B2VA 3AYHB 2NU4I 3E3XA 1PFNA 1CM9A 3SE0A 2A8VA 5I2XA 1VQNA 2DN8A 1H9MA 2QEXA 4YY3L 4QIWE 1F9RA 1TS5A 1U4MA 1XTDA 4J6HA 4BXXG 2Z9HA 1WTRA 2ORWA 1EY0A 1TWAB 5FO8B 4NV5A 1CT1D 1AH9A 2HCCA 3N6RA 3KF6B 5CCLA 1LR9A 1PZKD 1Y14B 5DEHA 5EQ0A 4C3IH 4B3TQ 1NXUA 1LUZA 4LF8Q 4WORA 2RLDA 2K33A 3ICEA 2BE5C 1EU4A 3TZDA 2JB1A 4P72A 4LUOA 3UDIA 2K4KA 3S1MH 1HH2P 3I2ZA 1EZ6A 1QUQA 3BVZA 3TP5A 5LMUL 4HIDA 1YNJD 3L0IA 1KRTA 2DB6A 3EBEA 3MFYA 1SNMA 1V43A 2A68D 1VF5C 4R4CA 5FKAC 3MFGA 1PH4A 1UE6A 1AN1I 1JICA 5CMDA 5ELFA 3I4OA 5G3LD 2EIFA 3VR2A 2L12A 1EIYB 2JA1A 3CCMA 2KMPA 1HTLD 2RSNA 2K5DA 2LB7A 2R92H 3UITA 1Y1VG 2RCFA 2NYZD 1CQFA 2K14A 4QIWB 1I6VC 1RD9D 1W3SA 5CV4A 1STEA 1A0IA 1WTQA 3GV3A 3H15A 1CZWA 2F3IA 1N36Q 2Z4HA 5I6WA 5D14A 1HPCA 4KV6A 1Z7KB 3OOCA 1ILQA 4HIKA 1S5DD 1K0RA 1V8QA 4MN3A 3M4PA 1F2MA 5M5XH 4E1RA 1FGUA 4O1OA 2L8EA 4IJHA 3GTOH 1WI5A 4KHVA 4KKSA 4DKAC 4LAAA 1HA5A 2XRQD 1YIJA 2EYLA 4QMGA 1CUKA 4RKBA 5L37A 3GTPH 5DAUA 5C0XG 3STBC 3M7NA 2KHIA 3VR3A 5CV6A 2F0NA 4PMBA 1NR4A 1EL0A 1AP0A 2FXQA 3UFFA 1FL0A 5IGBA 3D3RA 3BDCA 4I7ZC 5ELBA 1BMOA 4TRDA 5M5WB 1BXTA 1LTAD 1K3RA 1WD1A 3A56A 2F0HA 1KBFA 1IKLA 2RA4A 4YWMA 5E3PA 3T1YQ 3VA9A 3GTQH 1H9JA 3HFZB 1O7ZA 4AYBB 2I46A 4PL5A 3GQBA 2F0EA 3ND8A 3CCJA 4JI3Q 1U9RA 3K0YA 5CBEE 4N8FA 5F2DA 4Z9CB 4GOPB 4BA1I 3HKSA 1HCZA 2F0UA 2WB1E 4BBRG 1LO5D 4A3MG 3K8AA 2CW0C 1Y1VB 1GKHA 3S16B 2ORVA 4R8IA 3JAMc 2A5HA 4KY5A 1XTCD 4DR5L 3TS2A 2QQCA 2OTLA 1F9QA 3QOLA 3NXWA 1E0BA 2QA4A 2EOTA 4H44C 2XVSA 3SK4A 4FDBA 1O7YA 3AEVA 1XPOA 2WVJA 1K7VA 3TO7A 5BR8Q 1WJJA 2UZ3A 3R8BA 2SGQI 4YWKA 2KCTA 2CWAA 3OPOA 2MO0A 1Z7TA 1R79A 5EBDA 1STAA 1EY4A 1UE5A 3DA3A 5K5PA 4LF6Q 4F7XA 3KJOA 3PQIA 3A5UA 4BY7B 2SGFI 3A8IE 2ENNA 2QPOA 2E5RA 1GUOA 3Q24A 1DS3I 1NCVA 1PH3A 1ULKA 3LGJA 3NWSA 3ULLA 2XTQA 3C1FA 1STHA 4IZ8A 3NENA 2K9HA 3W3AA 1SYFA 3GTMB 1WOCA 4N9TA 2B39A 3L7ZC 3FSYA 4HGUA 1VQFA 2F0MA 4BY1G 3MEKA 1Q8IA 4X64Q 5HURA 1PH8A 2B2UC 4CJ0B 1VQEA 1EY9A 3TMEA 3T53B 1VQ4A 4EQOA 4KHZA 1OTCA 4B3TL 3B55A 1X32A 1XNRL 4A3MB 2LXJA 4R9WA 5JJLA 1JCKB 2IPKD 4A4IA 3G6EA 4NDXA 3FKIG 4O42A 2F3VA 2R92B 3R93A 1LT4D 2KECA 2WP8J 1YEZA 2G9HD 1IW7D 4JI1Q 4P75A 3W1BA 2HHHQ 5GAEC 2JBWA 1RL2A 4XQJA 2BUSA 5FUXA 1Y69U 2A74C 1ET6A 1D5MC 5CV8A 1E24A 3BYTB 2WCYA 2XRSD 1HQRD 5FUYA 4WRDA 4HN7A 1ENFA 1L1OC 5C5MA 5KRUA 5H1SE 1Q1BA 1X56A 2PPBC 1DOKA 4HSPA 1BO0A 5IYCH 2NVXB 4Y7NB 2F3WA 2ES2A 2WGCA 4A3JB 4DR6Q 4AS2A 4BY7G 1I5FA 2XTRA 2VRWB 3OVOA 1PA6A 3OIQA 1PXUA 1ICFB 1PTOC 3JAML 1U4RA 4A24A 3GTGB 2R93H 4DV0Q 1SROA 4WP4A 3SDJA 1Z6HA 2NUCA 2H5XA 3DHQA 2UXBQ 5LL6X 3TO9A 4A3DH 2O2LD 3HOUH 2PW5A 2CW0D 1XMQL 2RDGA 1GOZA 3RNUA 1YJWA 2OF1A 3SEKC 3GOXA 1HNZQ 4BY1B 2K01A 3G6JB 2K52A 4OL7A 4X65L 5KEEA 3J7AV 1B3QA 3H6MA 4BXXH 2PO4A 1J6QA 4K8JA 1PLFA 1FY7A 1AZQA 5KYIA 4GOPA 3PO3B 3J7YW 1PRTB 1G6ZA 2OT2A 2JA6B 1PDQA 4Y7NH 1ZEQX 1NMGA 1HR0W 2JXDA 1TWHB 4PNYA 5JJZA 2OEOA 1YVCA 2B29A 3GTPB 1VQIA 3KF8A 1H9KA 3S9WA 1CSOI 1XMOL 1S5BD 1TWGB 5J1ZA 3W5OA 4PZ8A 1UVGA 1DJRD 2PMZB 1UWVA 4XQQA 1WTXA 1ZXTA 1X3PA 5CCMA 1YITA 2HD3A 5BN4A 1A62A 4AMLA 1SE3A 4AYBE 5KNCA 2BL8A 4JV5L 1CKOA 2F3CI 1BNZA 2AUKA 4OHJA 1Q12A 1TURA 2ZM6Q 3D4WA 3CW2C 4IPDA 2Q8RE 1IHZA 1XMQQ 3I72A 3HOXB 4P71A 1A8VA 3URYA 4Q9VA 2HGKA 3BYYB 2YU9B 1MHWC 1QZGA 4OVOA 4R4TA 1F77A 3K5OA 2L5TA 2MJ8A 4BWGB 4A3BG 4BA2I 1E7ZA 3FP9A 2F4IA 2Q2IA 4DR7Q 1SYGA 3IFDA 1JB7A 4KKTA 4DNTB 1TWHH 3G48A 3VYSA 2O4XA 2XGTA 2KEEA 4G76A 3NQTA 2QKIC 1EEFD 4Q5VA 2MNAA 2GKVA 4A3DG 1H95A 3VA5A 1PCEA 2ICIA 2V53A 3KLSX 1KDBA 1XMOQ 3I4NG 4ZKCB 2BL7A 2OU2A 4PMWA 1UEAB 4M1UB 1ASYA 2A68C 1V1PA 1H9SB 2SNMA 3NWTA 2VW9A 4HJ5A 3OXLA 4FO2A 3VR5A 2DNCA 2B3GA 1HNWL 1YNJC 1PH7A 4BBRH 3HKZG 3S24A 1JE4A 2QEJC 1ESRA 2OCEA 3RN2A 1HZ9A 4IN3A 4K2KA 4RAUC 1ENCA 2UUAL 4IFDH 3I3CA 5FO9B 4KD3A 5C4ZA 3JAMi 1HFNA 5EPJA 1JOKA 2XN9C 4RKLA 2F0PA 2I0QA 3QWNA 3OXFA 2YTXA 2Z1CA 1RDPD 2DKVA 1JE5A 3EROA 1HR0L 1VMPA 2EDGA 4QL5A 4ILWA 1SGDI 2JA8G 4JOIA 1CI3M 2R7ZB 3CD6A 1B3AA 4FF4A 2KEDA 5ELDA 2XIWA 4ID6A 1T5XD 1TR5A 5GADC 5LMUQ 1PMRA 4AH6A 4UP8A 1DONA 2N3SA 3CCEA 5LMNL 4KHPQ 5J22A 4ZK9B 1IBMQ 4L6TB 1PFSA 4AIMA 1DS2I 3A5ZB 4PZ7A 1JR0D 1PTQA 1JWMD 1ULMA 3I4NB 2L15A 1HPTA 1KNAA 2K7VA 3C3LA 2EXDA 2ZTCA 4KMUC 4JBWA 2ZJQA 2GVAA 4GS3A 4FYDA 2VQEQ 5FJ8H 2EYJA 2MFIA 5ELEA 3NTHA 4ZUIA 1TY2A 4B08A 3HKZE 1HTPA 2F0SA 1SNOA 1Z2IA 4RG1A 3X3MA 2NVQB 3VR6A 4QF4A 5CYUA 2EQSA 2K19A 4JI8L 3RLOA 4O2DA 5C4XB 3R2IA 3OMGA 1MSHA 2PZUA 1JJGA 3M4YA 1WTOA 1EUJA 1SN8A 1UE7A 4DK3C 2A6HD 1KC8C 5BN5A 2IJ0A 3HP3A 3HOXG 3H3VC 1I4XA 4YY3Q 1ET9A 3JC66 5JOBA 4DR1Q 2YUUA 5LMNQ 4KHPL 2F1MA 4C3JH 1BCPC 4IFDJ 1SDFA 1WCMH 1PH9A 3X3NA 2JQOA 1CT0I 1Q46A 4JI4L 5BR8L 2N8NA 5IT9E 5AJ3L 3HOUB 2JA8B 2J7ZA 3KFUA 2K50A 4GN3B 3R5CA 2ZW3A 2IWHA 3KBGA 3S2HH 3IAS1 4DXFA 5KYLA 4YWLA 5FK9C 3HOUG 2YTVA 4AYBG 4A3DB 1M4VA 1SYCA 1KDCA 2CJSC 4HFVA 2WB1G 3J80c 4YZ9A 1VQPA 1SAPA 4K6DA 5D3IB 3DWPA 5CORA 1IY6A 5IP9H 2O5JC 4RCOA 4DAPA 4UXIA 2L9HA 4B6DA 1VS0A 3E9IA 1PYSB 3S14H 1TBOA 1G6PA 1AEXA 3MAQA 2EYFA 4IUTA 3KYHC 4HR7B 4J8QA 2CKZB 1QOHA 4DR2Q 2EJMA 4L63B 2ENZA 1HZCA 3TREA 3VDPA 1PTOH 2B2YC 5JAVA 5M5WH 2EY1A 1LR8A 1RTOA 1PH6A 1STNA 1TS3A 1TWFH 3KF6A 1N36L 3VYTA 2PYKA 2I07B 3AQQA 1XX8A 2ZJRA 4A3EB 3DEPA 1IL8A 1WCMB 1TQOA 2L1BA 4RA8A 1PH5A 1KQSA 2LS01 4DFAA 3GTOB 5FLXc 4K5VA 4A3EG 3BZDB 3CCSA 1HEVA 4OO1G 3UEJA 1YHAA 2F0DA 3KDFB 1VQJA 1AFPA 2Y0SG 4LJZC 2SGEI 1MIUA 2I5LX 3CKIB 4IJLA 2VY3A 3L3OC 1DOMA 4EGVA 2A2DA 3A54A 1ENAA 2ZXPA 2WINB 1I94Q 1ILPA 2M00A 1N33L 1TWFB 2GKTI 1WTHA 5BN3A 3EA6A 3VDUA 3OL0A 2B2TA 1P9GA 2NVQH 3R5BA 3TP7A 3T16A 5M3MH 4JI0Q 5ELNA 2ODDA 1Y8FA 4BBSH 2SOBA 2E5LQ 1X3EA 4L5TA 3HOZG 4KK7A 3E9HA 2MP1A 2D62A 2EY5A 1SMYD 1X3GA 1B9NA 1SMXA 4OWWB 1LTTD 5IODA 4LF4Q 4A3JH 1FNVA 2DJFC 2J87A 2NWGA 3RZOH 4K2LA 3F2DA 4GKJQ 2HHHL 1LT6D 2VB3X 2L4NA 1RFHA 5DLQE 2F0WA 4DV3L 1KTKA 4DR4L 3M3YH 2CAZB 3OTOQ 1P9ZA 2NZHA 2WV6D 1J9OA 5C5LA 4L8JA 1BCPB 2N17A 4K0KL 3PO2G 4MPIA 1QB5D 4ALPA 1I94L 2KCXA 4C3JG 3HOZH 1KLGD 1B4OA 1M8CA 3DWAA 1N13A 4JI2Q 5M3FH 1HHVA 3FNBA 1LLRD 2GVIA 2B63G 3GTKB 3J81L 4C3JB 4GI3C 4LFBL 3CCVA 3F8TA 3TP6A 2YQPA 1X6OA 4FXKC 1EOVA 5C6AA 1HUNA 1S5ED 2K5NA 4X66Q 4PG3A 1R0RI 3OMCA 4OELB 4K6LA 1N32L 1EYAA 5M3MB 1JORA 2IHEA 3KK7A 1SE8A 2HIXA 3UE1A 1BCPD 3DUZA 2BE5D 1SSOA 4U6RA 1C48A 4U68A 1TU2B 1SXTA 3J80i 4K5WA 4A75A 2JA9A 4DR2L 3FVQA 1MSGA 2A6HC 4KN7C 2M9VA 2SNSA 3BDOA 5E1FA 3EN2A 4DUZQ 1L0YB 4C3HH 5IYCG 1M1KC 1C8CA 1LR7A 1SEBD 2YTYA 3MEHA 3D0FA 1YBYA 3KF8B 5C4XH 4JI4Q 3OW2A 5HGIA 1D5XC 4JI2L 2HDLA 1QVFA 5HQ8A 2HQLA 2KOLA 2N78A 2UUBQ 2R7ZG 2FUG1 5EBCA 4A3IH 1CSPA 2CQOA 3I56A 4OX9Q 5JVH3 2PNRC 3P1HA 1TT2A 3F4MA 1BKBA 1BBUA 2QDBA 4LF7Q 2FINB 3PDNA 3PO2B 2KJXA 1KL9A 4A3FH 3CQZH 3GTKH 4A3EH 4DAYA 5JJIA 1VQHA 2B2WA 3TQYA 1I6HH 4HMIA 2JE6I 5CGKA 5JEAJ 3MVVA 4R8NA 1K83B 2E75C 3MXPA 1PH2A 1TBRR 2SEBD 2F0TA 2NN6I 4R4IA 3SXHA 3RZDB 3MXUA 4JW0A 3OXGA 2F0VA 2SDFA 2DJGC 3IFTA 3K80C 4FP5D 1KAAA 3QJYA 4NB3A 3TSSA 3SEBA 1HR0Q 2JA5B 1XXGA 4C3IB 1SGEI 1PZJD 4V190 3C1EA 4JI6Q 4OXPA 2NN6G 2Q2UA 2LKVA 5C44H 1LTBD 4WJ3M 1PTRA 4DR3Q 4B3SQ 3SK6A 1B53A 1D2BA 4L5QA 1WTWA 2Y0MA 1VF7A 1V1PB 1ZYRC 1LABA 5C3WA 3CC7A 4LFAQ 1HZAA 4JCVE 1Q9BA 1CFMA 1DYQA 3TO6A 3LNNA 4LFCL 1NMFA 1FYBA 2GKRI 2AQ2B 5JPMC 4I1TA 4JPBW 1I4GA 3J81i 1GUGA 3S1RB 4IOCA 1YHBA 1MJ9A 2E2HB 1G8ZD 1R9TH 1CE3A 2N88A 4QCLA 1YZ6A 2NBFA 4X3KA 4X65Q 5HI7A 4HIOA 5IYDG 3I8ZA 4JC0A 4XT3B 2KKMA 1UUCA 3VDYA 2XTIA 2Z6KC 1UVFA 1CK1A 1XYIA 2UUCQ 1GUTA 1K73C 4RGTA 4JBMA 4V0BA 5IIFA 1MBYA 3QR8A 2IW3A 4DV6Q 1J5EL 5EKLA 1STGA 2KQ3A 5IT9c 5C0XI 2I5HA 3W2DA 3A7AB 2XNAC 4OAUC 2B8FA 4YZCA 3HZXA 3UDXA 2J4XA 5A35A 3HS0C 3PUZA 4L5SA 1I4RA 1K8OA 4DK1A 1L1OB 1PHJA 4JV5Q 1E2VA 1I3QH 2JEBI 3BU2A 1CHQD 2PQ8A 5D3DA 5FJ8G 1U4LA 4DUZL 3I4MG 1OO9B 2QGQA 1XX6A 4F87A 1SGQI 1VCIA 4LMQD 4X3TA 1GUSA 4GKKL 1B8AA 4PMCA 1AN8A 1PTOB 1BCPF 1G291 3OW7A 2OQKA 2PI2E 3HOVB 3NE5B 1BUSA 4IUQA 4C3HB 1WYDA 4MNOA 5HY6A 4RGOS 2JYYA 2JAEA 4ZQ3A 2WKCA 1XJVA 3UGIA 2K05A 2D0OA 2VB2X 4X62Q 4J1MA 5JPNC 2F0GA 1S5CD 2JN4A 4HCEA 3MA2B 5C4JH 3QWPA 4KY6A 3GTGH 4DV1L 1DD2A 2HIVA 2X69A 2UXDQ 1L1OA 3SVMA 1AW7A 1K3BC 3CU7A 5FLXE 5IE8A 1Q7YC 2MJFB 2RADA 3NP8A 3SHLA 2JA5G 2GA4B 1O7IA 4G57A 1PTOD 1AE2A 1E22A 3C2PA 1TBNA 3H3VI 4XT1B 3SDZA 1X54A 3S15H 2DGYA 5NUCA 1KRSA 1R4PB 2JW6A 4JI0L 3H0GG 3BZCA 4HSVA 1Y1CA 4H02A 4X66L 3D8GA 2CHBD 3BDLA 3GO5A 3GTQB 2CCZA 3HOVH 1IBKL 4JOIC 3S1MB 3NHHA 2GN5A 4JYAQ 4OO1H 2NU3I 1IY5A 1GHJA 1K9MC 3K0XA 4QGUA 1IBML 4B9WA 4DXGA 1EWHA 3HOYG 4JI1L 4PQXA 1OXTA 4RWSC 1QZHA 1Y8NB 4OX9L 3FHWA 3FBVA 1EY7A 4FNFA 1VQ9A 3F1ZA 2PQAA 1K8GA 5DNFA 2ZM6L 1S5FD 3EQLC 4Z7GA 2LMCB 3P23A 1E1TA 4XTCS 2SGPI 2F0LA 4GN5A 1IYVA 1B1ZA 3PV0A 2RHSB 3ERQA 2V1CC 1I4QA 3DM1A 2UUBL 1MT1A 2VQFL 4G7HC 2CWPA 1Y1WB 4RGNA 5AFWA 1MJAA 2KMRA 2B2UA 1DCZA 3R5DA 1IBLQ 3KBXA 2WAQE 1CKMA 3GTLB 1QCBD 2N55A 1CGII 3N52A 4JI5Q 5J39A 4GLXA 2CWHA 4K5XA 4M8AA 4EQ5A 3KOJA 2JSOA 1ZYRD 2RDFA 3ONAB 3BS1A 3HG9A 5IGCA 1TIHA 1GUNA 4BS9A 4FF2A 3PO3H 1JMCA 1BVSA 2YYZA 4IOAA 4QY7A 5M3FG 1EY5A 1NY4A 2EE1A 3TN2A 3G7LA 5IYBH 2K32A 2R93B 3PIPA 3D4DA 2KENA 4UDUC 5KNBA 4L5RC 4YCWA 5FUWA 2QW7A 5M3FB 3MXGA 4ZRZA 5M5YB 1CT4I 3PO3G 3SR1A 4HJAA 3TRZA 3L2PA 2MPMA 2K5VA 4GZYC 2RKSA 1EY6A 5ISRA 4NV2A 4LF4L 3T51B 2N71A 3K59A 4PV1C 1AZPA 3EJIA 2GVBA 5E7NA 3PF4A 4NKLA 4HIMA 1VQ6A 1IKMA 2OD1A 4DU9A 4DV0L 1VQ7A 1QE6A 1A6XA 2G9DA 5EPKA 1HFGA 4B3ML 3H0GH 2FFKB 4XQNA 1STBA 1TBQR 1OXVA 1WGCA 1HDLA 3CQZB 3R2TA 1C4QA 1W6JA 1BUVT 1XWEA 4HTHA 1D8LA 2EJGC 4DR7L 1K8AC 2C9OA 1SBBB 4KKUA 1SMYC 5C3EB 4RHRA 2A69C 3MWYW 1ONLA 3HOYH 1LT3D 1I4PA 4CDFC 3DWQA 3NBHB 4DV5L 3TZUA 1PH1A 5KNDA 1KBEA 3VR4A 1FD7D 1F9SA 2FEFA 2VS1A 3QB3A 1VQ5A 4UXHA
