4JCVE

Crystal structure of the recor complex in an open conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
214
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQESEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein RecR
publication title An 'open' structure of the RecOR complex supports ssDNA binding within the core of the complex.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
total genus 51
structure length 214
sequence length 224
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02565 RecO_C Recombination protein O C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4jcvE02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jcvE01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4jcvE03
1LYLA 4MNOA 4RG1A 5BR8Q 2Q2HA 1UE6A 1LUZA 1TWCH 2XGTA 3A74A 3RN2A 1Q86C 2ES2A 1YJWA 1CUKA 4JBJA 1YEZA 4A3BG 1E22A 2VZAA 4X66L 2R93G 2UXBQ 3D31A 2WP8J 3UE0A 3JAMc 3HOYH 2E5LL 4BA2I 1VQCA 2N49A 4GN4B 3EN2A 4AYBE 3CC2A 1L1OA 4JI8Q 1Q7YC 4PG3A 1Q82C 4JI3Q 2D0OA 3EBEA 1A63A 4J15A 5IYBH 1FJGL 4DR4L 3FKIH 3NELA 3U58A 2B63G 1X54A 4OONA 3J81j 4IFDI 4Y52H 1HR0Q 1HH2P 4LF5Q 2JA7H 3PUYA 1E7ZA 3G4SA 1XPOA 4OXPA 4RMFA 4DV4L 2IY5B 4LF9L 4DR2L 2JA8G 1WI5A 4DR7Q 4B3RQ 4OWWB 5C4JH 1VQKA 2CQOA 4AQYL 3TS0A 3GTKH 4DUZQ 4DV3Q 3J81c 1IZ6A 2K5VA 1B7YB 4YHHQ 3GTGH 3HOZG 1I50H 4HJ7A 4GNXA 2JQOA 3KOJA 3UDIA 4BXXG 1PA6A 1K73C 5IYCH 1NY4A 3OTOL 4DV7Q 1YHQA 2UU9L 2B3GA 3CC4A 3GTPH 1N9WA 1N34Q 3RR5A 4IPGA 4Y7NH 2K14A 2AHOB 4BBSG 3J80c 4XTCS 1J6QA 3T1YL 4A3GG 3J80i 4DR1L 3CD6A 1OXUA 3HKZE 5ELNA 2YTVA 4JI0Q 5LMNQ 4JYAQ 2KBNA 1S3OA 1XPRA 1Q1EA 3OW2A 3H3VI 4A93H 4A3FG 1WYDA 1V43A 2AWOA 4KI0A 1CKOA 5IY0A 3CF5A 5C44G 3G6EA 3RLOA 2JA5H 4B3ML 3S17H 4K0KQ 2A1AA 3PCOB 4JI1Q 4C3IH 1B70B 4IJLA 3CCJA 5AJ3Q 1SR3A 4JI2L 3CCLA 4JI4L 5M3MH 3RZOH 5C4XG 3PUXA 1RL2A 3I56A 4JI5Q 1N32L 2WAQE 3UDGA 3U50C 3BU2A 3GD7A 3L0OA 2DUDA 3T1HL 3ER0A 1VQLA 4JV5L 2VS1A 4YCUA 3W1GA 3CCQA 4X62L 2YU9H 1X3EA 1S72A 2HIXA 3K0XA 1M90C 2VQEL 1PV4A 3CAMA 4X65Q 4A3DG 1CKNB 3ERSX 3KF6A 2N78A 3BJUA 5IP7H 1MJEA 1L2FA 4LWCA 3S1RH 2BA0A 1N33L 3PO2G 1VQDA 1IBMQ 1SN8A 4O0AA 3W1BA 2PQAB 1GD7A 1KRSA 4BBRH 4DAYB 1WCMG 3I4MH 4GKJL 1TWAH 1Y1VG 3SGIA 4IFDG 3AQQA 1SMXA 1QUQB 1FVIA 3PSIA 2UUBL 4LFCL 3F2DA 5C3EH 5C0XI 1OXSC 4B3SQ 3TRZA 5JJLA 4DK3C 1HR0W 2C35B 3IRBA 2AMCB 2PNHA 3BZKA 4LUZA 1HNXL 2E2HH 5JEAG 1SE8A 5LMUL 1XNRQ 1VQBA 1NE3A 1HNZL 1XMOL 1B8AA 3F2BA 1C7YA 4B3TQ 4A4IA 4A3CH 3AFPA 3HOVH 1YIJA 4X6AH 2NVTH 2NZHA 3S24A 4DV6L 4LF6L 5K36G 5JJKA 1Q1BA 3G71A 4GN3B 2R92H 5IWAQ 2VW9A 1EIFA 4HIMA 3JC66 2BH2A 1RIPA 3AEVA 4L5TA 1EFWA 2FXQA 4R4IA 1P8LA 3E9HA 1QZGA 1IBLL 2EXDA 1VQJA 4YY3Q 3CCVA 3M7NA 1I6HH 2WB1E 1YI2A 1P16A 2Y0SE 2CWAA 1E1OA 3L7ZC 1WFQA 3I2ZA 1K0RA 2PI2E 1A0IA 1KAWA 1J5EL 4A3MG 1VQHA 2QEXA 2BH8A 3M3YH 1X6OA 1NMGA 4A3EH 4JOIC 4JI7Q 5LMNW 3RN5A 1FGUA 2OCEA 4UY8C 2ASBA 4R4OA 4DV2L 3HOYG 3K81C 3ULLA 4A3KH 4X66Q 5EAYA 1TXYA 1X3FA 4QL5A 3W5OA 2VUMH 2N8NA 2E5LQ 3K7UC 3CCMA 4R4CA 1PH7A 1EIYB 4L5SA 3FKIG 1VQOA 2F4VL 4AH6A 4A3IH 2NVQH 1AE2A 2Z6KC 3HFZB 3K7AH 1NJIC 2JA7G 4HJAA 4ALPA 2B29A 4DUYL 1IBKL 1FJGQ 4DR4Q 5IYDH 1VQ5A 1Y14B 5ELOA 3TREA 4JBMA 1LTLA 1QZHA 3STBC 4IFDJ 1BBWA 2GN5A 4R1JA 2EIFA 4PZ8A 2GVBA 2JA6H 1K8GA 5BR8L 3M85A 4BY7H 4JI6L 4DV4Q 2Q2UA 1MIUA 1BVSA 2ZTCA 1XMQL 2ZM6L 4LF9Q 4DR2Q 2AKWB 2JA9A 3S1MH 1GKHA 4NXML 1Y1WH 1K83H 3GTOH 3U4ZA 2F3IA 1SRUA 5JEAJ 4DKAC 3CCEA 2R93H 2MFIA 4NPSA 5IP9H 3I7FA 4JI8L 4A3JH 5IYCG 2VY3A 4JI3L 3Q8DA 4AIMA 3HKSA 3ICEA 3DLLA 3H15A 5C0XG 2HT1A 2I0QA 1NMFA 3OTOQ 1VQGA 1HR0L 2UU9Q 4QJFA 4LF5L 2WB1G 3S15H 4IJHA 4QY7A 1NTGA 2IHFA 3F8TA 5FLMH 3L2PA 4HIOA 1X65A 4LW1A 1PH1A 3T1YQ 1I94L 1YZ6A 2IHEA 1JMCA 4DR7L 3FHWA 2XTIA 3AYHB 4IPDA 4GS3A 2DGYA 2JA5G 4LF7Q 3I4OA 1PFSA 3M4PA 4HJ9A 4UP7A 1VQ9A 2IT1A 4DUZL 3S2HH 1IYJB 3RNUA 4JBWA 1VQNA 1PH2A 4YHHL 2UUAL 4B3MQ 3GTJH 4BY1H 1PHJA 1Z47A 5M3MG 3A5UA 3PGZA 2CCZA 3ULPA 1TWHH 1PH9A 1N34L 4FDBA 1Q12A 2MQHA 1VQ6A 3CP0A 2NZOA 4AYBG 2E2IH 2HHHL 2IX1A 1N32Q 3STBD 3A5ZB 4A76A 2UXCQ 4UP9A 3K80C 1YITA 4JI0L 3J7A5 1OXVA 4BBSH 2AWNA 2QGQA 2UUCL 1W2BA 2K4KA 4LFBL 1I5FA 1JJGA 4DR3L 1PH5A 4C3JH 2K52A 3PF5A 5IP7G 1VQ7A 1E24A 4H02A 4JBKA 1CSQA 2OQ0A 4LFAQ 3CCUA 4DR5L 4P74A 1UE1A 4OWXB 4DPGA 2CWPA 2WFWA 4JG2A 1JJ2A 1N33Q 3U4VA 4TVAB 5M3FH 4HJ5A 4IPHA 1KC8C 1CKNA 3OYYA 4BBRG 5DLQE 4DNIA 3E9IA 1BBUA 4JI5L 5M5WH 4DV5Q 3NBHB 1LM0A 4ME3A 3GTQH 4OX9Q 1A8VA 3UDXA 2YTYA 1MJCA 2MO0A 4R4QA 5C3EG 4GKJQ 2ZTDA 1R9TH 4LF8Q 1YBYA 2PQAA 2HQLA 4TQUS 2NN6I 2A19A 3AFQA 3RLFA 3KDFB 5C0XJ 4MZ9A 3WWVA 1QUQA 1SFOH 1EQQA 4HIKA 3HKZG 1HNXQ 4A3CG 1G51A 3FP9A 5LMUQ 3HOVG 4UP8A 4LNQA 4IOAA 4GOPC 1XMOQ 4NXNL 1QVGA 4A3LH 5FJ8H 2R92G 1Q8KA 4P71A 3I4NH 3ZJYC 2R7ZG 4DV6Q 3K8AA 4LF6Q 3KLWA 2KHIA 2UXDQ 2RHSB 4X64L 2CFMA 2LXJA 1VQFA 5HY6A 1WOCA 3HOUH 1HNWQ 2NVXH 3TS2A 4KHPL 2JK8A 2YV5A 2L15A 1PH4A 1IBLQ 1L1OC 2E2JH 1TWFH 1YHAA 3HOXH 5GROA 1QVCA 3E0EA 3KYHC 4O2DA 2WAQG 3ULJA 3UDFA 2VQFQ 1HJPA 4QQBX 4DR6L 1U5KA 3KFUA 1N36L 3PF4A 3GDEA 4BA1I 3RLNA 1VQPA 2Q2TA 2VNUD 1Q81C 3I4MG 4KHZA 5GQOA 4A75A 3RZDH 1YJNA 4LF4Q 4IO9A 4A3KG 4DV1L 2ZJQA 2JE6I 3S1NH 1K8AC 3M4OH 4JC0A 1JT8A 4DV2Q 3H0GH 5GAEC 2VUMG 3BZCA 2Z0SA 1XTDA 1E3PA 3CQZH 3EIVA 1S40A 1G291 4HIDA 3PO3H 4A3IG 3MEFA 4GKKL 2I5HA 2QA4A 2RHQB 5IYDG 4GNXC 1EUJA 5IYBG 3S1QH 3PUVA 2F4VQ 1X9NA 4GOPB 1HZ9A 2ALYB 1IBKQ 4JCVE 4DUYQ 3I55A 2JA6G 4BY7G 2YYZA 1VCIA 2JJQA 4DV0L 1HZCA 1XNQL 1L0WA 3TEHB 1KIXA 1AH9A 2Q2IA 1PH3A 3HOWH 3H3VH 2JEBI 1O7IA 2V1CC 3KF8B 4JI6Q 1Y1WG 1XMQQ 3M9BA 2ID0A 2ZM6Q 4GLXA 3CW2C 1L1OB 1KRTA 3NENA 5JJIA 5IP9G 2UXBL 4OO1G 4MTNA 4NXMQ 4A3JG 1EYGA 4AQYQ 1QVFA 4A3BH 1VQEA 3JAMi 2BA1A 1AE3A 4L5QA 2D0PA 4XIGS 3KJOA 3PIOA 4P72A 3CCRA 1UE5A 1YNXA 1KL9A 3PV0A 1CKMA 4L5RC 2IX0A 4GLVB 2NN6G 5FLMG 1EWIA 1A62A 4DK6C 2Y0SG 1CSPA 2K5NA 1VQAA 2ZJRA 4OWTB 3VDYA 2B63H 1U0LA 2MNAA 4JOIA 3CMEA 4YWLA 1I94Q 1JE5A 1X56A 4DR1Q 4A93G 3F1ZA 1YVCA 2OWOA 1IL2A 4B3RL 1KXLA 4GNXB 1PVOA 1C0AA 4BY1G 1NBWA 5GAHC 4DV3L 1KQSA 2JA8H 2PI2A 2PMZE 1SLJA 2UUAQ 3J81i 1FL0A 4NB3A 3A0JA 1KD1C 1VQ8A 1N8RC 1EQRA 4JI2Q 3HOZH 3F2CA 1IXRA 2Z6KA 4R4TA 4DV7L 4HJ8A 4JI4Q 5E7NA 5M5YH 1KHIA 4BXXH 5IT9c 2R7FA 2RCNA 1E1TA 2OQKA 2HHHQ 3S2DH 1BKBA 1OXTA 5H1SE 2ZJPA 3T1HQ 4JV5Q 1UEBA 2K50A 4EQ5A 2KCTA 4X62Q 1H95A 1X55A 5LMNL 4LF7L 4JYAL 3D0FA 3CMAA 2UUCQ 4A3GH 4LFBQ 2VQEQ 4DR3Q 3DM3A 4LUVA 4APVA 1UE7A 4WJ3M 4PZ6A 4K0KL 1V9PA 1VS0A 1W3SA 4KLKA 1V1QA 3GO5A 5M3FG 4A3FH 4JI1L 3UE1A 2KCMA 5AJ3L 4DR5Q 1TWGH 5C44H 1VQMA 1SROA 5GADC 1ASYA 4IOCA 3M4QA 1OTCA 4OO1I 3PIPA 5IE8A 2LSSA 5GAGC 2UXCL 1C9OA 1PYSB 2OTJA 5C4XH 4YCWA 2EQSA 3KF6B 2UUBQ 2YTXA 4LFCQ 1PH8A 1G6PA 4POFA 3G48A 4POGA 1M1KC 1ASZA 4X65L 2I5LX 1K3RA 2N3SA 3CCSA 4C2MH 2MO1A 5FJ8G 4A3LG 4LFAL 1I3QH 3I4NG 4C3HH 1HNZQ 3CPFA 2K5HA 3KDFA 4A3DH 1T9HA 4P73A 4UPAA 4NXNQ 4QGUA 3HOUG 4P75A 2ZTEA 2RF4A 4DV5L 1PH6A 1GM5A 1IBML 2OTLA 3S16H 4EX5A 4X64Q 1YJ9A 4OX9L 2HIVA 3J7ZC 3PO2H 4LUOA 3HOXG 2D62A 4PZ7A 4LF8L 4WJ4A 4YWMA 4KHPQ 2KHJA 3NEMA 4DAMA 1WCMH 1Q46A 4B3SL 1Y1VH 2R7DA 1EOVA 1UWVA 4DR6Q 1XJVA 2A8VA 4QIWE 1N36Q 3MXNB 4GLAC 4PMWA 3CXCA 4A3EG 1J5EQ 1DGSA 1OXXK 1MKHA 3B6YA 3LGJA 3CC7A 2F52A 1JB7A 1WJJA 1XNRL 3GTMH 4B3TL 2JEAI 1D7QA 5HGQA 3H0GG 4GN5A 1Z9FA 4YCVA 3S14H 2UXDL 1GVPA 3GTLH 4DV1Q 1XPUA 2KENA 3CPWA 3PUWA 1JJCB 5IWAL 3PO3G 1HNWL 2R7ZH 1HZAA 1PYBA 1D8LA 2E8GA 3KJPA 2H5XA 2I5MX 4YY3L 4GKKQ 2VQFL 1YHBA 1X3GA 1VQ4A 2LXKA 4YWKA 5FLXc 2R6GA 1VQIA 2ATWA 1K9MC 2GVAA 4IPCA 3HOWG 3TQYA 5J3BA 2K75A 1GO3E 2NVYH 4DV0Q 1XNQQ 2CKZB 5M5XH 1HZBA 4JI7L 4A3MH 4LF4L 2VL6A 4GOPA 3PUZA
chains in the Genus database with same CATH superfamily
4MNOA 2Q2HA 2XGTA 4OL7A 1MJ9A 2HDMA 4C1NI 1STHA 2ES2A 4A3BG 3ND9A 4OIJA 1E22A 1G2SA 2VZAA 2NU4I 2WVJA 1YO7A 2WP8J 3JAMc 4DAPA 1DYQA 1R4QB 2E5LL 2RC4A 3HGBA 3QWNA 4YZDA 3EN2A 1EL0A 3FKIB 4JI3Q 4PG3A 2O5IC 1EWHA 4RH6A 3LX0A 2XTQA 2XSCA 4NKLA 1X54A 3VR3A 4N9PA 4RHSA 1CT2I 1HR0Q 3E59A 1FAQA 3OMCA 3PUYA 1ZKOA 3QOLA 4DXGA 2BL8A 4LF9L 1AW7A 3BYYB 4DR2L 4DR7Q 4B3RQ 3PQIA 1X3QA 5FKAC 4B08A 5C4JH 2CQOA 1KBEA 3UI2A 3GTKH 2B39A 4DV3Q 4B6DA 3GTGH 2FU2A 5DM63 1SE4A 3HOZG 2Z8LA 2JQOA 3MAQA 3UEJA 2N17A 5D65A 3OTOL 3S2DB 1V1PA 3GTPH 3NHHA 1F9SA 3RR5A 5C0XH 1LTGD 1TVXA 2M9VA 1LLRD 2NTSA 3MVVA 1B1ZA 2V1CA 5HGTA 1WTQA 1D1IA 5HI7A 1Q1EA 1EEID 5FUVA 1Y1CA 4A3FG 4EQOA 2K5WA 2JA5H 4K0KQ 3VA5A 3G6EA 3RLOA 3SK4A 3S17H 1EYAA 5E1FA 4C3IH 1TR5A 4JI1Q 5M3MB 5AJ3Q 1GUWA 5C4XG 4ZKCB 1N32L 2WAQE 2YU9B 2ORWA 2SDFA 3L0OA 4RCNA 3T1HL 1YNJC 2A69C 2JXMB 2K5QA 2ZXRA 4X62L 1S72A 2B2YA 3EROA 1IKLA 1M90C 2VQEL 3TN2A 3Q6SA 1SAPA 2Z9HA 5IODA 5CV7A 2ZT9C 4A3DG 1CKNB 1W6KA 2IPKD 3KF6A 3BJUA 3M7GA 1IY5A 2A6ED 2NU2I 3S1RH 2BA0A 1N33L 3PO2G 2PQAB 1KTKA 3FPPA 1SNPA 2RSOA 1ZEQX 1WCMB 4IFDG 3CU7A 1Y1VB 1QUQB 2IP6A 1FVIA 4H44C 4M8AA 4NP5A 1SMYC 5C0XI 4B3SQ 2B2TA 5JJLA 2Z4HA 4ODGA 3Q24A 1HR0W 1OMUA 3IRBA 2AMCB 2PNHA 1Y8FA 1AN1I 2ZW3A 3S14B 1DJRD 4A3CH 3AFPA 1IKMA 4X6AH 5K36G 3FVQA 2R7ZB 2R92H 1EIFA 3JC66 3FSYA 4HFVA 3I73A 2FXQA 2BDNA 1P8LA 3CCVA 2WB1E 2PW5A 1WFQA 4N9TA 5LNK1 2PI2E 2QDLA 5M5XB 4A3MG 1V1HA 1VQHA 2L0CA 2KMPA 1MHWC 2BH8A 3M3YH 1F2YA 4JOIC 4JI7Q 3RN5A 2PW7A 2MJ8A 2TMPA 2Z6BA 3VDUA 4A3KH 4A3IB 3CCMA 1TIHA 3FSXA 4XT1B 1VQOA 2F4VL 4AH6A 2F0JA 2Z6KC 3HFZB 2RDFA 1NJIC 4HJAA 4XDXA 2M00A 4ZYSA 4ALPA 1FJGQ 2JA7G 4MPIA 3U9SA 5ISRA 1QZHA 3STBC 1K8GA 1BVSA 5C4JB 2ZM6L 2EYLA 4R8NA 2PYKA 3H09A 3FRPB 1B3AA 5DM73 5KNBA 3GTKB 1XBTA 2ERWA 4O1OA 5ELFA 3GTGB 1PTQA 1E2VA 4NPSA 4JI8L 1QNKA 2SOBA 3NTHA 3DLLA 3GTPB 3NTKA 4M1UB 3IKJA 1K7UA 2UU9Q 4LF5L 4KY7A 3S15H 1CZWA 1NUBA 2XRQD 3M4YA 2IHFA 3F8TA 4HIOA 3QB3A 3T1YQ 1I94L 3NWSA 1K8MA 5IGGA 2XTIA 3AYHB 4LF7Q 4GS3A 2DGYA 3I4OA 2JA5B 4XQQA 1SJHD 2CW0C 1VQ9A 3S17B 4DUZL 1IYJB 4C3IB 1PH2A 1PTOH 2UUAL 3MEKA 2WV6D 5EGTA 2Z1CA 1Z47A 4HMIA 2CCZA 1PRTC 1TWHH 2WACA 4N8FA 1Q12A 2E2IH 2IX1A 1DCZA 2BOSA 3MFYA 2B2WC 4C3JB 3J7A5 4H7BA 2F0HA 4LFBL 3PF5A 2HUGA 4V0BA 4OELB 4K6LA 3P1HA 2XRSD 3S1RB 4H02A 5EPKA 4E1RA 1CSQA 4LFAQ 1XPUA 4P74A 1H9SB 1HTLD 2BE5D 4OWXB 4DPGA 5M5WB 3CRLC 4RGNA 2O2LD 4Z7HA 1KC8C 4DNIA 3I4MG 1Y1BA 4RGOS 1LM0A 3HH2C 2JN4A 1TS5A 4OX9Q 3UDXA 5C3EG 4GKJQ 2PQEA 1SNCA 2EZVA 4LF8Q 2ELIA 4ZUJA 5IOCA 4G4KA 2IW3A 1U4MA 4IQZA 4RHRA 1U9RA 3WWVA 1EQQA 3NQIA 4HIKA 3HKZG 1HNXQ 1PRTB 1NNXA 4F7XA 1QVGA 5FJ8H 3NPPA 1Q8KA 2EYHA 2R92B 4DV6Q 4LF6Q 3QWPA 3LNNA 3HOUH 2P5ZX 3E6ZX 4CDDC 5M9OA 4LAAA 4KHPL 2F0FA 3ERQA 2L15A 1PH4A 2E2JH 1L1OC 3UEYA 1I4RA 5GROA 4QQBX 1WGCA 1U5KA 2FMCA 4NV2A 3M3YB 4OVOA 4X3UA 3GDEA 1ESFA 3RLNA 1ICFB 4KHZA 3D6CA 3RD4A 3LWEA 4KD4A 3RZDH 1B4OA 5HQ8A 3CKIB 4DV1L 3S1NH 4A3KB 4Z9CB 5GAEC 