4JCVE

Crystal structure of the recor complex in an open conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
214
Chain Sequence
b'SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQESEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein RecR
publication title An 'open' structure of the RecOR complex supports ssDNA binding within the core of the complex.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
total genus 51
structure length 214
sequence length 224
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02565 RecO_C Recombination protein O C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4jcvE02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jcvE01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4jcvE03
1GO3E 1NY4A 4X64Q 4GKKL 2YTVA 3BU2A 5AJ3Q 3HOUH 5LMNQ 1V9PA 4PG3A 1UEBA 4YCUA 5C0XI 3UDGA 2NVYH 4PMWA 1D7QA 4B3TL 3CCMA 1HR0W 4DV7L 3GTKH 4HIMA 1XMOL 1KC8C 1HNWL 4R4TA 4MTNA 3RN5A 3PF5A 3UDIA 1NE3A 3ULJA 2JA7G 1QUQA 4K0KQ 1YHAA 4FDBA 4IOAA 5IYDH 2K50A 2ZTEA 4BBRG 4OXPA 4GS3A 4A3EH 2GVAA 2MFIA 4A75A 2PQAA 4DR2Q 2YTXA 3HOWH 3KFUA 2E5LL 2KCTA 4JOIC 1HNZQ 2E2IH 3H3VI 1WJJA 2VY3A 4AQYL 4UP9A 2NVXH 5HGQA 1B7YB 3S2DH 1I6HH 2KHJA 4IFDG 2JA7H 4YY3Q 4A3LH 3S1MH 4JYAQ 3TS0A 2XGTA 4BBRH 4X62Q 4JI5Q 2HIVA 1JJCB 3HOXG 4IPGA 5M5YH 2VQFL 4DR6Q 1X3FA 4PZ7A 5IP9G 3OTOL 4Y52H 3KF6A 1KHIA 1OXSC 4QL5A 4OO1I 4DV6Q 2IY5B 2NZOA 4GNXA 4YHHQ 1VQ4A 1C7YA 1IBLL 2FXQA 4DR3Q 2PI2E 5C4XH 4LFAL 4DV1Q 2KENA 4P74A 1KRTA 1LYLA 2ZJPA 4BA1I 2Y0SG 2JA9A 3T1YQ 3S1QH 3IRBA 1M90C 1IBMQ 1VQ6A 5IYCG 3HOVH 1EFWA 3RR5A 5BR8Q 1VQ9A 1KL9A 4GOPB 2ES2A 2VUMH 4OWTB 4DK6C 1PV4A 4DR1L 4C3JH 4IPHA 5IP9H 2Q2HA 4PZ8A 1Y1VG 4JI3L 1VQCA 3CCQA 2OCEA 1SN8A 3W1GA 4JBKA 4JI7Q 3M4OH 2MQHA 3RNUA 4JOIA 1MJEA 1Q1EA 3F1ZA 1FJGL 2HIXA 2Y0SE 3FP9A 3JAMc 5ELNA 4B3RL 4R1JA 1TWGH 5JJLA 1EWIA 1VQBA 1QVCA 1SR3A 4DAMA 1YBYA 4JI0Q 4LUVA 3D0FA 4A3JG 3CCUA 4JV5L 4DUYQ 3HKZG 3CCSA 2JA6H 2R7ZG 4A76A 4BXXG 1A62A 1RL2A 4DV2Q 2R6GA 1WOCA 3AEVA 5C0XG 1XNRQ 3CC4A 5JJIA 4DUZQ 1Y1VH 2N78A 2EIFA 4JBJA 2Q2UA 1O7IA 2E8GA 4IFDJ 4B3ML 4POGA 1J5EQ 1CSQA 4MZ9A 1QUQB 2K5NA 2UXBQ 3CPFA 1B70B 4JI6Q 3JAMi 3PO2G 3PCOB 2UUCQ 4X65L 3GTJH 2UXDQ 2F52A 3EIVA 1TWAH 4NPSA 4C3IH 5LMUQ 4ALPA 2UU9L 2OTLA 4JBMA 2R7ZH 4DR4Q 2L15A 4HIDA 1YJNA 4HJAA 3HOZH 3CCJA 5AJ3L 1UWVA 5M3FH 3GTOH 5LMNL 4XIGS 1YVCA 4LF6L 1CUKA 1QZGA 1VQ7A 5M5WH 2PI2A 1OXUA 1XPUA 1XNQQ 1SLJA 2MNAA 2JEAI 1KIXA 4DV5L 1U0LA 3A74A 2YV5A 5LMNW 4A3MG 3TRZA 1KAWA 4L5SA 2HHHQ 3PO3G 1WFQA 4BY1H 3PIPA 3PO2H 4C2MH 1CKNB 3GTQH 4K0KL 3CC7A 2CWPA 2I0QA 1PH9A 4LF4L 3F2DA 1MJCA 2ZM6L 1PH3A 3AYHB 2NVQH 1GKHA 1P8LA 1TXYA 1VQDA 1AH9A 4DR2L 3PUZA 4JI1Q 5IP7G 3I2ZA 4LF7Q 2IHFA 4Y7NH 4GNXB 3BZKA 3B6YA 3GD7A 2OQKA 1K8GA 4LF5L 4OO1G 3K80C 4WJ4A 1RIPA 1U5KA 2A19A 4B3SQ 1SFOH 2HQLA 2WB1E 3KLWA 1G51A 1MIUA 1VQ5A 2Z6KA 5GAHC 5FLMG 3HOVG 4JYAL 4GN3B 1HR0L 4X62L 2NN6I 4JI5L 4YCWA 3F8TA 5IT9c 3L7ZC 2RHSB 2K5VA 3E0EA 3BJUA 3ULPA 2VQEL 2UUAQ 5M3MG 1AE2A 4R4QA 5GAGC 3AFQA 3E9HA 5IP7H 3W1BA 3G48A 4NXMQ 1B8AA 2B3GA 1X55A 3NELA 1L0WA 2K5HA 3DM3A 2F3IA 3M85A 4DV6L 1FVIA 3TEHB 3CCEA 4A3IG 4YHHL 1X9NA 3S16H 2V1CC 3M9BA 5IE8A 4IO9A 1YJ9A 1UE7A 4DV1L 2HT1A 2MO0A 2UUBL 3RZOH 1E7ZA 2AMCB 1E24A 2DUDA 1JJ2A 3T1YL 1NTGA 4AYBG 4EQ5A 4UP7A 4YWMA 4JI2Q 4NB3A 4DR5Q 2A8VA 1HZCA 4LF8L 3Q8DA 4X66Q 3A5UA 1PH1A 2VW9A 1I94Q 1KQSA 2JQOA 3LGJA 2VL6A 1EIFA 1N36Q 2E2HH 3EN2A 3A0JA 5M3MH 1N34Q 3CF5A 3STBC 3TQYA 2VS1A 2ID0A 2RHQB 3CP0A 1VQGA 1K0RA 4GKJQ 4O0AA 4A3IH 2EQSA 1PH6A 4LFCL 2A1AA 3KDFA 2CWAA 1TWHH 2R92G 2EXDA 1PYBA 1FL0A 3K8AA 4JI0L 3MXNB 2I5HA 4A3GG 5IY0A 3FKIG 2B29A 4DNIA 1XMQQ 1SE8A 3M7NA 1E22A 1WCMG 2QGQA 3I7FA 5JEAJ 4DV2L 1YITA 2R7FA 5DLQE 1XNRL 2BA1A 4JC0A 5JJKA 1EUJA 3KOJA 4JI8L 4A3DG 1K3RA 3I55A 3KJPA 3KJOA 4A93G 1ASZA 3T1HL 3M3YH 2UXBL 1BBUA 1JB7A 1UE5A 1YJWA 4JI6L 3CCVA 1Y14B 4LF9L 3BZCA 5IWAQ 1Z47A 3HKSA 1HNXQ 3HOXH 1HH2P 4HIKA 1K8AC 2BH2A 2ASBA 5LMUL 2JA8G 4IPDA 4DR4L 1WCMH 1T9HA 3U4VA 1YEZA 1VQKA 3S1RH 3E9IA 4OX9L 1LUZA 3JC66 4DV4L 1EOVA 2Z0SA 3HOYG 1H95A 1L1OB 2R7DA 1N32L 1YZ6A 4A93H 1IBKQ 4JCVE 2HHHL 3CCRA 4LUZA 3OYYA 2B63G 3UDXA 5IYCH 1IXRA 4DV3L 4DK3C 3WWVA 4R4OA 4POFA 1X3EA 1PA6A 3I56A 2CKZB 2NN6G 3U50C 4KI0A 2RF4A 4H02A 3W5OA 4IOCA 1Q81C 1L2FA 1EQRA 2E5LQ 2LXKA 1JJGA 2F4VL 1N33Q 4IJHA 4NXNL 2C35B 4A3CG 4AQYQ 2LSSA 4LF7L 2YYZA 4RG1A 3ULLA 4BA2I 1SMXA 4DV0L 5H1SE 3HOYH 3HKZE 2D62A 4EX5A 5C44G 3STBD 4DR7L 3CC2A 5GADC 3RN2A 2AWOA 2N8NA 3CCLA 1V43A 4A3JH 1K73C 2VQFQ 1Z9FA 1IZ6A 2AHOB 4BXXH 2PQAB 1XTDA 3CAMA 3OTOQ 4X64L 3G71A 4GOPC 3S17H 1QVFA 3L0OA 1BKBA 4KHPQ 2BA0A 1XJVA 4UPAA 3U58A 2AWNA 1Y1WG 2LXJA 1IBLQ 2BH8A 2OQ0A 4LFAQ 4GN4B 3KDFB 3G6EA 1X3GA 4IFDI 1VQLA 2JA5G 4BY7G 1E3PA 2DGYA 4YCVA 3DLLA 1S40A 4AH6A 4DPGA 3J7ZC 4HIOA 5IWAL 1S3OA 3GTMH 2K52A 5C3EG 1VQMA 2VNUD 2K14A 3KF6B 2ATWA 3H0GG 1DGSA 3FHWA 2WFWA 4QQBX 1PHJA 3EBEA 4L5QA 5C4JH 2GVBA 1VQFA 1X6OA 2JJQA 1I94L 1HNZL 1BVSA 2KCMA 5HY6A 2OWOA 1Q82C 1FJGQ 1OXXK 3ERSX 1Y1WH 3H3VH 4B3RQ 1IYJB 4OONA 4A3MH 1N34L 1IL2A 1HZAA 1VS0A 3PO3H 4HJ9A 4GKJL 1QZHA 2JA5H 4YY3L 4A3FG 4L5RC 5C0XJ 3RLOA 1VQAA 4HJ5A 4A3KG 1YIJA 3U4ZA 3CXCA 1Q12A 3GTPH 5FLXc 1YHBA 4TVAB 3K7AH 3H15A 2IX1A 4DR6L 1XMQL 1G291 1Q1BA 4GOPA 4LW1A 2JE6I 2E2JH 4UP8A 4B3MQ 1GD7A 4DR3L 1J6QA 3L2PA 3NENA 4X65Q 4A3FH 3MEFA 4GLAC 3S24A 2YTYA 5FLMH 2ZTCA 4A3EG 4A3KH 1NJIC 5J3BA 1GM5A 1IBML 2Q2TA 5BR8L 3J80c 1HNXL 3M4QA 4A3BG 3HOWG 3CQZH 1N8RC 4LF6Q 4LFBQ 4WJ3M 1S72A 4HJ7A 1Q7YC 1CSPA 1XPOA 2RCNA 4O2DA 5E7NA 4DV5Q 4GNXC 4JI7L 3S15H 3GDEA 3GTLH 1WYDA 3PUYA 4AYBE 4QIWE 2K4KA 3F2BA 4A3LG 3UE1A 3CMAA 2CFMA 1A0IA 1GVPA 1IBKL 4P73A 2IX0A 2ZM6Q 4LF4Q 4YWLA 4DUYL 3TS2A 3S14H 1JT8A 1D8LA 1JE5A 2K75A 3G4SA 5ELOA 1YI2A 1VQOA 1KRSA 3J80i 2ALYB 5IYBG 2N49A 1SROA 2QEXA 4A3BH 2OTJA 1WI5A 1HZ9A 1X54A 4DUZL 4LF5Q 4IJLA 1NMFA 2AKWB 1N33L 3PIOA 2MO1A 2WP8J 3SGIA 1J5EL 3ICEA 5C4XG 3HFZB 1LM0A 1VQJA 1YHQA 3NBHB 4GLVB 1PH2A 2ZJQA 1X65A 2R92H 2PMZE 2D0PA 4GKKQ 2UUCL 1CKNA 3KF8B 1HR0Q 2R93G 4A3GH 2UXDL 2I5LX 1TWFH 2IHEA 3FKIH 3M4PA 4P75A 1ASYA 2VUMG 1CKOA 1SRUA 1NBWA 4B3TQ 5M5XH 4XTCS 2VQEQ 5IYBH 3CD6A 4DV7Q 3J7A5 2UXCQ 1XMOQ 1HNWQ 3PUXA 1UE6A 4KHPL 4R4IA 1LTLA 1FGUA 4OWXB 1VQPA 3RLFA 1I50H 1XNQL 3PSIA 4A3DH 3I4OA 4GN5A 3RLNA 4DAYB 1I3QH 2UUBQ 1KD1C 3GO5A 1UE1A 1VQIA 3K7UC 3J81j 2JA6G 1A63A 1E1OA 2WAQG 4LF8Q 2R93H 4X6AH 1EYGA 3PUWA 2JA8H 3UDFA 1JMCA 1VQHA 4RMFA 2QA4A 3AQQA 3PUVA 4LUOA 4JI1L 1PVOA 1EQQA 1G6PA 2CCZA 1HZBA 4LFCQ 1MKHA 4OWWB 2CQOA 4B3SL 1C0AA 2WAQE 3CMEA 4QGUA 3A5ZB 4GLXA 1HJPA 3ZJYC 3OW2A 3NEMA 4JG2A 2B63H 1AE3A 1Q46A 3ER0A 1PH5A 2XTIA 4A4IA 1Q86C 3HOZG 1OXTA 5M3FG 4BBSG 4L5TA 3S2HH 3J81c 3KYHC 2UUAL 1BBWA 4A3CH 4JI8Q 2I5MX 4NXML 2VZAA 3PF4A 3CW2C 3D31A 1NMGA 3T1HQ 1OTCA 1L1OC 1P16A 5C44H 4BY1G 2UXCL 4APVA 2Z6KC 2N3SA 1TWCH 4KLKA 4YWKA 1W2BA 4LF9Q 4UY8C 1KXLA 2H5XA 2D0OA 3K0XA 1QVGA 1PFSA 3I4MG 3CPWA 4TQUS 4DR5L 4JI2L 4DR1Q 1CKMA 4C3HH 3PGZA 4JI4L 4LNQA 4JI3Q 4IPCA 5GQOA 2ZJRA 4LWCA 3TREA 1VCIA 4P72A 3I4NG 2NZHA 4OX9Q 4X66L 1A8VA 1PH7A 1VQEA 2Q2IA 4BBSH 1E1TA 1YNXA 3J81i 4DV4Q 3VDYA 1N36L 4LFBL 1Q8KA 1N32Q 2KHIA 3AFPA 1M1KC 4PZ6A 3RZDH 2GN5A 4JV5Q 4BY7H 3UE0A 3GTGH 1PH4A 1PH8A 5FJ8G 4AIMA 1OXVA 2JEBI 4DV3Q 1EIYB 4MNOA 4QY7A 1I5FA 2WB1G 4QJFA 1VQ8A 3HOUG 3I4MH 5C3EH 3S1NH 4JI4Q 3K81C 1PYSB 2ZTDA 3H0GH 4JBWA 2F4VQ 1R9TH 2NVTH 1XPRA 2JK8A 4NXNQ 3I4NH 2PNHA 2KBNA 1K83H 1VQNA 1V1QA 5JEAG 4HJ8A 4DV0Q 1K9MC 4ME3A 5GROA 4DKAC 5GAEC 4DR7Q 1C9OA 5K36G 5IYDG 4J15A 1L1OA 3PV0A 5EAYA 3F2CA 2YU9H 4P71A 1N9WA 2UU9Q 4KHZA 5FJ8H 2IT1A 1X56A 1W3SA 4R4CA
chains in the Genus database with same CATH superfamily
1NY4A 5IIFA 3I73A 3GTLB 2YTVA 1KNAA 1G6ZA 2JB1A 1V9PA 5C0XI 5LMNQ 1RODA 1AFPA 1SJED 5EBDA 1HTLD 4PMWA 1HDLA 1D7QA 1MI2A 3PIO3 4QIWB 5JVH3 4A3EB 1KC8C 2X3TA 3UDIA 1X32A 1NE3A 3J7YW 1SBBB 3ULJA 1QUQA 5K36H 2NU1I 4AS2A 3TZDA 4A3EH 1TS2A 2PQAA 4DR2Q 2K5QA 2E5LL 3A7AB 3J7AV 1HNZQ 3H3VI 1TWFB 2VY3A 4AQYL 1X4SA 2NVXH 5KYLA 3OSOA 2SNMA 4KMUC 3FNBA 4DGZA 3S1MH 4ABNA 1I50B 3DWPA 5C5MA 4F7XA 3HOXG 1JJCB 3K0YA 1NR2A 5DM73 4CGYB 1X3FA 2L55A 4L63B 2ARPF 2EYOA 2MUYA 1T5XD 2EYPA 4RHRA 4QL5A 5E4XA 4DV6Q 2JB3A 5J8FA 1CQFA 1IBLL 4DR3Q 3SK4A 4LFAL 1DOMA 2N52A 1CFMA 3H91A 4P74A 1KRTA 2ZJPA 3T1YQ 1GUGA 3IRBA 1IBMQ 1PTOF 3IFDA 1R0RI 3EROA 1EFWA 3RR5A 1LT5D 4C1NK 4ZLTF 4GOPB 2ES2A 1UNSA 2RQXA 2ETDA 1SGRI 4IPHA 4JI3L 1VQCA 3FMCA 4JBKA 3RNUA 5JPNC 3F1ZA 5HQ8A 1FAQA 2ZW3A 3NUCA 1MJ9A 5ELNA 5JJLA 1QVCA 1SR3A 1II3A 2K1BA 3D0FA 1SNQA 1GHJA 4ODGA 2R7ZG 4A76A 4BXXG 1A62A 5L37A 1FR3A 2EIFA 1O7IA 3K59A 1HXYD 4POGA 5D14A 4C3HB 1CSQA 2K5NA 3CPFA 1VF5C 3PCOB 2H1EA 2MHVA 2QGMA 4JBMA 4NPSA 5IGBA 4ALPA 2R7ZH 3MXNA 3FPUB 4DR4Q 3RZDB 2L15A 1YJNA 3HOZH 4BY7B 1I4GA 2M2LA 5M3FH 3GTOH 5LMNL 5HI7A 4NKLA 1QZGA 5AFWA 2ORWA 5M5WH 2PI2A 1OXUA 2MNAA 1KIXA 3TOAA 4DV5L 4A3MG 3QG1A 1R9TB 4IUQA 4FXDA 2YFAA 1BUSA 1CGJI 2M00A 3GTQH 1HQMC 3CC7A 2OF1A 2LKVA 2LMCB 1PPFI 1YTPA 5DEHA 1TXYA 1TOTA 1UUPA 4DR2L 2GKRI 5IP7G 3I2ZA 1SGPI 1K8GA 3BZKA 4U6RA 4B3SQ 1CSOI 1V1HA 3KLWA 1CM9A 2NVYB 2WB1E 2EZVA 1P9ZA 4WORA 2B2WA 4B9XA 1HR0L 1TDPA 1PYWD 1MJBA 5E1FA 3UFFA 2NN6I 1SYGA 3F8TA 3L7ZC 5FLXL 1M4VA 3ULPA 3G7LA 1Y8OB 1AE2A 4NXMQ 5IP7H 2VB3X 1EL0A 1IW7C 2PNRC 1B9MA 4E6IA 5CORA 2K5HA 3DM3A 4DV6L 3HOWB 2KMOA 4AS3A 3CCEA 4NMZA 3X3MA 1H9KA 4IO9A 5JJZA 1LTAD 2E2HB 4B6DA 3GOXA 1TURA 1B53A 3T1YL 2BL7A 4AYBG 2EY5A 4UP7A 4YWMA 4JI2Q 4EQ5A 4DR5Q 2MJFB 2AUJD 3S2DB 1HZCA 1AP0A 4J1MA 3A5UA 1PH1A 2F0HA 1I94Q 4BBRB 2JQOA 3EVQA 2G5DA 2VL6A 2E2HH 3DA3A 4QF4A 1DXMA 4ULLA 4XT1B 1C4QA 5DNFA 2CWAA 2R92G 4R8IA 4LAAA 3Q0AA 1FL0A 3K8AA 5C4XB 3SGBI 1E22A 2WGCA 1YITA 2R7FA 1VF7A 1ILPA 1NUBA 4JC0A 1JQOA 3KJOA 3W2DA 3T1HL 1ML0D 4CDEC 3P1HA 1YJWA 3NQTA 4LF9L 3HKSA 2RA4A 1SGDI 1K8AC 3FSYA 3QAHA 1ULKA 3BYYB 4DR4L 1BDOA 3U4VA 2Y0SB 3S1RH 1WD1A 1EY6A 1LUZA 4XDXA 1F2LA 1SGQI 3ONAB 2Z0SA 2X69A 2RSOA 1YZ6A 2A6HD 2IW3A 4R9WA 2F1MA 2B63G 4RGNA 4DV3L 4DK3C 5E3PA 2N17A 4POFA 1X3EA 4I65A 3I56A 1TS3A 2CKZB 3U50C 4KI0A 5FO8B 3W5OA 1Q81C 1S5ED 2WACA 3Q23A 2F4VL 2GIVA 1TWAB 4C3IB 2FMCA 4P2CB 4FYDA 3I3CA 5LL6X 3HKZE 5C44G 4DR7L 3RN2A 1EIHA 3CCLA 1ENCA 2DJFC 1EWCA 1SNOA 2E73A 2UVOA 3CAMA 3S17H 4X64L 4GOPC 5C0XH 4H7BA 1QILA 2SGPI 5EPLA 2E5RA 