chains in the Genus database with same CATH topology
4P73A 1OMUA 3D31A 4APVA 1Q81C 3HOVG 2YFAA 4C2MH 5FLXc 1Z7KB 4IPGA 4YHHQ 2QQEA 2A2CA 4HIKA 3NEMA 4A3EG 1HNXL 3G4SA 3CCSA 1K0RA 4OO1G 4A3FG 4EX5A 3UEJA 3M4PA 1YHAA 3KDFB 5M5XH 4E1RA 1VQJA 1FGUA 2KBNA 4O1OA 3CPWA 4IJHA 4JI7Q 3GTOH 1WI5A 1CT2I 2L8EA 3K81C 2Y0SG 2ROWA 2SGEI 2XRCA 1N8RC 1MIUA 2R92G 2I5LX 4IJLA 4AQYL 2VY3A 3PUXA 1QVGA 4DKAC 1CHOI 2A2DA 1YIJA 4J15A 4HEA1 1W2BA 1SGRI 1CUKA 1I94Q 4XIGS 3DO9A 3CC2A 1N33L 4P74A 2AMCB 2I5MX 2GKTI 3GTPH 5C0XG 3CXLA 1QVCA 1PPFI 1IW4A 3DA4A 3STBC 2R93G 3VDUA 1Z47A 3CAMA 2KHIA 4BY1H 1Q8KA 3M7NA 3OL0A 1XBTA 1Y1WG 2JA6H 2NVQH 3E59A 4KI0A 2FXQA 2P22B 2N52A 3UFFA 4DK6C 1FL0A 5M3MH 5ELNA 4JI0Q 5C3EH 3J7A5 3S2DH 2ODDA 1M90C 1Y8FA 1BMOA 2PNHA 4BBSH 1MKHA 3CPFA 4R4OA 2VUMG 4TVAB 2E5LQ 2NU2I 3LJ2A 1TUSA 1X3EA 4L5TA 3HOZG 1PTRA 1K3RA 1TXYA 2D62A 3E9HA 1IBLL 2PQAB 1YTPA 1KBFA 5EAYA 2BA1A 1X3GA 3CCLA 1TOTA 4YWMA 3JSBA 1SMXA 1VQ8A 4OWWB 1X55A 3VA9A 3T1YQ 4LF4Q 2C35B 1VQ6A 3HFZB 3GTQH 1TWGH 2UXCL 2R7DA 3I4NH 4A3JH 4SGBI 2Q2HA 5IYBG 2J87A 4PL5A 4LF9L 3RZOH 4A3LH 3DM3A 2A1AA 4A93H 1HJAI 3U50C 3F2DA 1QUQB 5IP7H 1VQLA 3CCJA 2PMZE 4JI3Q 4GKJQ 3QTLD 2HHHL 5GAGC 4LFCQ 4LF5L 1RFHA 3CCRA 3B4VC 5DLQE 1HNWQ 3RU0A 1I50H 4DV3L 4GOPB 1XPUA 4BA1I 2CAZB 3HKSA 3M3YH 4BBRG 2WB1E 3OTOQ 1P16A 2NZHA 3F2BA 4DR5Q 1X65A 4A3MG 3K8AA 1M8BA 1SR3A 2BA0A 4LF5Q 2YFBA 1GKHA 3CC4A 2NU0I 2ORVA 3T1HQ 3JAMc 5HQ8A 2OVOA 2N17A 4K0KL 3PO2G 3A74A 2E8GA 3ZJYC 4DR5L 1I94L 4ALPA 3TS2A 2KCXA 1EQRA 3PO2H 2QQCA 2OTLA 5JJKA 1GD7A 1X74A 4DR1L 3HOZH 2IY5B 1M8CA 1N13A 1EWIA 4JI2Q 5M3FH 1Y1BA 5IP9G 2VQEL 2QA4A 2B63G 2GVIA 2ARPF 3GTJH 4FDBA 3AEVA 1XPOA 3OYYA 1V1HA 2WVJA 1NUBA 4LF8L 4GI3C 4LFBL 3CCVA 1SFOH 5BR8Q 1WJJA 2UZ3A 1VQMA 3F8TA 3BJIA 3F2CA 2YQPA 1B7YB 1X6OA 2SGQI 4YWKA 1EOVA 5FUVA 2A19A 4GLVB 1OXUA 4DV2Q 2KCTA 2K5NA 2CWAA 4X66Q 4PG3A 5M5YH 2MO0A 2QQ0A 1R79A 4LF6L 1R0RI 4HJ9A 3BJUA 4JBJA 1B70B 3J7ZC 1U0LA 2ELIA 3L0OA 1N32L 1HNXQ 1UE5A 2ZTDA 3DA3A 2IHEA 1SE8A 2HIXA 3AFPA 5EX3A 4LF6Q 4NXNQ 3UE1A 3KJOA 1VQAA 2AWOA 4A3JG 4JG2A 1L0WA 3MEFA 5FLMG 4U6RA 3A5UA 4JI7L 2SGFI 2RHQB 2ENNA 2QPOA 2E5RA 3J80i 1DS3I 1NE3A 1PH3A 4A75A 2ATWA 2V1CA 2JA9A 4DR2L 3LGJA 1PVOA 3ULLA 3I55A 2XTQA 3PF5A 4LUZA 1N34Q 2VNUD 3KJPA 2AKWB 3NENA 1SGYI 3EN2A 4DUZQ 2K9HA 2AHOB 4C3HH 5IYCG 1M1KC 1LR7A 1NTGA 1VQGA 2JJQA 5IY0A 1WOCA 2YTYA 2VQFQ 3D0FA 1XPRA 1N34L 2QQDA 1V9PA 1YBYA 4B3RQ 4JI6L 3L7ZC 4HGUA 1VQFA 4BY1G 2E2IH 1LM0A 3KF8B 1YJNA 4RMFA 5C4XH 1UE1A 3CXCA 3OW2A 1IBKQ 4JI4Q 3MEKA 4X64Q 5HGIA 4JI2L 1QVFA 4PZ6A 4A3KH 3CMAA 1IXRA 4DR6L 5C4XG 2HQLA 4DR3L 2K5HA 4A3GG 1PH8A 2N78A 2UUBQ 3S1NH 1VQEA 5LMNW 3S17H 1VDDA 1ASZA 2L7XA 5HGQA 1VQ4A 2R7ZG 2FUG1 2HT1A 2F4VL 4KHZA 1OTCA 4LF7L 4B3TL 3BZKA 3K7UC 1CSPA 5J3BA 4A3IH 2CQOA 3I56A 2NVTH 4OX9Q 1XNRL 4DWLA 1OMTA 2LXJA 5C44G 5JJLA 2VUMH 3F4MA 1BKBA 4A4IA 3G6EA 1BBUA 3FKIG 2KCMA 4LF7Q 4L9MA 1Z9FA 3PDNA 2WP8J 1KL9A 1YEZA 3CQZH 4A3FH 3GTKH 1NJIC 2UU9L 4LNQA 2LXKA 3M9BA 4A3EH 4JI1Q 4P75A 2JB3A 3W1BA 2HHHQ 1YU6C 3E0EA 1EFWA 5GAEC 5JJIA 1RL2A 4OAVB 1VQHA 3AFQA 4HJ8A 2BUSA 3TQYA 5FUXA 1I6HH 4PL3A 2JE6I 2OWOA 5JEAJ 1DGSA 4GNXB 1TBRR 2KMQA 1PH2A 1T9HA 1E24A 1GO3E 2NN6I 3PUYA 1JJCB 4R4IA 4DV7L 2R7ZH 2WCYA 4UP7A 1G51A 4AQYQ 5FUYA 3M85A 1Y1VH 3OXGA 2KMOA 1KXLA 2SGDI 2UUAQ 2E2JH 3E2IA 3K80C 3RLFA 4JBKA 4NB3A 5H1SE 1HR0Q 2IHFA 1Q1BA 1X56A 1SGEI 3EIVA 3J81c 1SLJA 1KAWA 2UUCL 3UGLA 4NXMQ 2IX0A 5IYCH 1OVOA 2IT1A 4YCVA 4JI6Q 4OXPA 2NN6G 3PCOB 2B0UC 1TWCH 2ES2A 2Q2UA 5C44H 4QQBX 3AJFA 4DR6Q 4AS2A 2Y0SE 2XTRA 1I5FA 3ULJA 2Q2TA 4AS3A 1FVIA 4DR3Q 4A3IG 4BY7G 2ASBA 2AWNA 1PA6A 4B3SQ 4MZ9A 2UXBL 2N1AB 3OVOA 4UXJA 4OWXB 2VZAA 4L5QA 4GOPC 3RLNA 2LUYA 4A24A 1X9NA 4DV0Q 1SROA 3CC7A 3LJ1A 3SDJA 3PUVA 3B6YA 4LFAQ 4JCVE 1HZAA 1EYGA 2ZRRA 2NVXH 2H5XA 4DNIA 3Q8DA 1CKNB 1E1OA 4B3SL 4IFDG 2UXBQ 1W4RA 4A3DH 4LFCL 4A3MH 4YZDA 3HOUH 2JA5H 1XMQL 2Z0SA 4DV3Q 3RNUA 1YJWA 1E3PA 5EX0A 3OTOL 3SEKC 2IP6A 1NMFA 2ID0A 1HNZQ 2JEAI 2GKRI 3GOXA 1FYBA 2UXDL 5K36G 4I1TA 2K52A 4JI3L 3J81i 5IWAQ 4X65L 2JZMA 4BXXH 1JT8A 2K75A 4IOCA 3SGBI 1J6QA 4O1PA 1EIFA 1YHBA 1S3OA 3CCQA 3U58A 2ZJPA 1R9TH 1CE3A 4QJFA 1YZ6A 3TEHB 2W0TA 4IPHA 5IWAL 4X65Q 1YNXA 4HIOA 4LWCA 5HI7A 5IYDG 4JC0A 4GOPA 2ZTEA 5FLMH 3I4MH 4GKKQ 2KKMA 1YJ9A 2WFWA 1C9OA 3VDYA 1UUCA 4UP9A 4LUVA 2XTIA 4Y7NH 2Z6KC 2JXDA 1SJ8A 1NMGA 1HR0W 1UVFA 2OD1A 5JHWC 1FAQA 4NPSA 4GLAC 2FNFX 2CFMA 4X64L 1YVCA 2B29A 2UUCQ 3GTLH 1K73C 1VQIA 4JBMA 2IX1A 4E1PA 4DV4Q 4A3KG 1Y1WH 2JA6G 1SGNI 1CSOI 4DV6Q 1J5EL 1XMOL 2F4VQ 4GNXC 3W5OA 4PZ8A 4JI5L 4GNXA 1UVGA 3HH2C 4DR4L 1UWVA 5IT9c 5C0XI 5CCMA 2RIOA 2I5HA 1NBWA 1YITA 5LNK1 1A62A 2DUDA 4R4QA 4YHHL 4OAUC 1HZBA 4AYBE 4A3BH 4JV5L 4YZCA 1CKOA 3M4OH 2F3CI 3UDXA 1Q82C 2NU1I 4A93G 2A20A 4G75A 1X4SA 1PV4A 2F6MB 2DIPA 1Q12A 3PUZA 2ZM6Q 1TURA 4L5SA 2R7FA 3CW2C 4IPDA 1FARA 1MJCA 4B3MQ 1L1OB 1IZ6A 2NZOA 3U4VA 1XMQQ 1PHJA 4JV5Q 1I3QH 4PL4A 2JEBI 3KDFA 3BU2A 4P71A 4POGA 1A8VA 4Q9VA 4DR4Q 4OVOA 1QZGA 3FKIH 5FJ8G 4R4TA 3STBD 4DUZL 4HJ7A 3IRBA 3G71A 2JA7H 3I4MG 2QGQA 3PGZA 4A3BG 1XX6A 5AJ3Q 1SGQI 1U5KA 1VCIA 1JJ2A 4BA2I 1E7ZA 3FP9A 2E5LL 2Q2IA 4DR7Q 2ERWA 1LTLA 1JB7A 4WJ3M 1BBWA 4GKKL 3CF5A 1TWHH 1B8AA 3G48A 3UDGA 1D7QA 2E73A 3W1GA 4DAMA 1V1QA 2XGTA 1KMAA 4DV2L 4G76A 1G291 3CCUA 4JYAL 2OQKA 2PI2E 2V6EA 4B3RL 1BUSA 1WYDA 4MNOA 5HY6A 2MNAA 2GKVA 4A3DG 1H95A 1N32Q 2JYYA 2JAEA 4BY7H 1PCEA 2V53A 1XJVA 1EQQA 3UGIA 3DLLA 1VQDA 2JA8H 1XMOQ 1KHIA 4OWTB 3J81j 3I4NG 2D0OA 5GROA 4X62Q 1CKNA 1IYJB 4BBSG 4PMWA 2MO1A 2D0PA 3VE5A 5GQOA 5M3MG 1ASYA 3HOWG 4R1JA 1FJGQ 5C4JH 2VW9A 4HJ5A 3OXLA 2OTJA 3QWPA 2VL6A 1IL2A 4X62L 3TS0A 3GD7A 4MTNA 1TWAH 4DV1L 3GTGH 2B3GA 4K0KQ 2HIVA 1HNWL 2ALYB 1PH7A 4BBRH 3HKZG 1TGSI 3S24A 2P6AC 5C3EG 1FJGL 4A3CG 2UXDQ 2M5XA 1L1OA 2UU9Q 2J9RA 1A63A 5IE8A 1Q7YC 2OCEA 2MJFB 3RN2A 2JA5G 4DV5Q 1HJPA 1N33Q 1HZ9A 4O0AA 5IP7G 4DUYQ 1O7IA 2UUAL 4Y52H 1AE2A 1E22A 4GN4B 3UE0A 4A3LG 1TBNA 3WWVA 3RN5A 3H3VI 1GVPA 4IO9A 1C7YA 3JAMi 1X54A 3S15H 2DGYA 1KRSA 4UY8C 3A0JA 4DUYL 3H0GG 4JI0L 3BZCA 1N9WA 3S1QH 1OYVI 1Y1CA 3U4ZA 1RIPA 2I0QA 4YCUA 4H02A 1LYLA 1Q1EA 2PI2A 2YTXA 2MQHA 3SGIA 4X66L 4A3CH 3OXFA 4DPGA 4FKDA 1JE5A 4JI8Q 3GO5A 3PSIA 1HR0L 4QL5A 1IBKL 2CCZA 3I7FA 4JOIC 3HOVH 2JA8G 4JOIA 1SGDI 2GN5A 3CD6A 4JYAQ 1XNQQ 2NU3I 4POFA 1L2FA 4NXNL 5C0XJ 2F52A 1IY5A 5DAEA 1K9MC 5GADC 3K0XA 4ME3A 4QGUA 5LMUQ 5ELOA 4GXTA 1IBML 3HOYG 2N49A 4JI1L 4AH6A 1K83H 1OXTA 1OXSC 4UP8A 1QZHA 4OX9L 1XNRQ 2LEOA 3FHWA 3FBVA 1VQ9A 2N3SA 3TJQA 3CCEA 5LMNL 4KHPQ 3HOXH 1VQOA 3F1ZA 3RZDH 2F66B 4A76A 1IBMQ 2PQAA 1P8LA 1PFSA 1K8GA 2YU9H 4AIMA 2ZM6L 1DS2I 1H0ZA 3A5ZB 4IPCA 4Z7GA 4OONA 1MT1A 3P23A 1E1TA 4PZ7A 2BH8A 4XTCS 4DV1Q 1PTQA 2SGPI 4GN5A 1VQCA 2RCNA 2JW6A 4IFDI 2L15A 1HPTA 2R93H 3H3VH 2JK8A 2EXDA 1X3FA 3PV0A 2ZTCA 4DV7Q 4LFBQ 4KLKA 2BH2A 4JBWA 2RHSB 2ZJQA 2V1CC 2GVAA 4GS3A 3K7AH 2UUBL 2VQFL 3ER0A 2CWPA 2R6GA 2VQEQ 2LSSA 2KHJA 3I9V1 2MFIA 3ERSX 5FJ8H 3FC3A 1S72A 3HKZE 5IYDH 2NVYH 2KMRA 3GDEA 3PUWA 2JB2A 2YV5A 3MXNB 4RG1A 3UGDA 3LJ0A 4GKJL 1IBLQ 2WAQE 1CKMA 3GTMH 4DV6L 1J5EQ 2VRWB 2EQSA 2K19A 4OO1I 4DAYB 3T1YL 3RR5A 3S1RH 3KLWA 3M4QA 1CGII 2UXCQ 4JI8L 3RLOA 3PIOA 4GLXA 4JI5Q 4O2DA 1C0AA 4EQ5A 3D00A 3KOJA 3CMEA 1JJGA 1CSQA 1EUJA 1XNQL 4DV4L 1TIHA 1SN8A 1UE7A 4DK3C 3PO3H 2B8TA 1JMCA 1BVSA 4LW1A 1KC8C 2YYZA 5JEAG 3HOXG 4IOAA 4YY3Q 2JA7G 4QY7A 3IAM1 1NY4A 3JC66 5M3FG 4Z7HA 3AYHB 5IYBH 4DR1Q 2E2HH 4LFAL 1SGPI 2NU4I 2YUUA 3PIPA 5LMNQ 2KENA 4C3JH 4KHPL 4IFDJ 4L5RC 1WCMH 1PH9A 2A8VA 1VQNA 4YCWA 4X6AH 5FUWA 2Z6KA 2QEXA 