4DF7A 5K36H 2QQDA 1E3PA 3S1QB 3OL0A 5J8FA 4GKKL 3FVVA 2WKCA 2I5HA 2QA4A 2MUYA 5IYDG 1PTOC 2QSBA 2A2CA 4DUYQ 1KMAA 3BZDB 4RA8A 3I55A 3HOWB 4O1NA 4U6RA 2JJQA 3TEHB 2RDGA 1LTTD 2Q2IA 4PNYA 3CRKC 2NU3I 1F2MA 4UXIA 5BN3A 5FOBB 4GLXA 3OMGA 1L1OB 1RJTA 3NENA 7WGAA 2UXBL 1VQEA 2BA1A 1AE3A 1MGSA 3QO2A 4XIGS 4KJOA 3VYTA 4IUNA 1GXDC 3PV0A 2LEOA 4L5RC 1F2LA 2NN6G 1MJBA 3S15B 4L6TB 4DK6C 2K5NA 3OHXC 2B63H 2MNAA 2OZUA 3JAML 3AMUA 2SGEI 1T5XD 3F1ZA 1B3QA 4OAUC 1UEAB 4IALA 1I4GA 2IJ0A 5IGDA 1PTOB 1C0AA 4BY1G 5FUWA 2JA8H 1STNA 1ZXTA 1CA5A 1RHPA 4IUTA 1YTPA 3UOEA 1GUGA 2LMCB 4UXJA 3D4WA 4R4TA 4DV7L 2E2IB 5M5YH 3EA6A 1E1TA 2HHHQ 2A6HC 3D3RA 3BYTB 5H1SE 2EJGC 5ELEA 2LUYA 4JV5Q 1PRTF 2K50A 4EQ5A 3J7AV 1H95A 3J81E 3DM3A 1XTCD 5CYUA 2F0DA 4A3FB 1UE7A 3TDQA 4PZ6A 4WJ3M 3SK8A 1VS0A 1V1QA 3GO5A 5M3FG 2DNCA 1DS2I 2KCMA 2CH4W 4DR5Q 5C44H 3N6RA 1P9ZA 1EY9A 3R5BA 4Q0FA 1JQYD 4OO1I 1FD7D 2LSSA 1YNNC 5C4XB 1Y69U 1PYSB 4DXFA 2OTJA 4DWLA 3A56A 1QG7A 1BUSA 2X6LA 4XQJA 2DY7A 4LFCQ 3BJIA 3Q22A 1G6ZA 1VF7A 3FC3A 3BS1A 2I5LX 1K3RA 4X3KA 1DD2A 1IW7D 2X6GA 2BCOA 2HQEA 1I3QH 2NB0A 1JORA 2P22B 3FNBA 2AQ3B 3CPFA 2RBMA 4UPAA 4NXNQ 2F0EA 4DV5L 1GM5A 3HOUB 3PO2B 2PMZB 4PV1C 4DFAA 2HIVA 3HOXG 2E2JB 2D62A 2B0UC 4RGTA 4JW0A 4YWMA 2KHJA 3OXFA 2XWBB 2R7DA 4WRDA 4PMWA 4LMQD 5CV9A 1MKHA 3RZDB 1D7QA 3VE5A 1Z9FA 3MXUA 1ULKA 5COYA 2OVOA 2QGMA 1HNWL 5E3PA 1HEVA 3R93A 3QJYA 2ODDA 2UVOA 4QCLA 2I5MX 4YY3L 1BCPD 4H13C 1D5MC 3MHBA 2XN9C 1N13A 1VQ4A 2LXKA 1D5ZC 2RADA 2ATWA 2NVYB 4XQNA 3SEKC 4RKLA 3P7JA 4A3MB 1XNQQ 1HZBA 1PTOF 1A2TA 5EQ0A 2KUMA 1PZKD 1SNDA 2EVBA 1Y8PB 2W0TA 1UE6A 1LUZA 1Q86C 3KUPA 5JOBA 1QWYA 2RCFA 5C4ZA 2R93G 4KKUA 3NQTA 3D31A 3OWEB 5JJZA 4BA2I 3A8JE 1SGNI 2QZGA 1TBOA 3NUCA 4ZKBB 4AYBE 1Q7YC 5A2QL 1WTPA 1CQVA 2EDGA 4J15A 4DR4L 2GKVA 4ZUIA 3ND8A 3FKIH 3SVMA 3NELA 4MTKA 2L11A 2B63B 4YZCA 5AFWA 4QF4A 2EPBA 2MP1A 1XPOA 1U4RA 1WI5A 2JA8B 2GKRI 1UAPA 3X3NA 3D8GA 1O80A 1WVLA 5EPLA 1Y8NB 1B7YB 1Q90A 2A6EC 3TSSA 4GNXA 2QQCA 5CBAE 2O4XA 5M5YB 4BXXG 1PA6A 1K73C 1SDFA 3F2UA 5IYCH 4FF4A 1F9PA 1YHQA 2F0OA 3GP7A 4MIUA 1N34Q 3SK6A 5DAEA 2K14A 3GV6A 2AHOB 4BBSG 1O7ZA 4XTCS 1J6QA 1Z7KB 4DR1L 3CD6A 3URYA 4UDUC 3D4RA 3OW2A 2EYPA 3H3VI 1NR4A 2XRCA 2LKVA 4B3ML 5IY0A 3CF5A 1KABA 2JB1A 4KHVA 1KBFA 1SR3A 1JOOA 1GHJA 3NBIA 5CGKA 4JI4L 3J80L 5M3MH 2JW6A 3I56A 5J8CA 1EY7A 1LT5D 2LY7A 2DUDA 4UAIA 1GJXA 2ETDA 2YU9H 2HIXA 1CA6A 1SEBD 4TSSA 1NXUA 3V2TA 1B2TA 2L9HA 2RIJA 1I4XA 4C3HG 4RFBA 3ERSX 5IP7H 1MJEA 1SGRI 1L2FA 1IBMQ 1SN8A 3I4MB 2PPBC 1GD7A 1ZYRC 3CHBD 2I46A 3G7LA 1I4QA 5C3EB 3EJIA 3SGIA 3AQQA 3KLRA 3PSIA 2UUBL 4L9MA 2PQ8A 3F2DA 1OXSC 4TKOB 5G3LD 3IL8A 4DK3C 4K5VA 2C35B 1SJ8A 1EYCA 4DU9A 4ZLTF 5LL6X 1VQBA 1XNRQ 5C5MA 3MEHA 3F2BA 1C7YA 4A4IA 2WKDA 3R2IA 4DA2A 2NVTH 1BXTA 5JJKA 4OGQC 2QQEA 3VR6A 3G71A 2N1AB 4KKTA 2VW9A 4HIMA 2SGQI 3AEVA 1RIPA 1VDZA 4L5TA 2F3CI 2L55A 4R4IA 1IBLL 1I6HH 2EXDA 1VQJA 3PDNA 2F0VA 3GOXA 1M8CA 2JB2A 1LACA 1JICA 2F0SA 1E1OA 2NU0I 2VB2X 2F0UA 3SGQI 2ICEC 1SGPI 1JWSD 3TP5A 1AN8A 1BBXC 2XWJB 4G57A 2QEXA 4NDXA 3GQBA 3UITA 2OCEA 1V1IA 3Q23A 3NSWA 4ME5A 2D5DA 5KYLA 4DV2L 2F0NA 3VDPA 3HOYG 3ULLA 1UVGA 1RTNA 5EBDA 5EKIA 2VUMH 1RFHA 5A35A 2E5LQ 3K7UC 1CT1D 3BDOA 1HPCA 4R4CA 4A3IH 3K7AH 4G7HC 2A74C 3MC0B 4CDEC 2B29A 1IBKL 1PCEA 2GIVA 2JAEA 3DWPA 1H9MA 3TREA 4LJZC 4JBMA 4R1JA 5CV8A 4KK7A 3I70A 1KDAA 2KKMA 1MIUA 2ZTCA 3E0JA 2FMMA 4LF9Q 4DR2Q 4G75A 2XIWA 1A3TA 2JA9A 4KY6A 1NCVA 3GV3A 1K83H 3GTOH 2F3IA 1D2BA 2DJFC 3NXWA 5JEAJ 2R93H 3R3OA 3KY9A 4OAVB 5IP9H 2NUCA 2VY3A 4JI3L 4QUCA 3Q8DA 4HTHA 1VMCA 2BE5C 3ICEA 3H15A 9WGAA 2I0QA 1NMFA 4KV6A 3OTOQ 1VQGA 4ZAIA 1HR0L 1EY5A 1EEFD 2PCFB 1FY7A 2WB1G 1NUCA 1F9QA 4QY7A 5FUXA 1PH1A 1X65A 4RAUC 5I9PA 1TS4A 1YZ6A 2JSOA 5IGFA 2IHEA 3JAME 1ESRA 3DM1A 4G7ZC 4DR7L 3R5CA 1PFSA 3S2HH 4BY1B 1TIID 1M8AA 5KGUA 2JYYA 4Z7GA 1PH9A 1N32Q 2NZOA 4AYBB 2RDHA 1SGEI 4A76A 3X3MA 2A68D 3K80C 2K01A 4BBSH 2QGQA 1I5FA 4C3JH 3OXGA 1EWCA 4KN4C 2GVIA 1HHVA 4B9WA 1S5BD 3CCUA 1XWEA 2CWPA 4JG2A 5C3WA 1N33Q 3U4VA 1VMPA 4IPHA 3OYYA 4BBRG 5M5WH 4WORA 1C48A 3E5SA 4ME3A 4J6HA 2F4IA 1BDOA 2MO0A 4R4QA 1R9TH 5E4XA 4NW2A 4TQUS 1SYGA 4GI3C 4DAYA 4R9WA 2EY2A 4DGZA 3BVGA 5C0XJ 2CWGA 1R79A 1Q3LA 1SFOH 1G51A 3BVMA 3FP9A 3T53B 3HOVG 2NVTB 2N55A 2RQXA 2OD1A 1PDQA 1D5XC 4P71A 2RIOA 1JC7A 1HFNA 4X64L 3LWUA 5HY6A 1VQFA 1WOCA 1I6HB 1HJAI 2NTTA 5E3FA 3HOXB 3I3CA 2RVLA 2QPOA 1L0YB 4KTAA 1YHAA 4FP5D 1QVCA 3E0EA 4O2DA 5LL6S 1B9NA 3KFUA 4KMUC 1N36L 1LT6D 4BA1I 1LTBD 2VNUD 3KP9A 5GQOA 1YJNA 3Q0AA 3HRZC 2ZJQA 2JE6I 3M4OH 1K8AC 4FF1A 1JT8A 2KEDA 3BZCA 2Z0SA 2VUMB 1XTDA 2KHSA 5C5LA 1AP0A 3IFDA 3CQZH 3EIVA 1G291 1JR0D 3MEFA 4I1TA 3S1QH 3K7AB 2F4VQ 2Z4IA 1X9NA 1CT4I 4ABNA 1IYVA 2QILA 1DXMA 2JA6G 1BQQT 4BY7G 4DV0L 1HZCA 5C4HA 1PH3A 5FUYA 3HOWH 1O7IA 2V1CC 5HGIA 2LB7A 2O5JC 1Y1WG 3W3AA 2GA4B 1GUTA 2DY8A 2F0MA 1K83B 2ZM6Q 3GTOB 1TDPA 1BO0A 4OO1G 2DJGC 4MTNA 2R93B 4A3JG 1EYGA 4AQYQ 4A3BH 5FLXE 2LS01 3JAMi 1TBNA 2KMRA 4L5QA 2YQPA 4FO2A 1HTPA 1YNXA 1JB3A 2IX0A 3BG3A 3L9AX 4KY5A 5FLMG 5C6AA 1A62A 4U673 2Y0SG 1CSPA 5EBCA 2ZJRA 4OWTB 5ELBA 4YWLA 2B2YC 1I94Q 5CMDA 4A93G 3S2HB 1KXLA 4DAVA 1QOHA 3B55A 1NBWA 1KQSA 1IW7C 1H9JA 2PI2A 2PMZE 5EKKA 1HUNA 2UUAQ 1V1PB 1A15A 5J22A 3OOCA 5IIFA 4XYQA 1EY6A 1VQ8A 2CHBD 1RF2D 4JI2Q 3HOZH 2CQAA 5E7NA 4Q5VA 3VYSA 4JVZA 1PXUA 1PTRA 3VA7A 2OQKA 3TOAA 4BBSB 4PMCA 1UNSA 4TRDA 5HURA 1WD1A 4QUFA 3I72A 4IUPA 5LMNL 4LF7L 4JYAL 3D0FA 3CMAA 4LFBQ 3OVOA 4DNTB 1HXYD 4XT3B 5BN5A 1FR3A 1W3SA 1TWGB 1FYBA 3S9WA 1DM0B 4A3FH 4PMBA 4G7OC 1WTOA 1NAPA 5GADC 5IT9L 1HFGA 1B53A 3J80E 1OTCA 1BF4A 5GAGC 4A24A 1SXTA 1K0SA 1R9TB 2YUUA 2NWGA 5C4XH 4YCWA 2EQSA 1BCPC 4ZCKA 3KF6B 3NBHA 1SFOB 3G48A 1HQRD 2NZ1D 4X65L 2J9RA 3CCSA 2N3SA 3K5NA 4A3LG 1B50A 5TSSA 4LFAL 3I4NG 2CVRA 3TP8A 1HNZQ 4A3DH 3BDCA 3KDFA 2Y0MA 1LTID 1T9HA 4P73A 4QB4A 3S16B 4QGUA 1S20A 4P75A 3MZ5A 1NSNS 1PH6A 4EX5A 4OX9L 3J7ZC 3PO2H 2F0PA 3FMCA 4LF8L 2EY5A 2Q8RE 4KHPQ 2B2UC 4IFDH 2F0WA 1AZPA 5IGCA 2L1BA 2F3WA 3CXCA 1J5EQ 3UFFA 1DGSA 1OXXK 3B6YA 3CC7A 1WJJA 3OIPA 4B3TL 3M4OB 4CJ2C 5HGQA 3H0GG 4GN5A 1VDDA 3GTLH 4DV1Q 4K2KA 3CQZB 1BCPB 1JJCB 1TKWB 5IWAL 1GOZA 3PO3G 4C1NK 1KAAA 4JK1C 1PYBA 1PZJD 4GKKQ 2H5XA 4H0LC 1QJOA 1X3GA 2K9HA 2R6GA 1STYA 3B4VC 2MJFB 3TQYA 5J3BA 1MBYA 1MI2A 2NVYH 4A3MH 1K0RA 2QF7A 4GOPA 1H9KA 1Q8IA 1LYLA 5BR8Q 2B8FA 4G76A 3A74A 3RN2A 1CUKA 4JBJA 1YEZA 4K8JA 2ENBA 1UUPA 4X66L 3HOYB 4A3BB 2UXBQ 3KF8A 1CE3A 1IHZA 1VQCA 1STAA 3UGLA 1SMYD 4GN4B 3CC2A 1A2UA 1Q82C 3EBEA 4PL5A 3U58A 4Y52H 3NK9A 4OONA 3J81j 4IFDI 1HH2P 2JA7H 3QTLD 1SYEA 4DV4L 1MSGA 3SHLA 2ARPF 2XVSA 3UGDA 3NTIA 1VQKA 1STGA 2N88A 3TS0A 1GUOA 3WOFA 1I50B 3J81c 2K5VA 4YHHQ 1HRJA 5FK9C 3HOZB 3KOJA 4PQXA 1KLUD 4JPBW 4IUQA 2JZMA 1WKXA 1PJUA 3DEPA 4DV7Q 3DHQA 3RUZA 2B3GA 2EYFA 5FO9B 4AS2A 1N9WA 3CC4A 1P9GA 5E4WC 4Y7NH 1KNEA 5KRUA 1S5ED 4A3GG 3J80i 4RKBA 3HKZE 2YTVA 5EJWA 3TP7A 4JI0Q 2KBNA 1XPRA 2ENNA 2KECA 4A93H 1WTJA 4CBVA 4KI0A 1CKOA 1RTOA 2A1AA 3PCOB 1B70B 2HCIA 2SGPI 3RZOH 3PUXA 4JI5Q 3K57A 2FINB 4JV5L 2B8GA 4YCUA 3W1GA 3CCQA 1K7TA 1OO9B 3K0XA 3DWAA 4EVOA 1PV4A 4HAEA 1STBA 3C1FA 4A3DB 2F1MA 1BCPF 2GSCA 2N78A 1TQOA 4LWCA 2KEEA 3HG9A 1EYDA 1VQDA 4BBRB 4O0AA 1CHQD 3W1BA 4HSPA 2HD3A 1MD2D 3I4MH 1WCMG 1BOSA 1TWAH 1Y1VG 4DK1A 3R2TA 3LJ1A 4LFCL 1RDPD 2X52A 5C3EH 2B2VA 5JVH3 2CW0D 5NUCA 2E2HB 3BZKA 2A2DA 3SDZA 5JEAG 5LMUL 2ROWA 1LABA 5C3XA 1XMOL 1DS3I 3GTLB 3ZYYX 3DA3A 3MXNA 3S24A 4WJWA 4GN3B 1LR7A 2BH2A 2MPMA 1QZGA 4YY3Q 3M7NA 1RD9D 3D6WA 1YI2A 2CWAA 3HS0C 4U68A 2F66B 2BUSA 2F0QA 2R61A 1X3PA 1JOKA 1OVOA 2VRWB 1TS2A 1X6OA 2PZWA 2VXWA 1FGUA 4S3SA 1HA6A 3C3LA 4K5WA 3NWTA 1KLGD 2EXZA 1EIGA 2D9UA 5EAYA 5JPMC 1TXYA 1LTSD 4QL5A 3J7AF 1SGDI 5E3QA 1EQTA 1PH7A 1EIYB 2IL8A 5CV6A 4R8IA 4L5SA 2PNRC 3AJFA 1AE2A 4KD3A 5IYDH 4DR4Q 2JA7B 4DNRB 1FNUA 1WTXA 1VQ5A 2JA6B 1BBWA 2GN5A 4PZ8A 2GVBA 4FF3A 2A68C 4JI6L 5CCLA 1T5EA 2Q2UA 1XMQL 2AKWB 1EZ6A 3S1MH 5JAVA 4NXML 1LR9A 2LFNA 4ZRZA 1S4ZA 2HCCA 4AIMA 3HKSA 2QW7A 1PYWD 3MXGA 5C0XG 2HT1A 2EE1A 4Y7NB 2AQ2B 4QJFA 3TJQA 2NN6H 4IJHA 3L2PA 1STEA 4CJ1B 2XNAC 3FHWA 1JMCA 4A93B 2JA5G 5CV4A 1CZGA 3M4PA 3GTJB 4C3IG 3K58A 1VQNA 4B3MQ 3RMHA 4J8QA 4BY1H 1PHJA 2K03A 3A5UA 1F9RA 3RZOB 1E2WA 3FEWX 1PMRA 3PGZA 4HGUA 1N34L 2MQHA 4O1PA 1VQ6A 3CP0A 3OIQA 2UXCQ 2M2LA 2EYJA 3TZDA 4UP9A 1OXVA 4K2LA 2AWNA 2UUCL 1W2BA 2K4KA 2QEJC 4DR3L 1RODA 4YIJA 2RLDA 3MWYW 2OQ0A 3SDJA 2K32A 1CHPD 1S5DD 4TVAB 5M3FH 5IT9E 1CKNA 4UY8C 1TWAB 1SE3A 3DEOA 4Q9VA 1A8VA 3MTSA 2YTYA 1MJCA 2ZTDA 2RA4A 1KNAA 4GXTA 1YBYA 2PQAA 2F0GA 3RLFA 2NN6I 2A19A 2K1BA 1PFNA 1CSOI 4IUUA 3K5MA 2GKTI 3SXHA 4MZ9A 1ILQA 1QUQA 4CHTB 4A3CG 3NE5B 3HKZB 4IOAA 5CORA 1MJAA 4UP8A 5CR3A 3I4NB 2R92G 2HGKA 3ZJYC 2UXDQ 3K8AA 3IAS1 1E0BA 1R4PB 1O7YA 2RHSB 1EY0A 5F2DA 5BN4A 1AZQA 1TWFB 4BWGB 2BDOA 2L4NA 2X3TA 3TS2A 2YV5A 1IBLQ 3HOXH 1GUNA 2VQFQ 1EIHA 3VR5A 3KYHC 2WAQG 3N52A 3UDFA 5JHWC 1U4PA 4DR6L 3SEBA 3PF4A 3R5AA 1IY6A 3KBXA 4X3TA 4LF4Q 4IO9A 5EKLA 4A3KG 1MT1A 1QE6A 2ICIA 4DV2Q 3HZXA 2K28A 2DKVA 2ZRRA 2V53A 2F3VA 4GNXC 3DWQA 1CQFA 5IYBG 3PUVA 1QNUA 4EQPA 1HZ9A 4C56C 1I4PA 1IBKQ 4JCVE 2K6AA 4K14A 2KA7A 2AQ1B 4MHEA 1AH9A 1ENCA 1XX6A 1ONLA 2FHTA 2CWHA 5IGEA 3VR2A 3S1MB 2ID0A 1M8BA 3I4LA 2E76C 5JJIA 1VF5C 2J4XA 1WTHA 1UVFA 1SYBA 4UHVA 2L5TA 3KJOA 3PIOA 4CJ0B 1UE5A 1CKMA 1A3VA 2V4DA 4GLVB 1EWIA 2H4OA 3TP6A 4KN7C 3VDYA 1MSHA 1U0LA 3TOBA 4JOIA 4OEMB 3CMEA 1GHKA 2OU2A 4B3RL 2CJSC 4GNXB 2KMQA 4DV3L 5I4DA 1SLJA 4I65A 1FL0A 3I9V1 2IWHA 2KCNA 1IXRA 2Z6KA 4HEDA 3VA9A 1LTRD 2QQ0A 2CH4A 3AU7A 4BXXH 5KNDA 2R7FA 3SR1A 3T16A 4F88A 1QCBD 3TO7A 2ZJPA 5CBEE 4HR7B 1UEBA 3T1HQ 4A3GB 2KCTA 4X62Q 2B8TA 1X55A 4FYDA 3J81L 1CM9A 4CDCC 2VQEQ 1H0ZA 2JYOA 2CAZB 2A73B 2YFAA 2BL7A 2XTRA 4K0KL 4NV5A 4DNCA 4JI1L 5M3FB 1CGJI 5AJ3L 1TWGH 1Z7TA 1ASYA 1SYDA 4IOCA 1XA6A 3PIPA 5IE8A 2DN8A 3LJ2A 2E73A 1C9OA 1UHAA 1H9SA 5DNFA 4FF2A 2YFBA 3KLSX 5T1GA 3U9OA 2YTXA 2NYZD 1EFID 3PMFA 4F87A 4POFA 1ASZA 1B44D 1XX8A 4YZ9A 4C2MH 2MO1A 5FJ8G 1JCKB 3UGIA 4C3HH 5KNCA 2K5HA 1EU3A 1Q9BA 5KIXA 3I90A 3HOUG 1ILPA 2ZTEA 4DN4M 2K04A 3S16H 1HPTA 4IUVA 4X64Q 1YJ9A 4XXEA 2L7XA 4LUOA 5FO7B 4CKBA 4PZ7A 2QDBA 2F6MB 2Q8TA 1L0XB 4B3SL 2B2WA 1TS3A 2A8VA 1PFMA 3GTMB 1N36Q 4GLAC 4A3EG 3L3OC 3LGJA 2F52A 1XXGA 2JEAI 3E3XA 2E74C 1GVPA 3CPWA 2DNEA 1GUSA 2WCYA 3OXLA 1D1KA 5EPJA 1DONA 1H9RA 3LJ0A 1LT4D 3PIO3 1U4LA 1SGQI 5CV5A 1IW4A 1YHBA 4HCSA 4YWKA 4KJNA 5FLXc 1TY0A 1SNMA 2E5RA 2GVAA 1JWMD 4LK1C 4IPCA 3OPOA 2K75A 4DV0Q 1TBQR 2A5HA 4F8MA 4JI7L 4KKSA 4RG1A 2SNMA 1TWCH 1IYUA 1LO5D 5ELDA 1YJWA 1ZYRD 4EGVA 3KLSA 5E3RA 1FNWA 4HSVA 3UE0A 3EFXD 3HOYH 3K5OA 1ET6A 3F4MA 1K28A 2N49A 2X69A 