1AZPA 1XJVA 5IT9E 2O5IC 4X3SA 2AWNA 3U58A 2F0EA 2CW0C 1W6KA 1WTRA 3KDFB 1X3GA 3R5CA 4IFDI 1Q8IA 4QCLA 1P9GA 1XTCD 2DGYA 4Y7NB 3VR2A 4HGUA 1PXUA 3A8KE 2VNUD 1VQMA 2ATWA 3H0GG 1IYUA 3BVGA 2RSNA 2WFWA 1J8IA 2A68C 5C4JH 1EU4A 1I94L 3DEOA 1EZ8A 1LTGD 2KCMA 1FJGQ 3H3VH 4FXGC 4OONA 4CDFC 1RTOA 3K6OA 3Q22A 5D3IB 4K6DA 2EJMA 4L5RC 5EX0A 3IAYA 5C0XJ 1VQAA 5IGDA 1S5CD 4F88A 3I90A 3S16B 1Q12A 1PFMA 5FLXc 1KLGD 2DIPA 2IPKD 4ID6A 2IX1A 2FINB 1G291 4GOPA 3B55A 3KP9A 2E2JH 5HURA 1DD2A 2HCIA 2F0JA 3TO6A 4MN3A 1CA5A 3L2PA 2JYYA 3NENA 5D65A 2YQPA 1MBYA 3NQIA 3I70A 4GLAC 3S15B 2FNFX 5J1ZA 2Q2TA 5BR8L 5COYA 3VYRA 4JPBW 5ELEA 2F0SA 2K7VA 1CSPA 3GQBA 1XPOA 4JI7L 2GKVA 3S15H 2KCNA 2L5TA 4X3UA 5CMDA 2F3VA 3IKJA 1CQVA 4QIWE 2FFKB 3F2BA 4A3LG 1TT2A 3CMAA 2QSBA 1GVPA 2ZM6Q 2IX0A 3TS2A 2XRCA 1JT8A 1JE5A 3M3YB 1KRSA 1LV9A 2ALYB 2B2YC 2N49A 1SROA 1KDAA 2OTJA 1WI5A 1HZ9A 1X54A 3SXHA 1NMFA 1PTOH 1EOTA 4DWLA 3SK6A 2MO1A 2WP8J 3SGIA 3ICEA 1FY7A 2ENNA 4GLVB 5E3FA 4ILWA 2V1CA 3NTKA 3MVVA 2HD3A 2Y0MA 3D6WA 4QB4A 5T1IA 2R93G 5I4DA 3MHBA 3MFGA 3FKIH 4UAIA 1AN1I 1SRUA 2EE1A 1EY7A 2VQEQ 3CD6A 4DV7Q 4FF1A 5FKAC 1X3QA 2CHBD 1XNQL 3BVZA 1DOLA 4IUVA 4DAYB 1KD1C 1OYVI 4KN4C 4RCNA 3K7UC 2R93H 1EYGA 3PUWA 3TP8A 1FNWA 1BMOA 4K2KA 3AB9A 2L12A 1BQQT 1STBA 2QA4A 1PVOA 4JI1L 2QW7A 1PMRA 2CVRA 1EQQA 1HZBA 1MKHA 4OWWB 2CQOA 2B2UC 4FXKC 2FHTA 4GLXA 4JG2A 3BG3A 3ER0A 2HUGA 3WOFA 3V2TA 2UUAL 2EXZA 1F9PA 2VZAA 2XSCA 4QMGA 2B0UC 2JXDA 4APVA 2N3SA 1TWCH 1KXLA 1NCVA 2F0NA 1Y1WB 3UEJA 1PFSA 3I4MG 2EYLA 2KUMA 1GUOA 4LNQA 4IPCA 4LWCA 1VCIA 4P72A 1IW4A 2M9VA 2F0MA 3TZUA 1NSNS 1E1TA 1YNXA 1Q8KA 2KHIA 4PZ6A 2IL8A 3R93A 5EGTA 2VB2X 2B2UA 4AIMA 1A15A 1EIYB 3N6RA 4MNOA 1I5FA 2WB1G 3HOUG 3I4MH 3S1NH 1I4HA 2X6LA 3K81C 1KBFA 4K14A 2ZTDA 2OT2A 2EJGC 2JA1A 2NVTH 4A3FB 3T4AC 1LT6D 3HOVB 4KJNA 2QPOA 1NAPA 2IWHA 1UAPA 1KTKA 5BN4A 4DV0Q 3HG9A 1PLFA 5GROA 5LL6S 2ENZA 2JB2A 3QOLA 3TSSA 1WKXA 1PFBA 3H6MA 5IYDG 4FF2A 2EY2A 4FP5D 2PZUA 1WTJA 3BVMA 2UU9Q 2IT1A 1SGYI 1XX8A 2I07B 1QVGA 1DCZA 3BU2A 3HOUH 1LTTD 1JOKA 1UEBA 4YCUA 5IT9L 2XTRA 1EQVA 1HR0W 4KV6A 4DV7L 3S14B 1TY2A 1LT3D 2CWHA 4A3BB 2SGEI 2SGFI 1CHOI 4IOAA 5IYDH 4CJ2C 4B9WA 1HEVA 1XX6A 4RGMA 2ENBA 4KY5A 2K5WA 2PW5A 4EQNA 2GVAA 1WTOA 2MFIA 3RU0A 4EVOA 2KCTA 5C5LA 3P23A 5IOCA 4FKDA 2E2IH 2QEJC 1CTMA 4UP9A 5HGQA 3NHHA 3MXGA 4IFDG 5IODA 1DJRD 4RKBA 1F2MA 4JYAQ 3TS0A 4A3DB 5M5YH 4JK1C 4FO2A 4DR6Q 3D4DA 4PZ7A 3GV6A 4C3JG 3OTOL 4Y52H 1I4PA 4RA8A 1EYDA 4RGTA 4GXTA 4KHVA 1RDPD 3A8IE 2IY5B 2OXPA 2RADA 2NZOA 4YHHQ 4GNXA 3J81E 1VQ4A 2JA8B 4A24A 4IFDH 2SGQI 3S1QH 1XXGA 1SGNI 1VQ6A 3BJIA 3CHBD 2PQEA 1VQ9A 3EQLC 2VUMH 4C3JH 2Q2HA 4PZ8A 1Y1VG 3MAQA 3BDOA 3CCQA 2OCEA 1SN8A 3TO7A 3M4OH 1YNNC 1XWEA 3N52A 1MJEA 3ND8A 2NU0I 2Y0SE 3FP9A 4B3RL 4PL5A 1TWGH 1WTXA 3S2HB 1LABA 4WJWA 4LUVA 3CCUA 4DUYQ 3HKZG 2JA6H 2TSSA 2KQ3A 5EBCA 3AEVA 1C8CA 2QDBA 2F66B 1PDQA 5FLXE 5CBEE 1Y1VH 2FEFA 2JBWA 4IFDJ 4B3ML 3BDCA 4UXIA 3SGQI 2Z6BA 1B70B 1HFGA 1KAAA 5F2DA 1STEA 4JI6Q 1TS5A 2UUCQ 1L0YB 4QUFA 4X65L 3UGIA 4YIJA 4RAUC 2UU9L 3UEYA 3UGDA 3QWPA 4HIDA 3A7LA 2A2DA 4XIGS 1YVCA 2L0CA 3VR5A 2PO4A 4LF6L 2F0PA 1U4RA 5C3EB 3A74A 1MT1A 2YV5A 1MJAA 4L5SA 2CWFA 3PO3G 4BY1H 3I4NB 1K83B 5CV4A 3TBIB 5CGKA 1H9SB 1SYFA 4TSSA 1MJCA 2KMQA 3T51B 1VQDA 4LMQD 1H9RA 1B3AA 3MA2B 3LWEA 4OO1G 2XN9C 3B6YA 3MXUA 2OQKA 3K80C 4WJ4A 1U5KA 1SFOH 2K28A 1VQ5A 3TDQA 2Z6KA 3MWYW 4DAYA 5EKKA 4JYAL 4KY6A 3VR4A 5IT9c 1HHVA 4HSPA 2ZT9C 3ERQA 4DN4M 3AFQA 2A6HC 3E9HA 5GAGC 3G48A 5IGEA 1B8AA 1D5XC 3R3OA 1QE6A 1L0WA 1RF2D 4OO1H 1DONA 2B2VC 1X9NA 4YHHL 1DZ1A 1STYA 5IE8A 3T53B 5EKLA 1EWHA 2HT1A 3D8GA 2UUBL 1EEFD 2KOLA 1E24A 2DUDA 2NVXB 4NB3A 1CZWA 3Q8DA 3S1MB 4X66Q 1SYCA 3FEWX 4CKCA 1EIFA 1N36Q 3IAM1 1GUTA 3TQYA 2ID0A 2F0QA 2RHQB 1DS2I 2L1LB 1K0RA 1PH6A 1BUVT 2J87A 1YO7A 4HEDA 3JAME 4JW0A 1WTWA 1QNKA 4A3GG 2DNCA 5IY0A 4DNIA 2B29A 3M7NA 5C4ZA 1WCMG 3I7FA 1Y69U 1F9SA 2BA1A 5I6WA 3RD4A 2KECA 5KIXA 3KJPA 2ELIA 4NW2A 4PQXA 1ASZA 4JI6L 5DM63 5IWAQ 1HNXQ 3HOXH 3QTLD 1RFHA 1DOKA 2BH2A 2ASBA 2ZXRA 1V8QA 4IPDA 3V05A 2ORVA 1WCMH 4K6LA 5C3XA 4RCOA 3PDNA 1N13A 3JC66 5E4WC 2SDFA 2KJXA 3HOYG 1BF4A 1L1OB 2BE5D 1N32L 3LJ0A 4HMJA 4MHEA 2JAEA 1IBKQ 3O13A 2LEOA 3CCRA 4LUZA 1SNDA 3SDJA 1ESRA 1MD2D 1IYVA 4RHSA 2DN8A 2HCCA 1PA6A 1EFID 1ZEQX 4H02A 2KKMA 1JJGA 1EQRA 5C6AA 3VDUA 3A56A 3DO9A 1CI3M 1A3VA 4IJHA 4A3CG 3CXLA 2R7ZB 2EYJA 4WP4A 1UVFA 2A20A 3HZXA 3HOZB 2D9UA 4BA2I 2WCYA 5H1SE 1TS4A 4PL3A 5M3FB 3HOYH 3GTOB 2FMMA 5M5WB 3BDLA 2I46A 2VQFQ 1B9NA 2A6ED 1Z9FA 4G4KA 4BXXH 1VDDA 5CV5A 2N88A 2SNSA 3GTQB 3SDZA 1I4RA 2F03A 3J81L 2Z9HA 4UPAA 4G75A 3MXPA 2BH8A 2N55A 4BY7G 1E3PA 1T5EA 3DLLA 4AH6A 4LK1C 3E6ZX 1PTOD 1ESFA 3WDNA 1Q9BA 4QQBX 2WV6D 3OL0A 4RGOS 1HJAI 4I7AA 5DAUA 3SK5A 2HGKA 2JJQA 5C3WA 1HNZL 2OWOA 1Q82C 4A3MH 4DNRB 1NXUA 5ELCA 3RLOA 2L11A 4A3KG 1STGA 1K28A 1YIJA 3U4ZA 1SYEA 2CWGA 3H15A 3VR6A 4DXFA 1WTHA 3D4WA 2YFBA 3NE5B 1GD7A 2IJ0A 4DR3L 5E3QA 4BWGB 1LACA 3TJQA 3S24A 1IBML 4A3KH 4JI4Q 5I2YA 4OELB 1HNXL 3M4QA 2Q8RE 2F0WA 3HOWG 4XQNA 4O1NA 1S72A 4HJ7A 1Q7YC 2B8TA 5E7NA 2CH4A 3TO9A 5FUVA 3ITPA 2F0VA 2CFMA 4G57A 1A0IA 1JC7A 1IBKL 4LF4Q 1AH9A 3HGBA 2W0TA 4SGBI 1D8LA 3VYSA 5ELOA 3JSBA 1VQOA 1PZKD 2B2TC 4CBVA 3KLSA 4LF5Q 1L0XB 3OXFA 4OAUC 5C4XG 1YHQA 3NBHB 3S1RB 2R92H 4IUPA 1TGSI 1CKOA 5M5XH 4XTCS 2RIJA 1XMOQ 2NTTA 3OXGA 4R4IA 1FGUA 3RLFA 4ZYSA 3I4OA 2WKCA 4GN5A 5CCMA 1I3QH 4O42A 2IP6A 1G8ZD 3QIAA 1EQTA 1A63A 2A5HA 2WAQG 4LF8Q 4X6AH 1BXTA 3KBGA 4CDDC 1GOZA 4RWSC 1PCEA 1ET6A 1JMCA 1OVOA 3SHLA 3S9WA 1QNUA 1IL8A 1VDZA 1VQHA 3AQQA 3PUVA 4OGQC 4RMFA 2P6AC 3S17B 1G6PA 1RTNA 3A8JE 2CCZA 4LFCQ 3JAML 1KLUD 4B3SL 1RJTA 1C0AA 1SNPA 2B8GA 2WIIB 2E75C 1K3BC 1TR5A 3ZJYC 2B63H 1AE3A 1GXDC 1Q46A 4XT3B 1ENAA 4A4IA 5DAEA 1PFNA 4FVMA 4BBSG 4L5TA 1D1IA 5G3LF 3J81c 4JI8Q 3FC3A 2I5MX 4NXML 2YUUA 3D31A 3I8ZA 1OTCA 1L1OC 5C44H 3SVMA 5C4JB 2NZ1D 4KLKA 1W2BA 2H5XA 3R2IA 3CPWA 4TQUS 3VA7A 4DR5L 5CCLA 4JI2L 4JI4L 4I1TA 5GQOA 2LY7A 3J80E 4OX9Q 4BBSH 3J81i 4DV4Q 1U4LA 5EX3A 4G7HC 2E2JB 1S5FD 4L6TB 2V6EA 1PH4A 3GTGH 2NWGA 4QUCA 2F0TA 3Q24A 2OZUA 1KMAA 1PYSB 2DJGC 3H0GH 4ZUIA 4JBWA 1HPCA 1XPRA 3E0JA 4NXNQ 3DM1A 1STHA 3ND9A 4XXEA 5BN5A 1VQNA 1V1QA 2K33A 4E1PA 5JEAG 4ME3A 3K5LA 4HEA1 1C9OA 3U9SA 4J15A 1L1OA 2D5DA 1N9WA 2RDFA 1W3SA 1GO3E 2SGDI 3SEBA 3UDGA 2BUSA 3K5OA 2DKVA 2QQCA 2QQ0A 3GTKH 4HIMA 1XMOL 2RC4A 2F4IA 4KKUA 4MTNA 3DHQA 3PF5A 3NTHA 5NUCA 2JA7G 1K8MA 4K0KQ 5C4HA 2LS01 2K50A 1PTOB 2ZTEA 4OXPA 3EFXD 2O2LD 2MP1A 4ZQ3A 1FGBD 3C3LA 3VYTA 1HQRD 2YTXA 5FK9C 1Z2IA 4JOIC 2EJFC 1WJJA 2RDHA 3FKIB 2DY8A 2PMZB 3HRZC 1HUNA 4NV5A 1I6HH 2HDLA 2KHJA 4ZKCB 2JA7H 1JR0D 2ZRRA 4YY3Q 4A3LH 1TBOA 2J0TD 2AQ1B 2HIVA 1QWYA 4ME5A 2N71A 4XYQA 2TMPA 1S5BD 5IP9G 4IN3A 3VE5A 4MPIA 4OO1I 5TSSA 2AUKA 2R93B 1C7YA 2FXQA 1UUCA 5HGIA 4M1UB 2XWBB 4DV1Q 2KENA 1LYLA 1QJOA 4U673 1GUWA 2JA9A 1M90C 4K5WA 5IYCG 3VDPA 2JSOA 1ULNA 3FVQA 5KNDA 1F9RA 1K0SA 2PQ8A 2KCCA 1ICFB 1G91A 5IP9H 2B2YA 1HCZA 4N9PA 2KA7A 5K5PA 4R8NA 2X6GA 3GV3A 1Q1EA 3HP3A 4JOIA 5FOBB 4EGVA 2QZGA 2HIXA 1FJGL 3JAMc 4R1JA 3A55A 1EWIA 1VQBA 3Q6SA 4A3JG 3E2IA 1BO0A 3CU7A 3CCSA 5A35A 4Z7HA 2R6GA 1WOCA 4I7ZC 4KD3A 4DV2Q 1TWCB 1FYBA 1XNRQ 2F0GA 5JJIA 4DUZQ 3K5NA 2ZXPA 3T13A 2Q2UA 1KBEA 1J5EQ 4MZ9A 1QUQB 2UXBQ 3SE0A 5I6YA 3JAMi 3PO2G 2J9RA 3UITA 1D5MC 3NK9A 2ICIA 5I2XA 3GTJH 2O4XA 2UXDQ 2F52A 3EIVA 3K58A 5LMUQ 2OTLA 1VMCA 2H4OA 3OWEB 4HJAA 3E3XA 3VA9A 4PV1C 3I4MB 3S1NB 1XPUA 1SLJA 4J8QA 1U0LA 5LMNW 5EPJA 2F0FA 2NVTB 2J7ZA 3PO2H 4C2MH 4K0KL 1ZXTA 2CWPA 1NR4A 1PH9A 1SXTA 3F2DA 1QG7A 2ZM6L 2RKSA 1PH3A 4IUNA 2NVQH 5FO7B 1EY5A 2XTQA 3UGLA 3C1FA 3GD7A 3HOUB 2QDLA 3F4MA 4GI3C 5EQ0A 1G51A 1O80A 2CQAA 1TU2B 1HPTA 3H3VC 1ILQA 5FLMG 5GAHC 3HOVG 4GN3B 5JAVA 3QJYA 1SE2A 1JWUD 2RHSB 4IUTA 5J22A 2VQEL 2ERWA 5M3MG 2BE5C 1MHWC 4U68A 2B3GA 1X55A 3NELA 2M5XA 2UXCQ 4A3IG 4YZDA 2V4DA 4RH6A 2E2IB 1UE7A 4DV1L 2MO0A 3RZOH 2AMCB 3QOJA 1ULMA 1JJ2A 4Z7GA 1EYAA 2BDNA 7WGAA 3J80L 5T1GA 1HFNA 4N9TA 2GA4B 2VW9A 1KQSA 2OD1A 3LGJA 3EN2A 3A0JA 5M5YB 2EYHA 5M3MH 1Y1CA 4BS9A 4GKJQ 4O0AA 4JVZA 2EQSA 5FO9B 4A3IH 2A1AA 3KDFA 2ODDA 2A6EC 2C5CA 1J9OA 1WGCA 5JPMC 3MXNB 1PRTD 2G9DA 1ET9A 1XMQQ 1SE8A 1ENFA 4V190 3S1QB 4DV2L 2ICEC 5KGUA 3NP8A 1XNRL 1NUCA 4A3DG 2VUMB 1K3RA 3I55A 4UXHA 4C3JB 1TIID 4A93G 4OVOA 2UXBL 1HA6A 1JB7A 3M4OB 1PTOC 1Y14B 3BZCA 2B39A 3T16A 3U9OA 1Y8FA 1TWGB 4RKLA 5LMUL 4WRDA 2JA8G 1T9HA 1YEZA 3E9IA 2JA6B 4OIKA 1EOVA 1V1IA 4G76A 5J39A 3OWFA 2JXMB 1RD9D 4K8IA 4A93H 1Y1VB 4K5VA 1CK1A 4K2LA 3TMEA 1BCPD 3UDXA 3MEKA 1IXRA 4ZKBB 4R4OA 1BR9A 1A6XA 2Z1CA 2F6MB 2QCPX 2RF4A 3IFTA 4OIJA 1L2FA 2E5LQ 3NWTA 3VR3A 3L0IA 1STAA 2C35B 4DK0A 4AQYQ 1I4XA 2LSSA 4HR7B 1C48A 4RG1A 3ULLA 4WFN3 1I6VC 1PZJD 1SMXA 2NTSA 3OOCA 4DV0L 2LB7A 3STBD 4K8JA 4DF7A 2AWOA 2N8NA 1W4RA 1V43A 4Q9VA 2JN4A 1K73C 4F8MA 2GKTI 1IZ6A 1XTDA 4BY1B 2JW6A 4UXJA 2NBFA 1H9MA 2NU4I 3URYA 2LXJA 1LO5D 1IBLQ 1LR9A 4LFAQ 3NXWA 3G6EA 1IHZA 1VQLA 2JA5G 3GP7A 3MC0B 4ZAIA 4YCVA 2PPBC 1S40A 3J7ZC 3GTMH 1TBRR 5C3EG 1SFOB 2AQ3B 3KF6B 1I4QA 2K14A 3L3OC 4HN7A 3FHWA 1PHJA 3EBEA 1TQOA 1VQFA 4PL4A 1BVSA 3PQIA 5HY6A 3ERSX 2N1AB 1VS0A 3PO3H 2WINB 4HJ9A 4GKJL 2D2CC 1QZHA 2JA5H 3DUZA 2XMXA 3TP6A 2EVBA 5KNBA 2OVOA 1R4QB 3CXCA 3B4VC 2L9HA 3GTPH 4TVAB 3K7AH 3OPOA 3CRKC 4DR6L 1XMQL 1TBQR 4UP8A 2L7XA 1S20A 1Z7KB 2A73B 3RUZA 4RFBA 5CYUA 3R5DA 2K03A 3CQZB 5FUWA 3I4LA 1O78A 3K57A 2JYOA 2HDMA 1JWMD 4ZRZA 3MEFA 5KRUA 2YTYA 2F0DA 5BN3A 4A3EG 1GM5A 1ZYRD 2A8VA 3J80c 4N8FA 2EOTA 3CQZH 2RCFA 1FD7D 1A3TA 4XYOA 2RCNA 4O2DA 4DV5Q 2F0IA 1U9RA 5EJWA 3GTLH 1WYDA 2K4KA 5JVG3 1VMPA 2Z4HA 5J8CA 5CV7A 3IL8A 4DUYL 4HAEA 3G4SA 2NUCA 1JB3A 1B2TA 2NB0A 3J80i 1H9JA 5IYBG 2QEXA 2ROWA 1TY0A 1CZGA 3HOXB 1E2WA 1EY9A 4IJLA 4DFAA 4A3GB 5E3RA 1AEXA 2J4XA 4OEMB 3I91A 1WCMB 2B2VA 1LM0A 1VQJA 1PH2A 2ZJQA 4J6HA 1BOSA 2PMZE 4L8JA 1S5DD 1XYIA 3KF8B 1HR0Q 2UUCL 4GKKQ 3D00A 4A3GH 4FNFA 2RLDA 2I5LX 1TWFH 2XRQD 1KDCA 3M4PA 1ASYA 1GUNA 4L9MA 2EY6A 1NBWA 4B3TQ 3LWUA 5IYBH 1HNWQ 2F3WA 1Y1BA 5IGGA 2E76C 4NP5A 1LTLA 4HFVA 1VQPA 1I50H 1LTRD 3PSIA 4G7ZC 2WKDA 3RLNA 2C9OA 3OMCA 3QWNA 1VQIA 3J81j 3W3AA 5KYIA 4CJ0B 3HOYB 2UZ3A 5IGCA 1CHQD 3QB3A 3UDFA 3OXLA 2JP1A 2K5DA 1FYCA 1H0ZA 4OL7A 1PRTB 4NDXA 4QGUA 3A5ZB 1JQYD 3OW2A 3NEMA 3FDTA 1PH5A 4C3HG 3HOZG 1V1OA 