4YY3L 1WCMG 4QIWE 4LF9Q 2B63H 1XTDA 2JQOA 1CT0I 1Q46A 4JI4L 5BR8L 2N8NA 4BXXG 2ORWA 5AJ3L 3UDFA 1AH9A 4NV5A 1YHQA 3KFUA 5CCLA 2K50A 3KF6B 1LR9A 1Y14B 4GN3B 1OXXK 1CT4I 1V1IA 3PO3G 1YO7A 4C3IH 4B3TQ 3S2HH 2WAQG 3KY9A 1LUZA 4HJAA 1MJEA 3IAS1 4LF8Q 3TRZA 4YWLA 3HOUG 3ICEA 3L2PA 2YTVA 4WJ4A 4AYBG 2K5VA 1CGJI 4NV2A 4LF4L 3KP9A 2JB1A 4HFVA 2WB1G 1SRUA 2CJSC 3J80c 2N71A 4P72A 4YZ9A 4LUOA 1VQPA 3UDIA 1PYBA 1IY6A 1S40A 2K4KA 5IP9H 3S1MH 4UXIA 2GVBA 1HH2P 3I2ZA 5E7NA 4B6DA 3PF4A 3S16H 1QUQA 1VS0A 3CP0A 4HIMA 5LMUL 1VQBA 4HIDA 1KD1C 3E9IA 1PYSB 2RF4A 4DV0L 1HNZL 1Q86C 1VQ7A 3S14H 1TBOA 1G6PA 3L0IA 4TQUS 1KRTA 2DB6A 3EBEA 4B3ML 1AE3A 3KYHC 1KIXA 1GM5A 3H0GH 1V43A 2CKZB 4R4CA 3T1HL 4DR2Q 1PH4A 1UE6A 2ENZA 1HZCA 1AN1I 1PJUA 3SGQI 3TREA 1TBQR 3VDPA 2L1LB 1OXVA 1HDLA 3I4OA 1YI2A 2EIFA 1EIYB 1VQKA 1XA6A 2JA1A 3CCMA 5GAHC 4NXML 2KMPA 1D8LA 5M5WH 1LR8A 1WFQA 2OQ0A 4DR7L 1K8AC 4A3GH 1PH6A 1UEBA 2R92H 3UITA 1TWFH 1Y1VG 4UPAA 3KF6A 1N36L 3HOYH 2K14A 3NBHB 4DV5L 1PH1A 3AQQA 1W3SA 3NELA 2ZJRA 1KBEA 1A0IA 3H15A 2F3IA 3ULPA 1PH5A 2XMXA 2VS1A 1KQSA 3HOWH 3UEYA 1N36Q 1L1OC 1VQ5A 4UXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P73 A;  3D31 A;  4APV A;  1Q81 C;  3HOV G;  4C2M H;  5FLX c;  4IPG A;  4YHH Q;  4HIK A;  4A3E G;  3NEM A;  1HNX L;  3G4S A;  3CCS A;  1K0R A;  4OO1 G;  4A3F G;  4EX5 A;  3M4P A;  1YHA A;  3KDF B;  5M5X H;  1VQJ A;  1FGU A;  2KBN A;  3CPW A;  4JI7 Q;  4IJH A;  3GTO H;  1WI5 A;  3K81 C;  2Y0S G;  1N8R C;  1MIU A;  2R92 G;  2I5L X;  4IJL A;  4AQY L;  2VY3 A;  3PUX A;  1QVG A;  4DKA C;  1YIJ A;  4J15 A;  1W2B A;  1CUK A;  1I94 Q;  4XIG S;  3CC2 A;  1N33 L;  4P74 A;  2AMC B;  2I5M X;  3GTP H;  5C0X G;  1QVC A;  3STB C;  2R93 G;  1Z47 A;  3CAM A;  2KHI A;  4BY1 H;  1Q8K A;  3M7N A;  1Y1W G;  2JA6 H;  2NVQ H;  4KI0 A;  2FXQ A;  4DK6 C;  1FL0 A;  5M3M H;  5ELN A;  4JI0 Q;  5C3E H;  3J7A 5;  3S2D H;  1M90 C;  2PNH A;  4BBS H;  1MKH A;  3CPF A;  4R4O A;  2VUM G;  4TVA B;  2E5L Q;  1X3E A;  4L5T A;  3HOZ G;  1K3R A;  1TXY A;  2D62 A;  3E9H A;  1IBL L;  2PQA B;  5EAY A;  2BA1 A;  1X3G A;  3CCL A;  4YWM A;  1SMX A;  4OWW B;  1VQ8 A;  1VQ6 A;  1X55 A;  3T1Y Q;  3GTQ H;  4LF4 Q;  2C35 B;  3HFZ B;  2UXC L;  1TWG H;  2R7D A;  3I4N H;  4A3J H;  2Q2H A;  5IYB G;  4LF9 L;  3RZO H;  4A3L H;  3DM3 A;  2A1A A;  4A93 H;  3U50 C;  3F2D A;  1QUQ B;  5IP7 H;  1VQL A;  3CCJ A;  2PMZ E;  4JI3 Q;  4GKJ Q;  2HHH L;  5GAG C;  4LFC Q;  4LF5 L;  3CCR A;  5DLQ E;  1HNW Q;  1I50 H;  4DV3 L;  4GOP B;  1XPU A;  4BA1 I;  3HKS A;  3M3Y H;  4DR4 L;  4BBR G;  2WB1 E;  3OTO Q;  1P16 A;  2NZH A;  3F2B A;  4DR5 Q;  1X65 A;  4A3M G;  3K8A A;  1SR3 A;  2BA0 A;  4LF5 Q;  1GKH A;  3CC4 A;  3T1H Q;  3JAM c;  4K0K L;  3PO2 G;  3A74 A;  2E8G A;  3ZJY C;  4DR5 L;  1I94 L;  4ALP A;  3TS2 A;  1EQR A;  3PO2 H;  2OTL A;  5JJK A;  1GD7 A;  4DR1 L;  3HOZ H;  2IY5 B;  1EWI A;  4JI2 Q;  5M3F H;  5IP9 G;  2VQE L;  2QA4 A;  2B63 G;  3GTJ H;  4FDB A;  3AEV A;  1XPO A;  3OYY A;  4LF8 L;  4LFB L;  3CCV A;  1SFO H;  5BR8 Q;  1WJJ A;  1VQM A;  3F8T A;  3F2C A;  1B7Y B;  1X6O A;  4YWK A;  1EOV A;  2A19 A;  4GLV B;  1OXU A;  4DV2 Q;  2KCT A;  2K5N A;  2CWA A;  4X66 Q;  4PG3 A;  5M5Y H;  2MO0 A;  4LF6 L;  4HJ9 A;  3BJU A;  4JBJ A;  1B70 B;  3J7Z C;  1U0L A;  3L0O A;  1N32 L;  1HNX Q;  1UE5 A;  2ZTD A;  2IHE A;  1SE8 A;  2HIX A;  3AFP A;  4LF6 Q;  4NXN Q;  3UE1 A;  3KJO A;  1VQA A;  2AWO A;  4A3J G;  4JG2 A;  1L0W A;  3MEF A;  5FLM G;  3A5U A;  4JI7 L;  2RHQ B;  3J80 i;  1NE3 A;  1PH3 A;  4A75 A;  2ATW A;  2JA9 A;  4DR2 L;  3LGJ A;  1PVO A;  3ULL A;  3I55 A;  3PF5 A;  4LUZ A;  1N34 Q;  2VNU D;  3KJP A;  2AKW B;  3NEN A;  3EN2 A;  4DUZ Q;  2AHO B;  4C3H H;  5IYC G;  1M1K C;  1NTG A;  1VQG A;  2JJQ A;  5IY0 A;  1WOC A;  2YTY A;  2VQF Q;  3D0F A;  1XPR A;  1N34 L;  1V9P A;  1YBY A;  4B3R Q;  4JI6 L;  3L7Z C;  1VQF A;  4BY1 G;  2E2I H;  1LM0 A;  3KF8 B;  1YJN A;  4RMF A;  5C4X H;  1UE1 A;  3CXC A;  3OW2 A;  1IBK Q;  4JI4 Q;  4X64 Q;  4JI2 L;  1QVF A;  4PZ6 A;  4A3K H;  3CMA A;  1IXR A;  4DR6 L;  5C4X G;  2HQL A;  4DR3 L;  2K5H A;  4A3G G;  1PH8 A;  2N78 A;  2UUB Q;  3S1N H;  1VQE A;  5LMN W;  3S17 H;  1ASZ A;  5HGQ A;  1VQ4 A;  2R7Z G;  2HT1 A;  2F4V L;  4KHZ A;  1OTC A;  4LF7 L;  4B3T L;  3BZK A;  3K7U C;  1CSP A;  5J3B A;  4A3I H;  2CQO A;  3I56 A;  2NVT H;  4OX9 Q;  1XNR L;  2LXJ A;  5C44 G;  5JJL A;  2VUM H;  1BKB A;  4A4I A;  3G6E A;  1BBU A;  3FKI G;  2KCM A;  4LF7 Q;  1Z9F A;  2WP8 J;  1KL9 A;  1YEZ A;  3CQZ H;  4A3F H;  3GTK H;  1NJI C;  2UU9 L;  4LNQ A;  2LXK A;  3M9B A;  4A3E H;  4JI1 Q;  4P75 A;  3W1B A;  2HHH Q;  3E0E A;  1EFW A;  5GAE C;  5JJI A;  1RL2 A;  1VQH A;  4HJ8 A;  3AFQ A;  3TQY A;  1I6H H;  2JE6 I;  2OWO A;  5JEA J;  1DGS A;  4GNX B;  1PH2 A;  1T9H A;  1E24 A;  1GO3 E;  2NN6 I;  3PUY A;  1JJC B;  4R4I A;  4DV7 L;  2R7Z H;  4UP7 A;  1G51 A;  4AQY Q;  3M85 A;  1Y1V H;  1KXL A;  2UUA Q;  2E2J H;  3K80 C;  3RLF A;  4JBK A;  4NB3 A;  5H1S E;  1HR0 Q;  2IHF A;  1Q1B A;  1X56 A;  3EIV A;  3J81 c;  1SLJ A;  1KAW A;  2UUC L;  4NXM Q;  2IX0 A;  5IYC H;  2IT1 A;  4YCV A;  4JI6 Q;  4OXP A;  2NN6 G;  3PCO B;  1TWC H;  2ES2 A;  2Q2U A;  5C44 H;  4QQB X;  4DR6 Q;  3ULJ A;  2Y0S E;  1I5F A;  4BY7 G;  4WJ3 M;  2Q2T A;  1FVI A;  4DR3 Q;  4A3I G;  2ASB A;  2AWN A;  1PA6 A;  4B3S Q;  4MZ9 A;  2UXB L;  4OWX B;  2VZA A;  4L5Q A;  4GOP C;  3RLN A;  1X9N A;  4DV0 Q;  1SRO A;  3CC7 A;  4LF9 Q;  3PUV A;  2R93 H;  3B6Y A;  4LFA Q;  4JCV E;  1HZA A;  1EYG A;  2NVX H;  4X6A H;  2H5X A;  4DNI A;  3Q8D A;  1CKN B;  1E1O A;  4B3S L;  4IFD G;  2UXB Q;  4A3D H;  4LFC L;  4A3M H;  3HOU H;  2JA5 H;  1XMQ L;  2Z0S A;  4DV3 Q;  3RNU A;  1YJW A;  1E3P A;  3OTO L;  1NMF A;  2JEA I;  2ID0 A;  1HNZ Q;  2UXD L;  5K36 G;  2K52 A;  4JI3 L;  3J81 i;  5IWA Q;  4X65 L;  4BXX H;  1JT8 A;  2K75 A;  4IOC A;  1J6Q A;  1EIF A;  1YHB A;  3CCQ A;  1S3O A;  3U58 A;  2ZJP A;  1R9T H;  4QJF A;  1YZ6 A;  3TEH B;  4IPH A;  5IWA L;  4X65 Q;  1YNX A;  4HIO A;  4LWC A;  5IYD G;  4JC0 A;  4GOP A;  2ZTE A;  5FLM H;  3I4M H;  4GKK Q;  1YJ9 A;  2WFW A;  1C9O A;  3VDY A;  4UP9 A;  4LUV A;  2XTI A;  4Y7N H;  2Z6K C;  1NMG A;  1HR0 W;  4NPS A;  4GLA C;  2CFM A;  4X64 L;  1YVC A;  2B29 A;  2UUC Q;  3GTL H;  1K73 C;  1VQI A;  4JBM A;  2IX1 A;  4DV4 Q;  4A3K G;  1Y1W H;  2JA6 G;  4DV6 Q;  1J5E L;  1XMO L;  2F4V Q;  4GNX C;  3W5O A;  4PZ8 A;  4JI5 L;  4GNX A;  1UWV A;  5IT9 c;  5C0X I;  2I5H A;  1NBW A;  1YIT A;  1A62 A;  2DUD A;  4R4Q A;  4YHH L;  1HZB A;  4AYB E;  4A3B H;  4JV5 L;  1CKO A;  3M4O H;  3UDX A;  1Q82 C;  4A93 G;  1PV4 A;  1Q12 A;  3PUZ A;  2ZM6 Q;  4L5S A;  2R7F A;  3CW2 C;  4IPD A;  1MJC A;  4B3M Q;  1L1O B;  1IZ6 A;  2NZO A;  3U4V A;  1XMQ Q;  1PHJ A;  4JV5 Q;  1I3Q H;  2JEB I;  3KDF A;  3BU2 A;  4P71 A;  4POG A;  1A8V A;  4DR4 Q;  1QZG A;  3FKI H;  5FJ8 G;  4R4T A;  3STB D;  4DUZ L;  4HJ7 A;  3IRB A;  3G71 A;  2JA7 H;  3I4M G;  2QGQ A;  3PGZ A;  4A3B G;  5AJ3 Q;  1U5K A;  1VCI A;  1JJ2 A;  4BA2 I;  1E7Z A;  3FP9 A;  2E5L L;  2Q2I A;  4DR7 Q;  1LTL A;  1JB7 A;  1BBW A;  4GKK L;  3CF5 A;  1TWH H;  1B8A A;  3G48 A;  3UDG A;  1D7Q A;  3W1G A;  4DAM A;  1V1Q A;  2XGT A;  4DV2 L;  1G29 1;  4JYA L;  3CCU A;  2OQK A;  2PI2 E;  4B3R L;  1WYD A;  4MNO A;  5HY6 A;  2MNA A;  4A3D G;  1H95 A;  1N32 Q;  4BY7 H;  1XJV A;  1EQQ A;  3DLL A;  1VQD A;  2JA8 H;  1XMO Q;  1KHI A;  4OWT B;  3J81 j;  3I4N G;  2D0O A;  5GRO A;  4X62 Q;  1CKN A;  1IYJ B;  4BBS G;  4PMW A;  2MO1 A;  2D0P A;  5GQO A;  5M3M G;  1ASY A;  3HOW G;  4R1J A;  1FJG Q;  5C4J H;  2VW9 A;  4HJ5 A;  2OTJ A;  2VL6 A;  1IL2 A;  4X62 L;  3TS0 A;  3GD7 A;  4MTN A;  1TWA H;  4DV1 L;  3GTG H;  2B3G A;  4K0K Q;  2HIV A;  1HNW L;  2ALY B;  1PH7 A;  4BBR H;  3HKZ G;  3S24 A;  5C3E G;  1FJG L;  4A3C G;  2UXD Q;  1L1O A;  2UU9 Q;  1A63 A;  5IE8 A;  1Q7Y C;  2OCE A;  3RN2 A;  2JA5 G;  1N33 Q;  4DV5 Q;  1HJP A;  1HZ9 A;  4O0A A;  5IP7 G;  4DUY Q;  1O7I A;  2UUA L;  4Y52 H;  1AE2 A;  1E22 A;  4GN4 B;  3UE0 A;  4A3L G;  3WWV A;  3RN5 A;  3H3V I;  1GVP A;  4IO9 A;  1C7Y A;  3JAM i;  1X54 A;  3S15 H;  2DGY A;  1KRS A;  4UY8 C;  3A0J A;  4DUY L;  3H0G G;  4JI0 L;  3BZC A;  1N9W A;  3S1Q H;  3U4Z A;  1RIP A;  2I0Q A;  4YCU A;  4H02 A;  1LYL A;  1Q1E A;  2PI2 A;  2YTX A;  2MQH A;  3SGI A;  4X66 L;  4A3C H;  4DPG A;  1JE5 A;  4JI8 Q;  3GO5 A;  3PSI A;  1HR0 L;  4QL5 A;  1IBK L;  2CCZ A;  3I7F A;  4JOI C;  3HOV H;  2JA8 G;  4JOI A;  2GN5 A;  3CD6 A;  4JYA Q;  1XNQ Q;  4POF A;  1L2F A;  4NXN L;  5C0X