1BUVT 1X4SA 2B2UA 1L1OA 1SNQA 4JI8Q 1WTVA 2D0OA 5A2QE 1A63A 1R0RI 5IYBH 4O42A 1FJGL 1F2ZA 2B63G 3I8ZA 3KBGA 3FDTA 4CDFC 1XYIA 4LF5Q 2FJ2A 1E7ZA 1TGSI 2I07B 3EVQA 3G4SA 1V1OA 4OXPA 4RMFA 1TU2B 2IY5B 4QIWB 1AEXA 2JA8G 4BS9A 4OWWB 3G6JB 3P75A 3A7AB 4AQYL 3L0IA 4DUZQ 1C8CA 5D3DA 1IZ6A 4FXGC 1HQMC 1I50H 4HJ7A 1CK1A 1TT2A 3PIP3 1K7VA 3UDIA 1TUSA 2L8EA 1NY4A 5FO8B 1ULNA 1S5CD 2EOTA 2UU9L 3C1EA 2P6AC 4IPGA 3J80c 4RCOA 3T1YL 1OXUA 2KQ3A 5ELNA 2B2TC 5LMNQ 5D3IB 4JYAQ 3QR8A 1S3OA 5DAUA 2WIIB 4HN7A 2SGFI 1WYDA 1V43A 1ENFA 2AWOA 1JOQA 5EX0A 2F0KA 3OSOA 5C44G 4ZK9B 1W4RA 4AS3A 2AUJD 3CCJA 4IJLA 4JI2L 2A20A 1WTWA 3CCLA 1RL2A 2AUKA 5KYIA 3UDGA 3U50C 3ITPA 3BU2A 3GD7A 1ML0D 1VQLA 3ER0A 1NR2A 2VS1A 1X3EA 2SGDI 1LV9A 3HP3A 4UXHA 4C2MB 3CAMA 4X65Q 4RGMA 4C3HB 2EYMA 3T13A 5J39A 1DOKA 1W6JA 3K6OA 1WD0A 1FNVA 2F03A 1EY4A 3DMUA 3QG1A 1G91A 1KRSA 3A8KE 2ZXOA 4L63B 4BBRH 4DAYB 3V05A 4N8X1 4GKJL 1DOMA 4E6IA 1SMXA 3VYUA 3TRZA 1EOTA 3IAYA 4L8JA 1YU6C 3K0YA 3TO9A 4LUZA 1HNXL 2E2HH 1SE8A 3A7LA 1NE3A 1HNZL 1B8AA 3A55A 4B3TQ 3HOVH 2E75C 1DOLA 1YIJA 2NZHA 4DV6L 4LF6L 4PL4A 2WGCA 1Q1BA 2R3ZA 1BR9A 5EX3A 5IWAQ 3IFTA 3T4AC 3C46A 1EFWA 1YNJD 2A69D 1JQOA 2H1EA 3E9HA 1RCVD 1P16A 2Y0SE 2ENZA 5KEEA 3L7ZC 3QOJA 3I2ZA 2WAQB 1Y8OB 3QAHA 3O13A 1A0IA 1KAWA 1J5EL 4HCEA 2XMXA 1NMGA 5I6WA 1SBBB 4PL3A 5I2YA 5LMNW 4A3EH 1TWCB 1X74A 3H94A 2ASBA 4R4OA 3V96A 2J87A 1HA5A 1I4HA 3K81C 4X66Q 5I6YA 3D00A 3FBVA 1X3FA 5ELCA 3W5OA 1SYFA 2UZ3A 2N8NA 1K3BC 3FKIG 2NVQH 3H6MA 3OW7A 3RU0A 4DUYL 4LF4L 2E2DC 1TBRR 1Y14B 1PFBA 5ELOA 2VB3X 1LTLA 1WTRA 4IFDJ 2FNFX 2EIFA 2JA6H 4BY7H 5BR8L 3M85A 4DV4Q 2RKSA 5T1IA 4WP4A 1TURA 2EY6A 1GKHA 2RSNA 1Y1WH 2Q8IB 2NU1I 3U4ZA 1SRUA 1BMOA 4DKAC 3CCEA 2MFIA 4RWSC 2QKIC 3NP8A 4OO1H 3I7FA 2IX3A 1KDCA 5IYCG 4A3JH 4FNFA 3W2DA 2KMOA 2DIPA 4IN3A 4MN3A 4OIKA 1HDLA 2WB1B 5FLMH 1NTGA 1K8OA 4LW1A 3AB9A 3JSBA 1CFMA 4ZQ3A 4IPDA 5DEHA 3FPUB 1EU4A 3IAM1 4UP7A 4HJ9A 2IT1A 3ONAB 2K33A 4J1MA 2FEFA 4JBWA 3RNUA 1AFPA 1D6EC 4YHHL 3GTJH 5IGBA 5JVG3 5M3MG 1TWHB 2JBWA 1CHOI 3R8BA 1DZ1A 3ULPA 4FDBA 3TZUA 4AYBG 1A3UA 2HHHL 3STBD 3A5ZB 1WGTA 1CT0I 1YITA 4JI0L 1EZ8A 2C9OA 2EJFC 5L37A 2ZXPA 3DO9A 2JP1A 1PH5A 1JJGA 2K52A 5IP7G 2N52A 2J7ZA 3WOEA 1VQ7A 1E24A 2K19A 4JBKA 4DR5L 1UE1A 2WFWA 1JJ2A 1BNZA 4HJ5A 3KK7A 5DLQE 3E9IA 1BBUA 4JI5L 4DV5Q 3GTQH 3NBHB 1LR8A 2M5XA 1QILA 2EY1A 1OYVI 2KOLA 4EQNA 3BVZA 2HQLA 1JE4A 3AFQA 3KDFB 1SNOA 1KDBA 3I91A 1C4QA 1OMTA 4ILWA 5LMUQ 4I7ZC 4LNQA 3HOVB 4GOPC 3E2IA 4E1PA 1XMOQ 2NBFA 1ENAA 4NXNL 4A3LH 1PRTD 2ORVA 3I4NH 4FXKC 2R7ZG 3BDLA 3KLWA 2KHIA 5JPNC 2F0IA 2DB6A 2OF1A 1QB5D 2CFMA 2LXJA 1HNWQ 2G9HD 3VYRA 4ID6A 4P2CB 2NVXH 2JK8A 2OT2A 1TWFH 1F77A 2WINB 3TBIB 3ULJA 2F0LA 1HJPA 5LHY1 2J0TD 3SE0A 2JXDA 2QCPX 3VR4A 4V190 4A3EB 4XYOA 1VQPA 2Q2TA 3J7YW 1Q81C 3S1NB 3SGBI 1II3A 4A75A 2EYOA 1TY2A 4OHJA 1CI3M 1G8ZD 4JC0A 1FGBD 3H0GH 2VUMG 1SE2A 5K5PA 4FVMA 1S40A 1PLFA 4HIDA 2JB3A 4A3IG 3PO3H 5I9OA 4HEA1 2NVQB 2F0TA 2RHQB 1EUJA 4I7AA 2PO4A 3SK5A 5CC4A 1LTAD 4GOPB 2ALYB 4IZ8A 3K5LA 1PZID 3MXPA 2YYZA 1VCIA 1XNQL 1SYCA 4BY7B 1L0WA 1KIXA 4B9XA 3H3VH 2JEBI 1ULMA 3KF8B 4JI6Q 1XMQQ 2PZUA 3M9BA 1Y1WB 3CW2C 1KRTA 2FFKB 4CKCA 5IP9G 1I6VC 1IL8A 4NXMQ 1UUCA 3DUZA 1QVFA 5FLXL 4A3JB 4GZYC 2D0PA 4P72A 3CCRA 1KL9A 2HDLA 3H91A 3C2PA 1B9MA 1M4VA 2EJMA 1J8IA 1VQAA 2Y0SB 3A8IE 3CXLA 2D2CC 3D4DA 3A54A 1JE5A 1X56A 4DR1Q 2OXPA 2G5DA 1YVCA 2OWOA 2C5CA 2FUG1 1IL2A 3K59A 1PVOA 5GAHC 4AMLA 3J81i 3TO6A 4NB3A 3A0JA 1PTOD 5G3LF 1KD1C 1X32A 1N8RC 1CTMA 1EQVA 1EQRA 3HEJA 4CGYB 3F2CA 1V8QA 2SNSA 4HJ8A 4JI4Q 3R5DA 1HCZA 1KHIA 2CWFA 2SEBD 1SJED 1J9OA 5IT9c 2RCNA 3S2DH 1BKBA 1OXTA 4C3JG 4CKEA 2B2VC 3P20A 3TMEA 2UUCQ 4A3GH 4DR3Q 3OWFA 4LUVA 1O7LA 4APVA 1PPFI 1V9PA 4KLKA 5C44B 2L1LB 1SSOA 4NMZA 3UE1A 2K5DA 2PZTA 1VQMA 1SROA 3GTQB 1HUMA 1S5FD 3M4QA 2UXCL 5J1ZA 3T56B 4DK0A 1ICWA 1JWUD 2UUBQ 3MFGA 3QIAA 1FYCA 1PH8A 2OEOA 1G6PA 4POGA 3EQLC 1M1KC 1TOTA 3DXJC 1I3QB 1A6XA 2KCCA 3P23A 3MA2B 4SGBI 2K7VA 2TSSA 1SGYI 3H3VC 1IBML 2RF4A 2OTLA 1FARA 2NVXB 2A6HD 4WJ4A 1RKNA 4ULLA 4FKDA 2MGSA 3NEMA 4DAMA 1WCMH 1Q46A 1Y1VH 1Z2IA 1EOVA 1UWVA 4DR6Q 5I2XA 1XJVA 2V6EA 4QIWE 1Z6HA 3MXNB 2JA1A 1JB7A 1XNRL 5D14A 3GTMH 2N71A 1G2TA 4HMJA 4FXDA 4QMGA 5JEAH 3T51B 4IURA 1ET9A 4YCVA 3WDNA 3S14H 3H0GB 2UXDL 2KVMA 2KENA 1CGII 3PUWA 1YNND 2G9DA 1EY8A 3PO3B 4K8IA 2R7ZH 1HZAA 2KJXA 1D8LA 2E8GA 2K05A 3KJPA 1E2ZA 2VQFL 2KCXA 4K5XA 1LT3D 1VQIA 1K9MC 2L12A 2MHVA 4X3SA 4K6DA 3HOWG 5CCMA 1GO3E 2CKZB 5M5XH 4WFN3 3DA4A 1O78A 2VL6A 3PUZA
chains in the Genus database with same CATH topology
4MNOA 2Q2HA 2XGTA 2ES2A 4A3BG 2NU4I 1E22A 2WVJA 2VZAA 1YO7A 2WP8J 3JAMc 2E5LL 4YZDA 3EN2A 4JI3Q 4PG3A 2XTQA 1X54A 1CT2I 1HR0Q 3E59A 1FAQA 3PUYA 4LF9L 4DR2L 4DR7Q 4B3RQ 5C4JH 2CQOA 1KBEA 3GTKH 4DV3Q 4B6DA 3GTGH 3HOZG 2JQOA 3UEJA 2N17A 3OTOL 3GTPH 3RR5A 2V1CA 5HI7A 1Q1EA 5FUVA 1Y1CA 4A3FG 2JA5H 4K0KQ 3G6EA 3RLOA 3S17H 4C3IH 4JI1Q 5AJ3Q 5C4XG 1N32L 2WAQE 2ORWA 3L0OA 3T1HL 4X62L 1S72A 1M90C 2VQEL 4A3DG 1CKNB 3KF6A 3BJUA 1IY5A 2NU2I 3S1RH 2BA0A 1N33L 3PO2G 2PQAB 4IFDG 1QUQB 2IP6A 1FVIA 5C0XI 4B3SQ 5JJLA 1HR0W 1OMUA 3IRBA 2AMCB 2PNHA 1Y8FA 1AN1I 4A3CH 3AFPA 4X6AH 5K36G 2R92H 1EIFA 3JC66 4HFVA 2FXQA 1P8LA 3CCVA 2WB1E 1WFQA 5LNK1 2PI2E 4A3MG 1V1HA 1VQHA 2KMPA 2BH8A 3M3YH 4JOIC 4JI7Q 3RN5A 3VDUA 4A3KH 3CCMA 1TIHA 1VQOA 2F4VL 4AH6A 3HFZB 2Z6KC 1NJIC 2JA7G 4HJAA 4ALPA 1FJGQ 1QZHA 3STBC 1K8GA 1BVSA 2ZM6L 2ERWA 1XBTA 4O1OA 1PTQA 4NPSA 4JI8L 3DLLA 2UU9Q 4LF5L 3S15H 1NUBA 2IHFA 3F8TA 4HIOA 3T1YQ 1I94L 2XTIA 3AYHB 4LF7Q 4GS3A 2DGYA 3I4OA 1VQ9A 4DUZL 1IYJB 1PH2A 2UUAL 3MEKA 1Z47A 2CCZA 1TWHH 1Q12A 2E2IH 2IX1A 3J7A5 4LFBL 3PF5A 4H02A 4E1RA 1CSQA 4LFAQ 1XPUA 4P74A 4OWXB 4DPGA 4Z7HA 1KC8C 4DNIA 3I4MG 1Y1BA 1LM0A 3HH2C 4OX9Q 3UDXA 5C3EG 4GKJQ 4LF8Q 2ELIA 3WWVA 1EQQA 4HIKA 3HKZG 1HNXQ 1QVGA 5FJ8H 1Q8KA 4DV6Q 4LF6Q 3QWPA 3HOUH 4KHPL 1PH4A 2L15A 2E2JH 1L1OC 3UEYA 5GROA 4QQBX 1U5KA 4NV2A 4OVOA 3GDEA 3RLNA 4KHZA 3RZDH 5HQ8A 4DV1L 3S1NH 5GAEC 2QQDA 1E3PA 3OL0A 4GKKL 2I5HA 2QA4A 5IYDG 2A2CA 4DUYQ 1KMAA 3I55A 4U6RA 2JJQA 3TEHB 2Q2IA 2NU3I 4UXIA 4GLXA 1L1OB 3NENA 2UXBL 1VQEA 2BA1A 1AE3A 4XIGS 3PV0A 2LEOA 4L5RC 2NN6G 4DK6C 2K5NA 2B63H 2MNAA 2SGEI 3F1ZA 4OAUC 1C0AA 5FUWA 4BY1G 2JA8H 1YTPA 4UXJA 4R4TA 4DV7L 5M5YH 1E1TA 2HHHQ 5H1SE 2LUYA 4JV5Q 2K50A 4EQ5A 1H95A 3DM3A 1UE7A 4WJ3M 4PZ6A 1VS0A 1V1QA 3GO5A 5M3FG 1DS2I 2KCMA 4DR5Q 5C44H 4OO1I 2LSSA 1PYSB 2OTJA 4DWLA 1BUSA 4LFCQ 3BJIA 3FC3A 2I5LX 1K3RA 1I3QH 2P22B 3CPFA 4NXNQ 4UPAA 4DV5L 1GM5A 2HIVA 3HOXG 2D62A 2B0UC 4YWMA 2KHJA 3OXFA 2R7DA 4PMWA 1MKHA 1D7QA 3VE5A 1Z9FA 2OVOA 1HNWL 2ODDA 2I5MX 4YY3L 1N13A 1VQ4A 2LXKA 2ATWA 3SEKC 1XNQQ 1HZBA 2W0TA 1UE6A 1LUZA 1Q86C 2R93G 3D31A 4BA2I 1SGNI 1TBOA 4AYBE 1Q7YC 4J15A 4DR4L 2GKVA 3FKIH 3NELA 4YZCA 1XPOA 1WI5A 2GKRI 1B7YB 4GNXA 2QQCA 4BXXG 1PA6A 1K73C 5IYCH 1YHQA 1N34Q 5DAEA 2K14A 2AHOB 4BBSG 4XTCS 1J6QA 1Z7KB 4DR1L 3CD6A 3OW2A 3H3VI 2XRCA 4B3ML 5IY0A 3CF5A 2JB1A 1KBFA 1SR3A 4JI4L 5M3MH 2JW6A 3I56A 2DUDA 2YU9H 2HIXA 3ERSX 5IP7H 1MJEA 1SGRI 1L2FA 1IBMQ 1SN8A 1GD7A 3SGIA 3AQQA 3PSIA 2UUBL 4L9MA 3F2DA 1OXSC 4DK3C 2C35B 1SJ8A 1XNRQ 1VQBA 3F2BA 1C7YA 4A4IA 2NVTH 2QQEA 5JJKA 3G71A 2N1AB 2VW9A 4HIMA 2SGQI 3AEVA 1RIPA 4L5TA 2F3CI 4R4IA 1IBLL 1I6HH 2EXDA 1VQJA 3PDNA 3GOXA 1M8CA 2JB2A 1E1OA 2NU0I 3SGQI 1SGPI 2QEXA 3UITA 2OCEA 1V1IA 4DV2L 3VDPA 3HOYG 3ULLA 1UVGA 2VUMH 1RFHA 2E5LQ 3K7UC 4R4CA 4A3IH 3K7AH 1IBKL 2B29A 1PCEA 2JAEA 3TREA 4JBMA 4R1JA 2KKMA 1MIUA 2ZTCA 4LF9Q 4DR2Q 4G75A 2JA9A 1K83H 3GTOH 2F3IA 5JEAJ 2R93H 3KY9A 4OAVB 5IP9H 2VY3A 4JI3L 3Q8DA 3ICEA 3H15A 2I0QA 1NMFA 3OTOQ 1VQGA 1HR0L 2WB1G 4QY7A 5FUXA 1PH1A 1X65A 1YZ6A 2IHEA 4DR7L 1PFSA 3S2HH 2JYYA 4Z7GA 1PH9A 1N32Q 2NZOA 1SGEI 4A76A 3K80C 4BBSH 2QGQA 1I5FA 4C3JH 3OXGA 2GVIA 3CCUA 2CWPA 4JG2A 1N33Q 3U4VA 4IPHA 3OYYA 4BBRG 5M5WH 4ME3A 2MO0A 4R4QA 1R9TH 4TQUS 4GI3C 5C0XJ 1R79A 1SFOH 1G51A 3FP9A 3HOVG 2OD1A 4P71A 2RIOA 4X64L 5HY6A 1VQFA 1WOCA 1HJAI 2QPOA 1YHAA 1QVCA 3E0EA 4O2DA 3KFUA 1N36L 4BA1I 2VNUD 3KP9A 5GQOA 1YJNA 2ZJQA 2JE6I 3M4OH 1K8AC 1JT8A 3BZCA 2Z0SA 1XTDA 3CQZH 3EIVA 1G291 3MEFA 4I1TA 3S1QH 2F4VQ 1X9NA 1CT4I 2JA6G 4BY7G 4DV0L 1HZCA 5FUYA 1PH3A 3HOWH 1O7IA 2V1CC 5HGIA 1Y1WG 2ZM6Q 4OO1G 4MTNA 4A3JG 1EYGA 4AQYQ 4A3BH 3JAMi 1TBNA 2KMRA 4L5QA 2YQPA 1YNXA 2IX0A 5FLMG 1A62A 2Y0SG 1CSPA 2ZJRA 4OWTB 4YWLA 1I94Q 4A93G 1KXLA 1NBWA 1KQSA 2PI2A 2PMZE 2UUAQ 1VQ8A 4JI2Q 3HOZH 5E7NA 1PTRA 2OQKA 5LMNL 4LF7L 4JYAL 3D0FA 3CMAA 4LFBQ 3OVOA 1W3SA 1FYBA 4A3FH 5GADC 1OTCA 5GAGC 4A24A 2YUUA 5C4XH 4YCWA 2EQSA 3KF6B 3G48A 2J9RA 4X65L 3CCSA 2N3SA 4A3LG 4LFAL 3I4NG 1HNZQ 4A3DH 3KDFA 1T9HA 4P73A 4QGUA 4P75A 1PH6A 4EX5A 4OX9L 3J7ZC 3PO2H 4LF8L 4KHPQ 3CXCA 3UFFA 1J5EQ 1DGSA 1OXXK 3B6YA 3CC7A 1WJJA 4B3TL 5HGQA 3H0GG 4GN5A 1VDDA 3GTLH 4DV1Q 5IWAL 1JJCB 3PO3G 1PYBA 4GKKQ 2H5XA 1X3GA 2K9HA 2R6GA 3B4VC 2MJFB 3TQYA 5J3BA 2NVYH 4A3MH 1K0RA 4GOPA 1LYLA 5BR8Q 4G76A 3A74A 3RN2A 1CUKA 4JBJA 1YEZA 4X66L 2UXBQ 1CE3A 1VQCA 3UGLA 4GN4B 3CC2A 1Q82C 3EBEA 4PL5A 3U58A 4Y52H 4OONA 3J81j 4IFDI 1HH2P 2JA7H 3QTLD 4DV4L 2ARPF 3UGDA 1VQKA 3TS0A 3J81c 2K5VA 4YHHQ 3KOJA 2JZMA 1PJUA 4DV7Q 2B3GA 3CC4A 4AS2A 1N9WA 4Y7NH 4A3GG 3J80i 3HKZE 2YTVA 4JI0Q 2KBNA 1XPRA 2ENNA 4A93H 4KI0A 1CKOA 2A1AA 3PCOB 1B70B 2SGPI 3RZOH 3PUXA 4JI5Q 4JV5L 4YCUA 3W1GA 3CCQA 3K0XA 1PV4A 2N78A 4LWCA 1VQDA 4O0AA 3W1BA 3I4MH 1WCMG 1TWAH 1Y1VG 3LJ1A 4LFCL 5C3EH 3BZKA 2A2DA 5JEAG 5LMUL 2ROWA 1XMOL 1DS3I 3DA3A 3S24A 4GN3B 1LR7A 2BH2A 1QZGA 4YY3Q 3M7NA 1YI2A 2CWAA 2F66B 2BUSA 1OVOA 2VRWB 1X6OA 1FGUA 5EAYA 1TXYA 4QL5A 1SGDI 1PH7A 1EIYB 4L5SA 3AJFA 1AE2A 5IYDH 4DR4Q 1VQ5A 1BBWA 2GN5A 4PZ8A 2GVBA 4JI6L 5CCLA 2Q2UA 1XMQL 2AKWB 3S1MH 4NXML 1LR9A 4AIMA 3HKSA 5C0XG 2HT1A 4QJFA 3TJQA 4IJHA 3L2PA 1JMCA 3FHWA 2JA5G 3M4PA 1VQNA 4B3MQ 4BY1H 1PHJA 3A5UA 3PGZA 4HGUA 1N34L 2MQHA 4O1PA 1VQ6A 3CP0A 2UXCQ 4UP9A 1OXVA 2AWNA 2UUCL 1W2BA 2K4KA 4DR3L 2OQ0A 3SDJA 4TVAB 5M3FH 1CKNA 4UY8C 4Q9VA 1A8VA 2YTYA 1MJCA 2ZTDA 4GXTA 1YBYA 2PQAA 3RLFA 2NN6I 2A19A 1CSOI 2GKTI 4MZ9A 1QUQA 4A3CG 4IOAA 4UP8A 2R92G 3ZJYC 2UXDQ 3K8AA 3IAS1 2RHSB 3TS2A 2YV5A 1IBLQ 3HOXH 2VQFQ 3KYHC 2WAQG 3UDFA 5JHWC 4DR6L 3PF4A 1IY6A 4LF4Q 4IO9A 4A3KG 1MT1A 4DV2Q 2ZRRA 2V53A 4GNXC 5IYBG 3PUVA 1HZ9A 1IBKQ 4JCVE 1AH9A 1XX6A 2ID0A 1M8BA 5JJIA 1UVFA 3KJOA 3PIOA 1UE5A 1CKMA 4GLVB 1EWIA 3VDYA 1U0LA 4JOIA 3CMEA 4B3RL 2CJSC 4GNXB 2KMQA 4DV3L 1SLJA 1FL0A 3I9V1 1IXRA 2Z6KA 3VA9A 2QQ0A 4BXXH 2R7FA 2ZJPA 3T1HQ 1UEBA 2KCTA 4X62Q 2B8TA 1X55A 2VQEQ 1H0ZA 2CAZB 2YFAA 2XTRA 4K0KL 4NV5A 4JI1L 1CGJI 5AJ3L 1TWGH 1ASYA 1XA6A 4IOCA 3PIPA 5IE8A 3LJ2A 2E73A 1C9OA 2YFBA 2YTXA 4POFA 1ASZA 4YZ9A 