5M3FG 1SNMA 4HMIA 4IZ8A 5IGFA 2AQ2B 1SDFA 2GSCA 1R79A 1PJUA 2PCFB 1BBWA 4XQJA 4A3CH 1YNJD 3CW2C 4HSVA 1B44D 3PMFA 3D3RA 1NMGA 4KN7C 3T1HQ 1P16A 2A2CA 4LF9Q 3K0XA 2B2WC 2XIWA 4A3MB 2K01A 2Q8IB 2PW7A 3TOBA 3FRPB 4DR1Q 4C3HH 3PGZA 1WTVA 5A2QL 2ZJRA 3LX0A 2RIOA 3DEPA 1XA6A 2A74C 3KBXA 4X66L 1VQEA 2Q2IA 2RDGA 1HRJA 1O7LA 3VDYA 1N36L 3P75A 1PTRA 4X3TA 1BCPB 1M1KC 3RZDH 4Z9CB 4JV5Q 4BY7H 2K6AA 3HEJA 4DV3Q 1VQ8A 4KK7A 1OMUA 4IQZA 2JZMA 2FJ2A 2F4VQ 1R9TH 2PZTA 2JK8A 4B08A 2PNHA 4A3KB 1U4PA 3CRLC 4TRDA 5D3DA 4HJ8A 3KLRA 4C56C 4MIUA 5GAEC 4DR7Q 2SOBA 1LR7A 1YNND 4M8AA 5EAYA 3PV0A 3F2CA 4DA2A 1NNXA 4KHZA 1EY0A 1A2TA 3A54A 5IWAL 4X64Q 4GKKL 1EU3A 5AJ3Q 4GZYC 1JWSD 1B50A 4PG3A 2K05A 1EEID 3C1EA 2NVYH 3M4YA 4B3TL 3CCMA 1TVXA 4AYBB 1HNWL 4R4TA 3RN5A 1HUMA 3J7AF 1MSHA 1YHAA 4FDBA 2MPMA 1SMYD 4BBRG 4CKEA 5FUYA 2CH4W 4GS3A 2OU2A 3L9AX 1K7TA 4A75A 3HOWH 3WOEA 1TKWB 3KFUA 3TP5A 2R92B 5JHWC 3K5MA 3FVVA 1TUSA 1JORA 1CE3A 5CR3A 2WVJA 1B7YB 3S2DH 5M5XB 3R8BA 2SEBD 2XGTA 4BBRH 4X62Q 4IALA 4JI5Q 4IPGA 1H9SA 4O1OA 2VQFL 3F2UA 5CV6A 4DU9A 2QQEA 2BL8A 1I3QB 3KF6A 1KHIA 1OXSC 4PMBA 1WVLA 4HCEA 2QILA 2EYFA 2PI2E 2DNEA 5C4XH 3X3NA 1AZQA 4BA1I 2Y0SG 4X3KA 1TBNA 1Z6HA 5LNK1 2E74C 2KVMA 4YZ9A 1V1PB 5BR8Q 1A2UA 1KL9A 4OWTB 2PYKA 4K5XA 4DK6C 2A69D 1PV4A 4DR1L 1CT0I 2B63B 1SE4A 3W1GA 2HQEA 2B2TA 1WD0A 4JI7Q 2MQHA 3LJ1A 2WAQB 4TKOB 1DS3I 2K32A 3DWAA 4DAMA 1YBYA 4JI0Q 3VA5A 3HS0C 4JV5L 4E1RA 4OHJA 4C3IG 2NU2I 1RL2A 5C44B 4CKBA 5C0XG 1BNZA 1LR8A 3CC4A 1ONLA 3C46A 1UHAA 2N78A 4JBJA 3NPPA 2E8GA 1WTQA 1EZ6A 1JOOA 3QR8A 4DAPA 4MTKA 3NTIA 4BBSB 1SNCA 4EQOA 5CV9A 1TWAH 4C3IH 4HCSA 3SK8A 3TN2A 4S3SA 2GVIA 5FUXA 1FNVA 1M8CA 3GTGB 3VYUA 3CCJA 5AJ3L 1UWVA 1CUKA 4H44C 3BYTB 1VQ7A 1XNQQ 3C2PA 2JEAI 4O1PA 3TRZA 1E0BA 2K04A 3H0GB 4DNTB 1KAWA 2HHHQ 1SYDA 1STNA 1WFQA 5KNCA 3PIPA 1FNUA 1PRTC 1CKNB 2QKIC 2I0QA 1X3PA 4FF4A 2FUG1 2BCOA 2Q8TA 4LF4L 3V96A 3OIPA 3AYHB 3KF8A 1JE4A 1GKHA 3KK7A 1P8LA 3LJ2A 1KDBA 3PUZA 4JI1Q 4LF7Q 4Q0FA 2IHFA 3DMUA 4IUUA 5I9PA 4Y7NH 1Y8PB 4GNXB 4LF5L 1AW7A 4V0BA 1RIPA 2A19A 1DM0B 2HQLA 1CA6A 1MIUA 3GTKB 3OW7A 3ZYYX 1SSOA 2KEDA 3G6JB 4X62L 4JI5L 1MGSA 4YCWA 1DYQA 3E0EA 2K5VA 3I72A 3BJUA 2UUAQ 3R5BA 4R4QA 3E5SA 5G3LD 3W1BA 2XVSA 5JEAH 3M85A 2F3IA 1FVIA 3TEHB 3S16H 2L8EA 1BCPC 1S4ZA 2V1CC 4NV2A 3M9BA 4DXGA 1HA5A 1YJ9A 1CT1D 1E7ZA 1NTGA 4DK1A 2O5JC 4C1NI 1I6HB 2JA7B 4ZUJA 4LF8L 1JOQA 3MTSA 1TWHB 1U4MA 1CT4I 1N34Q 3CF5A 3STBC 2VS1A 1OO9B 1XBTA 4EQPA 3CP0A 1VQGA 1SGEI 3UOEA 1YU6C 4LFCL 1TWHH 2F0KA 2EXDA 1PYBA 4JI0L 3DWQA 2I5HA 5ELBA 1CT2I 1RHPA 1G2SA 3FKIG 3CKIB 1E2VA 2QGQA 5JEAJ 1PTQA 3I9V1 5DLQE 1KNEA 5JJKA 1EUJA 3KOJA 4JI8L 1Z7TA 3M3YH 1BBUA 2F0UA 1UE5A 3CCVA 1W6JA 1Z47A 1D1KA 1HH2P 1QOHA 3KLSX 4HIKA 1B3QA 5CV8A 2CJSC 2R61A 4KTAA 1VQKA 2PZWA 1M8AA 4OX9L 1QCBD 1JCKB 2IX3A 2RBMA 4DV4L 1H95A 4H13C 2R7DA 1IW7D 2Z4IA 1ZKOA 2HHHL 4JCVE 2F0LA 3OYYA 5JOBA 5IYCH 3D4RA 3WWVA 2LFNA 1G2TA 2NN6G 4XQQA 3H94A 4IOCA 2LXKA 3GTJB 4A3JB 1N33Q 4NXNL 1BBXC 1OMTA 1GUSA 4LF7L 2YYZA 4KJOA 2B8FA 1F9QA 4KKTA 3PIP3 4EX5A 2D62A 3NSWA 3P7JA 1R4PB 3CC2A 3IAS1 5GADC 1F2YA 1LLRD 1PZID 1ZYRC 4A3JH 1K8OA 2FU2A 2AHOB 2PQAB 5M9OA 3OTOQ 3G71A 1EY4A 2NN6H 3PO2B 4C2MB 3L0OA 1QVFA 3MZ5A 1BKBA 4KHPQ 2BA0A 1Y1WG 3QO2A 2NVQB 3MFYA 2OQ0A 4GN4B 1UVGA 1B4OA 2V53A 3NBHA 4DPGA 4HIOA 1S3OA 4LJZC 2K52A 2F0OA 2XRSD 3RMHA 2P22B 1D2BA 1DGSA 1M8BA 4L5QA 5CC4A 2GVBA 1D5ZC 1X6OA 2WB1B 1LTID 5EKIA 4PMCA 1IKMA 1OXXK 1Y1WH 4B3RQ 3H09A 1IYJB 1SYBA 4ZK9B 1N34L 3AJFA 1IL2A 1HZAA 3SEKC 5CBAE 2NYZD 2MJ8A 4AMLA 4YY3L 4A3FG 1PRTF 4HJ5A 3FPPA 4PNYA 2BOSA 4H0LC 1V1PA 2EPBA 1YHBA 1O7ZA 2P5ZX 1Q1BA 1O7YA 2JE6I 2EDGA 4LW1A 3RZOB 4ZCKA 4B3MQ 2X52A 2XNAC 1QB5D 4KKSA 4CDCC 1GHKA 3R2TA 1J6QA 3AMUA 4X65Q 1IY5A 1RKNA 5M3MB 2K19A 4A3FH 1K7UA 5FLMH 2NU3I 3HOVH 2ZTCA 3M7GA 1NJIC 5J3BA 4A3IB 3FBVA 4A3BG 1N8RC 4LF6Q 1Q3LA 2VXWA 4LFBQ 4WJ3M 1E2ZA 1GJXA 4GNXC 1X74A 4DNCA 3P20A 2ZXOA 4HTHA 3GDEA 2KMRA 4CHTB 3AU7A 3PUYA 4AYBE 1SJ8A 3NWSA 2CW0D 1BCPF 3UE1A 1EY8A 2KEEA 1F77A 1ICWA 4P73A 4YWLA 3S14H 2K75A 1YI2A 4IURA 2F3CI 3HH2C 3TP7A 4A3BH 1YNJC 4DUZL 4DAVA 2AKWB 1N33L 2XWJB 2A68D 3PIOA 2KCXA 1J5EL 3HFZB 1IKLA 1X65A 1WGTA 2D0PA 1CKNA 1SEBD 1UEAB 9WGAA 2UXDL 4P75A 2IHEA 2VUMG 2Z8LA 4A93B 2KHSA 2DY7A 5HGTA 1SAPA 3R5AA 4OAVB 5A2QE 3J7A5 4Q5VA 1CGII 4UDUC 3BZDB 3PUXA 1UE6A 3UI2A 4KHPL 1F2ZA 4OWXB 3KY9A 4A3DH 2BDOA 4N8X1 4YZCA 4F87A 4UHVA 2UUBQ 3GO5A 1EIGA 1UE1A 2QQDA 3EJIA 2JA6G 1E1OA 1KABA 2JA8H 3HKZB 3MEHA 4LUOA 2VRWB 2OEOA 2K9HA 1LTBD 5ISRA 3OVOA 2WAQE 3CMEA 3NBIA 4KD4A 1K7VA 1HJPA 1MSGA 2L4NA 5I9OA 1HTPA 2RVLA 1TIHA 2XTIA 1Q86C 1JICA 5EPKA 1OXTA 1Q90A 3S2HH 2L1BA 3KYHC 2CAZB 2EYMA 1LT4D 3GTMB 3DXJC 2KMPA 4G7OC 3KUPA 3PF4A 4FF3A 3BS1A 1SMYC 2UXCL 4BY1G 2Z6KC 4UY8C 1A3UA 4YWKA 2D0OA 5KEEA 1WTPA 2EY1A 3PO3B 1CKMA 1D6EC 4JI3Q 2JA5B 1SJHD 3TREA 1CHPD 3I4NG 3DA4A 2NZHA 2QF7A 1A8VA 1PH7A 4LFBL 1SE3A 3GTPB 2E2DC 1IY6A 1RCVD 5ELDA 4CJ1B 3K7AB 1N32Q 3AFPA 5LHY1 1EYCA 3LNNA 2GN5A 3UE0A 3OHXC 5FJ8G 1PH8A 3EA6A 3T56B 1OXVA 2JEBI 5ELFA 2MGSA 4QY7A 4QJFA 5C3EH 1FARA 2LUYA 2YU9B 3OMGA 3I4NH 3E59A 2KBNA 3D6CA 1K83H 1B1ZA 1LTSD 1K9MC 1Y8NB 3SR1A 4DKAC 5K36G 2G9HD 2YU9H 2DB6A 1AN8A 4P71A 5FJ8H 3FSXA 4KY7A 1X56A 2R3ZA 3OIQA 2A69C 4R4CA
chains in the Genus database with same CATH topology
1NY4A 2YTVA 2JB1A 1V9PA 5C0XI 5LMNQ 4PMWA 1HDLA 1D7QA 1KC8C 3UDIA 1NE3A 3ULJA 1QUQA 2NU1I 4AS2A 4A3EH 2PQAA 4DR2Q 2E5LL 1HNZQ 3H3VI 2VY3A 4AQYL 1X4SA 2NVXH 3S1MH 3HOXG 1JJCB 1X3FA 2ARPF 4QL5A 4DV6Q 2JB3A 1IBLL 4DR3Q 4LFAL 2N52A 4P74A 1KRTA 2ZJPA 3T1YQ 3IRBA 1IBMQ 1R0RI 1EFWA 3RR5A 4GOPB 2ES2A 1SGRI 4IPHA 4JI3L 1VQCA 4JBKA 3RNUA 5HQ8A 3F1ZA 1FAQA 5ELNA 5JJLA 1QVCA 1SR3A 3D0FA 2R7ZG 4A76A 4BXXG 1A62A 2EIFA 1O7IA 4POGA 1CSQA 2K5NA 3CPFA 3PCOB 4JBMA 4NPSA 4ALPA 2R7ZH 4DR4Q 2L15A 1YJNA 3HOZH 3GTOH 5M3FH 5LMNL 5HI7A 1QZGA 2ORWA 5M5WH 2PI2A 1OXUA 2MNAA 1KIXA 4DV5L 4A3MG 2YFAA 1BUSA 1CGJI 3GTQH 3CC7A 1PPFI 1YTPA 1TXYA 1TOTA 4DR2L 2GKRI 5IP7G 3I2ZA 1SGPI 1K8GA 3BZKA 4U6RA 4B3SQ 1CSOI 1V1HA 2WB1E 3KLWA 1HR0L 3UFFA 2NN6I 3F8TA 3L7ZC 3ULPA 1AE2A 4NXMQ 5IP7H 2K5HA 3DM3A 4DV6L 2KMOA 4AS3A 3CCEA 4IO9A 4B6DA 3GOXA 1TURA 3T1YL 4AYBG 4EQ5A 4DR5Q 4UP7A 4YWMA 4JI2Q 2MJFB 1HZCA 3A5UA 1PH1A 1I94Q 2JQOA 2VL6A 2E2HH 3DA3A 2CWAA 2R92G 1FL0A 3K8AA 3SGBI 1E22A 1YITA 2R7FA 1NUBA 4JC0A 3KJOA 3T1HL 1YJWA 4LF9L 3HKSA 1SGDI 1K8AC 4DR4L 3U4VA 3S1RH 1LUZA 1SGQI 2Z0SA 1YZ6A 2B63G 4DV3L 4DK3C 2N17A 4POFA 1X3EA 3I56A 2CKZB 3U50C 4KI0A 3W5OA 1Q81C 2F4VL 3HKZE 5C44G 4DR7L 3RN2A 3CCLA 2E73A 3CAMA 3S17H 4X64L 4GOPC 2SGPI 2E5RA 1XJVA 3U58A 2AWNA 3KDFB 1X3GA 4IFDI 2DGYA 4HGUA 2VNUD 1VQMA 2ATWA 3H0GG 2WFWA 5C4JH 1I94L 1FJGQ 2KCMA 3H3VH 4OONA 4L5RC 5EX0A 5C0XJ 1VQAA 1Q12A 5FLXc 2DIPA 2IX1A 1G291 4GOPA 3KP9A 2E2JH 3L2PA 2JYYA 3NENA 2YQPA 4GLAC 2FNFX 2Q2TA 5BR8L 1CSPA 1XPOA 4JI7L 2GKVA 3S15H 4QIWE 3F2BA 4A3LG 3CMAA 1GVPA 2ZM6Q 2IX0A 3TS2A 2XRCA 1JT8A 1JE5A 1KRSA 2ALYB 2OTJA 2N49A 1SROA 1WI5A 1HZ9A 1X54A 1NMFA 4DWLA 2MO1A 2WP8J 3SGIA 3ICEA 2ENNA 4GLVB 2V1CA 2R93G 3FKIH 1AN1I 1SRUA 2VQEQ 3CD6A 4DV7Q 1XNQL 4DAYB 1KD1C 1OYVI 3K7UC 2R93H 1EYGA 3PUWA 1BMOA 2QA4A 1PVOA 4JI1L 1EQQA 1HZBA 1MKHA 4OWWB 2CQOA 4GLXA 4JG2A 3ER0A 2UUAL 2VZAA 2B0UC 2JXDA 4APVA 2N3SA 1TWCH 1KXLA 3UEJA 1PFSA 3I4MG 4LNQA 4IPCA 4LWCA 1VCIA 4P72A 1IW4A 1E1TA 1YNXA 1Q8KA 2KHIA 4PZ6A 4AIMA 1EIYB 4MNOA 1I5FA 2WB1G 3HOUG 3I4MH 3S1NH 1KBFA 3K81C 2ZTDA 2JA1A 2NVTH 2QPOA 4DV0Q 5GROA 2ENZA 2JB2A 5IYDG 2UU9Q 2IT1A 1SGYI 1QVGA 3BU2A 3HOUH 1UEBA 4YCUA 2XTRA 1HR0W 4DV7L 2SGEI 2SGFI 1CHOI 4IOAA 5IYDH 1XX6A 2GVAA 2MFIA 3RU0A 2KCTA 4FKDA 3P23A 2E2IH 4UP9A 5HGQA 4IFDG 4JYAQ 3TS0A 5M5YH 4DR6Q 4PZ7A 3OTOL 4Y52H 4GXTA 2IY5B 2NZOA 4GNXA 4YHHQ 1VQ4A 4A24A 2SGQI 3S1QH 1SGNI 1VQ6A 3BJIA 1VQ9A 2VUMH 4C3JH 2Q2HA 4PZ8A 1Y1VG 3CCQA 2OCEA 1SN8A 3M4OH 1MJEA 2NU0I 2Y0SE 3FP9A 4B3RL 4PL5A 1TWGH 4LUVA 3CCUA 4DUYQ 3HKZG 2JA6H 3AEVA 2F66B 1Y1VH 4IFDJ 4B3ML 4UXIA 3SGQI 1B70B 4JI6Q 2UUCQ 3UGIA 4X65L 2UU9L 3UEYA 3UGDA 3QWPA 4HIDA 2A2DA 4XIGS 1YVCA 4LF6L 3A74A 1MT1A 2YV5A 4L5SA 3PO3G 4BY1H 1MJCA 2KMQA 1VQDA 4OO1G 3B6YA 2OQKA 3K80C 4WJ4A 1U5KA 1SFOH 1VQ5A 2Z6KA 4JYAL 5IT9c 5GAGC 3AFQA 3E9HA 3G48A 1B8AA 1L0WA 1X9NA 4YHHL 5IE8A 2HT1A 2UUBL 1E24A 2DUDA 4NB3A 3Q8DA 4X66Q 1EIFA 1N36Q 3IAM1 3TQYA 2ID0A 2RHQB 1DS2I 2L1LB 1K0RA 1PH6A 2J87A 1YO7A 4A3GG 5IY0A 4DNIA 2B29A 3M7NA 1WCMG 3I7FA 2BA1A 3KJPA 2ELIA 1ASZA 4JI6L 5IWAQ 1HNXQ 3HOXH 3QTLD 1RFHA 2BH2A 2ASBA 4IPDA 2ORVA 1WCMH 3PDNA 1N13A 3JC66 3HOYG 1L1OB 1N32L 3LJ0A 2JAEA 1IBKQ 2LEOA 3CCRA 4LUZA 3SDJA 1PA6A 4H02A 2KKMA 1JJGA 1EQRA 3VDUA 3DO9A 4IJHA 4A3CG 3CXLA 1UVFA 2A20A 4BA2I 2WCYA 5H1SE 3HOYH 4PL3A 2VQFQ 1Z9FA 4BXXH 1VDDA 4UPAA 4G75A 2BH8A 4BY7G 1E3PA 3DLLA 4AH6A 4QQBX 3OL0A 1HJAI 2JJQA 2OWOA 1HNZL 1Q82C 4A3MH 3RLOA 4A3KG 1YIJA 3U4ZA 3H15A 2YFBA 1GD7A 4DR3L 3TJQA 3S24A 1IBML 4A3KH 4JI4Q 1HNXL 3M4QA 3HOWG 1S72A 4HJ7A 1Q7YC 2B8TA 5E7NA 5FUVA 2CFMA 1A0IA 1AH9A 1IBKL 4LF4Q 2W0TA 4SGBI 1D8LA 5ELOA 3JSBA 1VQOA 4LF5Q 3OXFA 4OAUC 5C4XG 1YHQA 3NBHB 2R92H 1TGSI 1CKOA 5M5XH 4XTCS 1XMOQ 3OXGA 4R4IA 1FGUA 3RLFA 3I4OA 4GN5A 5CCMA 1I3QH 2IP6A 1A63A 2WAQG 4LF8Q 4X6AH 1PCEA 1JMCA 1OVOA 1VQHA 4RMFA 3AQQA 3PUVA 2P6AC 1G6PA 2CCZA 4LFCQ 4B3SL 1C0AA 2B63H 3ZJYC 1AE3A 1Q46A 4A4IA 5DAEA 4BBSG 4L5TA 3J81c 4JI8Q 3FC3A 2I5MX 4NXML 2YUUA 3D31A 1OTCA 1L1OC 5C44H 4KLKA 1W2BA 2H5XA 3CPWA 4TQUS 4DR5L 5CCLA 4JI2L 4JI4L 4I1TA 5GQOA 4OX9Q 4BBSH 3J81i 4DV4Q 5EX3A 2V6EA 1PH4A 3GTGH 1KMAA 1PYSB 3H0GH 4JBWA 1XPRA 4NXNQ 1VQNA 1V1QA 4E1PA 5JEAG 4ME3A 4HEA1 1C9OA 4J15A 1L1OA 1N9WA 1W3SA 1GO3E 2SGDI 3UDGA 2BUSA 2QQCA 2QQ0A 3GTKH 4HIMA 1XMOL 4MTNA 3PF5A 2JA7G 4K0KQ 2K50A 2ZTEA 4OXPA 2YTXA 4JOIC 1WJJA 4NV5A 1I6HH 2KHJA 2JA7H 2ZRRA 4YY3Q 4A3LH 1TBOA 2HIVA 2N71A 5IP9G 3VE5A 4OO1I 1C7YA 2FXQA 1UUCA 5HGIA 4DV1Q 2KENA 1LYLA 2JA9A 1M90C 5IYCG 3VDPA 5IP9H 4JOIA 1Q1EA 1FJGL 2HIXA 3JAMc 4R1JA 1EWIA 1VQBA 4A3JG 3E2IA 3CCSA 4Z7HA 2R6GA 1WOCA 4DV2Q 1FYBA 1XNRQ 5JJIA 4DUZQ 2Q2UA 1KBEA 1J5EQ 4MZ9A 1QUQB 2UXBQ 3JAMi 3PO2G 2J9RA 3UITA 3GTJH 2UXDQ 2F52A 3EIVA 5LMUQ 2OTLA 4HJAA 3VA9A 1XPUA 1SLJA 1U0LA 5LMNW 3PO2H 4C2MH 4K0KL 2CWPA 1PH9A 3F2DA 2ZM6L 1PH3A 2NVQH 2XTQA 3UGLA 3GD7A 3F4MA 4GI3C 1G51A 1HPTA 5GAHC 5FLMG 3HOVG 4GN3B 2RHSB 2VQEL 2ERWA 5M3MG 