J;  2F52 A;  1K9M C;  5GAD C;  3K0X A;  4ME3 A;  4QGU A;  5LMU Q;  5ELO A;  1IBM L;  3HOY G;  2N49 A;  4JI1 L;  4AH6 A;  1K83 H;  1OXT A;  1OXS C;  4UP8 A;  1QZH A;  4OX9 L;  1XNR Q;  3FHW A;  1VQ9 A;  2N3S A;  3CCE A;  5LMN L;  4KHP Q;  3HOX H;  1VQO A;  3F1Z A;  3RZD H;  4A76 A;  1IBM Q;  2PQA A;  1P8L A;  1PFS A;  1K8G A;  2YU9 H;  4AIM A;  2ZM6 L;  3A5Z B;  4IPC A;  4OON A;  1E1T A;  4PZ7 A;  2BH8 A;  4XTC S;  4DV1 Q;  4GN5 A;  1VQC A;  2RCN A;  4IFD I;  2L15 A;  3H3V H;  2JK8 A;  2EXD A;  1X3F A;  3PV0 A;  2ZTC A;  4DV7 Q;  4LFB Q;  4KLK A;  2BH2 A;  4JBW A;  2RHS B;  2ZJQ A;  2V1C C;  2GVA A;  4GS3 A;  3K7A H;  2UUB L;  2VQF L;  3ER0 A;  2CWP A;  2R6G A;  2VQE Q;  2LSS A;  2KHJ A;  5FJ8 H;  2MFI A;  3ERS X;  1S72 A;  3HKZ E;  5IYD H;  2NVY H;  3GDE A;  3PUW A;  2YV5 A;  3MXN B;  4RG1 A;  4GKJ L;  1IBL Q;  2WAQ E;  1CKM A;  3GTM H;  4DV6 L;  1J5E Q;  2EQS A;  4OO1 I;  4DAY B;  3T1Y L;  3RR5 A;  3S1R H;  3KLW A;  3M4Q A;  2UXC Q;  4JI8 L;  3RLO A;  3PIO A;  4GLX A;  4JI5 Q;  4O2D A;  1C0A A;  4EQ5 A;  3KOJ A;  3CME A;  1JJG A;  1CSQ A;  1EUJ A;  1XNQ L;  4DV4 L;  1SN8 A;  1UE7 A;  4DK3 C;  3PO3 H;  1JMC A;  1BVS A;  4LW1 A;  1KC8 C;  2YYZ A;  5JEA G;  3HOX G;  4IOA A;  4YY3 Q;  2JA7 G;  4QY7 A;  5M3F G;  1NY4 A;  3JC6 6;  2E2H H;  4LFA L;  3AYH B;  5IYB H;  4DR1 Q;  3PIP A;  5LMN Q;  2KEN A;  4C3J H;  4KHP L;  4IFD J;  4L5R C;  1WCM H;  1PH9 A;  2A8V A;  1VQN A;  4YCW A;  2Z6K A;  2QEX A;  4YY3 L;  1WCM G;  4QIW E;  2B63 H;  1XTD A;  2JQO A;  1Q46 A;  4JI4 L;  5BR8 L;  2N8N A;  4BXX G;  5AJ3 L;  3UDF A;  1AH9 A;  1YHQ A;  3KFU A;  2K50 A;  3KF6 B;  1Y14 B;  4GN3 B;  1OXX K;  3PO3 G;  4C3I H;  4B3T Q;  3S2H H;  2WAQ G;  1LUZ A;  4HJA A;  1MJE A;  4LF8 Q;  3TRZ A;  4YWL A;  3HOU G;  3ICE A;  3L2P A;  2YTV A;  4WJ4 A;  4AYB G;  2K5V A;  4LF4 L;  2WB1 G;  1SRU A;  3J80 c;  4P72 A;  4LUO A;  1VQP A;  3UDI A;  1PYB A;  1S40 A;  2K4K A;  5IP9 H;  3S1M H;  2GVB A;  1HH2 P;  3I2Z A;  5E7N A;  3PF4 A;  3S16 H;  1QUQ A;  1VS0 A;  3CP0 A;  4HIM A;  5LMU L;  1VQB A;  4HID A;  1KD1 C;  3E9I A;  1PYS B;  2RF4 A;  4DV0 L;  1HNZ L;  1Q86 C;  1VQ7 A;  3S14 H;  1G6P A;  4TQU S;  1KRT A;  3EBE A;  4B3M L;  1AE3 A;  3KYH C;  1KIX A;  1GM5 A;  3H0G H;  1V43 A;  2CKZ B;  4R4C A;  3T1H L;  4DR2 Q;  1PH4 A;  1UE6 A;  1HZC A;  3TRE A;  1OXV A;  3I4O A;  1YI2 A;  2EIF A;  1EIY B;  1VQK A;  3CCM A;  5GAH C;  4NXM L;  1D8L A;  5M5W H;  1WFQ A;  2OQ0 A;  4DR7 L;  1K8A C;  4A3G H;  1PH6 A;  1UEB A;  2R92 H;  1TWF H;  1Y1V G;  4UPA A;  3KF6 A;  1N36 L;  3HOY H;  2K14 A;  3NBH B;  4DV5 L;  1PH1 A;  3AQQ A;  1W3S A;  3NEL A;  2ZJR A;  1A0I A;  3H15 A;  2F3I A;  3ULP A;  1PH5 A;  1KQS A;  2VS1 A;  3HOW H;  1N36 Q;  1L1O C;  1VQ5 A; 
#chains in the Genus database with same CATH topology
 4P73 A;  3D31 A;  2YFA A;  4IPG A;  4MTK A;  2CH4 W;  3NEM A;  1HNX L;  2RQX A;  3G4S A;  1EOT A;  3O13 A;  4EX5 A;  4A3F G;  4IUR A;  1K7U A;  2PZT A;  2E2D C;  1NSN S;  2KBN A;  4DA2 A;  1CT2 I;  2XRC A;  2X3T A;  1SYB A;  1LTR D;  2ROW A;  1JQY D;  1N8R C;  2R92 G;  1LTS D;  3I4M B;  3PUX A;  2PQE A;  4ZUJ A;  2QDL A;  4J15 A;  4HEA 1;  5J8F A;  1W2B A;  3K6O A;  3CC2 A;  3FVV A;  2FMM A;  3OSO A;  1RJT A;  1K28 A;  1QVC A;  1PPF I;  5FOB B;  3DA4 A;  4BY1 H;  1I3Q B;  1Y1W G;  2JA6 H;  1XBT A;  3E59 A;  5KGU A;  4KI0 A;  2N52 A;  4DK6 C;  1LAC A;  2NVY B;  5C3E H;  2E74 C;  3S2D H;  2X52 A;  1MKH A;  4IUV A;  4CJ1 B;  2VUM G;  2K03 A;  1TUS A;  5JVG 3;  2XSC A;  1IBL L;  2X6G A;  2PQA B;  2H4O A;  5EAY A;  2BA1 A;  3CCL A;  3JSB A;  1VQ8 A;  2Q8I B;  4SGB I;  2UXC L;  1TWG H;  3I4N H;  2ETD A;  1SND A;  5IYB G;  1SE2 A;  2IL8 A;  4A93 H;  3U50 C;  1QUQ B;  5IP7 H;  2OXP A;  2PMZ E;  3MHB A;  5GAG C;  4LF5 L;  1KAB A;  3B4V C;  3RU0 A;  1JOO A;  1I50 H;  1SGR I;  3CRL C;  1M8B A;  3F2B A;  3M3Y B;  4C1N I;  3T1H Q;  4IAL A;  1YNN D;  3J80 E;  4DNR B;  3S1Q B;  1EQR A;  3FRP B;  5JJK A;  1GD7 A;  1X74 A;  2ICE C;  4DR1 L;  3MC0 B;  2IY5 B;  1EWI A;  5EJW A;  2EYO A;  2K5W A;  3P75 A;  1Y1B A;  2E76 C;  2VQE L;  2ARP F;  3GTJ H;  3S2D B;  3OYY A;  1HXY D;  4LF8 L;  3V05 A;  1SFO H;  4I65 A;  1VQM A;  3BJI A;  1FNU A;  1HQM C;  5FUV A;  2QCP X;  4GLV B;  1OXU A;  2EY2 A;  5M5Y H;  2QQ0 A;  3L9A X;  1A15 A;  2NZ1 D;  4HJ9 A;  5E4W C;  1B70 B;  4RH6 A;  3J7Z C;  3L0O A;  4DF7 A;  1WGT A;  1F2Z A;  1MD2 D;  5EX3 A;  4A3J G;  4JG2 A;  5EGT A;  1L0W A;  5FLM G;  3JAM E;  4JI7 L;  2FHT A;  1NE3 A;  2ATW A;  2V1C A;  3SK5 A;  3DXJ C;  3K58 A;  1I4H A;  4TSS A;  1FYC A;  4XDX A;  1CTM A;  2AHO B;  4C56 C;  2WKD A;  1QNU A;  1NTG A;  3U9S A;  2JJQ A;  2VQF Q;  1M90 C;  1FNW A;  2QQD A;  1N34 L;  1V9P A;  2A73 B;  3DMU A;  3K5L A;  1LM0 A;  5IOC A;  1YJN A;  4A3B B;  1UE1 A;  3CXC A;  4HMJ A;  4KY7 A;  4A3K H;  4DR6 L;  5KIX A;  5I6Y A;  1OYV I;  3S1N H;  1A3T A;  1VDD A;  5IGG A;  2HCI A;  1ASZ A;  5HGQ A;  2LFN A;  1H9S A;  2F4V L;  4LF7 L;  3BZK A;  3K7U C;  5J3B A;  2CWF A;  2NVT H;  1CA5 A;  1OMT A;  4DWL A;  3D6W A;  5C44 G;  2CVR A;  1B50 A;  2MGS A;  1ZKO A;  1Z9F A;  5EKI A;  2QIL A;  1NJI C;  4LNQ A;  1YU6 C;  1B9M A;  1EIH A;  2QZG A;  3AFQ A;  3E5S A;  2OWO A;  1CHP D;  4GNX B;  2KMQ A;  1T9H A;  3KLS A;  1GO3 E;  4DV7 L;  3ZYY X;  2Z4I A;  2VXW A;  2DY8 A;  1QG7 A;  1B2T A;  5IGD A;  4AQY Q;  1Y1V H;  2KMO A;  4CDC C;  3IL8 A;  2SGD I;  2UUA Q;  3RLF A;  4JBK A;  2LY7 A;  4EVO A;  3TOA A;  1ESF A;  4IUU A;  1F2L A;  2IX0 A;  4E6I A;  2IT1 A;  4YCV A;  1Q3L A;  1R4Q B;  3PCO B;  3ULJ A;  1FVI A;  4A3I G;  2ASB A;  2AWN A;  2N1A B;  4MZ9 A;  2VZA A;  4CGY B;  4F88 A;  2ERW A;  3PUV A;  1DZ1 A;  3B6Y A;  2NVX H;  4X6A H;  3BVM A;  1A2U A;  1GHK A;  4B3S L;  4IFD G;  1D1K A;  4YZD A;  4LK1 C;  2JA5 H;  3D4R A;  1EFI D;  2Z0S A;  1CA6 A;  1E3P A;  7WGA A;  4OGQ C;  2JEA I;  2ID0 A;  3VYR A;  2EYH A;  2UXD L;  5K36 G;  2MHV A;  1NAP A;  4KD4 A;  5IWA Q;  5C44 B;  1JT8 A;  3SGB I;  1EIF A;  3CCQ A;  1E2W A;  4QJF A;  2W0T A;  1YNX A;  4LWC A;  5IGF A;  2ZTE A;  5FLM H;  3I4M H;  1YJ9 A;  1STY A;  4UP9 A;  4LUV A;  1ROD A;  2FNF X;  3GTL H;  1D6E C;  5COY A;  2IX1 A;  4DV4 Q;  4A3K G;  1Y1W H;  2JA6 G;  3HOY B;  2ZXO A;  2QF7 A;  2JA7 B;  4GNX A;  3NBH A;  3HH2 C;  3RMH A;  4XYQ A;  1NBW A;  3LWU A;  4R4Q A;  4YHH L;  1HZB A;  4RHS A;  1WKX A;  2NU1 I;  3M4O H;  1Q82 C;  1X4S A;  5A2Q L;  2F6M B;  1TS2 A;  1O78 A;  1UUP A;  2R7F A;  4C2M B;  4B3M Q;  1IZ6 A;  3U4V A;  2NZO A;  4DNC A;  3KDF A;  4KJO A;  4G7Z C;  1TS4 A;  3WOE A;  3FKI H;  5EKK A;  3V96 A;  1QWY A;  3IRB A;  3G71 A;  3PGZ A;  2B2T C;  4FF3 A;  5AJ3 Q;  5FO7 B;  5G3L F;  2WB1 B;  2Z6B A;  4ABN A;  2IX3 A;  1BR9 A;  3UOE A;  1LTL A;  4RGM A;  3NPP A;  1D7Q A;  1TDP A;  3W1G A;  4DAM A;  2E2I B;  4EQP A;  1KMA A;  4C3I G;  4DV2 L;  5M5X B;  1L0X B;  3CCU A;  4B3R L;  2V6E A;  2X6L A;  1KDA A;  3WDN A;  1W6K A;  2EYP A;  1N32 Q;  4BY7 H;  4XYO A;  4BBR B;  1ICW A;  1EQQ A;  3DLL A;  3J81 j;  4KTA A;  4OWT B;  1CKN A;  2BDN A;  2XWJ B;  2ZXR A;  5E4X A;  2MO1 A;  4BBS G;  2D0P A;  3GTJ B;  3VE5 A;  5GQO A;  5M3M G;  1FJG Q;  3E0J A;  3KLR A;  2VL6 A;  1IL2 A;  4X62 L;  3TS0 A;  1EQT A;  3GD7 A;  1S20 A;  1TWA H;  1TGS I;  2ALY B;  2P6A C;  1EYD A;  2BCO A;  4X3S A;  2AQ1 B;  3PIO 3;  2M5X A;  2EJF C;  2UU9 Q;  2J9R A;  1A63 A;  2DNE A;  4DV5 Q;  1HJP A;  1A3V A;  4Y52 H;  4GN4 B;  3UE0 A;  4A3L G;  3RN5 A;  1GVP A;  1A3U A;  4IUN A;  1C7Y A;  5E3F A;  4UY8 C;  5IGE A;  4DUY L;  3S1Q H;  3U4Z A;  4NP5 A;  1SYD A;  4YCU A;  1LYL A;  1Q1E A;  2PI2 A;  4A3C H;  4DPG A;  1WTV A;  4HCS A;  3I91 A;  2NB0 A;  3PSI A;  4JI8 Q;  3I7F A;  1PRT D;  1K0S A;  2KCC A;  3A8J E;  1XNQ Q;  1EEI D;  4POF A;  3I90 A;  5C0X J;  1GUW A;  1RCV D;  5DAE A;  5ELO A;  4GXT A;  3VYU A;  2N49 A;  1XNR Q;  3OWF A;  3OWE B;  4A3I B;  1LV9 A;  3TJQ A;  2K04 A;  9WGA A;  1VQO A;  2D5D A;  4WFN 3;  4CBV A;  4A76 A;  3S1N B;  4I7A A;  1P8L A;  4OON A;  2HDM A;  2KA7 A;  4A93 B;  2BH8 A;  2G5D A;  2RCN A;  1WD0 A;  4IFD I;  2AUJ D;  1SE4 A;  2AQ3 B;  4LFB Q;  4DV7 Q;  4KLK A;  2BH2 A;  1PTO F;  3TOB A;  3ER0 A;  4FXD A;  3I9V 1;  3ERS X;  1GXD C;  1PZI D;  3FC3 A;  2NVY H;  3F2U A;  3PUW A;  2YV5 A;  3H09 A;  3UI2 A;  3UGD A;  3HGB A;  1RTN A;  3M7G A;  3FMC A;  3S1R H;  3K5M A;  2K5Q A;  4Q0F A;  1C0A A;  2EVB A;  2D9U A;  1PRT F;  1D1I A;  1TY0 A;  1CSQ A;  1XNQ L;  1SNP A;  1QJO A;  2B8T A;  1Q90 A;  4LW1 A;  5JEA G;  4JK1 C;  4ZYS A;  3I4L