4C2MH 2MO1A 5FJ8G 3UGIA 4C3HH 2K5HA 3HOUG 2ZTEA 3S16H 1HPTA 4X64Q 1YJ9A 2L7XA 4LUOA 4PZ7A 2F6MB 4B3SL 2A8VA 1N36Q 4GLAC 4A3EG 3LGJA 2F52A 2JEAI 1GVPA 3CPWA 2WCYA 3OXLA 1SGQI 3LJ0A 1IW4A 1YHBA 4YWKA 5FLXc 2E5RA 2GVAA 4IPCA 2K75A 4DV0Q 1TBQR 4JI7L 4RG1A 1TWCH 1YJWA 3UE0A 3HOYH 3F4MA 2N49A 1X4SA 1L1OA 4JI8Q 2D0OA 1A63A 1R0RI 5IYBH 1FJGL 2B63G 4LF5Q 1E7ZA 1TGSI 3G4SA 4OXPA 4RMFA 2IY5B 2JA8G 4OWWB 4AQYL 3L0IA 4DUZQ 1IZ6A 1I50H 4HJ7A 1TUSA 3UDIA 2L8EA 1NY4A 2UU9L 2P6AC 4IPGA 3J80c 3T1YL 1OXUA 5ELNA 5LMNQ 4JYAQ 1S3OA 2SGFI 1WYDA 1V43A 2AWOA 5EX0A 5C44G 1W4RA 4AS3A 3CCJA 4IJLA 4JI2L 2A20A 3CCLA 1RL2A 3UDGA 3U50C 3BU2A 3GD7A 1VQLA 3ER0A 2VS1A 1X3EA 2SGDI 4UXHA 3CAMA 4X65Q 1KRSA 4BBRH 4DAYB 4GKJL 1SMXA 3TRZA 1YU6C 4LUZA 1HNXL 2E2HH 1SE8A 1NE3A 1HNZL 1B8AA 4B3TQ 3HOVH 1YIJA 2NZHA 4DV6L 4LF6L 4PL4A 1Q1BA 5EX3A 5IWAQ 1EFWA 3E9HA 1P16A 2Y0SE 2ENZA 3L7ZC 3I2ZA 1A0IA 1KAWA 1J5EL 2XMXA 1NMGA 4A3EH 4PL3A 5LMNW 1X74A 2ASBA 4R4OA 2J87A 3K81C 4X66Q 3D00A 3FBVA 1X3FA 3W5OA 2UZ3A 2N8NA 3FKIG 2NVQH 3RU0A 4DUYL 1TBRR 1Y14B 5ELOA 1LTLA 4IFDJ 2FNFX 2EIFA 2JA6H 4BY7H 5BR8L 3M85A 4DV4Q 1TURA 1GKHA 1Y1WH 2NU1I 3U4ZA 1SRUA 1BMOA 4DKAC 3CCEA 2MFIA 3I7FA 4A3JH 5IYCG 2KMOA 2DIPA 1HDLA 5FLMH 1NTGA 4LW1A 3JSBA 4IPDA 3IAM1 4UP7A 4HJ9A 2IT1A 3RNUA 4JBWA 4YHHL 3GTJH 5M3MG 1CHOI 3ULPA 4FDBA 4AYBG 2HHHL 3STBD 3A5ZB 1CT0I 1YITA 4JI0L 3DO9A 1JJGA 1PH5A 2K52A 5IP7G 2N52A 1VQ7A 1E24A 2K19A 4JBKA 4DR5L 1UE1A 2WFWA 1JJ2A 4HJ5A 5DLQE 3E9IA 1BBUA 4JI5L 4DV5Q 3GTQH 3NBHB 1LR8A 2M5XA 1OYVI 2HQLA 3AFQA 3KDFB 1OMTA 5LMUQ 4LNQA 3E2IA 4GOPC 4E1PA 1XMOQ 4NXNL 4A3LH 2ORVA 3I4NH 2R7ZG 3KLWA 2KHIA 2DB6A 2CFMA 2LXJA 1HNWQ 2NVXH 2JK8A 1TWFH 3ULJA 1HJPA 2JXDA 1VQPA 2Q2TA 1Q81C 3SGBI 4A75A 4JC0A 3H0GH 2VUMG 1S40A 3PO3H 4HIDA 2JB3A 4A3IG 4HEA1 2RHQB 1EUJA 4GOPB 2ALYB 2YYZA 1VCIA 1XNQL 1L0WA 1KIXA 3H3VH 2JEBI 3KF8B 4JI6Q 1XMQQ 3M9BA 3CW2C 1KRTA 5IP9G 4NXMQ 1UUCA 1QVFA 2D0PA 4P72A 3CCRA 1KL9A 1VQAA 3CXLA 1JE5A 1X56A 4DR1Q 1YVCA 2OWOA 1IL2A 2FUG1 1PVOA 5GAHC 3J81i 4NB3A 3A0JA 1KD1C 1N8RC 1EQRA 3F2CA 4HJ8A 4JI4Q 1KHIA 5IT9c 2RCNA 3S2DH 1BKBA 1OXTA 2UUCQ 4A3GH 4DR3Q 4LUVA 1PPFI 4APVA 1V9PA 4KLKA 2L1LB 3UE1A 1VQMA 1SROA 3M4QA 2UXCL 2UUBQ 1PH8A 1G6PA 4POGA 1M1KC 1TOTA 3P23A 4SGBI 1SGYI 1IBML 2RF4A 2OTLA 1FARA 4WJ4A 4FKDA 3NEMA 4DAMA 1WCMH 1Q46A 1Y1VH 1EOVA 1UWVA 4DR6Q 1XJVA 2V6EA 4QIWE 3MXNB 2JA1A 1JB7A 1XNRL 3GTMH 2N71A 4YCVA 3S14H 2UXDL 2KENA 1CGII 3PUWA 2R7ZH 1HZAA 1D8LA 2E8GA 3KJPA 2VQFL 2KCXA 1VQIA 1K9MC 3HOWG 5CCMA 1GO3E 2CKZB 5M5XH 3DA4A 4LF4L 2VL6A 3PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LYL A;  4MNO A;  4RG1 A;  5BR8 Q;  2Q2H A;  1UE6 A;  1LUZ A;  1TWC H;  2XGT A;  3A74 A;  3RN2 A;  1Q86 C;  2ES2 A;  1YJW A;  1CUK A;  4JBJ A;  1YEZ A;  4A3B G;  1E22 A;  2VZA A;  4X66 L;  2R93 G;  2UXB Q;  3D31 A;  2WP8 J;  3UE0 A;  3JAM c;  3HOY H;  2E5L L;  4BA2 I;  1VQC A;  2N49 A;  4GN4 B;  3EN2 A;  4AYB E;  3CC2 A;  1L1O A;  4JI8 Q;  1Q7Y C;  4PG3 A;  1Q82 C;  4JI3 Q;  2D0O A;  3EBE A;  1A63 A;  4J15 A;  5IYB H;  1FJG L;  4DR4 L;  3FKI H;  3NEL A;  3U58 A;  2B63 G;  1X54 A;  4OON A;  3J81 j;  4IFD I;  4Y52 H;  1HR0 Q;  1HH2 P;  4LF5 Q;  2JA7 H;  3PUY A;  1E7Z A;  3G4S A;  1XPO A;  4OXP A;  4RMF A;  4DV4 L;  2IY5 B;  4LF9 L;  4DR2 L;  2JA8 G;  1WI5 A;  4DR7 Q;  4B3R Q;  4OWW B;  5C4J H;  1VQK A;  2CQO A;  4AQY L;  3TS0 A;  3GTK H;  4DUZ Q;  4DV3 Q;  3J81 c;  1IZ6 A;  2K5V A;  1B7Y B;  4YHH Q;  3GTG H;  3HOZ G;  1I50 H;  4HJ7 A;  4GNX A;  2JQO A;  3KOJ A;  3UDI A;  4BXX G;  1PA6 A;  1K73 C;  5IYC H;  1NY4 A;  3OTO L;  4DV7 Q;  1YHQ A;  2UU9 L;  2B3G A;  3CC4 A;  3GTP H;  1N9W A;  1N34 Q;  3RR5 A;  4IPG A;  4Y7N H;  2K14 A;  2AHO B;  4BBS G;  3J80 c;  4XTC S;  1J6Q A;  3T1Y L;  4A3G G;  3J80 i;  4DR1 L;  3CD6 A;  1OXU A;  3HKZ E;  5ELN A;  2YTV A;  4JI0 Q;  5LMN Q;  4JYA Q;  2KBN A;  1S3O A;  1XPR A;  1Q1E A;  3OW2 A;  3H3V I;  4A93 H;  4A3F G;  1WYD A;  1V43 A;  2AWO A;  4KI0 A;  1CKO A;  5IY0 A;  3CF5 A;  5C44 G;  3G6E A;  3RLO A;  2JA5 H;  4B3M L;  3S17 H;  4K0K Q;  2A1A A;  3PCO B;  4JI1 Q;  4C3I H;  1B70 B;  4IJL A;  3CCJ A;  5AJ3 Q;  1SR3 A;  4JI2 L;  3CCL A;  4JI4 L;  5M3M H;  3RZO H;  5C4X G;  3PUX A;  1RL2 A;  3I56 A;  4JI5 Q;  1N32 L;  2WAQ E;  3UDG A;  3U50 C;  3BU2 A;  3GD7 A;  3L0O A;  2DUD A;  3T1H L;  3ER0 A;  1VQL A;  4JV5 L;  2VS1 A;  4YCU A;  3W1G A;  3CCQ A;  4X62 L;  2YU9 H;  1X3E A;  1S72 A;  2HIX A;  3K0X A;  1M90 C;  2VQE L;  1PV4 A;  3CAM A;  4X65 Q;  4A3D G;  1CKN B;  3ERS X;  3KF6 A;  2N78 A;  3BJU A;  5IP7 H;  1MJE A;  1L2F A;  4LWC A;  3S1R H;  2BA0 A;  1N33 L;  3PO2 G;  1VQD A;  1IBM Q;  1SN8 A;  4O0A A;  3W1B A;  2PQA B;  1GD7 A;  1KRS A;  4BBR H;  4DAY B;  1WCM G;  3I4M H;  4GKJ L;  1TWA H;  1Y1V G;  3SGI A;  4IFD G;  3AQQ A;  1SMX A;  1QUQ B;  1FVI A;  3PSI A;  2UUB L;  4LFC L;  3F2D A;  5C3E H;  5C0X I;  1OXS C;  4B3S Q;  3TRZ A;  5JJL A;  4DK3 C;  1HR0 W;  2C35 B;  3IRB A;  2AMC B;  2PNH A;  3BZK A;  4LUZ A;  1HNX L;  2E2H H;  5JEA G;  1SE8 A;  5LMU L;  1XNR Q;  1VQB A;  1NE3 A;  1HNZ L;  1XMO L;  1B8A A;  3F2B A;  1C7Y A;  4B3T Q;  4A4I A;  4A3C H;  3AFP A;  3HOV H;  1YIJ A;  4X6A H;  2NVT H;  2NZH A;  3S24 A;  4DV6 L;  4LF6 L;  5K36 G;  5JJK A;  1Q1B A;  3G71 A;  4GN3 B;  2R92 H;  5IWA Q;  2VW9 A;  1EIF A;  4HIM A;  3JC6 6;  2BH2 A;  1RIP A;  3AEV A;  4L5T A;  1EFW A;  2FXQ A;  4R4I A;  1P8L A;  3E9H A;  1QZG A;  1IBL L;  2EXD A;  1VQJ A;  4YY3 Q;  3CCV A;  3M7N A;  1I6H H;  2WB1 E;  1YI2 A;  1P16 A;  2Y0S E;  2CWA A;  1E1O A;  3L7Z C;  1WFQ A;  3I2Z A;  1K0R A;  2PI2 E;  1A0I A;  1KAW A;  1J5E L;  4A3M G;  1VQH A;  2QEX A;  2BH8 A;  3M3Y H;  1X6O A;  1NMG A;  4A3E H;  4JOI C;  4JI7 Q;  5LMN W;  3RN5 A;  1FGU A;  2OCE A;  4UY8 C;  2ASB A;  4R4O A;  4DV2 L;  3HOY G;  3K81 C;  3ULL A;  4A3K H;  4X66 Q;  5EAY A;  1TXY A;  1X3F A;  4QL5 A;  3W5O A;  2VUM H;  2N8N A;  2E5L Q;  3K7U C;  3CCM A;  4R4C A;  1PH7 A;  1EIY B;  4L5S A;  3FKI G;  1VQO A;  2F4V L;  4AH6 A;  4A3I H;  2NVQ H;  1AE2 A;  2Z6K C;  3HFZ B;  3K7A H;  1NJI C;  2JA7 G;  4HJA A;  4ALP A;  2B29 A;  4DUY L;  1IBK L;  1FJG Q;  4DR4 Q;  5IYD H;  1VQ5 A;  1Y14 B;  5ELO A;  3TRE A;  4JBM A;  1LTL A;  1QZH A;  3STB C;  4IFD J;  1BBW A;  2GN5 A;  4R1J A;  2EIF A;  4PZ8 A;  2GVB A;  2JA6 H;  1K8G A;  5BR8 L;  3M85 A;  4BY7 H;  4JI6 L;  4DV4 Q;  2Q2U A;  1MIU A;  1BVS A;  2ZTC A;  1XMQ L;  2ZM6 L;  4LF9 Q;  4DR2 Q;  2AKW B;  2JA9 A;  3S1M H;  1GKH A;  4NXM L;  1Y1W H;  1K83 H;  3GTO H;  3U4Z A;  2F3I A;  1SRU A;  5JEA J;  4DKA C;  3CCE A;  2R93 H;  2MFI A;  4NPS A;  5IP9 H;  3I7F A;  4JI8 L;  4A3J H;  5IYC G;  2VY3 A;  4JI3 L;  3Q8D A;  4AIM A;  3HKS A;  3ICE A;  3DLL A;  3H15 A;  5C0X G;  2HT1 A;  2I0Q A;  1NMF A;  3OTO Q;  1VQG A;  1HR0 L;  2UU9 Q;  4QJF A;  4LF5 L;  2WB1 G;  3S15 H;  4IJH A;  4QY7 A;  1NTG A;  2IHF A;  3F8T A;  5FLM H;  3L2P A;  4HIO A;  1X65 A;  4LW1 A;  1PH1 A;  3T1Y Q;  1I94 L;  1YZ6 A;  2IHE A;  1JMC A;  4DR7 L;  3FHW A;  2XTI A;  3AYH B;  4IPD A;  4GS3 A;  2DGY A;  2JA5 G;  4LF7 Q;  3I4O A;  1PFS A;  3M4P A;  4HJ9 A;  4UP7 A;  1VQ9 A;  2IT1 A;  4DUZ L;  3S2H H;  1IYJ B;  3RNU A;  4JBW A;  1VQN A;  1PH2 A;  4YHH L;  2UUA L;  4B3M Q;  3GTJ H;  4BY1 H;  1PHJ A;  1Z47 A;  5M3M G;  3A5U A;  3PGZ A;  2CCZ A;  3ULP A;  1TWH H;  1PH9 A;  1N34 L;  4FDB A;  1Q12 A;  2MQH A;  1VQ6 A;  3CP0 A;  2NZO A;  4AYB G;  2E2I H;  2HHH L;  2IX1 A;  1N32 Q;  3STB D;  3A5Z B;  4A76 A;  2UXC Q;  4UP9 A;  3K80 C;  1YIT A;  4JI0 L;  3J7A 5;  1OXV A;  4BBS H;  2AWN A;  2QGQ A;  2UUC L;  1W2B A;  2K4K A;  4LFB L;  1I5F A;  1JJG A;  4DR3 L;  1PH5 A;  4C3J H;  2K52 A;  3PF5 A;  5IP7 G;  1VQ7 A;  1E24 A;  4H02 A;  4JBK A;  1CSQ A;  2OQ0 A;  4LFA Q;  3CCU A;  4DR5 L;  4P74 A;  1UE1 A;  4OWX B;  4DPG A;  2CWP A;  2WFW A;  4JG2 A;  1JJ2 A;  1N33 Q;  3U4V A;  4TVA B;  5M3F H;  4HJ5 A;  4IPH A;  1KC8 C;  1CKN A;  3OYY A;  4BBR G;  5DLQ E;  4DNI A;  3E9I A;  1BBU A;  4JI5 L;  5M5W H;  4DV5 Q;  3NBH B;  1LM0 A;  4ME3 A;  3GTQ H;  4OX9 Q;  1A8V A;  3UDX A;  2YTY A;  1MJC A;  2MO0 A;  4R4Q A;  5C3E G;  4GKJ Q;  2ZTD A;  1R9T H;  4LF8 Q;  1YBY A;  2PQA A;  2HQL A;  4TQU S;  2NN6 I;  2A19 A;  3AFQ A;  3RLF A;  3KDF B;  5C0X J;  4MZ9 A;  3WWV A;  1QUQ A;  1SFO H;  1EQQ A;  4HIK A;  3HKZ G;  1HNX Q;  4A3C G;  1G51 A;  3FP9 A;  5LMU Q;  3HOV G;  4UP8 A;  4LNQ A;  4IOA A;  4GOP C;  1XMO Q;  4NXN L;  1QVG A;  4A3L H;  5FJ8 H;  2R92 G;  1Q8K A;  4P71 A;  3I4N H;  3ZJY C;  2R7Z G;  4DV6 Q;  3K8A A;  4LF6 Q;  3KLW A;  2KHI A;  2UXD Q;  2RHS B;  4X64 L;  2CFM A;  2LXJ A;  1VQF A;  5HY6 A;  1WOC A;  3HOU H;  1HNW Q;  2NVX H;  3TS2 A;  4KHP L;  2JK8 A;  2YV5 A;  2L15 A;  1PH4 A;  1IBL Q;  1L1O C;  2E2J H;  1TWF H;  1YHA A;  3HOX H;  5GRO A;  1QVC A;  3E0E A;  3KYH C;  4O2D A;  2WAQ G;  3ULJ A;  3UDF A;  2VQF Q;  1HJP A;  4QQB X;  4DR6 L;  1U5K A;  3KFU A;  1N36 L;  3PF4 A;  3GDE A;  4BA1 I;  3RLN A;  1VQP A;  2Q2T A;  2VNU D;  1Q81 C;  3I4M G;  4KHZ A;  5GQO A;  4A75 A;  3RZD H;  1YJN A;  4LF4 Q;  4IO9 A;  4A3K G;  4DV1 L;  2ZJQ A;  2JE6 I;  3S1N H;  1K8A C;  3M4O H;  4JC0 A;  1JT8 A;  4DV2 Q;  3H0G H;  5GAE C;  2VUM G;  3BZC A;  2Z0S A;  1XTD A;  1E3P A;  3CQZ H;  3EIV A;  1S40 A;  1G29 1;  4HID A;  3PO3 H;  4A3I G;  3MEF A;  4GKK L;  2I5H A;  2QA4 A;  2RHQ B;  5IYD G;  4GNX C;  1EUJ A;  5IYB G;  3S1Q H;  3PUV A;  2F4V Q;  1X9N A;  4GOP B;  1HZ9 A;  2ALY B;  1IBK Q;  4JCV E;  4DUY Q;  3I55 A;  2JA6 G;  4BY7 G;  2YYZ A;  1VCI A;  2JJQ A;  4DV0 L;  1HZC A;  1XNQ L;  1L0W A;  3TEH B;  1KIX A;  1AH9 A;  2Q2I A;  1PH3 A;  3HOW H;  3H3V H;  2JEB I;  1O7I A;  2V1C C;  3KF8 B;  4JI6 Q;  1Y1W G;  1XMQ Q;  3M9B A;  2ID0 A;  2ZM6 Q;  4GLX A;  3CW2 C;  1L1O B;  1KRT A;  3NEN A;  5JJI A;  5IP9 G;  2UXB L;  4OO1 G;  4MTN A;  4NXM Q;  4A3J G;  1EYG A;  4AQY Q;  1QVF A;  4A3B H;  1VQE A;  3JAM i;  2BA1 A;  1AE3 A;  4L5Q A;  2D0P A;  4XIG S;  3KJO A;  3PIO A;  4P72 A;  3CCR A;  1UE5 A;  1YNX A;  1KL9 A;  3PV0 A;  1CKM A;  4L5R C;  2IX0 A;  4GLV B;  2NN6 G;  5FLM G;  1EWI A;  1A62 A;  4DK6 C;  2Y0S G;  1CSP A;  2K5N A;  1VQA A;  2ZJR A;  4OWT B;  3VDY A;  2B63 H;  1U0L A;  2MNA A;  4JOI A;  3CME A;  4YWL A;  1I94 Q;  1JE5 A;  1X56 A;  4DR1 Q;  4A93 G;  3F1Z A;  1YVC A;  2OWO A;  1IL2 A;  4B3R L;  1KXL A;  4GNX B;  1PVO A;  1C0A A;  4BY1 G;  1NBW A;  5GAH C;  4DV3 L;  1KQS A;  2JA8 H;  2PI2 A;  2PMZ E;  1SLJ A;  2UUA Q;  3J81 i;  1FL0 A;  4NB3 A;  3A0J A;  1KD1 C;  1VQ8 A;  1N8R C;  1EQR A;  4JI2 Q;  3HOZ H;  