2B3GA 1X55A 3NELA 2M5XA 2UXCQ 4A3IG 4YZDA 1UE7A 4DV1L 2MO0A 3RZOH 2AMCB 1JJ2A 4Z7GA 2VW9A 1KQSA 2OD1A 3LGJA 3EN2A 3A0JA 5M3MH 1Y1CA 4GKJQ 4O0AA 4A3IH 2EQSA 2A1AA 3KDFA 2ODDA 3MXNB 1XMQQ 1SE8A 4DV2L 1XNRL 4A3DG 1K3RA 3I55A 4UXHA 4A93G 4OVOA 2UXBL 1JB7A 1Y14B 3BZCA 1Y8FA 5LMUL 2JA8G 1T9HA 1YEZA 3E9IA 1EOVA 1V1IA 4G76A 4A93H 3UDXA 3MEKA 1IXRA 4R4OA 2F6MB 2RF4A 2E5LQ 1L2FA 3L0IA 2C35B 4AQYQ 2LSSA 4RG1A 3ULLA 1SMXA 4DV0L 3STBD 2AWOA 2N8NA 1W4RA 1V43A 4Q9VA 1K73C 2GKTI 1IZ6A 1XTDA 2JW6A 4UXJA 2NU4I 2LXJA 1IBLQ 1LR9A 4LFAQ 3G6EA 1VQLA 2JA5G 4YCVA 1S40A 3J7ZC 3GTMH 1TBRR 5C3EG 2K14A 3KF6B 3FHWA 1PHJA 3EBEA 1VQFA 4PL4A 1BVSA 5HY6A 3ERSX 2N1AB 1VS0A 3PO3H 4HJ9A 4GKJL 1QZHA 2JA5H 2XMXA 2OVOA 3CXCA 3B4VC 3GTPH 4TVAB 3K7AH 4DR6L 1TBQR 1XMQL 4UP8A 2L7XA 1Z7KB 5FUWA 3MEFA 2YTYA 4A3EG 2A8VA 1GM5A 3J80c 3CQZH 2RCNA 4O2DA 4DV5Q 3GTLH 1WYDA 2K4KA 4DUYL 3G4SA 3J80i 5IYBG 2ROWA 2QEXA 4IJLA 1LM0A 1VQJA 1PH2A 2ZJQA 2PMZE 4GKKQ 2UUCL 3KF8B 1HR0Q 3D00A 4A3GH 2I5LX 1TWFH 3M4PA 1ASYA 4L9MA 1NBWA 4B3TQ 5IYBH 1HNWQ 1Y1BA 1LTLA 4HFVA 1VQPA 1I50H 3PSIA 3RLNA 1VQIA 3J81j 2UZ3A 3UDFA 3OXLA 1H0ZA 4QGUA 3A5ZB 3OW2A 3NEMA 1PH5A 3HOZG 5M3FG 1R79A 1PJUA 1BBWA 4A3CH 3CW2C 1NMGA 3T1HQ 1P16A 2A2CA 4LF9Q 3K0XA 4DR1Q 4C3HH 3PGZA 2ZJRA 2RIOA 1XA6A 4X66L 1VQEA 2Q2IA 3VDYA 1N36L 1PTRA 1M1KC 3RZDH 4JV5Q 4BY7H 4DV3Q 1VQ8A 1OMUA 2JZMA 2F4VQ 1R9TH 2JK8A 2PNHA 4HJ8A 5GAEC 4DR7Q 1LR7A 5EAYA 3PV0A 3F2CA 4KHZA 5IWAL 4X64Q 4GKKL 5AJ3Q 4PG3A 2NVYH 4B3TL 3CCMA 1HNWL 4R4TA 3RN5A 1YHAA 4FDBA 4BBRG 5FUYA 4GS3A 4A75A 3HOWH 3KFUA 5JHWC 1TUSA 1CE3A 2WVJA 1B7YB 3S2DH 2XGTA 4BBRH 4X62Q 4JI5Q 4IPGA 2VQFL 4O1OA 2QQEA 3KF6A 1KHIA 1OXSC 2PI2E 5C4XH 4BA1I 2Y0SG 1TBNA 5LNK1 4YZ9A 5BR8Q 1KL9A 4OWTB 4DK6C 1PV4A 4DR1L 1CT0I 3W1GA 4JI7Q 2MQHA 3LJ1A 1DS3I 4DAMA 1YBYA 4JI0Q 4E1RA 4JV5L 2NU2I 1RL2A 5C0XG 1LR8A 3CC4A 2N78A 4JBJA 2E8GA 1TWAH 4C3IH 2GVIA 5FUXA 1M8CA 3CCJA 5AJ3L 1UWVA 1CUKA 1VQ7A 1XNQQ 2JEAI 4O1PA 3TRZA 1KAWA 2HHHQ 1WFQA 3PIPA 1CKNB 2I0QA 2FUG1 4LF4L 3AYHB 1GKHA 1P8LA 3LJ2A 3PUZA 4JI1Q 4LF7Q 2IHFA 4Y7NH 4GNXB 4LF5L 1RIPA 2A19A 2HQLA 1MIUA 4X62L 4JI5L 4YCWA 3E0EA 2K5VA 3BJUA 2UUAQ 4R4QA 3W1BA 3M85A 2F3IA 1FVIA 3TEHB 3S16H 2L8EA 2V1CC 4NV2A 3M9BA 1YJ9A 1E7ZA 1NTGA 4LF8L 1CT4I 1N34Q 3CF5A 3STBC 2VS1A 1XBTA 3CP0A 1VQGA 1SGEI 1YU6C 4LFCL 1TWHH 2EXDA 1PYBA 4JI0L 2I5HA 1CT2I 3FKIG 2QGQA 5JEAJ 1PTQA 3I9V1 5DLQE 5JJKA 1EUJA 3KOJA 4JI8L 3M3YH 1BBUA 1UE5A 3CCVA 1Z47A 1HH2P 4HIKA 2CJSC 1VQKA 4OX9L 4DV4L 1H95A 2R7DA 2HHHL 4JCVE 3OYYA 5IYCH 3WWVA 2NN6G 4IOCA 2LXKA 1N33Q 4NXNL 1OMTA 4LF7L 2YYZA 4EX5A 2D62A 3CC2A 3IAS1 5GADC 4A3JH 2AHOB 2PQAB 3G71A 3OTOQ 1QVFA 3L0OA 1BKBA 4KHPQ 2BA0A 1Y1WG 2OQ0A 4GN4B 1UVGA 2V53A 4DPGA 4HIOA 1S3OA 2K52A 1M8BA 2P22B 1DGSA 4L5QA 2GVBA 1X6OA 1OXXK 1Y1WH 4B3RQ 1IYJB 1N34L 1IL2A 3AJFA 1HZAA 3SEKC 4YY3L 4A3FG 4HJ5A 1YHBA 1Q1BA 4LW1A 2JE6I 4B3MQ 1J6QA 4X65Q 1IY5A 2K19A 4A3FH 5FLMH 2NU3I 3HOVH 2ZTCA 1NJIC 5J3BA 3FBVA 4A3BG 1N8RC 4LF6Q 4LFBQ 4WJ3M 4GNXC 1X74A 3GDEA 2KMRA 3PUYA 4AYBE 1SJ8A 3UE1A 4P73A 4YWLA 3S14H 2K75A 1YI2A 2F3CI 3HH2C 4A3BH 4DUZL 2AKWB 1N33L 2KCXA 3PIOA 1J5EL 3HFZB 1X65A 2D0PA 1CKNA 2UXDL 4P75A 2IHEA 2VUMG 4OAVB 3J7A5 1CGII 3PUXA 1UE6A 4KHPL 4OWXB 3KY9A 4A3DH 4YZCA 2UUBQ 3GO5A 1UE1A 2QQDA 2JA6G 1E1OA 2JA8H 4LUOA 2VRWB 2K9HA 3OVOA 2WAQE 3CMEA 1HJPA 1TIHA 2XTIA 1Q86C 1OXTA 3S2HH 3KYHC 2CAZB 2KMPA 3PF4A 2UXCL 4BY1G 2Z6KC 4UY8C 4YWKA 2D0OA 1CKMA 4JI3Q 3TREA 3I4NG 3DA4A 2NZHA 1A8VA 1PH7A 4LFBL 1IY6A 1N32Q 3AFPA 2GN5A 3UE0A 1PH8A 5FJ8G 1OXVA 2JEBI 4QY7A 4QJFA 5C3EH 1FARA 2LUYA 3I4NH 3E59A 2KBNA 1K83H 1K9MC 4DKAC 5K36G 2YU9H 2DB6A 4P71A 5FJ8H 1X56A 4R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO3 E;  1NY4 A;  4X64 Q;  4GKK L;  2YTV A;  3BU2 A;  5AJ3 Q;  3HOU H;  5LMN Q;  1V9P A;  4PG3 A;  1UEB A;  4YCU A;  5C0X I;  3UDG A;  2NVY H;  4PMW A;  1D7Q A;  4B3T L;  3CCM A;  1HR0 W;  4DV7 L;  3GTK H;  4HIM A;  1XMO L;  1KC8 C;  1HNW L;  4R4T A;  4MTN A;  3RN5 A;  3PF5 A;  3UDI A;  1NE3 A;  3ULJ A;  2JA7 G;  1QUQ A;  4K0K Q;  1YHA A;  4FDB A;  4IOA A;  5IYD H;  2K50 A;  2ZTE A;  4BBR G;  4OXP A;  4GS3 A;  4A3E H;  2GVA A;  2MFI A;  4A75 A;  2PQA A;  4DR2 Q;  2YTX A;  3HOW H;  3KFU A;  2E5L L;  2KCT A;  4JOI C;  1HNZ Q;  2E2I H;  3H3V I;  1WJJ A;  2VY3 A;  4AQY L;  4UP9 A;  2NVX H;  5HGQ A;  1B7Y B;  3S2D H;  1I6H H;  2KHJ A;  4IFD G;  2JA7 H;  4YY3 Q;  4A3L H;  3S1M H;  4JYA Q;  3TS0 A;  2XGT A;  4BBR H;  4X62 Q;  4JI5 Q;  2HIV A;  1JJC B;  3HOX G;  4IPG A;  5M5Y H;  2VQF L;  4DR6 Q;  1X3F A;  4PZ7 A;  5IP9 G;  3OTO L;  4Y52 H;  3KF6 A;  1KHI A;  1OXS C;  4QL5 A;  4OO1 I;  4DV6 Q;  2IY5 B;  2NZO A;  4GNX A;  4YHH Q;  1VQ4 A;  1C7Y A;  1IBL L;  2FXQ A;  4DR3 Q;  2PI2 E;  5C4X H;  4LFA L;  4DV1 Q;  2KEN A;  4P74 A;  1KRT A;  1LYL A;  2ZJP A;  4BA1 I;  2Y0S G;  2JA9 A;  3T1Y Q;  3S1Q H;  3IRB A;  1M90 C;  1IBM Q;  1VQ6 A;  5IYC G;  3HOV H;  1EFW A;  3RR5 A;  5BR8 Q;  1VQ9 A;  1KL9 A;  4GOP B;  2ES2 A;  2VUM H;  4OWT B;  4DK6 C;  1PV4 A;  4DR1 L;  4C3J H;  4IPH A;  5IP9 H;  2Q2H A;  4PZ8 A;  1Y1V G;  4JI3 L;  1VQC A;  3CCQ A;  2OCE A;  1SN8 A;  3W1G A;  4JBK A;  4JI7 Q;  3M4O H;  2MQH A;  3RNU A;  4JOI A;  1MJE A;  1Q1E A;  3F1Z A;  1FJG L;  2HIX A;  2Y0S E;  3FP9 A;  3JAM c;  5ELN A;  4B3R L;  4R1J A;  1TWG H;  5JJL A;  1EWI A;  1VQB A;  1QVC A;  1SR3 A;  4DAM A;  1YBY A;  4JI0 Q;  4LUV A;  3D0F A;  4A3J G;  3CCU A;  4JV5 L;  4DUY Q;  3HKZ G;  3CCS A;  2JA6 H;  2R7Z G;  4A76 A;  4BXX G;  1A62 A;  1RL2 A;  4DV2 Q;  2R6G A;  1WOC A;  3AEV A;  5C0X G;  1XNR Q;  3CC4 A;  5JJI A;  4DUZ Q;  1Y1V H;  2N78 A;  2EIF A;  4JBJ A;  2Q2U A;  1O7I A;  2E8G A;  4IFD J;  4B3M L;  4POG A;  1J5E Q;  1CSQ A;  4MZ9 A;  1QUQ B;  2K5N A;  2UXB Q;  3CPF A;  1B70 B;  4JI6 Q;  3JAM i;  3PO2 G;  3PCO B;  2UUC Q;  4X65 L;  3GTJ H;  2UXD Q;  2F52 A;  3EIV A;  1TWA H;  4NPS A;  4C3I H;  5LMU Q;  4ALP A;  2UU9 L;  2OTL A;  4JBM A;  2R7Z H;  4DR4 Q;  2L15 A;  4HID A;  1YJN A;  4HJA A;  3HOZ H;  3CCJ A;  5AJ3 L;  1UWV A;  5M3F H;  3GTO H;  5LMN L;  4XIG S;  1YVC A;  4LF6 L;  1CUK A;  1QZG A;  1VQ7 A;  5M5W H;  2PI2 A;  1OXU A;  1XPU A;  1XNQ Q;  1SLJ A;  2MNA A;  2JEA I;  1KIX A;  4DV5 L;  1U0L A;  3A74 A;  2YV5 A;  5LMN W;  4A3M G;  3TRZ A;  1KAW A;  4L5S A;  2HHH Q;  3PO3 G;  1WFQ A;  4BY1 H;  3PIP A;  3PO2 H;  4C2M H;  1CKN B;  3GTQ H;  4K0K L;  3CC7 A;  2CWP A;  2I0Q A;  1PH9 A;  4LF4 L;  3F2D A;  1MJC A;  2ZM6 L;  1PH3 A;  3AYH B;  2NVQ H;  1GKH A;  1P8L A;  1TXY A;  1VQD A;  1AH9 A;  4DR2 L;  3PUZ A;  4JI1 Q;  5IP7 G;  3I2Z A;  4LF7 Q;  2IHF A;  4Y7N H;  4GNX B;  3BZK A;  3B6Y A;  3GD7 A;  2OQK A;  1K8G A;  4LF5 L;  4OO1 G;  3K80 C;  4WJ4 A;  1RIP A;  1U5K A;  2A19 A;  4B3S Q;  1SFO H;  2HQL A;  2WB1 E;  3KLW A;  1G51 A;  1MIU A;  1VQ5 A;  2Z6K A;  5GAH C;  5FLM G;  3HOV G;  4JYA L;  4GN3 B;  1HR0 L;  4X62 L;  2NN6 I;  4JI5 L;  4YCW A;  3F8T A;  5IT9 c;  3L7Z C;  2RHS B;  2K5V A;  3E0E A;  3BJU A;  3ULP A;  2VQE L;  2UUA Q;  5M3M G;  1AE2 A;  4R4Q A;  5GAG C;  3AFQ A;  3E9H A;  5IP7 H;  3W1B A;  3G48 A;  4NXM Q;  1B8A A;  2B3G A;  1X55 A;  3NEL A;  1L0W A;  2K5H A;  3DM3 A;  2F3I A;  3M85 A;  4DV6 L;  1FVI A;  3TEH B;  3CCE A;  4A3I G;  4YHH L;  1X9N A;  3S16 H;  2V1C C;  3M9B A;  5IE8 A;  4IO9 A;  1YJ9 A;  1UE7 A;  4DV1 L;  2HT1 A;  2MO0 A;  2UUB L;  3RZO H;  1E7Z A;  2AMC B;  1E24 A;  2DUD A;  1JJ2 A;  3T1Y L;  1NTG A;  4AYB G;  4EQ5 A;  4UP7 A;  4YWM A;  4JI2 Q;  4NB3 A;  4DR5 Q;  2A8V A;  1HZC A;  4LF8 L;  3Q8D A;  4X66 Q;  3A5U A;  1PH1 A;  2VW9 A;  1I94 Q;  1KQS A;  2JQO A;  3LGJ A;  2VL6 A;  1EIF A;  1N36 Q;  2E2H H;  3EN2 A;  3A0J A;  5M3M H;  1N34 Q;  3CF5 A;  3STB C;  3TQY A;  2VS1 A;  2ID0 A;  2RHQ B;  3CP0 A;  1VQG A;  1K0R A;  4GKJ Q;  4O0A A;  4A3I H;  2EQS A;  1PH6 A;  4LFC L;  2A1A A;  3KDF A;  2CWA A;  1TWH H;  2R92 G;  2EXD A;  1PYB A;  1FL0 A;  3K8A A;  4JI0 L;  3MXN B;  2I5H A;  4A3G G;  5IY0 A;  3FKI G;  2B29 A;  4DNI A;  1XMQ Q;  1SE8 A;  3M7N A;  1E22 A;  1WCM G;  2QGQ A;  3I7F A;  5JEA J;  4DV2 L;  1YIT A;  2R7F A;  5DLQ E;  1XNR L;  2BA1 A;  4JC0 A;  5JJK A;  1EUJ A;  3KOJ A;  4JI8 L;  4A3D G;  1K3R A;  3I55 A;  3KJP A;  3KJO A;  4A93 G;  1ASZ A;  3T1H L;  3M3Y H;  2UXB L;  1BBU A;  1JB7 A;  1UE5 A;  1YJW A;  4JI6 L;  3CCV A;  1Y14 B;  4LF9 L;  3BZC A;  5IWA Q;  1Z47 A;  3HKS A;  1HNX Q;  3HOX H;  1HH2 P;  4HIK A;  1K8A C;  2BH2 A;  2ASB A;  5LMU L;  2JA8 G;  4IPD A;  4DR4 L;  1WCM H;  1T9H A;  3U4V A;  1YEZ A;  1VQK A;  3S1R H;  3E9I A;  4OX9 L;  1LUZ A;  3JC6 6;  4DV4 L;  1EOV A;  2Z0S A;  3HOY G;  1H95 A;  1L1O B;  2R7D A;  1N32 L;  1YZ6 A;  4A93 H;  1IBK Q;  4JCV E;  2HHH L;  3CCR A;  4LUZ A;  3OYY A;  2B63 G;  3UDX A;  5IYC H;  1IXR A;  4DV3 L;  4DK3 C;  3WWV A;  4R4O A;  4POF A;  1X3E A;  1PA6 A;  3I56 A;  2CKZ B;  2NN6 G;  3U50 C;  4KI0 A;  2RF4 A;  4H02 A;  3W5O A;  4IOC A;  1Q81 C;  1L2F A;  1EQR A;  2E5L Q;  2LXK A;  1JJG A;  2F4V L;  1N33 Q;  4IJH A;  4NXN L;  2C35 B;  4A3C G;  4AQY Q;  2LSS A;  4LF7 L;  2YYZ A;  4RG1 A;  3ULL A;  4BA2 I;  1SMX A;  4DV0 L;  5H1S E;  3HOY H;  3HKZ E;  2D62 A;  4EX5 A;  5C44 G;  3STB D;  4DR7 L;  3CC2 A;  5GAD C;  3RN2 A;  2AWO A;  2N8N A;  3CCL A;  1V43 A;  4A3J H;  1K73 C;  2VQF Q;  1Z9F A;  1IZ6 A;  2AHO B;  4BXX H;  2PQA B;  1XTD A;  3CAM A;  3OTO Q;  4X64 L;  3G71 A;  4GOP C;  3S17 H;  1QVF A;  3L0O A;  1BKB A;  4KHP Q;  2BA0 A;  1XJV A;  4UPA A;  3U58 A;  2AWN A;  1Y1W G;  2LXJ A;  1IBL Q;  2BH8 A;  2OQ0 A;  4LFA Q;  4GN4 B;  3KDF B;  3G6E A;  1X3G A;  4IFD I;  1VQL A;  2JA5 G;  4BY7 G;  1E3P A;  2DGY A;  4YCV A;  3DLL A;  1S40 A;  4AH6 A;  4DPG A;  3J7Z C;  4HIO A;  5IWA L;  1S3O A;  3GTM H;  2K52 A;  5C3E G;  1VQM A;  2VNU D;  2K14 A;  3KF6 B;  2ATW A;  3H0G G;  1DGS A;  3FHW A;  2WFW A;  4QQB X;  1PHJ A;  3EBE A;  4L5Q A;  5C4J H;  2GVB A;  1VQF A;  1X6O A;  2JJQ A;  1I94 L;  1HNZ L;  1BVS A;  2KCM A;  5HY6 A;  2OWO A;  1Q82 C;  1FJG Q;  1OXX K;  3ERS X;  1Y1W H;  3H3V H;  4B3R Q;  1IYJ B;  4OON A;  4A3M H;  1N34 L;  1IL2 A;  1HZA A;  1VS0 A;  3PO3 H;  4HJ9 A;  4GKJ L;  1QZH A;  2JA5 H;  4YY3 L;  4A3F G;  4L5R C;  5C0X J;  3RLO A;  1VQA A;  4HJ5 A;  