A;  2JA7 G;  4CKC A;  2RBM A;  1SGP I;  5I4D A;  1EZ8 A;  4ZLT F;  2CH4 A;  3HOW B;  3TBI B;  3S2H B;  5I9P A;  1RHP A;  2Z6K A;  1WCM G;  2B63 H;  4N9P A;  3CHB D;  1ML0 D;  3Q23 A;  3UDF A;  3VA7 A;  4DGZ A;  5DM6 3;  1YHQ A;  2DY7 A;  5K36 H;  2K1B A;  1JWS D;  1OXX K;  1V1I A;  1YO7 A;  4FVM A;  3KY9 A;  2WAQ G;  1MJE A;  4IQZ A;  2MUY A;  4WJ4 A;  3A8K E;  1QIL A;  2V4D A;  1CGJ I;  3KP9 A;  4U67 3;  1SRU A;  5CV5 A;  3ITP A;  1PYB A;  1BOS A;  1S40 A;  5LL6 S;  3S16 H;  3E6Z X;  3CP0 A;  4XXE A;  1KD1 C;  1VQB A;  1TWC B;  2RF4 A;  1HNZ L;  1Q86 C;  1FGB D;  4TQU S;  2FJ2 A;  1AE3 A;  1KIX A;  1GM5 A;  1I6H B;  1GJX A;  3R5A A;  1E2Z A;  3T1H L;  1WTP A;  3TP8 A;  4IUP A;  4BBS B;  1PJU A;  3SGQ I;  2L1L B;  3RZO B;  1YI2 A;  3CRK C;  1VQK A;  1UAP A;  2K28 A;  4F8M A;  4NXM L;  5GAH C;  1UHA A;  1XA6 A;  1WFQ A;  2OQ0 A;  2EXZ A;  3BVG A;  4A3K B;  4A3G H;  1MGS A;  1UEB A;  4FXG C;  4UPA A;  1NR2 A;  1SNQ A;  1X3Q A;  3NEL A;  4KJN A;  3WOF A;  2B2Y A;  2NVT B;  3ULP A;  3Q6S A;  3HOW H;  2XMX A;  2F0O A;  3J81 E;  1OMU A;  4APV A;  1Q81 C;  3HOV G;  3DEO A;  4C2M H;  1G2T A;  2QQE A;  2RIJ A;  4YHH Q;  2F0Q A;  3QOJ A;  4QUF A;  2A2C A;  3C46 A;  3HEJ A;  1Y8P B;  3J7A F;  2B8G A;  3H91 A;  2RC4 A;  2ENB A;  3CPW A;  4JI7 Q;  3K81 C;  2PZW A;  3GP7 A;  1QVG A;  4AQY L;  1CHO I;  1J8I A;  5JEA H;  2PCF B;  5IT9 L;  1BQQ T;  3DO9 A;  4XIG S;  1SNC A;  4CKB A;  4P74 A;  2AMC B;  2I5M X;  3CXL A;  2P5Z X;  1IW4 A;  1KLU D;  2R93 G;  1Z47 A;  3CAM A;  2C5C A;  3K7A B;  1Q8K A;  1ULN A;  1SFO B;  1PRT C;  2P22 B;  2FMC A;  3J7A 5;  1NNX A;  2PNH A;  2BOS A;  3V2T A;  3CPF A;  4R4O A;  2NU2 I;  4TVA B;  3LJ2 A;  2F0F A;  2R3Z A;  2WII B;  3D6C A;  1TXY A;  5TSS A;  1TOT A;  1X55 A;  4HED A;  2JYO A;  2C35 B;  2R7D A;  4ME5 A;  2Q2H A;  1V1O A;  4LF9 L;  4A3L H;  3DM3 A;  2A1A A;  1HJA I;  4NMZ A;  1VQL A;  2XWB B;  3QTL D;  2F0K A;  4LFC Q;  3CCR A;  1HNW Q;  3IKJ A;  1XPU A;  4DR5 Q;  1P16 A;  2L11 A;  1X65 A;  3S14 B;  3FSX A;  1SR3 A;  2BA0 A;  4LF5 Q;  2YFB A;  4EQN A;  3CC4 A;  2NU0 I;  1G2S A;  1JC7 A;  4P2C B;  3A74 A;  1HUM A;  1T5E A;  2E8G A;  3ZJY C;  4C1N K;  2WAC A;  5CR3 A;  3PO2 H;  1SJE D;  3RUZ A;  3RD4 A;  3QIA A;  5IP9 G;  4MHE A;  1V1H A;  4NW2 A;  1EYC A;  2K6A A;  1NUB A;  1JOQ A;  5T1G A;  3F2C A;  1B7Y B;  2HQE A;  2B63 B;  2A19 A;  2L0C A;  1EQV A;  4DV2 Q;  4LF6 L;  3BJU A;  2WAQ B;  4JBJ A;  1U0L A;  5D65 A;  2ELI A;  1HNX Q;  2ZTD A;  4HAE A;  5E3Q A;  1PFM A;  3AFP A;  4FF1 A;  4NXN Q;  1VQA A;  2AWO A;  4ODG A;  1Y8O B;  3MEF A;  2RHQ B;  1DXM A;  1JB3 A;  4H13 C;  1PVO A;  1VDZ A;  3I55 A;  3U9O A;  3PF5 A;  4LUZ A;  1O7L A;  5HGT A;  5CBA E;  1N34 Q;  2VNU D;  4MIU A;  3KJP A;  1B44 D;  2AKW B;  2NN6 H;  1SYE A;  4K8I A;  3FEW X;  1SGY I;  3MXN A;  1VQG A;  5IY0 A;  1XPR A;  5I9O A;  1M8A A;  3NK9 A;  4B3R Q;  4JI6 L;  1KNE A;  2E2I H;  1WVL A;  4RMF A;  4ZKB B;  1IBK Q;  4UHV A;  2H1E A;  4PZ6 A;  3CMA A;  1IXR A;  5C4X G;  4DR3 L;  1TII D;  2K5H A;  2F0I A;  4A3G G;  1YTP A;  3T56 B;  1IW7 C;  1JWU D;  3MZ5 A;  5LMN W;  3S17 H;  4QB4 A;  2L7X A;  3Q22 A;  3NQI A;  2HT1 A;  2OVO A;  5CC4 A;  3GV6 A;  5ELC A;  4A3G B;  3QO2 A;  2VUM H;  3Q0A A;  2Y0S B;  3NTI A;  2KCM A;  4L9M A;  4CJ2 C;  2UU9 L;  2LXK A;  3M9B A;  3OHX C;  2JB3 A;  1K8M A;  3E0E A;  1EFW A;  4OAV B;  1JQO A;  4HJ8 A;  2QSB A;  4PL3 A;  1LTG D;  1DGS A;  4CHT B;  1HRJ A;  2NTT A;  4CDD C;  3PUY A;  1FR3 A;  4JVZ A;  2R7Z H;  1JJC B;  3T4A C;  4UP7 A;  3NTK A;  1G51 A;  3QG1 A;  3M85 A;  2F03 A;  1KXL A;  3E2I A;  2E2J H;  1PYW D;  3AB9 A;  1DM0 B;  2TSS A;  1RKN A;  2IHF A;  3T13 A;  3EIV A;  3J81 c;  1SLJ A;  1KAW A;  4OEM B;  2UUC L;  3HOZ B;  4NXM Q;  3UGL A;  1OVO A;  4ZCK A;  2RVL A;  4OIK A;  2B0U C;  1TWC H;  4QQB X;  3AJF A;  2Y0S E;  2Q2T A;  4AS3 A;  2L55 A;  5E3R A;  2UXB L;  4UXJ A;  2R61 A;  2O5I C;  4OWX B;  5DM7 3;  4GOP C;  2KUM A;  3RLN A;  2LUY A;  3NUC A;  1X9N A;  4LF9 Q;  5LHY 1;  3LJ1 A;  1CZG A;  1EYG A;  2ZRR A;  5C0X H;  4DNI A;  1W4R A;  3Q8D A;  1CKN B;  1E1O A;  3HKZ B;  1NUC A;  1TVX A;  4A3M H;  4DV3 Q;  2GIV A;  5EX0 A;  3OTO L;  2E2J B;  1RF2 D;  2IP6 A;  2D2C C;  2ZT9 C;  2CWG A;  4JI3 L;  4DK0 A;  2KVM A;  3EVQ A;  2JZM A;  2K75 A;  1H9R A;  4O1P A;  1PFB A;  4RCN A;  1S3O A;  4ULL A;  3U58 A;  3AU7 A;  2ZJP A;  4S3S A;  3TEH B;  1II3 A;  4IPH A;  5IWA L;  3UEY A;  4GKK Q;  3P7J A;  3QAH A;  2Q8T A;  2WFW A;  1C9O A;  1WTJ A;  1FAQ A;  5JHW C;  1SJ8 A;  1I50 B;  4NPS A;  4GLA C;  2GSC A;  2CFM A;  4X64 L;  1U4P A;  4H7B A;  4E1P A;  3AMU A;  1UNS A;  1SGN I;  3I70 A;  2F4V Q;  3NSW A;  5EPL A;  4GNX C;  4JI5 L;  3OIP A;  2RIO A;  2FU2 A;  5LNK 1;  2DUD A;  3A55 A;  4A3B H;  1QNK A;  4A93 G;  2A20 A;  4G75 A;  2JXM B;  1PV4 A;  2DIP A;  4YIJ A;  2PW7 A;  1F2Y A;  3FKI B;  3H94 A;  3FPP A;  4X3U A;  2RDH A;  2EPB A;  1FAR A;  5C3X A;  1MJC A;  3H0G B;  3LX0 A;  4PL4 A;  4POG A;  1S4Z A;  4DR4 Q;  4HJ7 A;  3STB D;  2JA7 H;  1U5K A;  1BF4 A;  1JJ2 A;  2E5L L;  2JP1 A;  1BBW A;  3CF5 A;  3KUP A;  1IYU A;  1BDO A;  3UDG A;  2E73 A;  4WJW A;  1V1Q A;  2KCN A;  1SJH D;  1R9T B;  4JYA L;  4O1N A;  4G7O C;  1LT5 D;  4KN4 C;  5M9O A;  2JA8 H;  1VQD A;  1KHI A;  1YNN C;  5GRO A;  3PIP 3;  1IYJ B;  2EZV A;  3HOW G;  4R1J A;  5A2Q E;  2OTJ A;  4MTN A;  2J0T D;  4K0K Q;  1MI2 A;  2BDO A;  3FPU B;  3S15 B;  2EY6 A;  5CV7 A;  1CQV A;  5CV9 A;  1HA6 A;  5C3E G;  1FJG L;  4A3C G;  1MJB A;  4CDE C;  4OIJ A;  1D5Z C;  3BG3 A;  4K14 A;  3J80 L;  1N33 Q;  4O0A A;  3K5N A;  5IP7 G;  4DUY Q;  1F9P A;  5C4J B;  3WWV A;  3TDQ A;  1G91 A;  4IO9 A;  3MTS A;  3SK8 A;  2TMP A;  2Z8L A;  4N8X 1;  3A0J A;  1N9W A;  1RIP A;  4CKE A;  3SGI A;  2MQH A;  5T1I A;  3EFX D;  2OZU A;  4FKD A;  1A2T A;  3P20 A;  3A7L A;  4DN4 M;  1EIG A;  5I2Y A;  3K57 A;  1L2F A;  4QUC A;  4NXN L;  2F52 A;  1TKW B;  4ME3 A;  4ZAI A;  1EWC A;  1BBX C;  2HUG A;  1K83 H;  1OXS C;  5J8C A;  2CQA A;  2LEO A;  2UVO A;  2NTS A;  4A3F B;  3NBI A;  3HOX H;  3LWE A;  1DOL A;  2F66 B;  3RZD H;  1O80 A;  2YU9 H;  2QGM A;  2A6E C;  1H0Z A;  4IPC A;  2B2W C;  2A69 D;  4DAV A;  4DV1 Q;  3R3O A;  3M4O B;  1VQC A;  2VUM B;  1K7T A;  3S17 B;  3I73 A;  3H3V H;  2JK8 A;  4B9X A;  1X3F A;  4H0L C;  4C3H G;  2F0J A;  1EY8 A;  2RSO A;  3K7A H;  3FDT A;  2R6G A;  5FLX L;  2LSS A;  2KHJ A;  3IAY A;  4TKO B;  1S72 A;  5IYD H;  1EU3 A;  3GDE A;  2JB2 A;  3MXN B;  3LJ0 A;  4GKJ L;  3GTM H;  1VMC A;  4DV6 L;  1J5E Q;  4RFB A;  4DAY B;  3T1Y L;  3RR5 A;  4OO1 I;  3KLW A;  3M4Q A;  2UXC Q;  3HRZ C;  3PIO A;  2B2V C;  3D00 A;  3CME A;  2M2L A;  3ND9 A;  4UAI A;  5C4H A;  4DV4 L;  2EYM A;  4G4K A;  3PMF A;  2A6E D;  1LTI D;  3IAM 1;  2KHS A;  2E2H H;  4LFA L;  4Z7H A;  2B2V A;  3AYH B;  2NU4 I;  3E3X A;  1PFN A;  1CM9 A;  3SE0 A;  2A8V A;  5I2X A;  1VQN A;  2DN8 A;  1H9M A;  2QEX A;  4YY3 L;  4QIW E;  1F9R A;  1TS5 A;  1U4M A;  1XTD A;  4J6H A;  4BXX G;  2Z9H A;  1WTR A;  2ORW A;  1EY0 A;  1TWA B;  5FO8 B;  4NV5 A;  1CT1 D;  1AH9 A;  2HCC A;  3N6R A;  3KF6 B;  5CCL A;  1LR9 A;  1PZK D;  1Y14 B;  5DEH A;  5EQ0 A;  4C3I H;  4B3T Q;  1NXU A;  1LUZ A;  4LF8 Q;  4WOR A;  2RLD A;  2K33 A;  3ICE A;  2BE5 C;  1EU4 A;  3TZD A;  2JB1 A;  4P72 A;  4LUO A;  3UDI A;  2K4K A;  3S1M H;  1HH2 P;  3I2Z A;  1EZ6 A;  1QUQ A;  3BVZ A;  3TP5 A;  5LMU L;  4HID A;  1YNJ D;  3L0I A;  1KRT A;  2DB6 A;  3EBE A;  3MFY A;  1SNM A;  1V43 A;  2A68 D;  1VF5 C;  4R4C A;  5FKA C;  3MFG A;  1PH4 A;  1UE6 A;  1AN1 I;  1JIC A;  5CMD A;  5ELF A;  3I4O A;  5G3L D;  2EIF A;  3VR2 A;  2L12 A;  1EIY B;  2JA1 A;  3CCM A;  2KMP A;  1HTL D;  2RSN A;  2K5D A;  2LB7 A;  2R92 H;  3UIT A;  1Y1V G;  2RCF A;  2NYZ D;  1CQF A;  2K14 A;  4QIW B;  1I6V C;  1RD9 D;  1W3S A;  5CV4 A;  1STE A;  1A0I A;  1WTQ A;  3GV3 A;  3H15 A;  1CZW A;  2F3I A;  1N36 Q;  2Z4H A;  5I6W A;  5D14 A;  1HPC A;  4KV6 A;  1Z7K B;  3OOC A;  1ILQ A;  4HIK A;  1S5D D;  1K0R A;  1V8Q A;  4MN3 A;  3M4P A;  1F2M A;  5M5X H;  4E1R A;  1FGU A;  4O1O A;  2L8E A;  4IJH A;  3GTO H;  1WI5 A;  4KHV A;  4KKS A;  4DKA C;  4LAA A;  1HA5 A;  2XRQ D;  1YIJ A;  2EYL A;  4QMG A;  1CUK A;  4RKB A;  5L37 A;  3GTP H;  5DAU A;  5C0X G;  3STB C;  3M7N A;  2KHI A;  3VR3 A;  5CV6 A;  2F0N A;  4PMB A;  1NR4 A;  1EL0 A;  1AP0 A;  2FXQ A;  3UFF A;  1FL0 A;  5IGB A;  3D3R A;  3BDC A;  4I7Z C;  5ELB A;  1BMO A;  4TRD A;  5M5W B;  1BXT A;  1LTA D;  1K3R A;  1WD1 A;  3A56 A;  2F0H