3F2C A;  1IXR A;  2Z6K A;  4R4T A;  4DV7 L;  4HJ8 A;  4JI4 Q;  5E7N A;  5M5Y H;  1KHI A;  4BXX H;  5IT9 c;  2R7F A;  2RCN A;  1E1T A;  2OQK A;  2HHH Q;  3S2D H;  1BKB A;  1OXT A;  5H1S E;  2ZJP A;  3T1H Q;  4JV5 Q;  1UEB A;  2K50 A;  4EQ5 A;  2KCT A;  4X62 Q;  1H95 A;  1X55 A;  5LMN L;  4LF7 L;  4JYA L;  3D0F A;  3CMA A;  2UUC Q;  4A3G H;  4LFB Q;  2VQE Q;  4DR3 Q;  3DM3 A;  4LUV A;  4APV A;  1UE7 A;  4WJ3 M;  4PZ6 A;  4K0K L;  1V9P A;  1VS0 A;  1W3S A;  4KLK A;  1V1Q A;  3GO5 A;  5M3F G;  4A3F H;  4JI1 L;  3UE1 A;  2KCM A;  5AJ3 L;  4DR5 Q;  1TWG H;  5C44 H;  1VQM A;  1SRO A;  5GAD C;  1ASY A;  4IOC A;  3M4Q A;  1OTC A;  4OO1 I;  3PIP A;  5IE8 A;  2LSS A;  5GAG C;  2UXC L;  1C9O A;  1PYS B;  2OTJ A;  5C4X H;  4YCW A;  2EQS A;  3KF6 B;  2UUB Q;  2YTX A;  4LFC Q;  1PH8 A;  1G6P A;  4POF A;  3G48 A;  4POG A;  1M1K C;  1ASZ A;  4X65 L;  2I5L X;  1K3R A;  2N3S A;  3CCS A;  4C2M H;  2MO1 A;  5FJ8 G;  4A3L G;  4LFA L;  1I3Q H;  3I4N G;  4C3H H;  1HNZ Q;  3CPF A;  2K5H A;  3KDF A;  4A3D H;  1T9H A;  4P73 A;  4UPA A;  4NXN Q;  4QGU A;  3HOU G;  4P75 A;  2ZTE A;  2RF4 A;  4DV5 L;  1PH6 A;  1GM5 A;  1IBM L;  2OTL A;  3S16 H;  4EX5 A;  4X64 Q;  1YJ9 A;  4OX9 L;  2HIV A;  3J7Z C;  3PO2 H;  4LUO A;  3HOX G;  2D62 A;  4PZ7 A;  4LF8 L;  4WJ4 A;  4YWM A;  4KHP Q;  2KHJ A;  3NEM A;  4DAM A;  1WCM H;  1Q46 A;  4B3S L;  1Y1V H;  2R7D A;  1EOV A;  1UWV A;  4DR6 Q;  1XJV A;  2A8V A;  4QIW E;  1N36 Q;  3MXN B;  4GLA C;  4PMW A;  3CXC A;  4A3E G;  1J5E Q;  1DGS A;  1OXX K;  1MKH A;  3B6Y A;  3LGJ A;  3CC7 A;  2F52 A;  1JB7 A;  1WJJ A;  1XNR L;  3GTM H;  4B3T L;  2JEA I;  1D7Q A;  5HGQ A;  3H0G G;  4GN5 A;  1Z9F A;  4YCV A;  3S14 H;  2UXD L;  1GVP A;  3GTL H;  4DV1 Q;  1XPU A;  2KEN A;  3CPW A;  3PUW A;  1JJC B;  5IWA L;  3PO3 G;  1HNW L;  2R7Z H;  1HZA A;  1PYB A;  1D8L A;  2E8G A;  3KJP A;  2H5X A;  2I5M X;  4YY3 L;  4GKK Q;  2VQF L;  1YHB A;  1X3G A;  1VQ4 A;  2LXK A;  4YWK A;  5FLX c;  2R6G A;  1VQI A;  2ATW A;  1K9M C;  2GVA A;  4IPC A;  3HOW G;  3TQY A;  5J3B A;  2K75 A;  1GO3 E;  2NVY H;  4DV0 Q;  1XNQ Q;  2CKZ B;  5M5X H;  1HZB A;  4JI7 L;  4A3M H;  4LF4 L;  2VL6 A;  4GOP A;  3PUZ A; 
#chains in the Genus database with same CATH topology
 4MNO A;  2Q2H A;  2XGT A;  4OL7 A;  1MJ9 A;  2HDM A;  4C1N I;  1STH A;  2ES2 A;  4A3B G;  3ND9 A;  4OIJ A;  1E22 A;  1G2S A;  2VZA A;  2NU4 I;  2WVJ A;  1YO7 A;  2WP8 J;  3JAM c;  4DAP A;  1DYQ A;  1R4Q B;  2E5L L;  2RC4 A;  3HGB A;  3QWN A;  4YZD A;  3EN2 A;  1EL0 A;  3FKI B;  4JI3 Q;  4PG3 A;  2O5I C;  1EWH A;  4RH6 A;  3LX0 A;  2XTQ A;  2XSC A;  4NKL A;  1X54 A;  3VR3 A;  4N9P A;  4RHS A;  1CT2 I;  1HR0 Q;  3E59 A;  1FAQ A;  3OMC A;  3PUY A;  1ZKO A;  3QOL A;  4DXG A;  2BL8 A;  4LF9 L;  1AW7 A;  3BYY B;  4DR2 L;  4DR7 Q;  4B3R Q;  3PQI A;  1X3Q A;  5FKA C;  4B08 A;  5C4J H;  2CQO A;  1KBE A;  3UI2 A;  3GTK H;  2B39 A;  4DV3 Q;  4B6D A;  3GTG H;  2FU2 A;  5DM6 3;  1SE4 A;  3HOZ G;  2Z8L A;  2JQO A;  3MAQ A;  3UEJ A;  2N17 A;  5D65 A;  3OTO L;  3S2D B;  1V1P A;  3GTP H;  3NHH A;  1F9S A;  3RR5 A;  5C0X H;  1LTG D;  1TVX A;  2M9V A;  1LLR D;  2NTS A;  3MVV A;  1B1Z A;  2V1C A;  5HGT A;  1WTQ A;  1D1I A;  5HI7 A;  1Q1E A;  1EEI D;  5FUV A;  1Y1C A;  4A3F G;  4EQO A;  2K5W A;  2JA5 H;  4K0K Q;  3VA5 A;  3G6E A;  3RLO A;  3SK4 A;  3S17 H;  1EYA A;  5E1F A;  4C3I H;  1TR5 A;  4JI1 Q;  5M3M B;  5AJ3 Q;  1GUW A;  5C4X G;  4ZKC B;  1N32 L;  2WAQ E;  2YU9 B;  2ORW A;  2SDF A;  3L0O A;  4RCN A;  3T1H L;  1YNJ C;  2A69 C;  2JXM B;  2K5Q A;  2ZXR A;  4X62 L;  1S72 A;  2B2Y A;  3ERO A;  1IKL A;  1M90 C;  2VQE L;  3TN2 A;  3Q6S A;  1SAP A;  2Z9H A;  5IOD A;  5CV7 A;  2ZT9 C;  4A3D G;  1CKN B;  1W6K A;  2IPK D;  3KF6 A;  3BJU A;  3M7G A;  1IY5 A;  2A6E D;  2NU2 I;  3S1R H;  2BA0 A;  1N33 L;  3PO2 G;  2PQA B;  1KTK A;  3FPP A;  1SNP A;  2RSO A;  1ZEQ X;  1WCM B;  4IFD G;  3CU7 A;  1Y1V B;  1QUQ B;  2IP6 A;  1FVI A;  4H44 C;  4M8A A;  4NP5 A;  1SMY C;  5C0X I;  4B3S Q;  2B2T A;  5JJL A;  2Z4H A;  4ODG A;  3Q24 A;  1HR0 W;  1OMU A;  3IRB A;  2AMC B;  2PNH A;  1Y8F A;  1AN1 I;  2ZW3 A;  3S14 B;  1DJR D;  4A3C H;  3AFP A;  1IKM A;  4X6A H;  5K36 G;  3FVQ A;  2R7Z B;  2R92 H;  1EIF A;  3JC6 6;  3FSY A;  4HFV A;  3I73 A;  2FXQ A;  2BDN A;  1P8L A;  3CCV A;  2WB1 E;  2PW5 A;  1WFQ A;  4N9T A;  5LNK 1;  2PI2 E;  2QDL A;  5M5X B;  4A3M G;  1V1H A;  1VQH A;  2L0C A;  2KMP A;  1MHW C;  2BH8 A;  3M3Y H;  1F2Y A;  4JOI C;  4JI7 Q;  3RN5 A;  2PW7 A;  2MJ8 A;  2TMP A;  2Z6B A;  3VDU A;  4A3K H;  4A3I B;  3CCM A;  1TIH A;  3FSX A;  4XT1 B;  1VQO A;  2F4V L;  4AH6 A;  2F0J A;  2Z6K C;  3HFZ B;  2RDF A;  1NJI C;  4HJA A;  4XDX A;  2M00 A;  4ZYS A;  4ALP A;  1FJG Q;  2JA7 G;  4MPI A;  3U9S A;  5ISR A;  1QZH A;  3STB C;  1K8G A;  1BVS A;  5C4J B;  2ZM6 L;  2EYL A;  4R8N A;  2PYK A;  3H09 A;  3FRP B;  1B3A A;  5DM7 3;  5KNB A;  3GTK B;  1XBT A;  2ERW A;  4O1O A;  5ELF A;  3GTG B;  1PTQ A;  1E2V A;  4NPS A;  4JI8 L;  1QNK A;  2SOB A;  3NTH A;  3DLL A;  3GTP B;  3NTK A;  4M1U B;  3IKJ A;  1K7U A;  2UU9 Q;  4LF5 L;  4KY7 A;  3S15 H;  1CZW A;  1NUB A;  2XRQ D;  3M4Y A;  2IHF A;  3F8T A;  4HIO A;  3QB3 A;  3T1Y Q;  1I94 L;  3NWS A;  1K8M A;  5IGG A;  2XTI A;  3AYH B;  4LF7 Q;  4GS3 A;  2DGY A;  3I4O A;  2JA5 B;  4XQQ A;  1SJH D;  2CW0 C;  1VQ9 A;  3S17 B;  4DUZ L;  1IYJ B;  4C3I B;  1PH2 A;  1PTO H;  2UUA L;  3MEK A;  2WV6 D;  5EGT A;  2Z1C A;  1Z47 A;  4HMI A;  2CCZ A;  1PRT C;  1TWH H;  2WAC A;  4N8F A;  1Q12 A;  2E2I H;  2IX1 A;  1DCZ A;  2BOS A;  3MFY A;  2B2W C;  4C3J B;  3J7A 5;  4H7B A;  2F0H A;  4LFB L;  3PF5 A;  2HUG A;  4V0B A;  4OEL B;  4K6L A;  3P1H A;  2XRS D;  3S1R B;  4H02 A;  5EPK A;  4E1R A;  1CSQ A;  4LFA Q;  1XPU A;  4P74 A;  1H9S B;  1HTL D;  2BE5 D;  4OWX B;  4DPG A;  5M5W B;  3CRL C;  4RGN A;  2O2L D;  4Z7H A;  1KC8 C;  4DNI A;  3I4M G;  1Y1B A;  4RGO S;  1LM0 A;  3HH2 C;  2JN4 A;  1TS5 A;  4OX9 Q;  3UDX A;  5C3E G;  4GKJ Q;  2PQE A;  1SNC A;  2EZV A;  4LF8 Q;  2ELI A;  4ZUJ A;  5IOC A;  4G4K A;  2IW3 A;  1U4M A;  4IQZ A;  4RHR A;  1U9R A;  3WWV A;  1EQQ A;  3NQI A;  4HIK A;  3HKZ G;  1HNX Q;  1PRT B;  1NNX A;  4F7X A;  1QVG A;  5FJ8 H;  3NPP A;  1Q8K A;  2EYH A;  2R92 B;  4DV6 Q;  4LF6 Q;  3QWP A;  3LNN A;  3HOU H;  2P5Z X;  3E6Z X;  4CDD C;  5M9O A;  4LAA A;  4KHP L;  2F0F A;  3ERQ A;  2L15 A;  1PH4 A;  2E2J H;  1L1O C;  3UEY A;  1I4R A;  5GRO A;  4QQB X;  1WGC A;  1U5K A;  2FMC A;  4NV2 A;  3M3Y B;  4OVO A;  4X3U A;  3GDE A;  1ESF A;  3RLN A;  1ICF B;  4KHZ A;  3D6C A;  3RD4 A;  3LWE A;  4KD4 A;  3RZD H;  1B4O A;  5HQ8 A;  3CKI B;  4DV1 L;  3S1N H;  4A3K B;  4Z9C B;  5GAE C;  4DF7 A;  5K36 H;  2QQD A;  1E3P A;  3S1Q B;  3OL0 A;  5J8F A;  4GKK L;  3FVV A;  2WKC A;  2I5H A;  2QA4 A;  2MUY A;  5IYD G;  1PTO C;  2QSB A;  2A2C A;  4DUY Q;  1KMA A;  3BZD B;  4RA8 A;  3I55 A;  3HOW B;  4O1N A;  4U6R A;  2JJQ A;  3TEH B;  2RDG A;  1LTT D;  2Q2I A;  4PNY A;  3CRK C;  2NU3 I;  1F2M A;  4UXI A;  5BN3 A;  5FOB B;  4GLX A;  3OMG A;  1L1O B;  1RJT A;  3NEN A;  7WGA A;  2UXB L;  1VQE A;  2BA1 A;  1AE3 A;  1MGS A;  3QO2 A;  4XIG S;  4KJO A;  3VYT A;  4IUN A;  1GXD C;  3PV0 A;  2LEO A;  4L5R C;  1F2L A;  2NN6 G;  1MJB A;  3S15 B;  4L6T B;  4DK6 C;  2K5N A;  3OHX C;  2B63 H;  2MNA A;  2OZU A;  3JAM L;  3AMU A;  2SGE I;  1T5X D;  3F1Z A;  1B3Q A;  4OAU C;  1UEA B;  4IAL A;  1I4G A;  2IJ0 A;  5IGD A;  1PTO B;  1C0A A;  4BY1 G;  5FUW A;  2JA8 H;  1STN A;  1ZXT A;  1CA5 A;  1RHP A;  4IUT A;  1YTP A;  3UOE A;  1GUG A;  2LMC B;  4UXJ A;  3D4W A;  4R4T A;  4DV7 L;  2E2I B;  5M5Y H;  3EA6 A;  1E1T A;  2HHH Q;  2A6H C;  3D3R A;  3BYT B;  5H1S E;  2EJG C;  5ELE A;  2LUY A;  4JV5 Q;  1PRT F;  2K50 A;  4EQ5 A;  3J7A V;  1H95 A;  3J81 E;  3DM3 A;  1XTC D;  5CYU A;  2F0D A;  4A3F B;  1UE7 A;  3TDQ A;  4PZ6 A;  4WJ3 M;  3SK8 A;  1VS0 A;  1V1Q A;  3GO5 A;  5M3F G;  2DNC A;  1DS2 I;  2KCM A;  2CH4 W;  4DR5 Q;  5C44 H;  3N6R A;  1P9Z A;  1EY9 A;  3R5B A;  4Q0F A;  1JQY D;  4OO1 I;  1FD7 D;  2LSS A;  1YNN C;  5C4X B;  1Y69 U;  1PYS B;  4DXF A;  2OTJ A;  4DWL A;  3A56 A;  1QG7 A;  1BUS A;  2X6L A;  4XQJ A;  2DY7 A;  4LFC Q;  3BJI A;  3Q22 A;  1G6Z A;  1VF7 A;  3FC3 A;  3BS1 A;  2I5L X;  1K3R A;  4X3K A;  1DD2 A;  1IW7 D;  2X6G A;  2BCO A;  2HQE A;  1I3Q H;  2NB0 A;  1JOR A;  2P22 B;  3FNB A;  2AQ3 B;  3CPF A;  2RBM A;  4UPA A;  4NXN Q;  2F0E A;  4DV5 L;  1GM5 A;  3HOU B;  3PO2 B;  2PMZ B;  4PV1 C;  4DFA A;  2HIV A;  3HOX G;  2E2J B;  2D62 A;  2B0U C;  4RGT A;  4JW0 A;  4YWM A;  2KHJ A;  3OXF A;  2XWB B;  2R7D A;  4WRD A;  4PMW A;  4LMQ D;  5CV9 A;  1MKH A;  3RZD B;  1D7Q A;  3VE5 A;  1Z9F A;  3MXU A;  1ULK A;  5COY A;  2OVO A;  2QGM A;  1HNW L;  5E3P A;  1HEV A;  3R93 A;  3QJY A;  2ODD A;  2UVO A;  4QCL A;  2I5M X;  4YY3 L;  1BCP D;  4H13 C;  1D5M C;  3MHB A;  2XN9 C;  1N13 A;  1VQ4 A;  2LXK A;  1D5Z C;  2RAD A;  2ATW A;  2NVY B;  4XQN A;  3SEK C;  4RKL A;  3P7J A;  4A3M B;  1XNQ Q;  1HZB A;  1PTO F;  1A2T A;  5EQ0 A;  2KUM A;  1PZK D;  1SND A;  2EVB A;  1Y8P B;  2W0T A;  1UE6 A;  1LUZ A;  1Q86 C;  3KUP A;  5JOB A;  1QWY A;  2RCF A;  5C4Z A;  2R93 G;  4KKU A;  3NQT A;  3D31 A;  3OWE B;  5JJZ A;  4BA2 I;  3A8J E;  1SGN I;  2QZG A;  1TBO A;  3NUC A;  4ZKB B;  4AYB E;  1Q7Y C;  5A2Q L;  1WTP A;  1CQV A;  2EDG A;  4J15 A;  4DR4 L;  2GKV A;  4ZUI A;  3ND8 A;  3FKI H;  3SVM A;  3NEL A;  4MTK A;  2L11 A;  2B63 B;  4YZC A;  5AFW A;  4QF4 A;  2EPB A;  2MP1 A;  1XPO A;  1U4R A;  1WI5 A;  2JA8 B;  2GKR I;  1UAP A;  3X3N A;  3D8G A;  1O80 A;  1WVL A;  5EPL A;  1Y8N B;  1B7Y B;  1Q90 A;  2A6E C;  3TSS A;  4GNX A;  2QQC A;  5CBA E;  2O4X A;  5M5Y B;  4BXX G;  1PA6 A;  1K73 C;  1SDF A;  3F2U A;  5IYC H;  4FF4 A;  1F9P A;  1YHQ A;  2F0O A;  3GP7 A;  4MIU A;  1N34 Q;  3SK6 A;  5DAE A;  2K14 A;  3GV6 A;  2AHO B;  4BBS G;  1O7Z A;  4XTC S;  1J6Q A;  1Z7K B;  4DR1 L;  3CD6 A;  3URY A;  4UDU C;  3D4R A;  3OW2 A;  2EYP A;  3H3V I;  1NR4 A;  2XRC A;  2LKV A;  4B3M L;  5IY0 A;  3CF5 A;  1KAB A;  2JB1 A;  4KHV A;  1KBF A;  1SR3 A;  1JOO A;  1GHJ A;  3NBI A;  5CGK A;  4JI4 L;  3J80 L;  5M3M H;  2JW6 A;  3I56 A;  5J8C A;  1EY7 A;  1LT5 D;  2LY7 A;  2DUD A;  4UAI A;  1GJX A;  2ETD A;  2YU9 H;  2HIX A;  1CA6 A;  1SEB D;  4TSS A;  1NXU A;  3V2T A;  1B2T A;  2L9H A;  2RIJ A;  1I4X A;  4C3H G;  4RFB A;  3ERS X;  5IP7 H;  1MJE A;  1SGR I;  1L2F A;  1IBM Q;  1SN8 A;  3I4M B;  2PPB C;  1GD7 A;  1ZYR C;  3CHB D;  2I46 A;  3G7L A;  1I4Q A;  5C3E B;  3EJI