4A3K G;  1YIJ A;  3U4Z A;  3CXC A;  1Q12 A;  3GTP H;  5FLX c;  1YHB A;  4TVA B;  3K7A H;  3H15 A;  2IX1 A;  4DR6 L;  1XMQ L;  1G29 1;  1Q1B A;  4GOP A;  4LW1 A;  2JE6 I;  2E2J H;  4UP8 A;  4B3M Q;  1GD7 A;  4DR3 L;  1J6Q A;  3L2P A;  3NEN A;  4X65 Q;  4A3F H;  3MEF A;  4GLA C;  3S24 A;  2YTY A;  5FLM H;  2ZTC A;  4A3E G;  4A3K H;  1NJI C;  5J3B A;  1GM5 A;  1IBM L;  2Q2T A;  5BR8 L;  3J80 c;  1HNX L;  3M4Q A;  4A3B G;  3HOW G;  3CQZ H;  1N8R C;  4LF6 Q;  4LFB Q;  4WJ3 M;  1S72 A;  4HJ7 A;  1Q7Y C;  1CSP A;  1XPO A;  2RCN A;  4O2D A;  5E7N A;  4DV5 Q;  4GNX C;  4JI7 L;  3S15 H;  3GDE A;  3GTL H;  1WYD A;  3PUY A;  4AYB E;  4QIW E;  2K4K A;  3F2B A;  4A3L G;  3UE1 A;  3CMA A;  2CFM A;  1A0I A;  1GVP A;  1IBK L;  4P73 A;  2IX0 A;  2ZM6 Q;  4LF4 Q;  4YWL A;  4DUY L;  3TS2 A;  3S14 H;  1JT8 A;  1D8L A;  1JE5 A;  2K75 A;  3G4S A;  5ELO A;  1YI2 A;  1VQO A;  1KRS A;  3J80 i;  2ALY B;  5IYB G;  2N49 A;  1SRO A;  2QEX A;  4A3B H;  2OTJ A;  1WI5 A;  1HZ9 A;  1X54 A;  4DUZ L;  4LF5 Q;  4IJL A;  1NMF A;  2AKW B;  1N33 L;  3PIO A;  2MO1 A;  2WP8 J;  3SGI A;  1J5E L;  3ICE A;  5C4X G;  3HFZ B;  1LM0 A;  1VQJ A;  1YHQ A;  3NBH B;  4GLV B;  1PH2 A;  2ZJQ A;  1X65 A;  2R92 H;  2PMZ E;  2D0P A;  4GKK Q;  2UUC L;  1CKN A;  3KF8 B;  1HR0 Q;  2R93 G;  4A3G H;  2UXD L;  2I5L X;  1TWF H;  2IHE A;  3FKI H;  3M4P A;  4P75 A;  1ASY A;  2VUM G;  1CKO A;  1SRU A;  1NBW A;  4B3T Q;  5M5X H;  4XTC S;  2VQE Q;  5IYB H;  3CD6 A;  4DV7 Q;  3J7A 5;  2UXC Q;  1XMO Q;  1HNW Q;  3PUX A;  1UE6 A;  4KHP L;  4R4I A;  1LTL A;  1FGU A;  4OWX B;  1VQP A;  3RLF A;  1I50 H;  1XNQ L;  3PSI A;  4A3D H;  3I4O A;  4GN5 A;  3RLN A;  4DAY B;  1I3Q H;  2UUB Q;  1KD1 C;  3GO5 A;  1UE1 A;  1VQI A;  3K7U C;  3J81 j;  2JA6 G;  1A63 A;  1E1O A;  2WAQ G;  4LF8 Q;  2R93 H;  4X6A H;  1EYG A;  3PUW A;  2JA8 H;  3UDF A;  1JMC A;  1VQH A;  4RMF A;  2QA4 A;  3AQQ A;  3PUV A;  4LUO A;  4JI1 L;  1PVO A;  1EQQ A;  1G6P A;  2CCZ A;  1HZB A;  4LFC Q;  1MKH A;  4OWW B;  2CQO A;  4B3S L;  1C0A A;  2WAQ E;  3CME A;  4QGU A;  3A5Z B;  4GLX A;  1HJP A;  3ZJY C;  3OW2 A;  3NEM A;  4JG2 A;  2B63 H;  1AE3 A;  1Q46 A;  3ER0 A;  1PH5 A;  2XTI A;  4A4I A;  1Q86 C;  3HOZ G;  1OXT A;  5M3F G;  4BBS G;  4L5T A;  3S2H H;  3J81 c;  3KYH C;  2UUA L;  1BBW A;  4A3C H;  4JI8 Q;  2I5M X;  4NXM L;  2VZA A;  3PF4 A;  3CW2 C;  3D31 A;  1NMG A;  3T1H Q;  1OTC A;  1L1O C;  1P16 A;  5C44 H;  4BY1 G;  2UXC L;  4APV A;  2Z6K C;  2N3S A;  1TWC H;  4KLK A;  4YWK A;  1W2B A;  4LF9 Q;  4UY8 C;  1KXL A;  2H5X A;  2D0O A;  3K0X A;  1QVG A;  1PFS A;  3I4M G;  3CPW A;  4TQU S;  4DR5 L;  4JI2 L;  4DR1 Q;  1CKM A;  4C3H H;  3PGZ A;  4JI4 L;  4LNQ A;  4JI3 Q;  4IPC A;  5GQO A;  2ZJR A;  4LWC A;  3TRE A;  1VCI A;  4P72 A;  3I4N G;  2NZH A;  4OX9 Q;  4X66 L;  1A8V A;  1PH7 A;  1VQE A;  2Q2I A;  4BBS H;  1E1T A;  1YNX A;  3J81 i;  4DV4 Q;  3VDY A;  1N36 L;  4LFB L;  1Q8K A;  1N32 Q;  2KHI A;  3AFP A;  1M1K C;  4PZ6 A;  3RZD H;  2GN5 A;  4JV5 Q;  4BY7 H;  3UE0 A;  3GTG H;  1PH4 A;  1PH8 A;  5FJ8 G;  4AIM A;  1OXV A;  2JEB I;  4DV3 Q;  1EIY B;  4MNO A;  4QY7 A;  1I5F A;  2WB1 G;  4QJF A;  1VQ8 A;  3HOU G;  3I4M H;  5C3E H;  3S1N H;  4JI4 Q;  3K81 C;  1PYS B;  2ZTD A;  3H0G H;  4JBW A;  2F4V Q;  1R9T H;  2NVT H;  1XPR A;  2JK8 A;  4NXN Q;  3I4N H;  2PNH A;  2KBN A;  1K83 H;  1VQN A;  1V1Q A;  5JEA G;  4HJ8 A;  4DV0 Q;  1K9M C;  4ME3 A;  5GRO A;  4DKA C;  5GAE C;  4DR7 Q;  1C9O A;  5K36 G;  5IYD G;  4J15 A;  1L1O A;  3PV0 A;  5EAY A;  3F2C A;  2YU9 H;  4P71 A;  1N9W A;  2UU9 Q;  4KHZ A;  5FJ8 H;  2IT1 A;  1X56 A;  1W3S A;  4R4C A; 
#chains in the Genus database with same CATH topology
 1NY4 A;  5IIF A;  3I73 A;  3GTL B;  2YTV A;  1KNA A;  1G6Z A;  2JB1 A;  1V9P A;  5C0X I;  5LMN Q;  1ROD A;  1AFP A;  1SJE D;  5EBD A;  1HTL D;  4PMW A;  1HDL A;  1D7Q A;  1MI2 A;  3PIO 3;  4QIW B;  5JVH 3;  4A3E B;  1KC8 C;  2X3T A;  3UDI A;  1X32 A;  1NE3 A;  3J7Y W;  1SBB B;  3ULJ A;  1QUQ A;  5K36 H;  2NU1 I;  4AS2 A;  3TZD A;  4A3E H;  1TS2 A;  2PQA A;  4DR2 Q;  2K5Q A;  2E5L L;  3A7A B;  3J7A V;  1HNZ Q;  3H3V I;  1TWF B;  2VY3 A;  4AQY L;  1X4S A;  2NVX H;  5KYL A;  3OSO A;  2SNM A;  4KMU C;  3FNB A;  4DGZ A;  3S1M H;  4ABN A;  1I50 B;  3DWP A;  5C5M A;  4F7X A;  3HOX G;  1JJC B;  3K0Y A;  1NR2 A;  5DM7 3;  4CGY B;  1X3F A;  2L55 A;  4L63 B;  2ARP F;  2EYO A;  2MUY A;  1T5X D;  2EYP A;  4RHR A;  4QL5 A;  5E4X A;  4DV6 Q;  2JB3 A;  5J8F A;  1CQF A;  1IBL L;  4DR3 Q;  3SK4 A;  4LFA L;  1DOM A;  2N52 A;  1CFM A;  3H91 A;  4P74 A;  1KRT A;  2ZJP A;  3T1Y Q;  1GUG A;  3IRB A;  1IBM Q;  1PTO F;  3IFD A;  1R0R I;  3ERO A;  1EFW A;  3RR5 A;  1LT5 D;  4C1N K;  4ZLT F;  4GOP B;  2ES2 A;  1UNS A;  2RQX A;  2ETD A;  1SGR I;  4IPH A;  4JI3 L;  1VQC A;  3FMC A;  4JBK A;  3RNU A;  5JPN C;  3F1Z A;  5HQ8 A;  1FAQ A;  2ZW3 A;  3NUC A;  1MJ9 A;  5ELN A;  5JJL A;  1QVC A;  1SR3 A;  1II3 A;  2K1B A;  3D0F A;  1SNQ A;  1GHJ A;  4ODG A;  2R7Z G;  4A76 A;  4BXX G;  1A62 A;  5L37 A;  1FR3 A;  2EIF A;  1O7I A;  3K59 A;  1HXY D;  4POG A;  5D14 A;  4C3H B;  1CSQ A;  2K5N A;  3CPF A;  1VF5 C;  3PCO B;  2H1E A;  2MHV A;  2QGM A;  4JBM A;  4NPS A;  5IGB A;  4ALP A;  2R7Z H;  3MXN A;  3FPU B;  4DR4 Q;  3RZD B;  2L15 A;  1YJN A;  3HOZ H;  4BY7 B;  1I4G A;  2M2L A;  5M3F H;  3GTO H;  5LMN L;  5HI7 A;  4NKL A;  1QZG A;  5AFW A;  2ORW A;  5M5W H;  2PI2 A;  1OXU A;  2MNA A;  1KIX A;  3TOA A;  4DV5 L;  4A3M G;  3QG1 A;  1R9T B;  4IUQ A;  4FXD A;  2YFA A;  1BUS A;  1CGJ I;  2M00 A;  3GTQ H;  1HQM C;  3CC7 A;  2OF1 A;  2LKV A;  2LMC B;  1PPF I;  1YTP A;  5DEH A;  1TXY A;  1TOT A;  1UUP A;  4DR2 L;  2GKR I;  5IP7 G;  3I2Z A;  1SGP I;  1K8G A;  3BZK A;  4U6R A;  4B3S Q;  1CSO I;  1V1H A;  3KLW A;  1CM9 A;  2NVY B;  2WB1 E;  2EZV A;  1P9Z A;  4WOR A;  2B2W A;  4B9X A;  1HR0 L;  1TDP A;  1PYW D;  1MJB A;  5E1F A;  3UFF A;  2NN6 I;  1SYG A;  3F8T A;  3L7Z C;  5FLX L;  1M4V A;  3ULP A;  3G7L A;  1Y8O B;  1AE2 A;  4NXM Q;  5IP7 H;  2VB3 X;  1EL0 A;  1IW7 C;  2PNR C;  1B9M A;  4E6I A;  5COR A;  2K5H A;  3DM3 A;  4DV6 L;  3HOW B;  2KMO A;  4AS3 A;  3CCE A;  4NMZ A;  3X3M A;  1H9K A;  4IO9 A;  5JJZ A;  1LTA D;  2E2H B;  4B6D A;  3GOX A;  1TUR A;  1B53 A;  3T1Y L;  2BL7 A;  4AYB G;  2EY5 A;  4UP7 A;  4YWM A;  4JI2 Q;  4EQ5 A;  4DR5 Q;  2MJF B;  2AUJ D;  3S2D B;  1HZC A;  1AP0 A;  4J1M A;  3A5U A;  1PH1 A;  2F0H A;  1I94 Q;  4BBR B;  2JQO A;  3EVQ A;  2G5D A;  2VL6 A;  2E2H H;  3DA3 A;  4QF4 A;  1DXM A;  4ULL A;  4XT1 B;  1C4Q A;  5DNF A;  2CWA A;  2R92 G;  4R8I A;  4LAA A;  3Q0A A;  1FL0 A;  3K8A A;  5C4X B;  3SGB I;  1E22 A;  2WGC A;  1YIT A;  2R7F A;  1VF7 A;  1ILP A;  1NUB A;  4JC0 A;  1JQO A;  3KJO A;  3W2D A;  3T1H L;  1ML0 D;  4CDE C;  3P1H A;  1YJW A;  3NQT A;  4LF9 L;  3HKS A;  2RA4 A;  1SGD I;  1K8A C;  3FSY A;  3QAH A;  1ULK A;  3BYY B;  4DR4 L;  1BDO A;  3U4V A;  2Y0S B;  3S1R H;  1WD1 A;  1EY6 A;  1LUZ A;  4XDX A;  1F2L A;  1SGQ I;  3ONA B;  2Z0S A;  2X69 A;  2RSO A;  1YZ6 A;  2A6H D;  2IW3 A;  4R9W A;  2F1M A;  2B63 G;  4RGN A;  4DV3 L;  4DK3 C;  5E3P A;  2N17 A;  4POF A;  1X3E A;  4I65 A;  3I56 A;  1TS3 A;  2CKZ B;  3U50 C;  4KI0 A;  5FO8 B;  3W5O A;  1Q81 C;  1S5E D;  2WAC A;  3Q23 A;  2F4V L;  2GIV A;  1TWA B;  4C3I B;  2FMC A;  4P2C B;  4FYD A;  3I3C A;  5LL6 X;  3HKZ E;  5C44 G;  4DR7 L;  3RN2 A;  1EIH A;  3CCL A;  1ENC A;  2DJF C;  1EWC A;  1SNO A;  2E73 A;  2UVO A;  3CAM A;  3S17 H;  4X64 L;  4GOP C;  5C0X H;  4H7B A;  1QIL A;  2SGP I;  5EPL A;  2E5R A;  1AZP A;  1XJV A;  5IT9 E;  2O5I C;  4X3S A;  2AWN A;  3U58 A;  2F0E A;  2CW0 C;  1W6K A;  1WTR A;  3KDF B;  1X3G A;  3R5C A;  4IFD I;  1Q8I A;  4QCL A;  1P9G A;  1XTC D;  2DGY A;  4Y7N B;  3VR2 A;  4HGU A;  1PXU A;  3A8K E;  2VNU D;  1VQM A;  2ATW A;  3H0G G;  1IYU A;  3BVG A;  2RSN A;  2WFW A;  1J8I A;  2A68 C;  5C4J H;  1EU4 A;  1I94 L;  3DEO A;  1EZ8 A;  1LTG D;  2KCM A;  1FJG Q;  3H3V H;  4FXG C;  4OON A;  4CDF C;  1RTO A;  3K6O A;  3Q22 A;  5D3I B;  4K6D A;  2EJM A;  4L5R C;  5EX0 A;  3IAY A;  5C0X J;  1VQA A;  5IGD A;  1S5C D;  4F88 A;  3I90 A;  3S16 B;  1Q12 A;  1PFM A;  5FLX c;  1KLG D;  2DIP A;  2IPK D;  4ID6 A;  2IX1 A;  2FIN B;  1G29 1;  4GOP A;  3B55 A;  3KP9 A;  2E2J H;  5HUR A;  1DD2 A;  2HCI A;  2F0J A;  3TO6 A;  4MN3 A;  1CA5 A;  3L2P A;  2JYY A;  3NEN A;  5D65 A;  2YQP A;  1MBY A;  3NQI A;  3I70 A;  4GLA C;  3S15 B;  2FNF X;  5J1Z A;  2Q2T A;  5BR8 L;  5COY A;  3VYR A;  4JPB W;  5ELE A;  2F0S A;  2K7V A;  1CSP A;  3GQB A;  1XPO A;  4JI7 L;  2GKV A;  3S15 H;  2KCN A;  2L5T A;  4X3U A;  5CMD A;  2F3V A;  3IKJ A;  1CQV A;  4QIW E;  2FFK B;  3F2B A;  4A3L G;  1TT2 A;  3CMA A;  2QSB A;  1GVP A;  2ZM6 Q;  2IX0 A;  3TS2 A;  2XRC A;  1JT8 A;  1JE5 A;  3M3Y B;  1KRS A;  1LV9 A;  2ALY B;  2B2Y C;  2N49 A;  1SRO A;  1KDA A;  2OTJ A;  1WI5 A;  1HZ9 A;  1X54 A;  3SXH A;  1NMF A;  1PTO H;  1EOT A;  4DWL A;  3SK6 A;  2MO1 A;  2WP8 J;  3SGI A;  3ICE A;  1FY7 A;  2ENN A;  4GLV B;  5E3F A;  4ILW A;  2V1C A;  3NTK A;  3MVV A;  2HD3 A;  2Y0M A;  3D6W A;  4QB4 A;  5T1I A;  2R93 G;  5I4D A;  3MHB A;  3MFG A;  3FKI H;  4UAI A;  1AN1 I;  1SRU A;  2EE1 A;  1EY7 A;  2VQE Q;  3CD6 A;  4DV7 Q;  4FF1 A;  5FKA C;  1X3Q A;  2CHB D;  1XNQ L;  3BVZ A;  1DOL A;  4IUV A;  4DAY B;  1KD1 C;  1OYV I;  4KN4 C;  4RCN A;  3K7U C;  2R93 H;  1EYG A;  3PUW A;  3TP8 A;  1FNW A;  1BMO A;  4K2K A;  3AB9 A;  2L12 A;  1BQQ T;  1STB A;  2QA4 A;  1PVO A;  4JI1 L;  2QW7 A;  1PMR A;  2CVR A;  1EQQ A;  1HZB A;  1MKH A;  4OWW B;  2CQO A;  2B2U C;  4FXK C;  2FHT A;  4GLX A;  4JG2 A;  3BG3 A;  3ER0 A;  2HUG A;  3WOF A;  3V2T A;  2UUA L;  2EXZ A;  1F9P A;  2VZA A;  2XSC A;  4QMG A;  2B0U C;  2JXD A;  4APV A;  2N3S A;  1TWC H;  1KXL A;  1NCV A;  2F0N A;  1Y1W B;  3UEJ A;  1PFS A;  3I4M G;  2EYL A;  2KUM A;  1GUO A;  4LNQ A;  4IPC A;  4LWC A;  1VCI A;  4P72 A;  1IW4 A;  2M9V A;  2F0M A;  3TZU A;  1NSN S;  1E1T A;  1YNX A;  1Q8K A;  2KHI A;  4PZ6 A;  2IL8 A;  3R93 A;  5EGT A;  2VB2 X;  2B2U A;  4AIM A;  1A15 A;  1EIY B;  3N6R A;  4MNO A;  1I5F A;  2WB1 G;  3HOU G;  3I4M H;  3S1N H;  1I4H A;  2X6L A;  3K81 