A;  1KBF A;  1IKL A;  2RA4 A;  4YWM A;  5E3P A;  3T1Y Q;  3VA9 A;  3GTQ H;  1H9J A;  3HFZ B;  1O7Z A;  4AYB B;  2I46 A;  4PL5 A;  3GQB A;  2F0E A;  3ND8 A;  3CCJ A;  4JI3 Q;  1U9R A;  3K0Y A;  5CBE E;  4N8F A;  5F2D A;  4Z9C B;  4GOP B;  4BA1 I;  3HKS A;  1HCZ A;  2F0U A;  2WB1 E;  4BBR G;  1LO5 D;  4A3M G;  3K8A A;  2CW0 C;  1Y1V B;  1GKH A;  3S16 B;  2ORV A;  4R8I A;  3JAM c;  2A5H A;  4KY5 A;  1XTC D;  4DR5 L;  3TS2 A;  2QQC A;  2OTL A;  1F9Q A;  3QOL A;  3NXW A;  1E0B A;  2QA4 A;  2EOT A;  4H44 C;  2XVS A;  3SK4 A;  4FDB A;  1O7Y A;  3AEV A;  1XPO A;  2WVJ A;  1K7V A;  3TO7 A;  5BR8 Q;  1WJJ A;  2UZ3 A;  3R8B A;  2SGQ I;  4YWK A;  2KCT A;  2CWA A;  3OPO A;  2MO0 A;  1Z7T A;  1R79 A;  5EBD A;  1STA A;  1EY4 A;  1UE5 A;  3DA3 A;  5K5P A;  4LF6 Q;  4F7X A;  3KJO A;  3PQI A;  3A5U A;  4BY7 B;  2SGF I;  3A8I E;  2ENN A;  2QPO A;  2E5R A;  1GUO A;  3Q24 A;  1DS3 I;  1NCV A;  1PH3 A;  1ULK A;  3LGJ A;  3NWS A;  3ULL A;  2XTQ A;  3C1F A;  1STH A;  4IZ8 A;  3NEN A;  2K9H A;  3W3A A;  1SYF A;  3GTM B;  1WOC A;  4N9T A;  2B39 A;  3L7Z C;  3FSY A;  4HGU A;  1VQF A;  2F0M A;  4BY1 G;  3MEK A;  1Q8I A;  4X64 Q;  5HUR A;  1PH8 A;  2B2U C;  4CJ0 B;  1VQE A;  1EY9 A;  3TME A;  3T53 B;  1VQ4 A;  4EQO A;  4KHZ A;  1OTC A;  4B3T L;  3B55 A;  1X32 A;  1XNR L;  4A3M B;  2LXJ A;  4R9W A;  5JJL A;  1JCK B;  2IPK D;  4A4I A;  3G6E A;  4NDX A;  3FKI G;  4O42 A;  2F3V A;  2R92 B;  3R93 A;  1LT4 D;  2KEC A;  2WP8 J;  1YEZ A;  2G9H D;  1IW7 D;  4JI1 Q;  4P75 A;  3W1B A;  2HHH Q;  5GAE C;  2JBW A;  1RL2 A;  4XQJ A;  2BUS A;  5FUX A;  1Y69 U;  2A74 C;  1ET6 A;  1D5M C;  5CV8 A;  1E24 A;  3BYT B;  2WCY A;  2XRS D;  1HQR D;  5FUY A;  4WRD A;  4HN7 A;  1ENF A;  1L1O C;  5C5M A;  5KRU A;  5H1S E;  1Q1B A;  1X56 A;  2PPB C;  1DOK A;  4HSP A;  1BO0 A;  5IYC H;  2NVX B;  4Y7N B;  2F3W A;  2ES2 A;  2WGC A;  4A3J B;  4DR6 Q;  4AS2 A;  4BY7 G;  1I5F A;  2XTR A;  2VRW B;  3OVO A;  1PA6 A;  3OIQ A;  1PXU A;  1ICF B;  1PTO C;  3JAM L;  1U4R A;  4A24 A;  3GTG B;  2R93 H;  4DV0 Q;  1SRO A;  4WP4 A;  3SDJ A;  1Z6H A;  2NUC A;  2H5X A;  3DHQ A;  2UXB Q;  5LL6 X;  3TO9 A;  4A3D H;  2O2L D;  3HOU H;  2PW5 A;  2CW0 D;  1XMQ L;  2RDG A;  1GOZ A;  3RNU A;  1YJW A;  2OF1 A;  3SEK C;  3GOX A;  1HNZ Q;  4BY1 B;  2K01 A;  3G6J B;  2K52 A;  4OL7 A;  4X65 L;  5KEE A;  3J7A V;  1B3Q A;  3H6M A;  4BXX H;  2PO4 A;  1J6Q A;  4K8J A;  1PLF A;  1FY7 A;  1AZQ A;  5KYI A;  4GOP A;  3PO3 B;  3J7Y W;  1PRT B;  1G6Z A;  2OT2 A;  2JA6 B;  1PDQ A;  4Y7N H;  1ZEQ X;  1NMG A;  1HR0 W;  2JXD A;  1TWH B;  4PNY A;  5JJZ A;  2OEO A;  1YVC A;  2B29 A;  3GTP B;  1VQI A;  3KF8 A;  1H9K A;  3S9W A;  1CSO I;  1XMO L;  1S5B D;  1TWG B;  5J1Z A;  3W5O A;  4PZ8 A;  1UVG A;  1DJR D;  2PMZ B;  1UWV A;  4XQQ A;  1WTX A;  1ZXT A;  1X3P A;  5CCM A;  1YIT A;  2HD3 A;  5BN4 A;  1A62 A;  4AML A;  1SE3 A;  4AYB E;  5KNC A;  2BL8 A;  4JV5 L;  1CKO A;  2F3C I;  1BNZ A;  2AUK A;  4OHJ A;  1Q12 A;  1TUR A;  2ZM6 Q;  3D4W A;  3CW2 C;  4IPD A;  2Q8R E;  1IHZ A;  1XMQ Q;  3I72 A;  3HOX B;  4P71 A;  1A8V A;  3URY A;  4Q9V A;  2HGK A;  3BYY B;  2YU9 B;  1MHW C;  1QZG A;  4OVO A;  4R4T A;  1F77 A;  3K5O A;  2L5T A;  2MJ8 A;  4BWG B;  4A3B G;  4BA2 I;  1E7Z A;  3FP9 A;  2F4I A;  2Q2I A;  4DR7 Q;  1SYG A;  3IFD A;  1JB7 A;  4KKT A;  4DNT B;  1TWH H;  3G48 A;  3VYS A;  2O4X A;  2XGT A;  2KEE A;  4G76 A;  3NQT A;  2QKI C;  1EEF D;  4Q5V A;  2MNA A;  2GKV A;  4A3D G;  1H95 A;  3VA5 A;  1PCE A;  2ICI A;  2V53 A;  3KLS X;  1KDB A;  1XMO Q;  3I4N G;  4ZKC B;  2BL7 A;  2OU2 A;  4PMW A;  1UEA B;  4M1U B;  1ASY A;  2A68 C;  1V1P A;  1H9S B;  2SNM A;  3NWT A;  2VW9 A;  4HJ5 A;  3OXL A;  4FO2 A;  3VR5 A;  2DNC A;  2B3G A;  1HNW L;  1YNJ C;  1PH7 A;  4BBR H;  3HKZ G;  3S24 A;  1JE4 A;  2QEJ C;  1ESR A;  2OCE A;  3RN2 A;  1HZ9 A;  4IN3 A;  4K2K A;  4RAU C;  1ENC A;  2UUA L;  4IFD H;  3I3C A;  5FO9 B;  4KD3 A;  5C4Z A;  3JAM i;  1HFN A;  5EPJ A;  1JOK A;  2XN9 C;  4RKL A;  2F0P A;  2I0Q A;  3QWN A;  3OXF A;  2YTX A;  2Z1C A;  1RDP D;  2DKV A;  1JE5 A;  3ERO A;  1HR0 L;  1VMP A;  2EDG A;  4QL5 A;  4ILW A;  1SGD I;  2JA8 G;  4JOI A;  1CI3 M;  2R7Z B;  3CD6 A;  1B3A A;  4FF4 A;  2KED A;  5ELD A;  2XIW A;  4ID6 A;  1T5X D;  1TR5 A;  5GAD C;  5LMU Q;  1PMR A;  4AH6 A;  4UP8 A;  1DON A;  2N3S A;  3CCE A;  5LMN L;  4KHP Q;  5J22 A;  4ZK9 B;  1IBM Q;  4L6T B;  1PFS A;  4AIM A;  1DS2 I;  3A5Z B;  4PZ7 A;  1JR0 D;  1PTQ A;  1JWM D;  1ULM A;  3I4N B;  2L15 A;  1HPT A;  1KNA A;  2K7V A;  3C3L A;  2EXD A;  2ZTC A;  4KMU C;  4JBW A;  2ZJQ A;  2GVA A;  4GS3 A;  4FYD A;  2VQE Q;  5FJ8 H;  2EYJ A;  2MFI A;  5ELE A;  3NTH A;  4ZUI A;  1TY2 A;  4B08 A;  3HKZ E;  1HTP A;  2F0S A;  1SNO A;  1Z2I A;  4RG1 A;  3X3M A;  2NVQ B;  3VR6 A;  4QF4 A;  5CYU A;  2EQS A;  2K19 A;  4JI8 L;  3RLO A;  4O2D A;  5C4X B;  3R2I A;  3OMG A;  1MSH A;  2PZU A;  1JJG A;  3M4Y A;  1WTO A;  1EUJ A;  1SN8 A;  1UE7 A;  4DK3 C;  2A6H D;  1KC8 C;  5BN5 A;  2IJ0 A;  3HP3 A;  3HOX G;  3H3V C;  1I4X A;  4YY3 Q;  1ET9 A;  3JC6 6;  5JOB A;  4DR1 Q;  2YUU A;  5LMN Q;  4KHP L;  2F1M A;  4C3J H;  1BCP C;  4IFD J;  1SDF A;  1WCM H;  1PH9 A;  3X3N A;  2JQO A;  1CT0 I;  1Q46 A;  4JI4 L;  5BR8 L;  2N8N A;  5IT9 E;  5AJ3 L;  3HOU B;  2JA8 B;  2J7Z A;  3KFU A;  2K50 A;  4GN3 B;  3R5C A;  2ZW3 A;  2IWH A;  3KBG A;  3S2H H;  3IAS 1;  4DXF A;  5KYL A;  4YWL A;  5FK9 C;  3HOU G;  2YTV A;  4AYB G;  4A3D B;  1M4V A;  1SYC A;  1KDC A;  2CJS C;  4HFV A;  2WB1 G;  3J80 c;  4YZ9 A;  1VQP A;  1SAP A;  4K6D A;  5D3I B;  3DWP A;  5COR A;  1IY6 A;  5IP9 H;  2O5J C;  4RCO A;  4DAP A;  4UXI A;  2L9H A;  4B6D A;  1VS0 A;  3E9I A;  1PYS B;  3S14 H;  1TBO A;  1G6P A;  1AEX A;  3MAQ A;  2EYF A;  4IUT A;  3KYH C;  4HR7 B;  4J8Q A;  2CKZ B;  1QOH A;  4DR2 Q;  2EJM A;  4L63 B;  2ENZ A;  1HZC A;  3TRE A;  3VDP A;  1PTO H;  2B2Y C;  5JAV A;  5M5W H;  2EY1 A;  1LR8 A;  1RTO A;  1PH6 A;  1STN A;  1TS3 A;  1TWF H;  3KF6 A;  1N36 L;  3VYT A;  2PYK A;  2I07 B;  3AQQ A;  1XX8 A;  2ZJR A;  4A3E B;  3DEP A;  1IL8 A;  1WCM B;  1TQO A;  2L1B A;  4RA8 A;  1PH5 A;  1KQS A;  2LS0 1;  4DFA A;  3GTO B;  5FLX c;  4K5V A;  4A3E G;  3BZD B;  3CCS A;  1HEV A;  4OO1 G;  3UEJ A;  1YHA A;  2F0D A;  3KDF B;  1VQJ A;  1AFP A;  2Y0S G;  4LJZ C;  2SGE I;  1MIU A;  2I5L X;  3CKI B;  4IJL A;  2VY3 A;  3L3O C;  1DOM A;  4EGV A;  2A2D A;  3A54 A;  1ENA A;  2ZXP A;  2WIN B;  1I94 Q;  1ILP A;  2M00 A;  1N33 L;  1TWF B;  2GKT I;  1WTH A;  5BN3 A;  3EA6 A;  3VDU A;  3OL0 A;  2B2T A;  1P9G A;  2NVQ H;  3R5B A;  3TP7 A;  3T16 A;  5M3M H;  4JI0 Q;  5ELN A;  2ODD A;  1Y8F A;  4BBS H;  2SOB A;  2E5L Q;  1X3E A;  4L5T A;  3HOZ G;  4KK7 A;  3E9H A;  2MP1 A;  2D62 A;  2EY5 A;  1SMY D;  1X3G A;  1B9N A;  1SMX A;  4OWW B;  1LTT D;  5IOD A;  4LF4 Q;  4A3J H;  1FNV A;  2DJF C;  2J87 A;  2NWG A;  3RZO H;  4K2L A;  3F2D A;  4GKJ Q;  2HHH L;  1LT6 D;  2VB3 X;  2L4N A;  1RFH A;  5DLQ E;  2F0W A;  4DV3 L;  1KTK A;  4DR4 L;  3M3Y H;  2CAZ B;  3OTO Q;  1P9Z A;  2NZH A;  2WV6 D;  1J9O A;  5C5L A;  4L8J A;  1BCP B;  2N17 A;  4K0K L;  3PO2 G;  4MPI A;  1QB5 D;  4ALP A;  1I94 L;  2KCX A;  4C3J G;  3HOZ H;  1KLG D;  1B4O A;  1M8C A;  3DWA A;  1N13 A;  4JI2 Q;  5M3F H;  1HHV A;  3FNB A;  1LLR D;  2GVI A;  2B63 G;  3GTK B;  3J81 L;  4C3J B;  4GI3 C;  4LFB L;  3CCV A;  3F8T A;  3TP6 A;  2YQP A;  1X6O A;  4FXK C;  1EOV A;  5C6A A;  1HUN A;  1S5E D;  2K5N A;  4X66 Q;  4PG3 A;  1R0R I;  3OMC A;  4OEL B;  4K6L A;  1N32 L;  1EYA A;  5M3M B;  1JOR A;  2IHE A;  3KK7 A;  1SE8 A;  2HIX A;  3UE1 A;  1BCP D;  3DUZ A;  2BE5 D;  1SSO A;  4U6R A;  1C48 A;  4U68 A;  1TU2 B;  1SXT A;  3J80 i;  4K5W A;  4A75 A;  2JA9 A;  4DR2 L;  3FVQ A;  1MSG A;  2A6H C;  4KN7 C;  2M9V A;  2SNS A;  3BDO A;  5E1F A;  3EN2 A;  4DUZ Q;  1L0Y B;  4C3H H;  5IYC G;  1M1K C;  1C8C A;  1LR7 A;  1SEB D;  2YTY A;  3MEH A;  3D0F A;  1YBY A;  3KF8 B;  5C4X H;  4JI4 Q;  3OW2 A;  5HGI A;  1D5X C;  4JI2 L;  2HDL A;  1QVF A;  5HQ8 A;  2HQL A;  2KOL A;  2N78 A;  2UUB Q;  2R7Z G;  2FUG 1;  5EBC A;  4A3I H;  1CSP A;  2CQO A;  3I56 A;  4OX9 Q;  5JVH 3;  2PNR C;  3P1H A;  1TT2 A;  3F4M A;  1BKB A;  1BBU A;  2QDB A;  4LF7 Q;  2FIN B;  3PDN A;  3PO2 B;  2KJX A;  1KL9 A;  4A3F H;  3CQZ H;  3GTK H;  4A3E H;  4DAY A;  5JJI A;  1VQH A;  2B2W A;  3TQY A;  1I6H H;  4HMI A;  2JE6 I;  5CGK A;  5JEA J;  3MVV A;  4R8N A;  1K83 B;  2E75 C;  3MXP A;  1PH2 A;  1TBR R;  2SEB D;  2F0T A;  2NN6 I;  4R4I A;  3SXH A;  3RZD B;  3MXU A;  4JW0 A;  3OXG