A;  3SGI A;  3AQQ A;  3KLR A;  3PSI A;  2UUB L;  4L9M A;  2PQ8 A;  3F2D A;  1OXS C;  4TKO B;  5G3L D;  3IL8 A;  4DK3 C;  4K5V A;  2C35 B;  1SJ8 A;  1EYC A;  4DU9 A;  4ZLT F;  5LL6 X;  1VQB A;  1XNR Q;  5C5M A;  3MEH A;  3F2B A;  1C7Y A;  4A4I A;  2WKD A;  3R2I A;  4DA2 A;  2NVT H;  1BXT A;  5JJK A;  4OGQ C;  2QQE A;  3VR6 A;  3G71 A;  2N1A B;  4KKT A;  2VW9 A;  4HIM A;  2SGQ I;  3AEV A;  1RIP A;  1VDZ A;  4L5T A;  2F3C I;  2L55 A;  4R4I A;  1IBL L;  1I6H H;  2EXD A;  1VQJ A;  3PDN A;  2F0V A;  3GOX A;  1M8C A;  2JB2 A;  1LAC A;  1JIC A;  2F0S A;  1E1O A;  2NU0 I;  2VB2 X;  2F0U A;  3SGQ I;  2ICE C;  1SGP I;  1JWS D;  3TP5 A;  1AN8 A;  1BBX C;  2XWJ B;  4G57 A;  2QEX A;  4NDX A;  3GQB A;  3UIT A;  2OCE A;  1V1I A;  3Q23 A;  3NSW A;  4ME5 A;  2D5D A;  5KYL A;  4DV2 L;  2F0N A;  3VDP A;  3HOY G;  3ULL A;  1UVG A;  1RTN A;  5EBD A;  5EKI A;  2VUM H;  1RFH A;  5A35 A;  2E5L Q;  3K7U C;  1CT1 D;  3BDO A;  1HPC A;  4R4C A;  4A3I H;  3K7A H;  4G7H C;  2A74 C;  3MC0 B;  4CDE C;  2B29 A;  1IBK L;  1PCE A;  2GIV A;  2JAE A;  3DWP A;  1H9M A;  3TRE A;  4LJZ C;  4JBM A;  4R1J A;  5CV8 A;  4KK7 A;  3I70 A;  1KDA A;  2KKM A;  1MIU A;  2ZTC A;  3E0J A;  2FMM A;  4LF9 Q;  4DR2 Q;  4G75 A;  2XIW A;  1A3T A;  2JA9 A;  4KY6 A;  1NCV A;  3GV3 A;  1K83 H;  3GTO H;  2F3I A;  1D2B A;  2DJF C;  3NXW A;  5JEA J;  2R93 H;  3R3O A;  3KY9 A;  4OAV B;  5IP9 H;  2NUC A;  2VY3 A;  4JI3 L;  4QUC A;  3Q8D A;  4HTH A;  1VMC A;  2BE5 C;  3ICE A;  3H15 A;  9WGA A;  2I0Q A;  1NMF A;  4KV6 A;  3OTO Q;  1VQG A;  4ZAI A;  1HR0 L;  1EY5 A;  1EEF D;  2PCF B;  1FY7 A;  2WB1 G;  1NUC A;  1F9Q A;  4QY7 A;  5FUX A;  1PH1 A;  1X65 A;  4RAU C;  5I9P A;  1TS4 A;  1YZ6 A;  2JSO A;  5IGF A;  2IHE A;  3JAM E;  1ESR A;  3DM1 A;  4G7Z C;  4DR7 L;  3R5C A;  1PFS A;  3S2H H;  4BY1 B;  1TII D;  1M8A A;  5KGU A;  2JYY A;  4Z7G A;  1PH9 A;  1N32 Q;  2NZO A;  4AYB B;  2RDH A;  1SGE I;  4A76 A;  3X3M A;  2A68 D;  3K80 C;  2K01 A;  4BBS H;  2QGQ A;  1I5F A;  4C3J H;  3OXG A;  1EWC A;  4KN4 C;  2GVI A;  1HHV A;  4B9W A;  1S5B D;  3CCU A;  1XWE A;  2CWP A;  4JG2 A;  5C3W A;  1N33 Q;  3U4V A;  1VMP A;  4IPH A;  3OYY A;  4BBR G;  5M5W H;  4WOR A;  1C48 A;  3E5S A;  4ME3 A;  4J6H A;  2F4I A;  1BDO A;  2MO0 A;  4R4Q A;  1R9T H;  5E4X A;  4NW2 A;  4TQU S;  1SYG A;  4GI3 C;  4DAY A;  4R9W A;  2EY2 A;  4DGZ A;  3BVG A;  5C0X J;  2CWG A;  1R79 A;  1Q3L A;  1SFO H;  1G51 A;  3BVM A;  3FP9 A;  3T53 B;  3HOV G;  2NVT B;  2N55 A;  2RQX A;  2OD1 A;  1PDQ A;  1D5X C;  4P71 A;  2RIO A;  1JC7 A;  1HFN A;  4X64 L;  3LWU A;  5HY6 A;  1VQF A;  1WOC A;  1I6H B;  1HJA I;  2NTT A;  5E3F A;  3HOX B;  3I3C A;  2RVL A;  2QPO A;  1L0Y B;  4KTA A;  1YHA A;  4FP5 D;  1QVC A;  3E0E A;  4O2D A;  5LL6 S;  1B9N A;  3KFU A;  4KMU C;  1N36 L;  1LT6 D;  4BA1 I;  1LTB D;  2VNU D;  3KP9 A;  5GQO A;  1YJN A;  3Q0A A;  3HRZ C;  2ZJQ A;  2JE6 I;  3M4O H;  1K8A C;  4FF1 A;  1JT8 A;  2KED A;  3BZC A;  2Z0S A;  2VUM B;  1XTD A;  2KHS A;  5C5L A;  1AP0 A;  3IFD A;  3CQZ H;  3EIV A;  1G29 1;  1JR0 D;  3MEF A;  4I1T A;  3S1Q H;  3K7A B;  2F4V Q;  2Z4I A;  1X9N A;  1CT4 I;  4ABN A;  1IYV A;  2QIL A;  1DXM A;  2JA6 G;  1BQQ T;  4BY7 G;  4DV0 L;  1HZC A;  5C4H A;  1PH3 A;  5FUY A;  3HOW H;  1O7I A;  2V1C C;  5HGI A;  2LB7 A;  2O5J C;  1Y1W G;  3W3A A;  2GA4 B;  1GUT A;  2DY8 A;  2F0M A;  1K83 B;  2ZM6 Q;  3GTO B;  1TDP A;  1BO0 A;  4OO1 G;  2DJG C;  4MTN A;  2R93 B;  4A3J G;  1EYG A;  4AQY Q;  4A3B H;  5FLX E;  2LS0 1;  3JAM i;  1TBN A;  2KMR A;  4L5Q A;  2YQP A;  4FO2 A;  1HTP A;  1YNX A;  1JB3 A;  2IX0 A;  3BG3 A;  3L9A X;  4KY5 A;  5FLM G;  5C6A A;  1A62 A;  4U67 3;  2Y0S G;  1CSP A;  5EBC A;  2ZJR A;  4OWT B;  5ELB A;  4YWL A;  2B2Y C;  1I94 Q;  5CMD A;  4A93 G;  3S2H B;  1KXL A;  4DAV A;  1QOH A;  3B55 A;  1NBW A;  1KQS A;  1IW7 C;  1H9J A;  2PI2 A;  2PMZ E;  5EKK A;  1HUN A;  2UUA Q;  1V1P B;  1A15 A;  5J22 A;  3OOC A;  5IIF A;  4XYQ A;  1EY6 A;  1VQ8 A;  2CHB D;  1RF2 D;  4JI2 Q;  3HOZ H;  2CQA A;  5E7N A;  4Q5V A;  3VYS A;  4JVZ A;  1PXU A;  1PTR A;  3VA7 A;  2OQK A;  3TOA A;  4BBS B;  4PMC A;  1UNS A;  4TRD A;  5HUR A;  1WD1 A;  4QUF A;  3I72 A;  4IUP A;  5LMN L;  4LF7 L;  4JYA L;  3D0F A;  3CMA A;  4LFB Q;  3OVO A;  4DNT B;  1HXY D;  4XT3 B;  5BN5 A;  1FR3 A;  1W3S A;  1TWG B;  1FYB A;  3S9W A;  1DM0 B;  4A3F H;  4PMB A;  4G7O C;  1WTO A;  1NAP A;  5GAD C;  5IT9 L;  1HFG A;  1B53 A;  3J80 E;  1OTC A;  1BF4 A;  5GAG C;  4A24 A;  1SXT A;  1K0S A;  1R9T B;  2YUU A;  2NWG A;  5C4X H;  4YCW A;  2EQS A;  1BCP C;  4ZCK A;  3KF6 B;  3NBH A;  1SFO B;  3G48 A;  1HQR D;  2NZ1 D;  4X65 L;  2J9R A;  3CCS A;  2N3S A;  3K5N A;  4A3L G;  1B50 A;  5TSS A;  4LFA L;  3I4N G;  2CVR A;  3TP8 A;  1HNZ Q;  4A3D H;  3BDC A;  3KDF A;  2Y0M A;  1LTI D;  1T9H A;  4P73 A;  4QB4 A;  3S16 B;  4QGU A;  1S20 A;  4P75 A;  3MZ5 A;  1NSN S;  1PH6 A;  4EX5 A;  4OX9 L;  3J7Z C;  3PO2 H;  2F0P A;  3FMC A;  4LF8 L;  2EY5 A;  2Q8R E;  4KHP Q;  2B2U C;  4IFD H;  2F0W A;  1AZP A;  5IGC A;  2L1B A;  2F3W A;  3CXC A;  1J5E Q;  3UFF A;  1DGS A;  1OXX K;  3B6Y A;  3CC7 A;  1WJJ A;  3OIP A;  4B3T L;  3M4O B;  4CJ2 C;  5HGQ A;  3H0G G;  4GN5 A;  1VDD A;  3GTL H;  4DV1 Q;  4K2K A;  3CQZ B;  1BCP B;  1JJC B;  1TKW B;  5IWA L;  1GOZ A;  3PO3 G;  4C1N K;  1KAA A;  4JK1 C;  1PYB A;  1PZJ D;  4GKK Q;  2H5X A;  4H0L C;  1QJO A;  1X3G A;  2K9H A;  2R6G A;  1STY A;  3B4V C;  2MJF B;  3TQY A;  5J3B A;  1MBY A;  1MI2 A;  2NVY H;  4A3M H;  1K0R A;  2QF7 A;  4GOP A;  1H9K A;  1Q8I A;  1LYL A;  5BR8 Q;  2B8F A;  4G76 A;  3A74 A;  3RN2 A;  1CUK A;  4JBJ A;  1YEZ A;  4K8J A;  2ENB A;  1UUP A;  4X66 L;  3HOY B;  4A3B B;  2UXB Q;  3KF8 A;  1CE3 A;  1IHZ A;  1VQC A;  1STA A;  3UGL A;  1SMY D;  4GN4 B;  3CC2 A;  1A2U A;  1Q82 C;  3EBE A;  4PL5 A;  3U58 A;  4Y52 H;  3NK9 A;  4OON A;  3J81 j;  4IFD I;  1HH2 P;  2JA7 H;  3QTL D;  1SYE A;  4DV4 L;  1MSG A;  3SHL A;  2ARP F;  2XVS A;  3UGD A;  3NTI A;  1VQK A;  1STG A;  2N88 A;  3TS0 A;  1GUO A;  3WOF A;  1I50 B;  3J81 c;  2K5V A;  4YHH Q;  1HRJ A;  5FK9 C;  3HOZ B;  3KOJ A;  4PQX A;  1KLU D;  4JPB W;  4IUQ A;  2JZM A;  1WKX A;  1PJU A;  3DEP A;  4DV7 Q;  3DHQ A;  3RUZ A;  2B3G A;  2EYF A;  5FO9 B;  4AS2 A;  1N9W A;  3CC4 A;  1P9G A;  5E4W C;  4Y7N H;  1KNE A;  5KRU A;  1S5E D;  4A3G G;  3J80 i;  4RKB A;  3HKZ E;  2YTV A;  5EJW A;  3TP7 A;  4JI0 Q;  2KBN A;  1XPR A;  2ENN A;  2KEC A;  4A93 H;  1WTJ A;  4CBV A;  4KI0 A;  1CKO A;  1RTO A;  2A1A A;  3PCO B;  1B70 B;  2HCI A;  2SGP I;  3RZO H;  3PUX A;  4JI5 Q;  3K57 A;  2FIN B;  4JV5 L;  2B8G A;  4YCU A;  3W1G A;  3CCQ A;  1K7T A;  1OO9 B;  3K0X A;  3DWA A;  4EVO A;  1PV4 A;  4HAE A;  1STB A;  3C1F A;  4A3D B;  2F1M A;  1BCP F;  2GSC A;  2N78 A;  1TQO A;  4LWC A;  2KEE A;  3HG9 A;  1EYD A;  1VQD A;  4BBR B;  4O0A A;  1CHQ D;  3W1B A;  4HSP A;  2HD3 A;  1MD2 D;  3I4M H;  1WCM G;  1BOS A;  1TWA H;  1Y1V G;  4DK1 A;  3R2T A;  3LJ1 A;  4LFC L;  1RDP D;  2X52 A;  5C3E H;  2B2V A;  5JVH 3;  2CW0 D;  5NUC A;  2E2H B;  3BZK A;  2A2D A;  3SDZ A;  5JEA G;  5LMU L;  2ROW A;  1LAB A;  5C3X A;  1XMO L;  1DS3 I;  3GTL B;  3ZYY X;  3DA3 A;  3MXN A;  3S24 A;  4WJW A;  4GN3 B;  1LR7 A;  2BH2 A;  2MPM A;  1QZG A;  4YY3 Q;  3M7N A;  1RD9 D;  3D6W A;  1YI2 A;  2CWA A;  3HS0 C;  4U68 A;  2F66 B;  2BUS A;  2F0Q A;  2R61 A;  1X3P A;  1JOK A;  1OVO A;  2VRW B;  1TS2 A;  1X6O A;  2PZW A;  2VXW A;  1FGU A;  4S3S A;  1HA6 A;  3C3L A;  4K5W A;  3NWT A;  1KLG D;  2EXZ A;  1EIG A;  2D9U A;  5EAY A;  5JPM C;  1TXY A;  1LTS D;  4QL5 A;  3J7A F;  1SGD I;  5E3Q A;  1EQT A;  1PH7 A;  1EIY B;  2IL8 A;  5CV6 A;  4R8I A;  4L5S A;  2PNR C;  3AJF A;  1AE2 A;  4KD3 A;  5IYD H;  4DR4 Q;  2JA7 B;  4DNR B;  1FNU A;  1WTX A;  1VQ5 A;  2JA6 B;  1BBW A;  2GN5 A;  4PZ8 A;  2GVB A;  4FF3 A;  2A68 C;  4JI6 L;  5CCL A;  1T5E A;  2Q2U A;  1XMQ L;  2AKW B;  1EZ6 A;  3S1M H;  5JAV A;  4NXM L;  1LR9 A;  2LFN A;  4ZRZ A;  1S4Z A;  2HCC A;  4AIM A;  3HKS A;  2QW7 A;  1PYW D;  3MXG A;  5C0X G;  2HT1 A;  2EE1 A;  4Y7N B;  2AQ2 B;  4QJF A;  3TJQ A;  2NN6 H;  4IJH A;  3L2P A;  1STE A;  4CJ1 B;  2XNA C;  3FHW A;  1JMC A;  4A93 B;  2JA5 G;  5CV4 A;  1CZG A;  3M4P A;  3GTJ B;  4C3I G;  3K58 A;  1VQN A;  4B3M Q;  3RMH A;  4J8Q A;  4BY1 H;  1PHJ A;  2K03 A;  3A5U A;  1F9R A;  3RZO B;  1E2W A;  3FEW X;  1PMR A;  3PGZ A;  4HGU A;  1N34 L;  2MQH A;  4O1P A;  1VQ6 A;  3CP0 A;  3OIQ A;  2UXC Q;  2M2L A;  2EYJ A;  3TZD A;  4UP9 A;  1OXV A;  4K2L A;  2AWN A;  2UUC L;  1W2B A;  2K4K A;  2QEJ C;  4DR3 L;  1ROD A;  4YIJ A;  2RLD A;  3MWY W;  2OQ0 A;  3SDJ A;  2K32 A;  1CHP D;  1S5D D;  4TVA B;  5M3F H;  5IT9 E;  1CKN A;  4UY8 C;  1TWA B;  1SE3 A;  3DEO A;  4Q9V A;  1A8V A;  3MTS A;  2YTY A;  1MJC A;  2ZTD A;  2RA4 A;  1KNA A;  4GXT A;  1YBY A;  2PQA A;  2F0G A;  3RLF A;  2NN6 I;  2A19 A;  2K1B A;  1PFN A;  1CSO I;  4IUU A;  3K5M A;  2GKT I;  3SXH A;  4MZ9 A;  1ILQ A;  1QUQ A;  4CHT B;  4A3C G;  3NE5 B;  3HKZ B;  4IOA A;  5COR A;  1MJA A;  4UP8 A;  5CR3 A;  3I4N B;  2R92 G;  2HGK A;  3ZJY C;  2UXD Q;  3K8A A;  3IAS 1;  1E0B A;  1R4P B;  1O7Y A;  2RHS B;  1EY0 A;  5F2D A;  5BN4 A;  1AZQ A;  1TWF B;  4BWG B;  2BDO A;  2L4N A;  2X3T A;  3TS2 A;  2YV5 A;  1IBL Q;  3HOX H;  1GUN A;  2VQF Q;  1EIH A;  3VR5 A;  3KYH C;  2WAQ G;  3N52 A;  3UDF A;  5JHW C;  1U4P A;  4DR6 L;  3SEB A;  3PF4 A;  3R5A A;  1IY6 A;  3KBX A;  4X3T A;  4LF4 Q;  4IO9 A;  5EKL A;  4A3K G;  1MT1 A;  1QE6 A;  2ICI A;  4DV2 Q;  3HZX A;  2K28 A;  2DKV A;  2ZRR A;  2V53 A;  2F3V A;  4GNX C;  3DWQ A;  1CQF A;  5IYB G;  3PUV A;  1QNU A;  4EQP A;  1HZ9 A;  4C56 C;  1I4P A;  1IBK Q;  4JCV E;  2K6A A;  4K14 A;  2KA7 A;  2AQ1 B;  4MHE A;  1AH9 A;  1ENC A;  1XX6 A;  1ONL A;  2FHT A;  2CWH A;  5IGE A;  3VR2 A;  3S1M B;  2ID0 A;  1M8B A;  3I4L A;  2E76 C;  5JJI A;  1VF5 C;  2J4X A;  1WTH A;  1UVF A;  1SYB A;  4UHV A;  2L5T A;  3KJO A;  3PIO A;  4CJ0 B;  1UE5 A;  1CKM A;  1A3V A;  2V4D A;  4GLV B;  1EWI A;  2H4O A;  3TP6 A;  4KN7 C;  3VDY A;  1MSH A;  1U0L A;  3TOB A;  4JOI A;  4OEM B;  3CME A;  1GHK A;  2OU2 A;  4B3R L;  2CJS C;  4GNX B;  2KMQ A;  4DV3 L;  5I4D A;  1SLJ A;  4I65 A;  1FL0 A;  3I9V 1;  2IWH A;  2KCN A;  1IXR A;  2Z6K A;  4HED A;  3VA9 A;  1LTR D;  2QQ0 A;  2CH4 A;  3AU7 A;  4BXX H;  5KND A;  2R7F A;  3SR1 A;  3T16 A;  4F88 A;  1QCB D;  3TO7 A;  2ZJP A;  5CBE E;  4HR7 B;  1UEB A;  3T1H Q;  4A3G B;  2KCT A;  4X62 Q;  2B8T A;  1X55 A;  4FYD A;  3J81 L;  1CM9 A;  4CDC C;  2VQE