C;  1KBF A;  4K14 A;  2ZTD A;  2OT2 A;  2EJG C;  2JA1 A;  2NVT H;  4A3F B;  3T4A C;  1LT6 D;  3HOV B;  4KJN A;  2QPO A;  1NAP A;  2IWH A;  1UAP A;  1KTK A;  5BN4 A;  4DV0 Q;  3HG9 A;  1PLF A;  5GRO A;  5LL6 S;  2ENZ A;  2JB2 A;  3QOL A;  3TSS A;  1WKX A;  1PFB A;  3H6M A;  5IYD G;  4FF2 A;  2EY2 A;  4FP5 D;  2PZU A;  1WTJ A;  3BVM A;  2UU9 Q;  2IT1 A;  1SGY I;  1XX8 A;  2I07 B;  1QVG A;  1DCZ A;  3BU2 A;  3HOU H;  1LTT D;  1JOK A;  1UEB A;  4YCU A;  5IT9 L;  2XTR A;  1EQV A;  1HR0 W;  4KV6 A;  4DV7 L;  3S14 B;  1TY2 A;  1LT3 D;  2CWH A;  4A3B B;  2SGE I;  2SGF I;  1CHO I;  4IOA A;  5IYD H;  4CJ2 C;  4B9W A;  1HEV A;  1XX6 A;  4RGM A;  2ENB A;  4KY5 A;  2K5W A;  2PW5 A;  4EQN A;  2GVA A;  1WTO A;  2MFI A;  3RU0 A;  4EVO A;  2KCT A;  5C5L A;  3P23 A;  5IOC A;  4FKD A;  2E2I H;  2QEJ C;  1CTM A;  4UP9 A;  5HGQ A;  3NHH A;  3MXG A;  4IFD G;  5IOD A;  1DJR D;  4RKB A;  1F2M A;  4JYA Q;  3TS0 A;  4A3D B;  5M5Y H;  4JK1 C;  4FO2 A;  4DR6 Q;  3D4D A;  4PZ7 A;  3GV6 A;  4C3J G;  3OTO L;  4Y52 H;  1I4P A;  4RA8 A;  1EYD A;  4RGT A;  4GXT A;  4KHV A;  1RDP D;  3A8I E;  2IY5 B;  2OXP A;  2RAD A;  2NZO A;  4YHH Q;  4GNX A;  3J81 E;  1VQ4 A;  2JA8 B;  4A24 A;  4IFD H;  2SGQ I;  3S1Q H;  1XXG A;  1SGN I;  1VQ6 A;  3BJI A;  3CHB D;  2PQE A;  1VQ9 A;  3EQL C;  2VUM H;  4C3J H;  2Q2H A;  4PZ8 A;  1Y1V G;  3MAQ A;  3BDO A;  3CCQ A;  2OCE A;  1SN8 A;  3TO7 A;  3M4O H;  1YNN C;  1XWE A;  3N52 A;  1MJE A;  3ND8 A;  2NU0 I;  2Y0S E;  3FP9 A;  4B3R L;  4PL5 A;  1TWG H;  1WTX A;  3S2H B;  1LAB A;  4WJW A;  4LUV A;  3CCU A;  4DUY Q;  3HKZ G;  2JA6 H;  2TSS A;  2KQ3 A;  5EBC A;  3AEV A;  1C8C A;  2QDB A;  2F66 B;  1PDQ A;  5FLX E;  5CBE E;  1Y1V H;  2FEF A;  2JBW A;  4IFD J;  4B3M L;  3BDC A;  4UXI A;  3SGQ I;  2Z6B A;  1B70 B;  1HFG A;  1KAA A;  5F2D A;  1STE A;  4JI6 Q;  1TS5 A;  2UUC Q;  1L0Y B;  4QUF A;  4X65 L;  3UGI A;  4YIJ A;  4RAU C;  2UU9 L;  3UEY A;  3UGD A;  3QWP A;  4HID A;  3A7L A;  2A2D A;  4XIG S;  1YVC A;  2L0C A;  3VR5 A;  2PO4 A;  4LF6 L;  2F0P A;  1U4R A;  5C3E B;  3A74 A;  1MT1 A;  2YV5 A;  1MJA A;  4L5S A;  2CWF A;  3PO3 G;  4BY1 H;  3I4N B;  1K83 B;  5CV4 A;  3TBI B;  5CGK A;  1H9S B;  1SYF A;  4TSS A;  1MJC A;  2KMQ A;  3T51 B;  1VQD A;  4LMQ D;  1H9R A;  1B3A A;  3MA2 B;  3LWE A;  4OO1 G;  2XN9 C;  3B6Y A;  3MXU A;  2OQK A;  3K80 C;  4WJ4 A;  1U5K A;  1SFO H;  2K28 A;  1VQ5 A;  3TDQ A;  2Z6K A;  3MWY W;  4DAY A;  5EKK A;  4JYA L;  4KY6 A;  3VR4 A;  5IT9 c;  1HHV A;  4HSP A;  2ZT9 C;  3ERQ A;  4DN4 M;  3AFQ A;  2A6H C;  3E9H A;  5GAG C;  3G48 A;  5IGE A;  1B8A A;  1D5X C;  3R3O A;  1QE6 A;  1L0W A;  1RF2 D;  4OO1 H;  1DON A;  2B2V C;  1X9N A;  4YHH L;  1DZ1 A;  1STY A;  5IE8 A;  3T53 B;  5EKL A;  1EWH A;  2HT1 A;  3D8G A;  2UUB L;  1EEF D;  2KOL A;  1E24 A;  2DUD A;  2NVX B;  4NB3 A;  1CZW A;  3Q8D A;  3S1M B;  4X66 Q;  1SYC A;  3FEW X;  4CKC A;  1EIF A;  1N36 Q;  3IAM 1;  1GUT A;  3TQY A;  2ID0 A;  2F0Q A;  2RHQ B;  1DS2 I;  2L1L B;  1K0R A;  1PH6 A;  1BUV T;  2J87 A;  1YO7 A;  4HED A;  3JAM E;  4JW0 A;  1WTW A;  1QNK A;  4A3G G;  2DNC A;  5IY0 A;  4DNI A;  2B29 A;  3M7N A;  5C4Z A;  1WCM G;  3I7F A;  1Y69 U;  1F9S A;  2BA1 A;  5I6W A;  3RD4 A;  2KEC A;  5KIX A;  3KJP A;  2ELI A;  4NW2 A;  4PQX A;  1ASZ A;  4JI6 L;  5DM6 3;  5IWA Q;  1HNX Q;  3HOX H;  3QTL D;  1RFH A;  1DOK A;  2BH2 A;  2ASB A;  2ZXR A;  1V8Q A;  4IPD A;  3V05 A;  2ORV A;  1WCM H;  4K6L A;  5C3X A;  4RCO A;  3PDN A;  1N13 A;  3JC6 6;  5E4W C;  2SDF A;  2KJX A;  3HOY G;  1BF4 A;  1L1O B;  2BE5 D;  1N32 L;  3LJ0 A;  4HMJ A;  4MHE A;  2JAE A;  1IBK Q;  3O13 A;  2LEO A;  3CCR A;  4LUZ A;  1SND A;  3SDJ A;  1ESR A;  1MD2 D;  1IYV A;  4RHS A;  2DN8 A;  2HCC A;  1PA6 A;  1EFI D;  1ZEQ X;  4H02 A;  2KKM A;  1JJG A;  1EQR A;  5C6A A;  3VDU A;  3A56 A;  3DO9 A;  1CI3 M;  1A3V A;  4IJH A;  4A3C G;  3CXL A;  2R7Z B;  2EYJ A;  4WP4 A;  1UVF A;  2A20 A;  3HZX A;  3HOZ B;  2D9U A;  4BA2 I;  2WCY A;  5H1S E;  1TS4 A;  4PL3 A;  5M3F B;  3HOY H;  3GTO B;  2FMM A;  5M5W B;  3BDL A;  2I46 A;  2VQF Q;  1B9N A;  2A6E D;  1Z9F A;  4G4K A;  4BXX H;  1VDD A;  5CV5 A;  2N88 A;  2SNS A;  3GTQ B;  3SDZ A;  1I4R A;  2F03 A;  3J81 L;  2Z9H A;  4UPA A;  4G75 A;  3MXP A;  2BH8 A;  2N55 A;  4BY7 G;  1E3P A;  1T5E A;  3DLL A;  4AH6 A;  4LK1 C;  3E6Z X;  1PTO D;  1ESF A;  3WDN A;  1Q9B A;  4QQB X;  2WV6 D;  3OL0 A;  4RGO S;  1HJA I;  4I7A A;  5DAU A;  3SK5 A;  2HGK A;  2JJQ A;  5C3W A;  1HNZ L;  2OWO A;  1Q82 C;  4A3M H;  4DNR B;  1NXU A;  5ELC A;  3RLO A;  2L11 A;  4A3K G;  1STG A;  1K28 A;  1YIJ A;  3U4Z A;  1SYE A;  2CWG A;  3H15 A;  3VR6 A;  4DXF A;  1WTH A;  3D4W A;  2YFB A;  3NE5 B;  1GD7 A;  2IJ0 A;  4DR3 L;  5E3Q A;  4BWG B;  1LAC A;  3TJQ A;  3S24 A;  1IBM L;  4A3K H;  4JI4 Q;  5I2Y A;  4OEL B;  1HNX L;  3M4Q A;  2Q8R E;  2F0W A;  3HOW G;  4XQN A;  4O1N A;  1S72 A;  4HJ7 A;  1Q7Y C;  2B8T A;  5E7N A;  2CH4 A;  3TO9 A;  5FUV A;  3ITP A;  2F0V A;  2CFM A;  4G57 A;  1A0I A;  1JC7 A;  1IBK L;  4LF4 Q;  1AH9 A;  3HGB A;  2W0T A;  4SGB I;  1D8L A;  3VYS A;  5ELO A;  3JSB A;  1VQO A;  1PZK D;  2B2T C;  4CBV A;  3KLS A;  4LF5 Q;  1L0X B;  3OXF A;  4OAU C;  5C4X G;  1YHQ A;  3NBH B;  3S1R B;  2R92 H;  4IUP A;  1TGS I;  1CKO A;  5M5X H;  4XTC S;  2RIJ A;  1XMO Q;  2NTT A;  3OXG A;  4R4I A;  1FGU A;  3RLF A;  4ZYS A;  3I4O A;  2WKC A;  4GN5 A;  5CCM A;  1I3Q H;  4O42 A;  2IP6 A;  1G8Z D;  3QIA A;  1EQT A;  1A63 A;  2A5H A;  2WAQ G;  4LF8 Q;  4X6A H;  1BXT A;  3KBG A;  4CDD C;  1GOZ A;  4RWS C;  1PCE A;  1ET6 A;  1JMC A;  1OVO A;  3SHL A;  3S9W A;  1QNU A;  1IL8 A;  1VDZ A;  1VQH A;  3AQQ A;  3PUV A;  4OGQ C;  4RMF A;  2P6A C;  3S17 B;  1G6P A;  1RTN A;  3A8J E;  2CCZ A;  4LFC Q;  3JAM L;  1KLU D;  4B3S L;  1RJT A;  1C0A A;  1SNP A;  2B8G A;  2WII B;  2E75 C;  1K3B C;  1TR5 A;  3ZJY C;  2B63 H;  1AE3 A;  1GXD C;  1Q46 A;  4XT3 B;  1ENA A;  4A4I A;  5DAE A;  1PFN A;  4FVM A;  4BBS G;  4L5T A;  1D1I A;  5G3L F;  3J81 c;  4JI8 Q;  3FC3 A;  2I5M X;  4NXM L;  2YUU A;  3D31 A;  3I8Z A;  1OTC A;  1L1O C;  5C44 H;  3SVM A;  5C4J B;  2NZ1 D;  4KLK A;  1W2B A;  2H5X A;  3R2I A;  3CPW A;  4TQU S;  3VA7 A;  4DR5 L;  5CCL A;  4JI2 L;  4JI4 L;  4I1T A;  5GQO A;  2LY7 A;  3J80 E;  4OX9 Q;  4BBS H;  3J81 i;  4DV4 Q;  1U4L A;  5EX3 A;  4G7H C;  2E2J B;  1S5F D;  4L6T B;  2V6E A;  1PH4 A;  3GTG H;  2NWG A;  4QUC A;  2F0T A;  3Q24 A;  2OZU A;  1KMA A;  1PYS B;  2DJG C;  3H0G H;  4ZUI A;  4JBW A;  1HPC A;  1XPR A;  3E0J A;  4NXN Q;  3DM1 A;  1STH A;  3ND9 A;  4XXE A;  5BN5 A;  1VQN A;  1V1Q A;  2K33 A;  4E1P A;  5JEA G;  4ME3 A;  3K5L A;  4HEA 1;  1C9O A;  3U9S A;  4J15 A;  1L1O A;  2D5D A;  1N9W A;  2RDF A;  1W3S A;  1GO3 E;  2SGD I;  3SEB A;  3UDG A;  2BUS A;  3K5O A;  2DKV A;  2QQC A;  2QQ0 A;  3GTK H;  4HIM A;  1XMO L;  2RC4 A;  2F4I A;  4KKU A;  4MTN A;  3DHQ A;  3PF5 A;  3NTH A;  5NUC A;  2JA7 G;  1K8M A;  4K0K Q;  5C4H A;  2LS0 1;  2K50 A;  1PTO B;  2ZTE A;  4OXP A;  3EFX D;  2O2L D;  2MP1 A;  4ZQ3 A;  1FGB D;  3C3L A;  3VYT A;  1HQR D;  2YTX A;  5FK9 C;  1Z2I A;  4JOI C;  2EJF C;  1WJJ A;  2RDH A;  3FKI B;  2DY8 A;  2PMZ B;  3HRZ C;  1HUN A;  4NV5 A;  1I6H H;  2HDL A;  2KHJ A;  4ZKC B;  2JA7 H;  1JR0 D;  2ZRR A;  4YY3 Q;  4A3L H;  1TBO A;  2J0T D;  2AQ1 B;  2HIV A;  1QWY A;  4ME5 A;  2N71 A;  4XYQ A;  2TMP A;  1S5B D;  5IP9 G;  4IN3 A;  3VE5 A;  4MPI A;  4OO1 I;  5TSS A;  2AUK A;  2R93 B;  1C7Y A;  2FXQ A;  1UUC A;  5HGI A;  4M1U B;  2XWB B;  4DV1 Q;  2KEN A;  1LYL A;  1QJO A;  4U67 3;  1GUW A;  2JA9 A;  1M90 C;  4K5W A;  5IYC G;  3VDP A;  2JSO A;  1ULN A;  3FVQ A;  5KND A;  1F9R A;  1K0S A;  2PQ8 A;  2KCC A;  1ICF B;  1G91 A;  5IP9 H;  2B2Y A;  1HCZ A;  4N9P A;  2KA7 A;  5K5P A;  4R8N A;  2X6G A;  3GV3 A;  1Q1E A;  3HP3 A;  4JOI A;  5FOB B;  4EGV A;  2QZG A;  2HIX A;  1FJG L;  3JAM c;  4R1J A;  3A55 A;  1EWI A;  1VQB A;  3Q6S A;  4A3J G;  3E2I A;  1BO0 A;  3CU7 A;  3CCS A;  5A35 A;  4Z7H A;  2R6G A;  1WOC A;  4I7Z C;  4KD3 A;  4DV2 Q;  1TWC B;  1FYB A;  1XNR Q;  2F0G A;  5JJI A;  4DUZ Q;  3K5N A;  2ZXP A;  3T13 A;  2Q2U A;  1KBE A;  1J5E Q;  4MZ9 A;  1QUQ B;  2UXB Q;  3SE0 A;  5I6Y A;  3JAM i;  3PO2 G;  2J9R A;  3UIT A;  1D5M C;  3NK9 A;  2ICI A;  5I2X A;  3GTJ H;  2O4X A;  2UXD Q;  2F52 A;  3EIV A;  3K58 A;  5LMU Q;  2OTL A;  1VMC A;  2H4O A;  3OWE B;  4HJA A;  3E3X A;  3VA9 A;  4PV1 C;  3I4M B;  3S1N B;  1XPU A;  1SLJ A;  4J8Q A;  1U0L A;  5LMN W;  5EPJ A;  2F0F A;  2NVT B;  2J7Z A;  3PO2 H;  4C2M H;  4K0K L;  1ZXT A;  2CWP A;  1NR4 A;  1PH9 A;  1SXT A;  3F2D A;  1QG7 A;  2ZM6 L;  2RKS A;  1PH3 A;  4IUN A;  2NVQ H;  5FO7 B;  1EY5 A;  2XTQ A;  3UGL A;  3C1F A;  3GD7 A;  3HOU B;  2QDL A;  3F4M A;  4GI3 C;  5EQ0 A;  1G51 A;  1O80 A;  2CQA A;  1TU2 B;  1HPT A;  3H3V C;  1ILQ A;  5FLM G;  5GAH C;  3HOV G;  4GN3 B;  5JAV A;  3QJY A;  1SE2 A;  1JWU D;  2RHS B;  4IUT A;  5J22 A;  2VQE L;  2ERW A;  5M3M G;  2BE5 C;  1MHW C;  4U68 A;  2B3G A;  1X55 A;  3NEL A;  2M5X A;  2UXC Q;  4A3I G;  4YZD A;  2V4D A;  4RH6 A;  2E2I B;  1UE7 A;  4DV1 L;  2MO0 A;  3RZO H;  2AMC B;  3QOJ A;  1ULM A;  1JJ2 A;  4Z7G A;  1EYA A;  2BDN A;  7WGA A;  3J80 L;  5T1G A;  1HFN A;  4N9T A;  2GA4 B;  2VW9 A;  1KQS A;  2OD1 A;  3LGJ A;  3EN2 A;  3A0J A;  5M5Y B;  2EYH A;  5M3M H;  1Y1C A;  4BS9 A;  4GKJ Q;  4O0A A;  4JVZ A;  2EQS A;  5FO9 B;  4A3I H;  2A1A A;  3KDF A;  2ODD A;  2A6E C;  2C5C A;  1J9O A;  1WGC A;  5JPM C;  3MXN B;  1PRT D;  2G9D A;  1ET9 A;  1XMQ Q;  1SE8 A;  1ENF A;  4V19 0;  3S1Q B;  4DV2 L;  2ICE C;  5KGU A;  3NP8 A;  1XNR L;  1NUC A;  4A3D G;  2VUM B;  1K3R A;  3I55 A;  4UXH A;  4C3J B;  1TII D;  4A93 G;  4OVO A;  2UXB L;  1HA6 A;  1JB7 A;  3M4O B;  1PTO C;  1Y14 B;  3BZC A;  2B39 A;  3T16 A;  3U9O A;  1Y8F A;  1TWG B;  4RKL A;  5LMU L;  4WRD A;  2JA8 G;  1T9H A;  1YEZ A;  3E9I A;  2JA6 B;  4OIK A;  1EOV A;  1V1I A;  4G76 A;  5J39 A;  3OWF A;  2JXM B;  1RD9 D;  4K8I A;  4A93 H;  1Y1V B;  4K5V A;  1CK1 A;  4K2L A;  3TME A;  1BCP D;  3UDX A;  3MEK A;  1IXR A;  4ZKB B;  4R4O A;  1BR9 A;  1A6X A;  2Z1C A;  2F6M B;  2QCP X;  2RF4 A;  3IFT A;  4OIJ A;  1L2F