A;  2F0V A;  2SDF A;  2DJG C;  3IFT A;  3K80 C;  4FP5 D;  1KAA A;  3QJY A;  4NB3 A;  3TSS A;  3SEB A;  1HR0 Q;  2JA5 B;  1XXG A;  4C3I B;  1SGE I;  1PZJ D;  4V19 0;  3C1E A;  4JI6 Q;  4OXP A;  2NN6 G;  2Q2U A;  2LKV A;  5C44 H;  1LTB D;  4WJ3 M;  1PTR A;  4DR3 Q;  4B3S Q;  3SK6 A;  1B53 A;  1D2B A;  4L5Q A;  1WTW A;  2Y0M A;  1VF7 A;  1V1P B;  1ZYR C;  1LAB A;  5C3W A;  3CC7 A;  4LFA Q;  1HZA A;  4JCV E;  1Q9B A;  1CFM A;  1DYQ A;  3TO6 A;  3LNN A;  4LFC L;  1NMF A;  1FYB A;  2GKR I;  2AQ2 B;  5JPM C;  4I1T A;  4JPB W;  1I4G A;  3J81 i;  1GUG A;  3S1R B;  4IOC A;  1YHB A;  1MJ9 A;  2E2H B;  1G8Z D;  1R9T H;  1CE3 A;  2N88 A;  4QCL A;  1YZ6 A;  2NBF A;  4X3K A;  4X65 Q;  5HI7 A;  4HIO A;  5IYD G;  3I8Z A;  4JC0 A;  4XT3 B;  2KKM A;  1UUC A;  3VDY A;  2XTI A;  2Z6K C;  1UVF A;  1CK1 A;  1XYI A;  2UUC Q;  1GUT A;  1K73 C;  4RGT A;  4JBM A;  4V0B A;  5IIF A;  1MBY A;  3QR8 A;  2IW3 A;  4DV6 Q;  1J5E L;  5EKL A;  1STG A;  2KQ3 A;  5IT9 c;  5C0X I;  2I5H A;  3W2D A;  3A7A B;  2XNA C;  4OAU C;  2B8F A;  4YZC A;  3HZX A;  3UDX A;  2J4X A;  5A35 A;  3HS0 C;  3PUZ A;  4L5S A;  1I4R A;  1K8O A;  4DK1 A;  1L1O B;  1PHJ A;  4JV5 Q;  1E2V A;  1I3Q H;  2JEB I;  3BU2 A;  1CHQ D;  2PQ8 A;  5D3D A;  5FJ8 G;  1U4L A;  4DUZ L;  3I4M G;  1OO9 B;  2QGQ A;  1XX6 A;  4F87 A;  1SGQ I;  1VCI A;  4LMQ D;  4X3T A;  1GUS A;  4GKK L;  1B8A A;  4PMC A;  1AN8 A;  1PTO B;  1BCP F;  1G29 1;  3OW7 A;  2OQK A;  2PI2 E;  3HOV B;  3NE5 B;  1BUS A;  4IUQ A;  4C3H B;  1WYD A;  4MNO A;  5HY6 A;  4RGO S;  2JYY A;  2JAE A;  4ZQ3 A;  2WKC A;  1XJV A;  3UGI A;  2K05 A;  2D0O A;  2VB2 X;  4X62 Q;  4J1M A;  5JPN C;  2F0G A;  1S5C D;  2JN4 A;  4HCE A;  3MA2 B;  5C4J H;  3QWP A;  4KY6 A;  3GTG H;  4DV1 L;  1DD2 A;  2HIV A;  2X69 A;  2UXD Q;  1L1O A;  3SVM A;  1AW7 A;  1K3B C;  3CU7 A;  5FLX E;  5IE8 A;  1Q7Y C;  2MJF B;  2RAD A;  3NP8 A;  3SHL A;  2JA5 G;  2GA4 B;  1O7I A;  4G57 A;  1PTO D;  1AE2 A;  1E22 A;  3C2P A;  1TBN A;  3H3V I;  4XT1 B;  3SDZ A;  1X54 A;  3S15 H;  2DGY A;  5NUC A;  1KRS A;  1R4P B;  2JW6 A;  4JI0 L;  3H0G G;  3BZC A;  4HSV A;  1Y1C A;  4H02 A;  4X66 L;  3D8G A;  2CHB D;  3BDL A;  3GO5 A;  3GTQ B;  2CCZ A;  3HOV H;  1IBK L;  4JOI C;  3S1M B;  3NHH A;  2GN5 A;  4JYA Q;  4OO1 H;  2NU3 I;  1IY5 A;  1GHJ A;  1K9M C;  3K0X A;  4QGU A;  1IBM L;  4B9W A;  4DXG A;  1EWH A;  3HOY G;  4JI1 L;  4PQX A;  1OXT A;  4RWS C;  1QZH A;  1Y8N B;  4OX9 L;  3FHW A;  3FBV A;  1EY7 A;  4FNF A;  1VQ9 A;  3F1Z A;  2PQA A;  1K8G A;  5DNF A;  2ZM6 L;  1S5F D;  3EQL C;  4Z7G A;  2LMC B;  3P23 A;  1E1T A;  4XTC S;  2SGP I;  2F0L A;  4GN5 A;  1IYV A;  1B1Z A;  3PV0 A;  2RHS B;  3ERQ A;  2V1C C;  1I4Q A;  3DM1 A;  2UUB L;  1MT1 A;  2VQF L;  4G7H C;  2CWP A;  1Y1W B;  4RGN A;  5AFW A;  1MJA A;  2KMR A;  2B2U A;  1DCZ A;  3R5D A;  1IBL Q;  3KBX A;  2WAQ E;  1CKM A;  3GTL B;  1QCB D;  2N55 A;  1CGI I;  3N52 A;  4JI5 Q;  5J39 A;  4GLX A;  2CWH A;  4K5X A;  4M8A A;  4EQ5 A;  3KOJ A;  2JSO A;  1ZYR D;  2RDF A;  3ONA B;  3BS1 A;  3HG9 A;  5IGC A;  1TIH A;  1GUN A;  4BS9 A;  4FF2 A;  3PO3 H;  1JMC A;  1BVS A;  2YYZ A;  4IOA A;  4QY7 A;  5M3F G;  1EY5 A;  1NY4 A;  2EE1 A;  3TN2 A;  3G7L A;  5IYB H;  2K32 A;  2R93 B;  3PIP A;  3D4D A;  2KEN A;  4UDU C;  5KNB A;  4L5R C;  4YCW A;  5FUW A;  2QW7 A;  5M3F B;  3MXG A;  4ZRZ A;  5M5Y B;  1CT4 I;  3PO3 G;  3SR1 A;  4HJA A;  3TRZ A;  3L2P A;  2MPM A;  2K5V A;  4GZY C;  2RKS A;  1EY6 A;  5ISR A;  4NV2 A;  4LF4 L;  3T51 B;  2N71 A;  3K59 A;  4PV1 C;  1AZP A;  3EJI A;  2GVB A;  5E7N A;  3PF4 A;  4NKL A;  4HIM A;  1VQ6 A;  1IKM A;  2OD1 A;  4DU9 A;  4DV0 L;  1VQ7 A;  1QE6 A;  1A6X A;  2G9D A;  5EPK A;  1HFG A;  4B3M L;  3H0G H;  2FFK B;  4XQN A;  1STB A;  1TBQ R;  1OXV A;  1WGC A;  1HDL A;  3CQZ B;  3R2T A;  1C4Q A;  1W6J A;  1BUV T;  1XWE A;  4HTH A;  1D8L A;  2EJG C;  4DR7 L;  1K8A C;  2C9O A;  1SBB B;  4KKU A;  1SMY C;  5C3E B;  4RHR A;  2A69 C;  3MWY W;  1ONL A;  3HOY H;  1LT3 D;  1I4P A;  4CDF C;  3DWQ A;  3NBH B;  4DV5 L;  3TZU A;  1PH1 A;  5KND A;  1KBE A;  3VR4 A;  1FD7 D;  1F9S A;  2FEF A;  2VS1 A;  3QB3 A;  1VQ5 A;  4UXH A; 
#chains in the Genus database with same CATH homology
 4P73 A;  1OMU A;  3D31 A;  4APV A;  1Q81 C;  3HOV G;  2YFA A;  4C2M H;  5FLX c;  1Z7K B;  4IPG A;  4YHH Q;  2QQE A;  2A2C A;  4HIK A;  3NEM A;  4A3E G;  1HNX L;  3G4S A;  3CCS A;  1K0R A;  4OO1 G;  4A3F G;  4EX5 A;  3UEJ A;  3M4P A;  1YHA A;  3KDF B;  5M5X H;  4E1R A;  1VQJ A;  1FGU A;  2KBN A;  4O1O A;  3CPW A;  4IJH A;  4JI7 Q;  3GTO H;  1WI5 A;  1CT2 I;  2L8E A;  3K81 C;  2Y0S G;  2ROW A;  2SGE I;  2XRC A;  1N8R C;  1MIU A;  2R92 G;  2I5L X;  4IJL A;  4AQY L;  2VY3 A;  3PUX A;  1QVG A;  4DKA C;  1CHO I;  2A2D A;  1YIJ A;  4J15 A;  4HEA 1;  1W2B A;  1SGR I;  1CUK A;  1I94 Q;  4XIG S;  3DO9 A;  3CC2 A;  1N33 L;  4P74 A;  2AMC B;  2I5M X;  2GKT I;  3GTP H;  5C0X G;  3CXL A;  1QVC A;  1PPF I;  1IW4 A;  3DA4 A;  3STB C;  2R93 G;  3VDU A;  1Z47 A;  3CAM A;  2KHI A;  4BY1 H;  1Q8K A;  3M7N A;  3OL0 A;  1XBT A;  1Y1W G;  2JA6 H;  2NVQ H;  3E59 A;  4KI0 A;  2FXQ A;  2P22 B;  2N52 A;  3UFF A;  4DK6 C;  1FL0 A;  5M3M H;  5ELN A;  4JI0 Q;  5C3E H;  3J7A 5;  3S2D H;  2ODD A;  1M90 C;  1Y8F A;  1BMO A;  2PNH A;  4BBS H;  1MKH A;  3CPF A;  4R4O A;  2VUM G;  4TVA B;  2E5L Q;  2NU2 I;  3LJ2 A;  1TUS A;  1X3E A;  4L5T A;  3HOZ G;  1PTR A;  1K3R A;  1TXY A;  2D62 A;  3E9H A;  1IBL L;  2PQA B;  1YTP A;  1KBF A;  5EAY A;  2BA1 A;  1X3G A;  3CCL A;  1TOT A;  4YWM A;  3JSB A;  1SMX A;  1VQ8 A;  4OWW B;  1X55 A;  3VA9 A;  3T1Y Q;  4LF4 Q;  2C35 B;  1VQ6 A;  3HFZ B;  3GTQ H;  1TWG H;  2UXC L;  2R7D A;  3I4N H;  4A3J H;  4SGB I;  2Q2H A;  5IYB G;  2J87 A;  4PL5 A;  4LF9 L;  3RZO H;  4A3L H;  3DM3 A;  2A1A A;  4A93 H;  1HJA I;  3U50 C;  3F2D A;  1QUQ B;  5IP7 H;  1VQL A;  3CCJ A;  2PMZ E;  4JI3 Q;  4GKJ Q;  3QTL D;  2HHH L;  5GAG C;  4LFC Q;  4LF5 L;  1RFH A;  3CCR A;  3B4V C;  5DLQ E;  1HNW Q;  3RU0 A;  1I50 H;  4DV3 L;  4GOP B;  1XPU A;  4BA1 I;  2CAZ B;  3HKS A;  3M3Y H;  4BBR G;  2WB1 E;  3OTO Q;  1P16 A;  2NZH A;  3F2B A;  4DR5 Q;  1X65 A;  4A3M G;  3K8A A;  1M8B A;  1SR3 A;  2BA0 A;  4LF5 Q;  2YFB A;  1GKH A;  3CC4 A;  2NU0 I;  2ORV A;  3T1H Q;  3JAM c;  5HQ8 A;  2OVO A;  2N17 A;  4K0K L;  3PO2 G;  3A74 A;  2E8G A;  3ZJY C;  4DR5 L;  1I94 L;  4ALP A;  3TS2 A;  2KCX A;  1EQR A;  3PO2 H;  2QQC A;  2OTL A;  5JJK A;  1GD7 A;  1X74 A;  4DR1 L;  3HOZ H;  2IY5 B;  1M8C A;  1N13 A;  1EWI A;  4JI2 Q;  5M3F H;  1Y1B A;  5IP9 G;  2VQE L;  2QA4 A;  2B63 G;  2GVI A;  2ARP F;  3GTJ H;  4FDB A;  3AEV A;  1XPO A;  3OYY A;  1V1H A;  2WVJ A;  1NUB A;  4LF8 L;  4GI3 C;  4LFB L;  3CCV A;  1SFO H;  5BR8 Q;  1WJJ A;  2UZ3 A;  1VQM A;  3F8T A;  3BJI A;  3F2C A;  2YQP A;  1B7Y B;  1X6O A;  2SGQ I;  4YWK A;  1EOV A;  5FUV A;  2A19 A;  4GLV B;  1OXU A;  4DV2 Q;  2KCT A;  2K5N A;  2CWA A;  4X66 Q;  4PG3 A;  5M5Y H;  2MO0 A;  2QQ0 A;  1R79 A;  4LF6 L;  1R0R I;  4HJ9 A;  3BJU A;  4JBJ A;  1B70 B;  3J7Z C;  1U0L A;  2ELI A;  3L0O A;  1N32 L;  1HNX Q;  1UE5 A;  2ZTD A;  3DA3 A;  2IHE A;  1SE8 A;  2HIX A;  3AFP A;  5EX3 A;  4LF6 Q;  4NXN Q;  3UE1 A;  3KJO A;  1VQA A;  2AWO A;  4A3J G;  4JG2 A;  1L0W A;  3MEF A;  5FLM G;  4U6R A;  3A5U A;  4JI7 L;  2SGF I;  2RHQ B;  2ENN A;  2QPO A;  2E5R A;  3J80 i;  1DS3 I;  1NE3 A;  1PH3 A;  4A75 A;  2ATW A;  2V1C A;  2JA9 A;  4DR2 L;  3LGJ A;  1PVO A;  3ULL A;  3I55 A;  2XTQ A;  3PF5 A;  4LUZ A;  1N34 Q;  2VNU D;  3KJP A;  2AKW B;  3NEN A;  1SGY I;  3EN2 A;  4DUZ Q;  2K9H A;  2AHO B;  4C3H H;  5IYC G;  1M1K C;  1LR7 A;  1NTG A;  1VQG A;  2JJQ A;  5IY0 A;  1WOC A;  2YTY A;  2VQF Q;  3D0F A;  1XPR A;  1N34 L;  2QQD A;  1V9P A;  1YBY A;  4B3R Q;  4JI6 L;  3L7Z C;  4HGU A;  1VQF A;  4BY1 G;  2E2I H;  1LM0 A;  3KF8 B;  1YJN A;  4RMF A;  5C4X H;  1UE1 A;  3CXC A;  3OW2 A;  1IBK Q;  4JI4 Q;  3MEK A;  4X64 Q;  5HGI A;  4JI2 L;  1QVF A;  4PZ6 A;  4A3K H;  3CMA A;  1IXR A;  4DR6 L;  5C4X G;  2HQL A;  4DR3 L;  2K5H A;  4A3G G;  1PH8 A;  2N78 A;  2UUB Q;  3S1N H;  1VQE A;  5LMN W;  3S17 H;  1VDD A;  1ASZ A;  2L7X A;  5HGQ A;  1VQ4 A;  2R7Z G;  2FUG 1;  2HT1 A;  2F4V L;  4KHZ A;  1OTC A;  4LF7 L;  4B3T L;  3BZK A;  3K7U C;  1CSP A;  5J3B A;  4A3I H;  2CQO A;  3I56 A;  2NVT H;  4OX9 Q;  1XNR L;  4DWL A;  1OMT A;  2LXJ A;  5C44 G;  5JJL A;  2VUM H;  3F4M A;  1BKB A;  4A4I A;  3G6E A;  1BBU A;  3FKI G;  2KCM A;  4LF7 Q;  4L9M A;  1Z9F A;  3PDN A;  2WP8 J;  1KL9 A;  1YEZ A;  3CQZ H;  4A3F