Q;  1H0Z A;  2JYO A;  2CAZ B;  2A73 B;  2YFA A;  2BL7 A;  2XTR A;  4K0K L;  4NV5 A;  4DNC A;  4JI1 L;  5M3F B;  1CGJ I;  5AJ3 L;  1TWG H;  1Z7T A;  1ASY A;  1SYD A;  4IOC A;  1XA6 A;  3PIP A;  5IE8 A;  2DN8 A;  3LJ2 A;  2E73 A;  1C9O A;  1UHA A;  1H9S A;  5DNF A;  4FF2 A;  2YFB A;  3KLS X;  5T1G A;  3U9O A;  2YTX A;  2NYZ D;  1EFI D;  3PMF A;  4F87 A;  4POF A;  1ASZ A;  1B44 D;  1XX8 A;  4YZ9 A;  4C2M H;  2MO1 A;  5FJ8 G;  1JCK B;  3UGI A;  4C3H H;  5KNC A;  2K5H A;  1EU3 A;  1Q9B A;  5KIX A;  3I90 A;  3HOU G;  1ILP A;  2ZTE A;  4DN4 M;  2K04 A;  3S16 H;  1HPT A;  4IUV A;  4X64 Q;  1YJ9 A;  4XXE A;  2L7X A;  4LUO A;  5FO7 B;  4CKB A;  4PZ7 A;  2QDB A;  2F6M B;  2Q8T A;  1L0X B;  4B3S L;  2B2W A;  1TS3 A;  2A8V A;  1PFM A;  3GTM B;  1N36 Q;  4GLA C;  4A3E G;  3L3O C;  3LGJ A;  2F52 A;  1XXG A;  2JEA I;  3E3X A;  2E74 C;  1GVP A;  3CPW A;  2DNE A;  1GUS A;  2WCY A;  3OXL A;  1D1K A;  5EPJ A;  1DON A;  1H9R A;  3LJ0 A;  1LT4 D;  3PIO 3;  1U4L A;  1SGQ I;  5CV5 A;  1IW4 A;  1YHB A;  4HCS A;  4YWK A;  4KJN A;  5FLX c;  1TY0 A;  1SNM A;  2E5R A;  2GVA A;  1JWM D;  4LK1 C;  4IPC A;  3OPO A;  2K75 A;  4DV0 Q;  1TBQ R;  2A5H A;  4F8M A;  4JI7 L;  4KKS A;  4RG1 A;  2SNM A;  1TWC H;  1IYU A;  1LO5 D;  5ELD A;  1YJW A;  1ZYR D;  4EGV A;  3KLS A;  5E3R A;  1FNW A;  4HSV A;  3UE0 A;  3EFX D;  3HOY H;  3K5O A;  1ET6 A;  3F4M A;  1K28 A;  2N49 A;  2X69 A;  1BUV T;  1X4S A;  2B2U A;  1L1O A;  1SNQ A;  4JI8 Q;  1WTV A;  2D0O A;  5A2Q E;  1A63 A;  1R0R I;  5IYB H;  4O42 A;  1FJG L;  1F2Z A;  2B63 G;  3I8Z A;  3KBG A;  3FDT A;  4CDF C;  1XYI A;  4LF5 Q;  2FJ2 A;  1E7Z A;  1TGS I;  2I07 B;  3EVQ A;  3G4S A;  1V1O A;  4OXP A;  4RMF A;  1TU2 B;  2IY5 B;  4QIW B;  1AEX A;  2JA8 G;  4BS9 A;  4OWW B;  3G6J B;  3P75 A;  3A7A B;  4AQY L;  3L0I A;  4DUZ Q;  1C8C A;  5D3D A;  1IZ6 A;  4FXG C;  1HQM C;  1I50 H;  4HJ7 A;  1CK1 A;  1TT2 A;  3PIP 3;  1K7V A;  3UDI A;  1TUS A;  2L8E A;  1NY4 A;  5FO8 B;  1ULN A;  1S5C D;  2EOT A;  2UU9 L;  3C1E A;  2P6A C;  4IPG A;  3J80 c;  4RCO A;  3T1Y L;  1OXU A;  2KQ3 A;  5ELN A;  2B2T C;  5LMN Q;  5D3I B;  4JYA Q;  3QR8 A;  1S3O A;  5DAU A;  2WII B;  4HN7 A;  2SGF I;  1WYD A;  1V43 A;  1ENF A;  2AWO A;  1JOQ A;  5EX0 A;  2F0K A;  3OSO A;  5C44 G;  4ZK9 B;  1W4R A;  4AS3 A;  2AUJ D;  3CCJ A;  4IJL A;  4JI2 L;  2A20 A;  1WTW A;  3CCL A;  1RL2 A;  2AUK A;  5KYI A;  3UDG A;  3U50 C;  3ITP A;  3BU2 A;  3GD7 A;  1ML0 D;  1VQL A;  3ER0 A;  1NR2 A;  2VS1 A;  1X3E A;  2SGD I;  1LV9 A;  3HP3 A;  4UXH A;  4C2M B;  3CAM A;  4X65 Q;  4RGM A;  4C3H B;  2EYM A;  3T13 A;  5J39 A;  1DOK A;  1W6J A;  3K6O A;  1WD0 A;  1FNV A;  2F03 A;  1EY4 A;  3DMU A;  3QG1 A;  1G91 A;  1KRS A;  3A8K E;  2ZXO A;  4L63 B;  4BBR H;  4DAY B;  3V05 A;  4N8X 1;  4GKJ L;  1DOM A;  4E6I A;  1SMX A;  3VYU A;  3TRZ A;  1EOT A;  3IAY A;  4L8J A;  1YU6 C;  3K0Y A;  3TO9 A;  4LUZ A;  1HNX L;  2E2H H;  1SE8 A;  3A7L A;  1NE3 A;  1HNZ L;  1B8A A;  3A55 A;  4B3T Q;  3HOV H;  2E75 C;  1DOL A;  1YIJ A;  2NZH A;  4DV6 L;  4LF6 L;  4PL4 A;  2WGC A;  1Q1B A;  2R3Z A;  1BR9 A;  5EX3 A;  5IWA Q;  3IFT A;  3T4A C;  3C46 A;  1EFW A;  1YNJ D;  2A69 D;  1JQO A;  2H1E A;  3E9H A;  1RCV D;  1P16 A;  2Y0S E;  2ENZ A;  5KEE A;  3L7Z C;  3QOJ A;  3I2Z A;  2WAQ B;  1Y8O B;  3QAH A;  3O13 A;  1A0I A;  1KAW A;  1J5E L;  4HCE A;  2XMX A;  1NMG A;  5I6W A;  1SBB B;  4PL3 A;  5I2Y A;  5LMN W;  4A3E H;  1TWC B;  1X74 A;  3H94 A;  2ASB A;  4R4O A;  3V96 A;  2J87 A;  1HA5 A;  1I4H A;  3K81 C;  4X66 Q;  5I6Y A;  3D00 A;  3FBV A;  1X3F A;  5ELC A;  3W5O A;  1SYF A;  2UZ3 A;  2N8N A;  1K3B C;  3FKI G;  2NVQ H;  3H6M A;  3OW7 A;  3RU0 A;  4DUY L;  4LF4 L;  2E2D C;  1TBR R;  1Y14 B;  1PFB A;  5ELO A;  2VB3 X;  1LTL A;  1WTR A;  4IFD J;  2FNF X;  2EIF A;  2JA6 H;  4BY7 H;  5BR8 L;  3M85 A;  4DV4 Q;  2RKS A;  5T1I A;  4WP4 A;  1TUR A;  2EY6 A;  1GKH A;  2RSN A;  1Y1W H;  2Q8I B;  2NU1 I;  3U4Z A;  1SRU A;  1BMO A;  4DKA C;  3CCE A;  2MFI A;  4RWS C;  2QKI C;  3NP8 A;  4OO1 H;  3I7F A;  2IX3 A;  1KDC A;  5IYC G;  4A3J H;  4FNF A;  3W2D A;  2KMO A;  2DIP A;  4IN3 A;  4MN3 A;  4OIK A;  1HDL A;  2WB1 B;  5FLM H;  1NTG A;  1K8O A;  4LW1 A;  3AB9 A;  3JSB A;  1CFM A;  4ZQ3 A;  4IPD A;  5DEH A;  3FPU B;  1EU4 A;  3IAM 1;  4UP7 A;  4HJ9 A;  2IT1 A;  3ONA B;  2K33 A;  4J1M A;  2FEF A;  4JBW A;  3RNU A;  1AFP A;  1D6E C;  4YHH L;  3GTJ H;  5IGB A;  5JVG 3;  5M3M G;  1TWH B;  2JBW A;  1CHO I;  3R8B A;  1DZ1 A;  3ULP A;  4FDB A;  3TZU A;  4AYB G;  1A3U A;  2HHH L;  3STB D;  3A5Z B;  1WGT A;  1CT0 I;  1YIT A;  4JI0 L;  1EZ8 A;  2C9O A;  2EJF C;  5L37 A;  2ZXP A;  3DO9 A;  2JP1 A;  1PH5 A;  1JJG A;  2K52 A;  5IP7 G;  2N52 A;  2J7Z A;  3WOE A;  1VQ7 A;  1E24 A;  2K19 A;  4JBK A;  4DR5 L;  1UE1 A;  2WFW A;  1JJ2 A;  1BNZ A;  4HJ5 A;  3KK7 A;  5DLQ E;  3E9I A;  1BBU A;  4JI5 L;  4DV5 Q;  3GTQ H;  3NBH B;  1LR8 A;  2M5X A;  1QIL A;  2EY1 A;  1OYV I;  2KOL A;  4EQN A;  3BVZ A;  2HQL A;  1JE4 A;  3AFQ A;  3KDF B;  1SNO A;  1KDB A;  3I91 A;  1C4Q A;  1OMT A;  4ILW A;  5LMU Q;  4I7Z C;  4LNQ A;  3HOV B;  4GOP C;  3E2I A;  4E1P A;  1XMO Q;  2NBF A;  1ENA A;  4NXN L;  4A3L H;  1PRT D;  2ORV A;  3I4N H;  4FXK C;  2R7Z G;  3BDL A;  3KLW A;  2KHI A;  5JPN C;  2F0I A;  2DB6 A;  2OF1 A;  1QB5 D;  2CFM A;  2LXJ A;  1HNW Q;  2G9H D;  3VYR A;  4ID6 A;  4P2C B;  2NVX H;  2JK8 A;  2OT2 A;  1TWF H;  1F77 A;  2WIN B;  3TBI B;  3ULJ A;  2F0L A;  1HJP A;  5LHY 1;  2J0T D;  3SE0 A;  2JXD A;  2QCP X;  3VR4 A;  4V19 0;  4A3E B;  4XYO A;  1VQP A;  2Q2T A;  3J7Y W;  1Q81 C;  3S1N B;  3SGB I;  1II3 A;  4A75 A;  2EYO A;  1TY2 A;  4OHJ A;  1CI3 M;  1G8Z D;  4JC0 A;  1FGB D;  3H0G H;  2VUM G;  1SE2 A;  5K5P A;  4FVM A;  1S40 A;  1PLF A;  4HID A;  2JB3 A;  4A3I G;  3PO3 H;  5I9O A;  4HEA 1;  2NVQ B;  2F0T A;  2RHQ B;  1EUJ A;  4I7A A;  2PO4 A;  3SK5 A;  5CC4 A;  1LTA D;  4GOP B;  2ALY B;  4IZ8 A;  3K5L A;  1PZI D;  3MXP A;  2YYZ A;  1VCI A;  1XNQ L;  1SYC A;  4BY7 B;  1L0W A;  1KIX A;  4B9X A;  3H3V H;  2JEB I;  1ULM A;  3KF8 B;  4JI6 Q;  1XMQ Q;  2PZU A;  3M9B A;  1Y1W B;  3CW2 C;  1KRT A;  2FFK B;  4CKC A;  5IP9 G;  1I6V C;  1IL8 A;  4NXM Q;  1UUC A;  3DUZ A;  1QVF A;  5FLX L;  4A3J B;  4GZY C;  2D0P A;  4P72 A;  3CCR A;  1KL9 A;  2HDL A;  3H91 A;  3C2P A;  1B9M A;  1M4V A;  2EJM A;  1J8I A;  1VQA A;  2Y0S B;  3A8I E;  3CXL A;  2D2C C;  3D4D A;  3A54 A;  1JE5 A;  1X56 A;  4DR1 Q;  2OXP A;  2G5D A;  1YVC A;  2OWO A;  2C5C A;  2FUG 1;  1IL2 A;  3K59 A;  1PVO A;  5GAH C;  4AML A;  3J81 i;  3TO6 A;  4NB3 A;  3A0J A;  1PTO D;  5G3L F;  1KD1 C;  1X32 A;  1N8R C;  1CTM A;  1EQV A;  1EQR A;  3HEJ A;  4CGY B;  3F2C A;  1V8Q A;  2SNS A;  4HJ8 A;  4JI4 Q;  3R5D A;  1HCZ A;  1KHI A;  2CWF A;  2SEB D;  1SJE D;  1J9O A;  5IT9 c;  2RCN A;  3S2D H;  1BKB A;  1OXT A;  4C3J G;  4CKE A;  2B2V C;  3P20 A;  3TME A;  2UUC Q;  4A3G H;  4DR3 Q;  3OWF A;  4LUV A;  1O7L A;  4APV A;  1PPF I;  1V9P A;  4KLK A;  5C44 B;  2L1L B;  1SSO A;  4NMZ A;  3UE1 A;  2K5D A;  2PZT A;  1VQM A;  1SRO A;  3GTQ B;  1HUM A;  1S5F D;  3M4Q A;  2UXC L;  5J1Z A;  3T56 B;  4DK0 A;  1ICW A;  1JWU D;  2UUB Q;  3MFG A;  3QIA A;  1FYC A;  1PH8 A;  2OEO A;  1G6P A;  4POG A;  3EQL C;  1M1K C;  1TOT A;  3DXJ C;  1I3Q B;  1A6X A;  2KCC A;  3P23 A;  3MA2 B;  4SGB I;  2K7V A;  2TSS A;  1SGY I;  3H3V C;  1IBM L;  2RF4 A;  2OTL A;  1FAR A;  2NVX B;  2A6H D;  4WJ4 A;  1RKN A;  4ULL A;  4FKD A;  2MGS A;  3NEM A;  4DAM A;  1WCM H;  1Q46 A;  1Y1V H;  1Z2I A;  1EOV A;  1UWV A;  4DR6 Q;  5I2X A;  1XJV A;  2V6E A;  4QIW E;  1Z6H A;  3MXN B;  2JA1 A;  1JB7 A;  1XNR L;  5D14 A;  3GTM H;  2N71 A;  1G2T A;  4HMJ A;  4FXD A;  4QMG A;  5JEA H;  3T51 B;  4IUR A;  1ET9 A;  4YCV A;  3WDN A;  3S14 H;  3H0G B;  2UXD L;  2KVM A;  2KEN A;  1CGI I;  3PUW A;  1YNN D;  2G9D A;  1EY8 A;  3PO3 B;  4K8I A;  2R7Z H;  1HZA A;  2KJX A;  1D8L A;  2E8G A;  2K05 A;  3KJP A;  1E2Z A;  2VQF L;  2KCX A;  4K5X A;  1LT3 D;  1VQI A;  1K9M C;  2L12 A;  2MHV A;  4X3S A;  4K6D A;  3HOW G;  5CCM A;  1GO3 E;  2CKZ B;  5M5X H;  4WFN 3;  3DA4 A;  1O78 A;  2VL6 A;  3PUZ A; 
#chains in the Genus database with same CATH homology
 4MNO A;  2Q2H A;  2XGT A;  2ES2 A;  4A3B G;  2NU4 I;  1E22 A;  2WVJ A;  2VZA A;  1YO7 A;  2WP8 J;  3JAM c;  2E5L L;  4YZD A;  3EN2 A;  4JI3 Q;  4PG3 A;  2XTQ A;  1X54 A;  1CT2 I;  1HR0 Q;  3E59 A;  1FAQ A;  3PUY A;  4LF9 L;  4DR2 L;  4DR7 Q;  4B3R Q;  5C4J H;  2CQO A;  1KBE A;  3GTK H;  4DV3 Q;  4B6D A;  3GTG H;  3HOZ G;  2JQO A;  3UEJ A;  2N17 A;  3OTO L;  3GTP H;  3RR5 A;  2V1C A;  5HI7 A;  1Q1E A;  5FUV A;  1Y1C A;  4A3F G;  2JA5 H;  4K0K Q;  3G6E A;  3RLO A;  3S17 H;  4C3I H;  4JI1 Q;  5AJ3 Q;  5C4X G;  1N32 L;  2WAQ E;  2ORW A;  3L0O A;  3T1H L;  4X62 L;  1S72 A;  1M90 C;  2VQE L;  4A3D G;  1CKN B;  3KF6 A;  3BJU A;  1IY5 A;  2NU2 I;  3S1R H;  2BA0 A;  1N33 L;  3PO2 G;  2PQA B;  4IFD G;  1QUQ B;  2IP6 A;  1FVI A;  5C0X I;  4B3S Q;  5JJL A;  1HR0 W;  1OMU A;  3IRB A;  2AMC B;  2PNH A;  1Y8F A;  1AN1 I;  4A3C H;  3AFP A;  4X6A H;  5K36 G;  2R92 H;  1EIF A;  3JC6 6;  4HFV A;  2FXQ A;  1P8L A;  3CCV A;  2WB1 E;  1WFQ A;  5LNK 1;  2PI2 E;  4A3M G;  1V1H A;  1VQH A;  2KMP A;  2BH8 A;  3M3Y H;  4JOI C;  4JI7 Q;  3RN5 A;  3VDU A;  4A3K H;  3CCM A;  1TIH A;  1VQO A;  2F4V L;  4AH6 A;  3HFZ B;  2Z6K C;  1NJI C;  2JA7 G;  4HJA A;  4ALP A;  1FJG Q;  1QZH A;  3STB C;  1K8G A;  1BVS A;  2ZM6 L;  2ERW A;  1XBT A;  4O1O A;  1PTQ A;  4NPS A;  4JI8 L;  3DLL A;  2UU9 Q;  4LF5 L;  3S15 H;  1NUB A;  2IHF A;  3F8T A;  4HIO A;  3T1Y Q;  1I94 L;  2XTI A;  3AYH B;  4LF7 Q;  4GS3 A;  2DGY A;  3I4O A;  1VQ9 A;  4DUZ L;  1IYJ B;  1PH2 A;  2UUA L;  3MEK A;  1Z47 A;  2CCZ A;  1TWH H;  1Q12 A;  2E2I H;  2IX1 A;  3J7A 5;  4LFB L;  3PF5 A;  4H02 A;  4E1R A;  1CSQ A;  4LFA Q;  1XPU A;  4P74 A;  4OWX B;  4DPG A;  4Z7H A;  1KC8 C;  4DNI A;  3I4M G;  1Y1B A;  1LM0 A;  3HH2 C;  4OX9 Q;  3UDX A;  5C3E G;  4GKJ Q;  4LF8 Q;  2ELI A;  3WWV A;  1EQQ A;  4HIK A;  3HKZ G;  1HNX Q;  1QVG A;  5FJ8 H;  1Q8K A;  4DV6 Q;  4LF6 Q;  3QWP A;  3HOU H;  4KHP L;  1PH4 A;  2L15 A;  2E2J H;  1L1O C;  3UEY A;  5GRO A;  4QQB X;  1U5K A;  4NV2 A;  4OVO A;  3GDE A;  3RLN A;  4KHZ A;  3RZD H;  5HQ8 A;  4DV1 L;  3S1N H;  5GAE C;  2QQD A;  1E3P A;  3OL0 A;  4GKK L;  2I5H A;  2QA4 A;  5IYD G;  2A2C A;  4DUY Q;  1KMA A;  3I55 A;  4U6R A;  2JJQ A;  3TEH B;  2Q2I A;  2NU3 I;  4UXI A;  4GLX A;  1L1O B;  3NEN A;  2UXB L;  1VQE A;  2BA1 A;  1AE3 A;  4XIG