A;  2E5L Q;  3NWT A;  3VR3 A;  3L0I A;  1STA A;  2C35 B;  4DK0 A;  4AQY Q;  1I4X A;  2LSS A;  4HR7 B;  1C48 A;  4RG1 A;  3ULL A;  4WFN 3;  1I6V C;  1PZJ D;  1SMX A;  2NTS A;  3OOC A;  4DV0 L;  2LB7 A;  3STB D;  4K8J A;  4DF7 A;  2AWO A;  2N8N A;  1W4R A;  1V43 A;  4Q9V A;  2JN4 A;  1K73 C;  4F8M A;  2GKT I;  1IZ6 A;  1XTD A;  4BY1 B;  2JW6 A;  4UXJ A;  2NBF A;  1H9M A;  2NU4 I;  3URY A;  2LXJ A;  1LO5 D;  1IBL Q;  1LR9 A;  4LFA Q;  3NXW A;  3G6E A;  1IHZ A;  1VQL A;  2JA5 G;  3GP7 A;  3MC0 B;  4ZAI A;  4YCV A;  2PPB C;  1S40 A;  3J7Z C;  3GTM H;  1TBR R;  5C3E G;  1SFO B;  2AQ3 B;  3KF6 B;  1I4Q A;  2K14 A;  3L3O C;  4HN7 A;  3FHW A;  1PHJ A;  3EBE A;  1TQO A;  1VQF A;  4PL4 A;  1BVS A;  3PQI A;  5HY6 A;  3ERS X;  2N1A B;  1VS0 A;  3PO3 H;  2WIN B;  4HJ9 A;  4GKJ L;  2D2C C;  1QZH A;  2JA5 H;  3DUZ A;  2XMX A;  3TP6 A;  2EVB A;  5KNB A;  2OVO A;  1R4Q B;  3CXC A;  3B4V C;  2L9H A;  3GTP H;  4TVA B;  3K7A H;  3OPO A;  3CRK C;  4DR6 L;  1XMQ L;  1TBQ R;  4UP8 A;  2L7X A;  1S20 A;  1Z7K B;  2A73 B;  3RUZ A;  4RFB A;  5CYU A;  3R5D A;  2K03 A;  3CQZ B;  5FUW A;  3I4L A;  1O78 A;  3K57 A;  2JYO A;  2HDM A;  1JWM D;  4ZRZ A;  3MEF A;  5KRU A;  2YTY A;  2F0D A;  5BN3 A;  4A3E G;  1GM5 A;  1ZYR D;  2A8V A;  3J80 c;  4N8F A;  2EOT A;  3CQZ H;  2RCF A;  1FD7 D;  1A3T A;  4XYO A;  2RCN A;  4O2D A;  4DV5 Q;  2F0I A;  1U9R A;  5EJW A;  3GTL H;  1WYD A;  2K4K A;  5JVG 3;  1VMP A;  2Z4H A;  5J8C A;  5CV7 A;  3IL8 A;  4DUY L;  4HAE A;  3G4S A;  2NUC A;  1JB3 A;  1B2T A;  2NB0 A;  3J80 i;  1H9J A;  5IYB G;  2QEX A;  2ROW A;  1TY0 A;  1CZG A;  3HOX B;  1E2W A;  1EY9 A;  4IJL A;  4DFA A;  4A3G B;  5E3R A;  1AEX A;  2J4X A;  4OEM B;  3I91 A;  1WCM B;  2B2V A;  1LM0 A;  1VQJ A;  1PH2 A;  2ZJQ A;  4J6H A;  1BOS A;  2PMZ E;  4L8J A;  1S5D D;  1XYI A;  3KF8 B;  1HR0 Q;  2UUC L;  4GKK Q;  3D00 A;  4A3G H;  4FNF A;  2RLD A;  2I5L X;  1TWF H;  2XRQ D;  1KDC A;  3M4P A;  1ASY A;  1GUN A;  4L9M A;  2EY6 A;  1NBW A;  4B3T Q;  3LWU A;  5IYB H;  1HNW Q;  2F3W A;  1Y1B A;  5IGG A;  2E76 C;  4NP5 A;  1LTL A;  4HFV A;  1VQP A;  1I50 H;  1LTR D;  3PSI A;  4G7Z C;  2WKD A;  3RLN A;  2C9O A;  3OMC A;  3QWN A;  1VQI A;  3J81 j;  3W3A A;  5KYI A;  4CJ0 B;  3HOY B;  2UZ3 A;  5IGC A;  1CHQ D;  3QB3 A;  3UDF A;  3OXL A;  2JP1 A;  2K5D A;  1FYC A;  1H0Z A;  4OL7 A;  1PRT B;  4NDX A;  4QGU A;  3A5Z B;  1JQY D;  3OW2 A;  3NEM A;  3FDT A;  1PH5 A;  4C3H G;  3HOZ G;  1V1O A;  5M3F G;  1SNM A;  4HMI A;  4IZ8 A;  5IGF A;  2AQ2 B;  1SDF A;  2GSC A;  1R79 A;  1PJU A;  2PCF B;  1BBW A;  4XQJ A;  4A3C H;  1YNJ D;  3CW2 C;  4HSV A;  1B44 D;  3PMF A;  3D3R A;  1NMG A;  4KN7 C;  3T1H Q;  1P16 A;  2A2C A;  4LF9 Q;  3K0X A;  2B2W C;  2XIW A;  4A3M B;  2K01 A;  2Q8I B;  2PW7 A;  3TOB A;  3FRP B;  4DR1 Q;  4C3H H;  3PGZ A;  1WTV A;  5A2Q L;  2ZJR A;  3LX0 A;  2RIO A;  3DEP A;  1XA6 A;  2A74 C;  3KBX A;  4X66 L;  1VQE A;  2Q2I A;  2RDG A;  1HRJ A;  1O7L A;  3VDY A;  1N36 L;  3P75 A;  1PTR A;  4X3T A;  1BCP B;  1M1K C;  3RZD H;  4Z9C B;  4JV5 Q;  4BY7 H;  2K6A A;  3HEJ A;  4DV3 Q;  1VQ8 A;  4KK7 A;  1OMU A;  4IQZ A;  2JZM A;  2FJ2 A;  2F4V Q;  1R9T H;  2PZT A;  2JK8 A;  4B08 A;  2PNH A;  4A3K B;  1U4P A;  3CRL C;  4TRD A;  5D3D A;  4HJ8 A;  3KLR A;  4C56 C;  4MIU A;  5GAE C;  4DR7 Q;  2SOB A;  1LR7 A;  1YNN D;  4M8A A;  5EAY A;  3PV0 A;  3F2C A;  4DA2 A;  1NNX A;  4KHZ A;  1EY0 A;  1A2T A;  3A54 A;  5IWA L;  4X64 Q;  4GKK L;  1EU3 A;  5AJ3 Q;  4GZY C;  1JWS D;  1B50 A;  4PG3 A;  2K05 A;  1EEI D;  3C1E A;  2NVY H;  3M4Y A;  4B3T L;  3CCM A;  1TVX A;  4AYB B;  1HNW L;  4R4T A;  3RN5 A;  1HUM A;  3J7A F;  1MSH A;  1YHA A;  4FDB A;  2MPM A;  1SMY D;  4BBR G;  4CKE A;  5FUY A;  2CH4 W;  4GS3 A;  2OU2 A;  3L9A X;  1K7T A;  4A75 A;  3HOW H;  3WOE A;  1TKW B;  3KFU A;  3TP5 A;  2R92 B;  5JHW C;  3K5M A;  3FVV A;  1TUS A;  1JOR A;  1CE3 A;  5CR3 A;  2WVJ A;  1B7Y B;  3S2D H;  5M5X B;  3R8B A;  2SEB D;  2XGT A;  4BBR H;  4X62 Q;  4IAL A;  4JI5 Q;  4IPG A;  1H9S A;  4O1O A;  2VQF L;  3F2U A;  5CV6 A;  4DU9 A;  2QQE A;  2BL8 A;  1I3Q B;  3KF6 A;  1KHI A;  1OXS C;  4PMB A;  1WVL A;  4HCE A;  2QIL A;  2EYF A;  2PI2 E;  2DNE A;  5C4X H;  3X3N A;  1AZQ A;  4BA1 I;  2Y0S G;  4X3K A;  1TBN A;  1Z6H A;  5LNK 1;  2E74 C;  2KVM A;  4YZ9 A;  1V1P B;  5BR8 Q;  1A2U A;  1KL9 A;  4OWT B;  2PYK A;  4K5X A;  4DK6 C;  2A69 D;  1PV4 A;  4DR1 L;  1CT0 I;  2B63 B;  1SE4 A;  3W1G A;  2HQE A;  2B2T A;  1WD0 A;  4JI7 Q;  2MQH A;  3LJ1 A;  2WAQ B;  4TKO B;  1DS3 I;  2K32 A;  3DWA A;  4DAM A;  1YBY A;  4JI0 Q;  3VA5 A;  3HS0 C;  4JV5 L;  4E1R A;  4OHJ A;  4C3I G;  2NU2 I;  1RL2 A;  5C44 B;  4CKB A;  5C0X G;  1BNZ A;  1LR8 A;  3CC4 A;  1ONL A;  3C46 A;  1UHA A;  2N78 A;  4JBJ A;  3NPP A;  2E8G A;  1WTQ A;  1EZ6 A;  1JOO A;  3QR8 A;  4DAP A;  4MTK A;  3NTI A;  4BBS B;  1SNC A;  4EQO A;  5CV9 A;  1TWA H;  4C3I H;  4HCS A;  3SK8 A;  3TN2 A;  4S3S A;  2GVI A;  5FUX A;  1FNV A;  1M8C A;  3GTG B;  3VYU A;  3CCJ A;  5AJ3 L;  1UWV A;  1CUK A;  4H44 C;  3BYT B;  1VQ7 A;  1XNQ Q;  3C2P A;  2JEA I;  4O1P A;  3TRZ A;  1E0B A;  2K04 A;  3H0G B;  4DNT B;  1KAW A;  2HHH Q;  1SYD A;  1STN A;  1WFQ A;  5KNC A;  3PIP A;  1FNU A;  1PRT C;  1CKN B;  2QKI C;  2I0Q A;  1X3P A;  4FF4 A;  2FUG 1;  2BCO A;  2Q8T A;  4LF4 L;  3V96 A;  3OIP A;  3AYH B;  3KF8 A;  1JE4 A;  1GKH A;  3KK7 A;  1P8L A;  3LJ2 A;  1KDB A;  3PUZ A;  4JI1 Q;  4LF7 Q;  4Q0F A;  2IHF A;  3DMU A;  4IUU A;  5I9P A;  4Y7N H;  1Y8P B;  4GNX B;  4LF5 L;  1AW7 A;  4V0B A;  1RIP A;  2A19 A;  1DM0 B;  2HQL A;  1CA6 A;  1MIU A;  3GTK B;  3OW7 A;  3ZYY X;  1SSO A;  2KED A;  3G6J B;  4X62 L;  4JI5 L;  1MGS A;  4YCW A;  1DYQ A;  3E0E A;  2K5V A;  3I72 A;  3BJU A;  2UUA Q;  3R5B A;  4R4Q A;  3E5S A;  5G3L D;  3W1B A;  2XVS A;  5JEA H;  3M85 A;  2F3I A;  1FVI A;  3TEH B;  3S16 H;  2L8E A;  1BCP C;  1S4Z A;  2V1C C;  4NV2 A;  3M9B A;  4DXG A;  1HA5 A;  1YJ9 A;  1CT1 D;  1E7Z A;  1NTG A;  4DK1 A;  2O5J C;  4C1N I;  1I6H B;  2JA7 B;  4ZUJ A;  4LF8 L;  1JOQ A;  3MTS A;  1TWH B;  1U4M A;  1CT4 I;  1N34 Q;  3CF5 A;  3STB C;  2VS1 A;  1OO9 B;  1XBT A;  4EQP A;  3CP0 A;  1VQG A;  1SGE I;  3UOE A;  1YU6 C;  4LFC L;  1TWH H;  2F0K A;  2EXD A;  1PYB A;  4JI0 L;  3DWQ A;  2I5H A;  5ELB A;  1CT2 I;  1RHP A;  1G2S A;  3FKI G;  3CKI B;  1E2V A;  2QGQ A;  5JEA J;  1PTQ A;  3I9V 1;  5DLQ E;  1KNE A;  5JJK A;  1EUJ A;  3KOJ A;  4JI8 L;  1Z7T A;  3M3Y H;  1BBU A;  2F0U A;  1UE5 A;  3CCV A;  1W6J A;  1Z47 A;  1D1K A;  1HH2 P;  1QOH A;  3KLS X;  4HIK A;  1B3Q A;  5CV8 A;  2CJS C;  2R61 A;  4KTA A;  1VQK A;  2PZW A;  1M8A A;  4OX9 L;  1QCB D;  1JCK B;  2IX3 A;  2RBM A;  4DV4 L;  1H95 A;  4H13 C;  2R7D A;  1IW7 D;  2Z4I A;  1ZKO A;  2HHH L;  4JCV E;  2F0L A;  3OYY A;  5JOB A;  5IYC H;  3D4R A;  3WWV A;  2LFN A;  1G2T A;  2NN6 G;  4XQQ A;  3H94 A;  4IOC A;  2LXK A;  3GTJ B;  4A3J B;  1N33 Q;  4NXN L;  1BBX C;  1OMT A;  1GUS A;  4LF7 L;  2YYZ A;  4KJO A;  2B8F A;  1F9Q A;  4KKT A;  3PIP 3;  4EX5 A;  2D62 A;  3NSW A;  3P7J A;  1R4P B;  3CC2 A;  3IAS 1;  5GAD C;  1F2Y A;  1LLR D;  1PZI D;  1ZYR C;  4A3J H;  1K8O A;  2FU2 A;  2AHO B;  2PQA B;  5M9O A;  3OTO Q;  3G71 A;  1EY4 A;  2NN6 H;  3PO2 B;  4C2M B;  3L0O A;  1QVF A;  3MZ5 A;  1BKB A;  4KHP Q;  2BA0 A;  1Y1W G;  3QO2 A;  2NVQ B;  3MFY A;  2OQ0 A;  4GN4 B;  1UVG A;  1B4O A;  2V53 A;  3NBH A;  4DPG A;  4HIO A;  1S3O A;  4LJZ C;  2K52 A;  2F0O A;  2XRS D;  3RMH A;  2P22 B;  1D2B A;  1DGS A;  1M8B A;  4L5Q A;  5CC4 A;  2GVB A;  1D5Z C;  1X6O A;  2WB1 B;  1LTI D;  5EKI A;  4PMC A;  1IKM A;  1OXX K;  1Y1W H;  4B3R Q;  3H09 A;  1IYJ B;  1SYB A;  4ZK9 B;  1N34 L;  3AJF A;  1IL2 A;  1HZA A;  3SEK C;  5CBA E;  2NYZ D;  2MJ8 A;  4AML A;  4YY3 L;  4A3F G;  1PRT F;  4HJ5 A;  3FPP A;  4PNY A;  2BOS A;  4H0L C;  1V1P A;  2EPB A;  1YHB A;  1O7Z A;  2P5Z X;  1Q1B A;  1O7Y A;  2JE6 I;  2EDG A;  4LW1 A;  3RZO B;  4ZCK A;  4B3M Q;  2X52 A;  2XNA C;  1QB5 D;  4KKS A;  4CDC C;  1GHK A;  3R2T A;  1J6Q A;  3AMU A;  4X65 Q;  1IY5 A;  1RKN A;  5M3M B;  2K19 A;  4A3F H;  1K7U A;  5FLM H;  2NU3 I;  3HOV H;  2ZTC A;  3M7G A;  1NJI C;  5J3B A;  4A3I B;  3FBV A;  4A3B G;  1N8R C;  4LF6 Q;  1Q3L A;  2VXW A;  4LFB Q;  4WJ3 M;  1E2Z A;  1GJX A;  4GNX C;  1X74 A;  4DNC A;  3P20 A;  2ZXO A;  4HTH A;  3GDE A;  2KMR A;  4CHT B;  3AU7 A;  3PUY A;  4AYB E;  1SJ8 A;  3NWS A;  2CW0 D;  1BCP F;  3UE1 A;  1EY8 A;  2KEE A;  1F77 A;  1ICW A;  4P73 A;  4YWL A;  3S14 H;  2K75 A;  1YI2 A;  4IUR A;  2F3C I;  3HH2 C;  3TP7 A;  4A3B H;  1YNJ C;  4DUZ L;  4DAV A;  2AKW B;  1N33 L;  2XWJ B;  2A68 D;  3PIO A;  2KCX A;  1J5E L;  3HFZ B;  1IKL A;  1X65 A;  1WGT A;  2D0P A;  1CKN A;  1SEB D;  1UEA B;  9WGA A;  2UXD L;  4P75 A;  2IHE A;  2VUM G;  2Z8L A;  4A93 B;  2KHS A;  2DY7 A;  5HGT A;  1SAP A;  3R5A A;  4OAV B;  5A2Q E;  3J7A 5;  4Q5V A;  1CGI I;  4UDU C;  3BZD B;  3PUX A;  1UE6 A;  3UI2 A;  4KHP L;  1F2Z A;  4OWX B;  3KY9 A;  4A3D H;  2BDO A;  4N8X 1;  4YZC A;  4F87 A;  4UHV A;  2UUB Q;  3GO5 A;  1EIG A;  1UE1 A;  2QQD A;  3EJI A;  2JA6 G;  1E1O A;  1KAB A;  2JA8 H;  3HKZ B;  3MEH A;  4LUO A;  2VRW B;  2OEO A;  2K9H A;  1LTB D;  5ISR A;  3OVO A;  2WAQ E;  3CME A;  3NBI A;  4KD4 A;  1K7V A;  1HJP A;  1MSG A;  2L4N A;  5I9O A;  1HTP A;  2RVL A;  1TIH A;  2XTI A;  1Q86 C;  1JIC A;  5EPK A;  1OXT A;  1Q90 A;  3S2H H;  2L1B A;  3KYH C;  2CAZ B;  2EYM A;  1LT4 D;  3GTM B;  3DXJ C;  2KMP A;  4G7O C;  3KUP A;  3PF4 A;  4FF3 A;  3BS1 A;  1SMY C;  2UXC L;  4BY1 G;  2Z6K C;  4UY8 C;  1A3U A;  4YWK A;  2D0O A;  5KEE A;  1WTP A;  2EY1 A;  3PO3 B;  1CKM A;  1D6E C;  4JI3 Q;  2JA5 B;  1SJH D;  3TRE A;  1CHP D;  3I4N G;  3DA4 A;  2NZH A;  2QF7 A;  1A8V A;  1PH7 A;  4LFB L;  1SE3 A;  3GTP B;  2E2D C;  1IY6 A;  1RCV D;  5ELD A;  4CJ1 B;  3K7A B;  1N32 Q;  3AFP A;  5LHY 1;  1EYC A;  3LNN A;  2GN5 A;  3UE0 A;  3OHX C;  5FJ8 G;  1PH8 A;  3EA6 A;  3T56 B;  1OXV A;  2JEB I;  5ELF A;  2MGS A;  4QY7 A;  4QJF A;  5C3E H;  1FAR A;  2LUY A;  2YU9 B;  3OMG A;  3I4N H;  3E59 A;  2KBN A;  3D6C A;  1K83 H;  1B1Z A;  1LTS D;  1K9M C;  1Y8N B;  3SR1 A;  4DKA C;  5K36 G;  2G9H D;  2YU9 H;  2DB6 A;  1AN8 A;  4P71 A;  5FJ8 H;  3FSX A;  4KY7 A;  1X56 A;  2R3Z A;  3OIQ A;  2A69 C;  4R4C A; 