H;  3GTK H;  1NJI C;  2UU9 L;  4LNQ A;  2LXK A;  3M9B A;  4A3E H;  4JI1 Q;  4P75 A;  2JB3 A;  3W1B A;  2HHH Q;  1YU6 C;  3E0E A;  1EFW A;  5GAE C;  5JJI A;  1RL2 A;  4OAV B;  1VQH A;  3AFQ A;  4HJ8 A;  2BUS A;  3TQY A;  5FUX A;  1I6H H;  4PL3 A;  2JE6 I;  2OWO A;  5JEA J;  1DGS A;  4GNX B;  1TBR R;  2KMQ A;  1PH2 A;  1T9H A;  1E24 A;  1GO3 E;  2NN6 I;  3PUY A;  1JJC B;  4R4I A;  4DV7 L;  2R7Z H;  2WCY A;  4UP7 A;  1G51 A;  4AQY Q;  5FUY A;  3M85 A;  1Y1V H;  3OXG A;  2KMO A;  1KXL A;  2SGD I;  2UUA Q;  2E2J H;  3E2I A;  3K80 C;  3RLF A;  4JBK A;  4NB3 A;  5H1S E;  1HR0 Q;  2IHF A;  1Q1B A;  1X56 A;  1SGE I;  3EIV A;  3J81 c;  1SLJ A;  1KAW A;  2UUC L;  3UGL A;  4NXM Q;  2IX0 A;  5IYC H;  1OVO A;  2IT1 A;  4YCV A;  4JI6 Q;  4OXP A;  2NN6 G;  3PCO B;  2B0U C;  1TWC H;  2ES2 A;  2Q2U A;  5C44 H;  4QQB X;  3AJF A;  4DR6 Q;  4AS2 A;  2Y0S E;  2XTR A;  1I5F A;  3ULJ A;  2Q2T A;  4AS3 A;  1FVI A;  4DR3 Q;  4A3I G;  4BY7 G;  2ASB A;  2AWN A;  1PA6 A;  4B3S Q;  4MZ9 A;  2UXB L;  2N1A B;  3OVO A;  4UXJ A;  4OWX B;  2VZA A;  4L5Q A;  4GOP C;  3RLN A;  2LUY A;  4A24 A;  1X9N A;  4DV0 Q;  1SRO A;  3CC7 A;  3LJ1 A;  3SDJ A;  3PUV A;  3B6Y A;  4LFA Q;  4JCV E;  1HZA A;  1EYG A;  2ZRR A;  2NVX H;  2H5X A;  4DNI A;  3Q8D A;  1CKN B;  1E1O A;  4B3S L;  4IFD G;  2UXB Q;  1W4R A;  4A3D H;  4LFC L;  4A3M H;  4YZD A;  3HOU H;  2JA5 H;  1XMQ L;  2Z0S A;  4DV3 Q;  3RNU A;  1YJW A;  1E3P A;  5EX0 A;  3OTO L;  3SEK C;  2IP6 A;  1NMF A;  2ID0 A;  1HNZ Q;  2JEA I;  2GKR I;  3GOX A;  1FYB A;  2UXD L;  5K36 G;  4I1T A;  2K52 A;  4JI3 L;  3J81 i;  5IWA Q;  4X65 L;  2JZM A;  4BXX H;  1JT8 A;  2K75 A;  4IOC A;  3SGB I;  1J6Q A;  4O1P A;  1EIF A;  1YHB A;  1S3O A;  3CCQ A;  3U58 A;  2ZJP A;  1R9T H;  1CE3 A;  4QJF A;  1YZ6 A;  3TEH B;  2W0T A;  4IPH A;  5IWA L;  4X65 Q;  1YNX A;  4HIO A;  4LWC A;  5HI7 A;  5IYD G;  4JC0 A;  4GOP A;  2ZTE A;  5FLM H;  3I4M H;  4GKK Q;  2KKM A;  1YJ9 A;  2WFW A;  1C9O A;  3VDY A;  1UUC A;  4UP9 A;  4LUV A;  2XTI A;  4Y7N H;  2Z6K C;  2JXD A;  1SJ8 A;  1NMG A;  1HR0 W;  1UVF A;  2OD1 A;  5JHW C;  1FAQ A;  4NPS A;  4GLA C;  2FNF X;  2CFM A;  4X64 L;  1YVC A;  2B29 A;  2UUC Q;  3GTL H;  1K73 C;  1VQI A;  4JBM A;  2IX1 A;  4E1P A;  4DV4 Q;  4A3K G;  1Y1W H;  2JA6 G;  1SGN I;  1CSO I;  4DV6 Q;  1J5E L;  1XMO L;  2F4V Q;  4GNX C;  3W5O A;  4PZ8 A;  4JI5 L;  4GNX A;  1UVG A;  3HH2 C;  4DR4 L;  1UWV A;  5IT9 c;  5C0X I;  5CCM A;  2RIO A;  2I5H A;  1NBW A;  1YIT A;  5LNK 1;  1A62 A;  2DUD A;  4R4Q A;  4YHH L;  4OAU C;  1HZB A;  4AYB E;  4A3B H;  4JV5 L;  4YZC A;  1CKO A;  3M4O H;  2F3C I;  3UDX A;  1Q82 C;  2NU1 I;  4A93 G;  2A20 A;  4G75 A;  1X4S A;  1PV4 A;  2F6M B;  2DIP A;  1Q12 A;  3PUZ A;  2ZM6 Q;  1TUR A;  4L5S A;  2R7F A;  3CW2 C;  4IPD A;  1FAR A;  1MJC A;  4B3M Q;  1L1O B;  1IZ6 A;  2NZO A;  3U4V A;  1XMQ Q;  1PHJ A;  4JV5 Q;  1I3Q H;  4PL4 A;  2JEB I;  3KDF A;  3BU2 A;  4P71 A;  4POG A;  1A8V A;  4Q9V A;  4DR4 Q;  4OVO A;  1QZG A;  3FKI H;  5FJ8 G;  4R4T A;  3STB D;  4DUZ L;  4HJ7 A;  3IRB A;  3G71 A;  2JA7 H;  3I4M G;  2QGQ A;  3PGZ A;  4A3B G;  1XX6 A;  5AJ3 Q;  1SGQ I;  1U5K A;  1VCI A;  1JJ2 A;  4BA2 I;  1E7Z A;  3FP9 A;  2E5L L;  2Q2I A;  4DR7 Q;  2ERW A;  1LTL A;  1JB7 A;  4WJ3 M;  1BBW A;  4GKK L;  3CF5 A;  1TWH H;  1B8A A;  3G48 A;  3UDG A;  1D7Q A;  2E73 A;  3W1G A;  4DAM A;  1V1Q A;  2XGT A;  1KMA A;  4DV2 L;  4G76 A;  1G29 1;  3CCU A;  4JYA L;  2OQK A;  2PI2 E;  2V6E A;  4B3R L;  1BUS A;  1WYD A;  4MNO A;  5HY6 A;  2MNA A;  2GKV A;  4A3D G;  1H95 A;  1N32 Q;  2JYY A;  2JAE A;  4BY7 H;  1PCE A;  2V53 A;  1XJV A;  1EQQ A;  3UGI A;  3DLL A;  1VQD A;  2JA8 H;  1XMO Q;  1KHI A;  4OWT B;  3J81 j;  3I4N G;  2D0O A;  5GRO A;  4X62 Q;  1CKN A;  1IYJ B;  4BBS G;  4PMW A;  2MO1 A;  2D0P A;  3VE5 A;  5GQO A;  5M3M G;  1ASY A;  3HOW G;  4R1J A;  1FJG Q;  5C4J H;  2VW9 A;  4HJ5 A;  3OXL A;  2OTJ A;  3QWP A;  2VL6 A;  1IL2 A;  4X62 L;  3TS0 A;  3GD7 A;  4MTN A;  1TWA H;  4DV1 L;  3GTG H;  2B3G A;  4K0K Q;  2HIV A;  1HNW L;  2ALY B;  1PH7 A;  4BBR H;  3HKZ G;  1TGS I;  3S24 A;  2P6A C;  5C3E G;  1FJG L;  4A3C G;  2UXD Q;  2M5X A;  1L1O A;  2UU9 Q;  2J9R A;  1A63 A;  5IE8 A;  1Q7Y C;  2OCE A;  2MJF B;  3RN2 A;  2JA5 G;  4DV5 Q;  1HJP A;  1N33 Q;  1HZ9 A;  4O0A A;  5IP7 G;  4DUY Q;  1O7I A;  2UUA L;  4Y52 H;  1AE2 A;  1E22 A;  4GN4 B;  3UE0 A;  4A3L G;  1TBN A;  3WWV A;  3RN5 A;  3H3V I;  1GVP A;  4IO9 A;  1C7Y A;  3JAM i;  1X54 A;  3S15 H;  2DGY A;  1KRS A;  4UY8 C;  3A0J A;  4DUY L;  3H0G G;  4JI0 L;  3BZC A;  1N9W A;  3S1Q H;  1OYV I;  1Y1C A;  3U4Z A;  1RIP A;  2I0Q A;  4YCU A;  4H02 A;  1LYL A;  1Q1E A;  2PI2 A;  2YTX A;  2MQH A;  3SGI A;  4X66 L;  4A3C H;  3OXF A;  4DPG A;  4FKD A;  1JE5 A;  4JI8 Q;  3GO5 A;  3PSI A;  1HR0 L;  4QL5 A;  1IBK L;  2CCZ A;  3I7F A;  4JOI C;  3HOV H;  2JA8 G;  4JOI A;  1SGD I;  2GN5 A;  3CD6 A;  4JYA Q;  1XNQ Q;  2NU3 I;  4POF A;  1L2F A;  4NXN L;  5C0X J;  2F52 A;  1IY5 A;  5DAE A;  1K9M C;  5GAD C;  3K0X A;  4ME3 A;  4QGU A;  5LMU Q;  5ELO A;  4GXT A;  1IBM L;  3HOY G;  2N49 A;  4JI1 L;  4AH6 A;  1K83 H;  1OXT A;  1OXS C;  4UP8 A;  1QZH A;  4OX9 L;  1XNR Q;  2LEO A;  3FHW A;  3FBV A;  1VQ9 A;  2N3S A;  3TJQ A;  3CCE A;  5LMN L;  4KHP Q;  3HOX H;  1VQO A;  3F1Z A;  3RZD H;  2F66 B;  4A76 A;  1IBM Q;  2PQA A;  1P8L A;  1PFS A;  1K8G A;  2YU9 H;  4AIM A;  2ZM6 L;  1DS2 I;  1H0Z A;  3A5Z B;  4IPC A;  4Z7G A;  4OON A;  1MT1 A;  3P23 A;  1E1T A;  4PZ7 A;  2BH8 A;  4XTC S;  4DV1 Q;  1PTQ A;  2SGP I;  4GN5 A;  1VQC A;  2RCN A;  2JW6 A;  4IFD I;  2L15 A;  1HPT A;  2R93 H;  3H3V H;  2JK8 A;  2EXD A;  1X3F A;  3PV0 A;  2ZTC A;  4DV7 Q;  4LFB Q;  4KLK A;  2BH2 A;  4JBW A;  2RHS B;  2ZJQ A;  2V1C C;  2GVA A;  4GS3 A;  3K7A H;  2UUB L;  2VQF L;  3ER0 A;  2CWP A;  2R6G A;  2VQE Q;  2LSS A;  2KHJ A;  3I9V 1;  2MFI A;  3ERS X;  5FJ8 H;  3FC3 A;  1S72 A;  3HKZ E;  5IYD H;  2NVY H;  2KMR A;  3GDE A;  3PUW A;  2JB2 A;  2YV5 A;  3MXN B;  4RG1 A;  3UGD A;  3LJ0 A;  4GKJ L;  1IBL Q;  2WAQ E;  1CKM A;  3GTM H;  4DV6 L;  1J5E Q;  2VRW B;  2EQS A;  2K19 A;  4OO1 I;  4DAY B;  3T1Y L;  3RR5 A;  3S1R H;  3KLW A;  3M4Q A;  1CGI I;  2UXC Q;  4JI8 L;  3RLO A;  3PIO A;  4GLX A;  4JI5 Q;  4O2D A;  1C0A A;  4EQ5 A;  3D00 A;  3KOJ A;  3CME A;  1JJG A;  1CSQ A;  1EUJ A;  1XNQ L;  4DV4 L;  1TIH A;  1SN8 A;  1UE7 A;  4DK3 C;  3PO3 H;  2B8T A;  1JMC A;  1BVS A;  4LW1 A;  1KC8 C;  2YYZ A;  5JEA G;  3HOX G;  4IOA A;  4YY3 Q;  2JA7 G;  4QY7 A;  3IAM 1;  1NY4 A;  3JC6 6;  5M3F G;  4Z7H A;  3AYH B;  5IYB H;  4DR1 Q;  2E2H H;  4LFA L;  1SGP I;  2NU4 I;  2YUU A;  3PIP A;  5LMN Q;  2KEN A;  4C3J H;  4KHP L;  4IFD J;  4L5R C;  1WCM H;  1PH9 A;  2A8V A;  1VQN A;  4YCW A;  4X6A H;  5FUW A;  2Z6K A;  2QEX A;  4YY3 L;  1WCM G;  4QIW E;  4LF9 Q;  2B63 H;  1XTD A;  2JQO A;  1CT0 I;  1Q46 A;  4JI4 L;  5BR8 L;  2N8N A;  4BXX G;  2ORW A;  5AJ3 L;  3UDF A;  1AH9 A;  4NV5 A;  1YHQ A;  3KFU A;  5CCL A;  2K50 A;  3KF6 B;  1LR9 A;  1Y14 B;  4GN3 B;  1OXX K;  1CT4 I;  1V1I A;  3PO3 G;  1YO7 A;  4C3I H;  4B3T Q;  3S2H H;  2WAQ G;  3KY9 A;  1LUZ A;  4HJA A;  1MJE A;  3IAS 1;  4LF8 Q;  3TRZ A;  4YWL A;  3HOU G;  3ICE A;  3L2P A;  2YTV A;  4WJ4 A;  4AYB G;  2K5V A;  1CGJ I;  4NV2 A;  4LF4 L;  3KP9 A;  2JB1 A;  4HFV A;  2WB1 G;  1SRU A;  2CJS C;  3J80 c;  2N71 A;  4P72 A;  4YZ9 A;  4LUO A;  1VQP A;  3UDI A;  1PYB A;  1IY6 A;  1S40 A;  2K4K A;  5IP9 H;  3S1M H;  4UXI A;  2GVB A;  1HH2 P;  3I2Z A;  5E7N A;  4B6D A;  3PF4 A;  3S16 H;  1QUQ A;  1VS0 A;  3CP0 A;  4HIM A;  5LMU L;  1VQB A;  4HID A;  1KD1 C;  3E9I A;  1PYS B;  2RF4 A;  4DV0 L;  1HNZ L;  1Q86 C;  1VQ7 A;  3S14 H;  1TBO A;  1G6P A;  3L0I A;  4TQU S;  1KRT A;  2DB6 A;  3EBE A;  4B3M L;  1AE3 A;  3KYH C;  1KIX A;  1GM5 A;  3H0G H;  1V43 A;  2CKZ B;  4R4C A;  3T1H L;  4DR2 Q;  1PH4 A;  1UE6 A;  2ENZ A;  1HZC A;  1AN1 I;  1PJU A;  3SGQ I;  3TRE A;  1TBQ R;  3VDP A;  2L1L B;  1OXV A;  1HDL A;  3I4O A;  1YI2 A;  2EIF A;  1EIY B;  1VQK A;  1XA6 A;  2JA1 A;  3CCM A;  5GAH C;  4NXM L;  2KMP A;  1D8L A;  5M5W H;  1LR8 A;  1WFQ A;  2OQ0 A;  4DR7 L;  1K8A C;  4A3G H;  1PH6 A;  1UEB A;  2R92 H;  3UIT A;  1TWF H;  1Y1V G;  4UPA A;  3KF6 A;  1N36 L;  3HOY H;  2K14 A;  3NBH B;  4DV5 L;  1PH1 A;  3AQQ A;  1W3S A;  3NEL A;  2ZJR A;  1KBE A;  1A0I A;  3H15 A;  2F3I A;  3ULP A;  1PH5 A;  2XMX A;  2VS1 A;  1KQS A;  3HOW H;  3UEY A;  1N36 Q;  1L1O C;  1VQ5 A;  4UXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...