S;  3PV0 A;  2LEO A;  4L5R C;  2NN6 G;  4DK6 C;  2K5N A;  2B63 H;  2MNA A;  2SGE I;  3F1Z A;  4OAU C;  1C0A A;  5FUW A;  4BY1 G;  2JA8 H;  1YTP A;  4UXJ A;  4R4T A;  4DV7 L;  5M5Y H;  1E1T A;  2HHH Q;  5H1S E;  2LUY A;  4JV5 Q;  2K50 A;  4EQ5 A;  1H95 A;  3DM3 A;  1UE7 A;  4WJ3 M;  4PZ6 A;  1VS0 A;  1V1Q A;  3GO5 A;  5M3F G;  1DS2 I;  2KCM A;  4DR5 Q;  5C44 H;  4OO1 I;  2LSS A;  1PYS B;  2OTJ A;  4DWL A;  1BUS A;  4LFC Q;  3BJI A;  3FC3 A;  2I5L X;  1K3R A;  1I3Q H;  2P22 B;  3CPF A;  4NXN Q;  4UPA A;  4DV5 L;  1GM5 A;  2HIV A;  3HOX G;  2D62 A;  2B0U C;  4YWM A;  2KHJ A;  3OXF A;  2R7D A;  4PMW A;  1MKH A;  1D7Q A;  3VE5 A;  1Z9F A;  2OVO A;  1HNW L;  2ODD A;  2I5M X;  4YY3 L;  1N13 A;  1VQ4 A;  2LXK A;  2ATW A;  3SEK C;  1XNQ Q;  1HZB A;  2W0T A;  1UE6 A;  1LUZ A;  1Q86 C;  2R93 G;  3D31 A;  4BA2 I;  1SGN I;  1TBO A;  4AYB E;  1Q7Y C;  4J15 A;  4DR4 L;  2GKV A;  3FKI H;  3NEL A;  4YZC A;  1XPO A;  1WI5 A;  2GKR I;  1B7Y B;  4GNX A;  2QQC A;  4BXX G;  1PA6 A;  1K73 C;  5IYC H;  1YHQ A;  1N34 Q;  5DAE A;  2K14 A;  2AHO B;  4BBS G;  4XTC S;  1J6Q A;  1Z7K B;  4DR1 L;  3CD6 A;  3OW2 A;  3H3V I;  2XRC A;  4B3M L;  5IY0 A;  3CF5 A;  2JB1 A;  1KBF A;  1SR3 A;  4JI4 L;  5M3M H;  2JW6 A;  3I56 A;  2DUD A;  2YU9 H;  2HIX A;  3ERS X;  5IP7 H;  1MJE A;  1SGR I;  1L2F A;  1IBM Q;  1SN8 A;  1GD7 A;  3SGI A;  3AQQ A;  3PSI A;  2UUB L;  4L9M A;  3F2D A;  1OXS C;  4DK3 C;  2C35 B;  1SJ8 A;  1XNR Q;  1VQB A;  3F2B A;  1C7Y A;  4A4I A;  2NVT H;  2QQE A;  5JJK A;  3G71 A;  2N1A B;  2VW9 A;  4HIM A;  2SGQ I;  3AEV A;  1RIP A;  4L5T A;  2F3C I;  4R4I A;  1IBL L;  1I6H H;  2EXD A;  1VQJ A;  3PDN A;  3GOX A;  1M8C A;  2JB2 A;  1E1O A;  2NU0 I;  3SGQ I;  1SGP I;  2QEX A;  3UIT A;  2OCE A;  1V1I A;  4DV2 L;  3VDP A;  3HOY G;  3ULL A;  1UVG A;  2VUM H;  1RFH A;  2E5L Q;  3K7U C;  4R4C A;  4A3I H;  3K7A H;  1IBK L;  2B29 A;  1PCE A;  2JAE A;  3TRE A;  4JBM A;  4R1J A;  2KKM A;  1MIU A;  2ZTC A;  4LF9 Q;  4DR2 Q;  4G75 A;  2JA9 A;  1K83 H;  3GTO H;  2F3I A;  5JEA J;  2R93 H;  3KY9 A;  4OAV B;  5IP9 H;  2VY3 A;  4JI3 L;  3Q8D A;  3ICE A;  3H15 A;  2I0Q A;  1NMF A;  3OTO Q;  1VQG A;  1HR0 L;  2WB1 G;  4QY7 A;  5FUX A;  1PH1 A;  1X65 A;  1YZ6 A;  2IHE A;  4DR7 L;  1PFS A;  3S2H H;  2JYY A;  4Z7G A;  1PH9 A;  1N32 Q;  2NZO A;  1SGE I;  4A76 A;  3K80 C;  4BBS H;  2QGQ A;  1I5F A;  4C3J H;  3OXG A;  2GVI A;  3CCU A;  2CWP A;  4JG2 A;  1N33 Q;  3U4V A;  4IPH A;  3OYY A;  4BBR G;  5M5W H;  4ME3 A;  2MO0 A;  4R4Q A;  1R9T H;  4TQU S;  4GI3 C;  5C0X J;  1R79 A;  1SFO H;  1G51 A;  3FP9 A;  3HOV G;  2OD1 A;  4P71 A;  2RIO A;  4X64 L;  5HY6 A;  1VQF A;  1WOC A;  1HJA I;  2QPO A;  1YHA A;  1QVC A;  3E0E A;  4O2D A;  3KFU A;  1N36 L;  4BA1 I;  2VNU D;  3KP9 A;  5GQO A;  1YJN A;  2ZJQ A;  2JE6 I;  3M4O H;  1K8A C;  1JT8 A;  3BZC A;  2Z0S A;  1XTD A;  3CQZ H;  3EIV A;  1G29 1;  3MEF A;  4I1T A;  3S1Q H;  2F4V Q;  1X9N A;  1CT4 I;  2JA6 G;  4BY7 G;  4DV0 L;  1HZC A;  5FUY A;  1PH3 A;  3HOW H;  1O7I A;  2V1C C;  5HGI A;  1Y1W G;  2ZM6 Q;  4OO1 G;  4MTN A;  4A3J G;  1EYG A;  4AQY Q;  4A3B H;  3JAM i;  1TBN A;  2KMR A;  4L5Q A;  2YQP A;  1YNX A;  2IX0 A;  5FLM G;  1A62 A;  2Y0S G;  1CSP A;  2ZJR A;  4OWT B;  4YWL A;  1I94 Q;  4A93 G;  1KXL A;  1NBW A;  1KQS A;  2PI2 A;  2PMZ E;  2UUA Q;  1VQ8 A;  4JI2 Q;  3HOZ H;  5E7N A;  1PTR A;  2OQK A;  5LMN L;  4LF7 L;  4JYA L;  3D0F A;  3CMA A;  4LFB Q;  3OVO A;  1W3S A;  1FYB A;  4A3F H;  5GAD C;  1OTC A;  5GAG C;  4A24 A;  2YUU A;  5C4X H;  4YCW A;  2EQS A;  3KF6 B;  3G48 A;  2J9R A;  4X65 L;  3CCS A;  2N3S A;  4A3L G;  4LFA L;  3I4N G;  1HNZ Q;  4A3D H;  3KDF A;  1T9H A;  4P73 A;  4QGU A;  4P75 A;  1PH6 A;  4EX5 A;  4OX9 L;  3J7Z C;  3PO2 H;  4LF8 L;  4KHP Q;  3CXC A;  3UFF A;  1J5E Q;  1DGS A;  1OXX K;  3B6Y A;  3CC7 A;  1WJJ A;  4B3T L;  5HGQ A;  3H0G G;  4GN5 A;  1VDD A;  3GTL H;  4DV1 Q;  5IWA L;  1JJC B;  3PO3 G;  1PYB A;  4GKK Q;  2H5X A;  1X3G A;  2K9H A;  2R6G A;  3B4V C;  2MJF B;  3TQY A;  5J3B A;  2NVY H;  4A3M H;  1K0R A;  4GOP A;  1LYL A;  5BR8 Q;  4G76 A;  3A74 A;  3RN2 A;  1CUK A;  4JBJ A;  1YEZ A;  4X66 L;  2UXB Q;  1CE3 A;  1VQC A;  3UGL A;  4GN4 B;  3CC2 A;  1Q82 C;  3EBE A;  4PL5 A;  3U58 A;  4Y52 H;  4OON A;  3J81 j;  4IFD I;  1HH2 P;  2JA7 H;  3QTL D;  4DV4 L;  2ARP F;  3UGD A;  1VQK A;  3TS0 A;  3J81 c;  2K5V A;  4YHH Q;  3KOJ A;  2JZM A;  1PJU A;  4DV7 Q;  2B3G A;  3CC4 A;  4AS2 A;  1N9W A;  4Y7N H;  4A3G G;  3J80 i;  3HKZ E;  2YTV A;  4JI0 Q;  2KBN A;  1XPR A;  2ENN A;  4A93 H;  4KI0 A;  1CKO A;  2A1A A;  3PCO B;  1B70 B;  2SGP I;  3RZO H;  3PUX A;  4JI5 Q;  4JV5 L;  4YCU A;  3W1G A;  3CCQ A;  3K0X A;  1PV4 A;  2N78 A;  4LWC A;  1VQD A;  4O0A A;  3W1B A;  3I4M H;  1WCM G;  1TWA H;  1Y1V G;  3LJ1 A;  4LFC L;  5C3E H;  3BZK A;  2A2D A;  5JEA G;  5LMU L;  2ROW A;  1XMO L;  1DS3 I;  3DA3 A;  3S24 A;  4GN3 B;  1LR7 A;  2BH2 A;  1QZG A;  4YY3 Q;  3M7N A;  1YI2 A;  2CWA A;  2F66 B;  2BUS A;  1OVO A;  2VRW B;  1X6O A;  1FGU A;  5EAY A;  1TXY A;  4QL5 A;  1SGD I;  1PH7 A;  1EIY B;  4L5S A;  3AJF A;  1AE2 A;  5IYD H;  4DR4 Q;  1VQ5 A;  1BBW A;  2GN5 A;  4PZ8 A;  2GVB A;  4JI6 L;  5CCL A;  2Q2U A;  1XMQ L;  2AKW B;  3S1M H;  4NXM L;  1LR9 A;  4AIM A;  3HKS A;  5C0X G;  2HT1 A;  4QJF A;  3TJQ A;  4IJH A;  3L2P A;  1JMC A;  3FHW A;  2JA5 G;  3M4P A;  1VQN A;  4B3M Q;  4BY1 H;  1PHJ A;  3A5U A;  3PGZ A;  4HGU A;  1N34 L;  2MQH A;  4O1P A;  1VQ6 A;  3CP0 A;  2UXC Q;  4UP9 A;  1OXV A;  2AWN A;  2UUC L;  1W2B A;  2K4K A;  4DR3 L;  2OQ0 A;  3SDJ A;  4TVA B;  5M3F H;  1CKN A;  4UY8 C;  4Q9V A;  1A8V A;  2YTY A;  1MJC A;  2ZTD A;  4GXT A;  1YBY A;  2PQA A;  3RLF A;  2NN6 I;  2A19 A;  1CSO I;  2GKT I;  4MZ9 A;  1QUQ A;  4A3C G;  4IOA A;  4UP8 A;  2R92 G;  3ZJY C;  2UXD Q;  3K8A A;  3IAS 1;  2RHS B;  3TS2 A;  2YV5 A;  1IBL Q;  3HOX H;  2VQF Q;  3KYH C;  2WAQ G;  3UDF A;  5JHW C;  4DR6 L;  3PF4 A;  1IY6 A;  4LF4 Q;  4IO9 A;  4A3K G;  1MT1 A;  4DV2 Q;  2ZRR A;  2V53 A;  4GNX C;  5IYB G;  3PUV A;  1HZ9 A;  1IBK Q;  4JCV E;  1AH9 A;  1XX6 A;  2ID0 A;  1M8B A;  5JJI A;  1UVF A;  3KJO A;  3PIO A;  1UE5 A;  1CKM A;  4GLV B;  1EWI A;  3VDY A;  1U0L A;  4JOI A;  3CME A;  4B3R L;  2CJS C;  4GNX B;  2KMQ A;  4DV3 L;  1SLJ A;  1FL0 A;  3I9V 1;  1IXR A;  2Z6K A;  3VA9 A;  2QQ0 A;  4BXX H;  2R7F A;  2ZJP A;  3T1H Q;  1UEB A;  2KCT A;  4X62 Q;  2B8T A;  1X55 A;  2VQE Q;  1H0Z A;  2CAZ B;  2YFA A;  2XTR A;  4K0K L;  4NV5 A;  4JI1 L;  1CGJ I;  5AJ3 L;  1TWG H;  1ASY A;  1XA6 A;  4IOC A;  3PIP A;  5IE8 A;  3LJ2 A;  2E73 A;  1C9O A;  2YFB A;  2YTX A;  4POF A;  1ASZ A;  4YZ9 A;  4C2M H;  2MO1 A;  5FJ8 G;  3UGI A;  4C3H H;  2K5H A;  3HOU G;  2ZTE A;  3S16 H;  1HPT A;  4X64 Q;  1YJ9 A;  2L7X A;  4LUO A;  4PZ7 A;  2F6M B;  4B3S L;  2A8V A;  1N36 Q;  4GLA C;  4A3E G;  3LGJ A;  2F52 A;  2JEA I;  1GVP A;  3CPW A;  2WCY A;  3OXL A;  1SGQ I;  3LJ0 A;  1IW4 A;  1YHB A;  4YWK A;  5FLX c;  2E5R A;  2GVA A;  4IPC A;  2K75 A;  4DV0 Q;  1TBQ R;  4JI7 L;  4RG1 A;  1TWC H;  1YJW A;  3UE0 A;  3HOY H;  3F4M A;  2N49 A;  1X4S A;  1L1O A;  4JI8 Q;  2D0O A;  1A63 A;  1R0R I;  5IYB H;  1FJG L;  2B63 G;  4LF5 Q;  1E7Z A;  1TGS I;  3G4S A;  4OXP A;  4RMF A;  2IY5 B;  2JA8 G;  4OWW B;  4AQY L;  3L0I A;  4DUZ Q;  1IZ6 A;  1I50 H;  4HJ7 A;  1TUS A;  3UDI A;  2L8E A;  1NY4 A;  2UU9 L;  2P6A C;  4IPG A;  3J80 c;  3T1Y L;  1OXU A;  5ELN A;  5LMN Q;  4JYA Q;  1S3O A;  2SGF I;  1WYD A;  1V43 A;  2AWO A;  5EX0 A;  5C44 G;  1W4R A;  4AS3 A;  3CCJ A;  4IJL A;  4JI2 L;  2A20 A;  3CCL A;  1RL2 A;  3UDG A;  3U50 C;  3BU2 A;  3GD7 A;  1VQL A;  3ER0 A;  2VS1 A;  1X3E A;  2SGD I;  4UXH A;  3CAM A;  4X65 Q;  1KRS A;  4BBR H;  4DAY B;  4GKJ L;  1SMX A;  3TRZ A;  1YU6 C;  4LUZ A;  1HNX L;  2E2H H;  1SE8 A;  1NE3 A;  1HNZ L;  1B8A A;  4B3T Q;  3HOV H;  1YIJ A;  2NZH A;  4DV6 L;  4LF6 L;  4PL4 A;  1Q1B A;  5EX3 A;  5IWA Q;  1EFW A;  3E9H A;  1P16 A;  2Y0S E;  2ENZ A;  3L7Z C;  3I2Z A;  1A0I A;  1KAW A;  1J5E L;  2XMX A;  1NMG A;  4A3E H;  4PL3 A;  5LMN W;  1X74 A;  2ASB A;  4R4O A;  2J87 A;  3K81 C;  4X66 Q;  3D00 A;  3FBV A;  1X3F A;  3W5O A;  2UZ3 A;  2N8N A;  3FKI G;  2NVQ H;  3RU0 A;  4DUY L;  1TBR R;  1Y14 B;  5ELO A;  1LTL A;  4IFD J;  2FNF X;  2EIF A;  2JA6 H;  4BY7 H;  5BR8 L;  3M85 A;  4DV4 Q;  1TUR A;  1GKH A;  1Y1W H;  2NU1 I;  3U4Z A;  1SRU A;  1BMO A;  4DKA C;  3CCE A;  2MFI A;  3I7F A;  4A3J H;  5IYC G;  2KMO A;  2DIP A;  1HDL A;  5FLM H;  1NTG A;  4LW1 A;  3JSB A;  4IPD A;  3IAM 1;  4UP7 A;  4HJ9 A;  2IT1 A;  3RNU A;  4JBW A;  4YHH L;  3GTJ H;  5M3M G;  1CHO I;  3ULP A;  4FDB A;  4AYB G;  2HHH L;  3STB D;  3A5Z B;  1CT0 I;  1YIT A;  4JI0 L;  3DO9 A;  1JJG A;  1PH5 A;  2K52 A;  5IP7 G;  2N52 A;  1VQ7 A;  1E24 A;  2K19 A;  4JBK A;  4DR5 L;  1UE1 A;  2WFW A;  1JJ2 A;  4HJ5 A;  5DLQ E;  3E9I A;  1BBU A;  4JI5 L;  4DV5 Q;  3GTQ H;  3NBH B;  1LR8 A;  2M5X A;  1OYV I;  2HQL A;  3AFQ A;  3KDF B;  1OMT A;  5LMU Q;  4LNQ A;  3E2I A;  4GOP C;  4E1P A;  1XMO Q;  4NXN L;  4A3L H;  2ORV A;  3I4N H;  2R7Z G;  3KLW A;  2KHI A;  2DB6 A;  2CFM A;  2LXJ A;  1HNW Q;  2NVX H;  2JK8 A;  1TWF H;  3ULJ A;  1HJP A;  2JXD A;  1VQP A;  2Q2T A;  1Q81 C;  3SGB I;  4A75 A;  4JC0 A;  3H0G H;  2VUM G;  1S40 A;  3PO3 H;  4HID A;  2JB3 A;  4A3I G;  4HEA 1;  2RHQ B;  1EUJ A;  4GOP B;  2ALY B;  2YYZ A;  1VCI A;  1XNQ L;  1L0W A;  1KIX A;  3H3V H;  2JEB I;  3KF8 B;  4JI6 Q;  1XMQ Q;  3M9B A;  3CW2 C;  1KRT A;  5IP9 G;  4NXM Q;  1UUC A;  1QVF A;  2D0P A;  4P72 A;  3CCR A;  1KL9 A;  1VQA A;  3CXL A;  1JE5 A;  1X56 A;  4DR1 Q;  1YVC A;  2OWO A;  1IL2 A;  2FUG 1;  1PVO A;  5GAH C;  3J81 i;  4NB3 A;  3A0J A;  1KD1 C;  1N8R C;  1EQR A;  3F2C A;  4HJ8 A;  4JI4 Q;  1KHI A;  5IT9 c;  2RCN A;  3S2D H;  1BKB A;  1OXT A;  2UUC Q;  4A3G H;  4DR3 Q;  4LUV A;  1PPF I;  4APV A;  1V9P A;  4KLK A;  2L1L B;  3UE1 A;  1VQM A;  1SRO A;  3M4Q A;  2UXC L;  2UUB Q;  1PH8 A;  1G6P A;  4POG A;  1M1K C;  1TOT A;  3P23 A;  4SGB I;  1SGY I;  1IBM L;  2RF4 A;  2OTL A;  1FAR A;  4WJ4 A;  4FKD A;  3NEM A;  4DAM A;  1WCM H;  1Q46 A;  1Y1V H;  1EOV A;  1UWV A;  4DR6 Q;  1XJV A;  2V6E A;  4QIW E;  3MXN B;  2JA1 A;  1JB7 A;  1XNR L;  3GTM H;  2N71 A;  4YCV A;  3S14 H;  2UXD L;  2KEN A;  1CGI I;  3PUW A;  2R7Z H;  1HZA A;  1D8L A;  2E8G A;  3KJP A;  2VQF L;  2KCX A;  1VQI A;  1K9M C;  3HOW G;  5CCM A;  1GO3 E;  2CKZ B;  5M5X H;  3DA4 A;  4LF4 L;  2VL6 A;  3PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...