#chains in the Genus database with same CATH homology
 1NY4 A;  2YTV A;  2JB1 A;  1V9P A;  5C0X I;  5LMN Q;  4PMW A;  1HDL A;  1D7Q A;  1KC8 C;  3UDI A;  1NE3 A;  3ULJ A;  1QUQ A;  2NU1 I;  4AS2 A;  4A3E H;  2PQA A;  4DR2 Q;  2E5L L;  1HNZ Q;  3H3V I;  2VY3 A;  4AQY L;  1X4S A;  2NVX H;  3S1M H;  3HOX G;  1JJC B;  1X3F A;  2ARP F;  4QL5 A;  4DV6 Q;  2JB3 A;  1IBL L;  4DR3 Q;  4LFA L;  2N52 A;  4P74 A;  1KRT A;  2ZJP A;  3T1Y Q;  3IRB A;  1IBM Q;  1R0R I;  1EFW A;  3RR5 A;  4GOP B;  2ES2 A;  1SGR I;  4IPH A;  4JI3 L;  1VQC A;  4JBK A;  3RNU A;  5HQ8 A;  3F1Z A;  1FAQ A;  5ELN A;  5JJL A;  1QVC A;  1SR3 A;  3D0F A;  2R7Z G;  4A76 A;  4BXX G;  1A62 A;  2EIF A;  1O7I A;  4POG A;  1CSQ A;  2K5N A;  3CPF A;  3PCO B;  4JBM A;  4NPS A;  4ALP A;  2R7Z H;  4DR4 Q;  2L15 A;  1YJN A;  3HOZ H;  3GTO H;  5M3F H;  5LMN L;  5HI7 A;  1QZG A;  2ORW A;  5M5W H;  2PI2 A;  1OXU A;  2MNA A;  1KIX A;  4DV5 L;  4A3M G;  2YFA A;  1BUS A;  1CGJ I;  3GTQ H;  3CC7 A;  1PPF I;  1YTP A;  1TXY A;  1TOT A;  4DR2 L;  2GKR I;  5IP7 G;  3I2Z A;  1SGP I;  1K8G A;  3BZK A;  4U6R A;  4B3S Q;  1CSO I;  1V1H A;  2WB1 E;  3KLW A;  1HR0 L;  3UFF A;  2NN6 I;  3F8T A;  3L7Z C;  3ULP A;  1AE2 A;  4NXM Q;  5IP7 H;  2K5H A;  3DM3 A;  4DV6 L;  2KMO A;  4AS3 A;  3CCE A;  4IO9 A;  4B6D A;  3GOX A;  1TUR A;  3T1Y L;  4AYB G;  4EQ5 A;  4DR5 Q;  4UP7 A;  4YWM A;  4JI2 Q;  2MJF B;  1HZC A;  3A5U A;  1PH1 A;  1I94 Q;  2JQO A;  2VL6 A;  2E2H H;  3DA3 A;  2CWA A;  2R92 G;  1FL0 A;  3K8A A;  3SGB I;  1E22 A;  1YIT A;  2R7F A;  1NUB A;  4JC0 A;  3KJO A;  3T1H L;  1YJW A;  4LF9 L;  3HKS A;  1SGD I;  1K8A C;  4DR4 L;  3U4V A;  3S1R H;  1LUZ A;  1SGQ I;  2Z0S A;  1YZ6 A;  2B63 G;  4DV3 L;  4DK3 C;  2N17 A;  4POF A;  1X3E A;  3I56 A;  2CKZ B;  3U50 C;  4KI0 A;  3W5O A;  1Q81 C;  2F4V L;  3HKZ E;  5C44 G;  4DR7 L;  3RN2 A;  3CCL A;  2E73 A;  3CAM A;  3S17 H;  4X64 L;  4GOP C;  2SGP I;  2E5R A;  1XJV A;  3U58 A;  2AWN A;  3KDF B;  1X3G A;  4IFD I;  2DGY A;  4HGU A;  2VNU D;  1VQM A;  2ATW A;  3H0G G;  2WFW A;  5C4J H;  1I94 L;  1FJG Q;  2KCM A;  3H3V H;  4OON A;  4L5R C;  5EX0 A;  5C0X J;  1VQA A;  1Q12 A;  5FLX c;  2DIP A;  2IX1 A;  1G29 1;  4GOP A;  3KP9 A;  2E2J H;  3L2P A;  2JYY A;  3NEN A;  2YQP A;  4GLA C;  2FNF X;  2Q2T A;  5BR8 L;  1CSP A;  1XPO A;  4JI7 L;  2GKV A;  3S15 H;  4QIW E;  3F2B A;  4A3L G;  3CMA A;  1GVP A;  2ZM6 Q;  2IX0 A;  3TS2 A;  2XRC A;  1JT8 A;  1JE5 A;  1KRS A;  2ALY B;  2OTJ A;  2N49 A;  1SRO A;  1WI5 A;  1HZ9 A;  1X54 A;  1NMF A;  4DWL A;  2MO1 A;  2WP8 J;  3SGI A;  3ICE A;  2ENN A;  4GLV B;  2V1C A;  2R93 G;  3FKI H;  1AN1 I;  1SRU A;  2VQE Q;  3CD6 A;  4DV7 Q;  1XNQ L;  4DAY B;  1KD1 C;  1OYV I;  3K7U C;  2R93 H;  1EYG A;  3PUW A;  1BMO A;  2QA4 A;  1PVO A;  4JI1 L;  1EQQ A;  1HZB A;  1MKH A;  4OWW B;  2CQO A;  4GLX A;  4JG2 A;  3ER0 A;  2UUA L;  2VZA A;  2B0U C;  2JXD A;  4APV A;  2N3S A;  1TWC H;  1KXL A;  3UEJ A;  1PFS A;  3I4M G;  4LNQ A;  4IPC A;  4LWC A;  1VCI A;  4P72 A;  1IW4 A;  1E1T A;  1YNX A;  1Q8K A;  2KHI A;  4PZ6 A;  4AIM A;  1EIY B;  4MNO A;  1I5F A;  2WB1 G;  3HOU G;  3I4M H;  3S1N H;  1KBF A;  3K81 C;  2ZTD A;  2JA1 A;  2NVT H;  2QPO A;  4DV0 Q;  5GRO A;  2ENZ A;  2JB2 A;  5IYD G;  2UU9 Q;  2IT1 A;  1SGY I;  1QVG A;  3BU2 A;  3HOU H;  1UEB A;  4YCU A;  2XTR A;  1HR0 W;  4DV7 L;  2SGE I;  2SGF I;  1CHO I;  4IOA A;  5IYD H;  1XX6 A;  2GVA A;  2MFI A;  3RU0 A;  2KCT A;  4FKD A;  3P23 A;  2E2I H;  4UP9 A;  5HGQ A;  4IFD G;  4JYA Q;  3TS0 A;  5M5Y H;  4DR6 Q;  4PZ7 A;  3OTO L;  4Y52 H;  4GXT A;  2IY5 B;  2NZO A;  4GNX A;  4YHH Q;  1VQ4 A;  4A24 A;  2SGQ I;  3S1Q H;  1SGN I;  1VQ6 A;  3BJI A;  1VQ9 A;  2VUM H;  4C3J H;  2Q2H A;  4PZ8 A;  1Y1V G;  3CCQ A;  2OCE A;  1SN8 A;  3M4O H;  1MJE A;  2NU0 I;  2Y0S E;  3FP9 A;  4B3R L;  4PL5 A;  1TWG H;  4LUV A;  3CCU A;  4DUY Q;  3HKZ G;  2JA6 H;  3AEV A;  2F66 B;  1Y1V H;  4IFD J;  4B3M L;  4UXI A;  3SGQ I;  1B70 B;  4JI6 Q;  2UUC Q;  3UGI A;  4X65 L;  2UU9 L;  3UEY A;  3UGD A;  3QWP A;  4HID A;  2A2D A;  4XIG S;  1YVC A;  4LF6 L;  3A74 A;  1MT1 A;  2YV5 A;  4L5S A;  3PO3 G;  4BY1 H;  1MJC A;  2KMQ A;  1VQD A;  4OO1 G;  3B6Y A;  2OQK A;  3K80 C;  4WJ4 A;  1U5K A;  1SFO H;  1VQ5 A;  2Z6K A;  4JYA L;  5IT9 c;  5GAG C;  3AFQ A;  3E9H A;  3G48 A;  1B8A A;  1L0W A;  1X9N A;  4YHH L;  5IE8 A;  2HT1 A;  2UUB L;  1E24 A;  2DUD A;  4NB3 A;  3Q8D A;  4X66 Q;  1EIF A;  1N36 Q;  3IAM 1;  3TQY A;  2ID0 A;  2RHQ B;  1DS2 I;  2L1L B;  1K0R A;  1PH6 A;  2J87 A;  1YO7 A;  4A3G G;  5IY0 A;  4DNI A;  2B29 A;  3M7N A;  1WCM G;  3I7F A;  2BA1 A;  3KJP A;  2ELI A;  1ASZ A;  4JI6 L;  5IWA Q;  1HNX Q;  3HOX H;  3QTL D;  1RFH A;  2BH2 A;  2ASB A;  4IPD A;  2ORV A;  1WCM H;  3PDN A;  1N13 A;  3JC6 6;  3HOY G;  1L1O B;  1N32 L;  3LJ0 A;  2JAE A;  1IBK Q;  2LEO A;  3CCR A;  4LUZ A;  3SDJ A;  1PA6 A;  4H02 A;  2KKM A;  1JJG A;  1EQR A;  3VDU A;  3DO9 A;  4IJH A;  4A3C G;  3CXL A;  1UVF A;  2A20 A;  4BA2 I;  2WCY A;  5H1S E;  3HOY H;  4PL3 A;  2VQF Q;  1Z9F A;  4BXX H;  1VDD A;  4UPA A;  4G75 A;  2BH8 A;  4BY7 G;  1E3P A;  3DLL A;  4AH6 A;  4QQB X;  3OL0 A;  1HJA I;  2JJQ A;  2OWO A;  1HNZ L;  1Q82 C;  4A3M H;  3RLO A;  4A3K G;  1YIJ A;  3U4Z A;  3H15 A;  2YFB A;  1GD7 A;  4DR3 L;  3TJQ A;  3S24 A;  1IBM L;  4A3K H;  4JI4 Q;  1HNX L;  3M4Q A;  3HOW G;  1S72 A;  4HJ7 A;  1Q7Y C;  2B8T A;  5E7N A;  5FUV A;  2CFM A;  1A0I A;  1AH9 A;  1IBK L;  4LF4 Q;  2W0T A;  4SGB I;  1D8L A;  5ELO A;  3JSB A;  1VQO A;  4LF5 Q;  3OXF A;  4OAU C;  5C4X G;  1YHQ A;  3NBH B;  2R92 H;  1TGS I;  1CKO A;  5M5X H;  4XTC S;  1XMO Q;  3OXG A;  4R4I A;  1FGU A;  3RLF A;  3I4O A;  4GN5 A;  5CCM A;  1I3Q H;  2IP6 A;  1A63 A;  2WAQ G;  4LF8 Q;  4X6A H;  1PCE A;  1JMC A;  1OVO A;  1VQH A;  4RMF A;  3AQQ A;  3PUV A;  2P6A C;  1G6P A;  2CCZ A;  4LFC Q;  4B3S L;  1C0A A;  2B63 H;  3ZJY C;  1AE3 A;  1Q46 A;  4A4I A;  5DAE A;  4BBS G;  4L5T A;  3J81 c;  4JI8 Q;  3FC3 A;  2I5M X;  4NXM L;  2YUU A;  3D31 A;  1OTC A;  1L1O C;  5C44 H;  4KLK A;  1W2B A;  2H5X A;  3CPW A;  4TQU S;  4DR5 L;  5CCL A;  4JI2 L;  4JI4 L;  4I1T A;  5GQO A;  4OX9 Q;  4BBS H;  3J81 i;  4DV4 Q;  5EX3 A;  2V6E A;  1PH4 A;  3GTG H;  1KMA A;  1PYS B;  3H0G H;  4JBW A;  1XPR A;  4NXN Q;  1VQN A;  1V1Q A;  4E1P A;  5JEA G;  4ME3 A;  4HEA 1;  1C9O A;  4J15 A;  1L1O A;  1N9W A;  1W3S A;  1GO3 E;  2SGD I;  3UDG A;  2BUS A;  2QQC A;  2QQ0 A;  3GTK H;  4HIM A;  1XMO L;  4MTN A;  3PF5 A;  2JA7 G;  4K0K Q;  2K50 A;  2ZTE A;  4OXP A;  2YTX A;  4JOI C;  1WJJ A;  4NV5 A;  1I6H H;  2KHJ A;  2JA7 H;  2ZRR A;  4YY3 Q;  4A3L H;  1TBO A;  2HIV A;  2N71 A;  5IP9 G;  3VE5 A;  4OO1 I;  1C7Y A;  2FXQ A;  1UUC A;  5HGI A;  4DV1 Q;  2KEN A;  1LYL A;  2JA9 A;  1M90 C;  5IYC G;  3VDP A;  5IP9 H;  4JOI A;  1Q1E A;  1FJG L;  2HIX A;  3JAM c;  4R1J A;  1EWI A;  1VQB A;  4A3J G;  3E2I A;  3CCS A;  4Z7H A;  2R6G A;  1WOC A;  4DV2 Q;  1FYB A;  1XNR Q;  5JJI A;  4DUZ Q;  2Q2U A;  1KBE A;  1J5E Q;  4MZ9 A;  1QUQ B;  2UXB Q;  3JAM i;  3PO2 G;  2J9R A;  3UIT A;  3GTJ H;  2UXD Q;  2F52 A;  3EIV A;  5LMU Q;  2OTL A;  4HJA A;  3VA9 A;  1XPU A;  1SLJ A;  1U0L A;  5LMN W;  3PO2 H;  4C2M H;  4K0K L;  2CWP A;  1PH9 A;  3F2D A;  2ZM6 L;  1PH3 A;  2NVQ H;  2XTQ A;  3UGL A;  3GD7 A;  3F4M A;  4GI3 C;  1G51 A;  1HPT A;  5GAH C;  5FLM G;  3HOV G;  4GN3 B;  2RHS B;  2VQE L;  2ERW A;  5M3M G;  2B3G A;  1X55 A;  3NEL A;  2M5X A;  2UXC Q;  4A3I G;  4YZD A;  1UE7 A;  4DV1 L;  2MO0 A;  3RZO H;  2AMC B;  1JJ2 A;  4Z7G A;  2VW9 A;  1KQS A;  2OD1 A;  3LGJ A;  3EN2 A;  3A0J A;  5M3M H;  1Y1C A;  4GKJ Q;  4O0A A;  4A3I H;  2EQS A;  2A1A A;  3KDF A;  2ODD A;  3MXN B;  1XMQ Q;  1SE8 A;  4DV2 L;  1XNR L;  4A3D G;  1K3R A;  3I55 A;  4UXH A;  4A93 G;  4OVO A;  2UXB L;  1JB7 A;  1Y14 B;  3BZC A;  1Y8F A;  5LMU L;  2JA8 G;  1T9H A;  1YEZ A;  3E9I A;  1EOV A;  1V1I A;  4G76 A;  4A93 H;  3UDX A;  3MEK A;  1IXR A;  4R4O A;  2F6M B;  2RF4 A;  2E5L Q;  1L2F A;  3L0I A;  2C35 B;  4AQY Q;  2LSS A;  4RG1 A;  3ULL A;  1SMX A;  4DV0 L;  3STB D;  2AWO A;  2N8N A;  1W4R A;  1V43 A;  4Q9V A;  1K73 C;  2GKT I;  1IZ6 A;  1XTD A;  2JW6 A;  4UXJ A;  2NU4 I;  2LXJ A;  1IBL Q;  1LR9 A;  4LFA Q;  3G6E A;  1VQL A;  2JA5 G;  4YCV A;  1S40 A;  3J7Z C;  3GTM H;  1TBR R;  5C3E G;  2K14 A;  3KF6 B;  3FHW A;  1PHJ A;  3EBE A;  1VQF A;  4PL4 A;  1BVS A;  5HY6 A;  3ERS X;  2N1A B;  1VS0 A;  3PO3 H;  4HJ9 A;  4GKJ L;  1QZH A;  2JA5 H;  2XMX A;  2OVO A;  3CXC A;  3B4V C;  3GTP H;  4TVA B;  3K7A H;  4DR6 L;  1TBQ R;  1XMQ L;  4UP8 A;  2L7X A;  1Z7K B;  5FUW A;  3MEF A;  2YTY A;  4A3E G;  2A8V A;  1GM5 A;  3J80 c;  3CQZ H;  2RCN A;  4O2D A;  4DV5 Q;  3GTL H;  1WYD A;  2K4K A;  4DUY L;  3G4S A;  3J80 i;  5IYB G;  2ROW A;  2QEX A;  4IJL A;  1LM0 A;  1VQJ A;  1PH2 A;  2ZJQ A;  2PMZ E;  4GKK Q;  2UUC L;  3KF8 B;  1HR0 Q;  3D00 A;  4A3G H;  2I5L X;  1TWF H;  3M4P A;  1ASY A;  4L9M A;  1NBW A;  4B3T Q;  5IYB H;  1HNW Q;  1Y1B A;  1LTL A;  4HFV A;  1VQP A;  1I50 H;  3PSI A;  3RLN A;  1VQI A;  3J81 j;  2UZ3 A;  3UDF A;  3OXL A;  1H0Z A;  4QGU A;  3A5Z B;  3OW2 A;  3NEM A;  1PH5 A;  3HOZ G;  5M3F G;  1R79 A;  1PJU A;  1BBW A;  4A3C H;  3CW2 C;  1NMG A;  3T1H Q;  1P16 A;  2A2C A;  4LF9 Q;  3K0X A;  4DR1 Q;  4C3H H;  3PGZ A;  2ZJR A;  2RIO A;  1XA6 A;  4X66 L;  1VQE A;  2Q2I A;  3VDY A;  1N36 L;  1PTR A;  1M1K C;  3RZD H;  4JV5 Q;  4BY7 H;  4DV3 Q;  1VQ8 A;  1OMU A;  2JZM A;  2F4V Q;  1R9T H;  2JK8 A;  2PNH A;  4HJ8 A;  5GAE C;  4DR7 Q;  1LR7 A;  5EAY A;  3PV0 A;  3F2C A;  4KHZ A;  5IWA L;  4X64 Q;  4GKK L;  5AJ3 Q;  4PG3 A;  2NVY H;  4B3T L;  3CCM A;  1HNW L;  4R4T A;  3RN5 A;  1YHA A;  4FDB A;  4BBR G;  5FUY A;  4GS3 A;  4A75 A;  3HOW H;  3KFU A;  5JHW C;  1TUS A;  1CE3 A;  2WVJ A;  1B7Y B;  3S2D H;  2XGT A;  4BBR H;  4X62 Q;  4JI5 Q;  4IPG A;  2VQF L;  4O1O A;  2QQE A;  3KF6 A;  1KHI A;  1OXS C;  2PI2 E;  5C4X H;  4BA1 I;  2Y0S G;  1TBN A;  5LNK 1;  4YZ9 A;  5BR8 Q;  1KL9 A;  4OWT B;  4DK6 C;  1PV4 A;  4DR1 L;  1CT0 I;  3W1G A;  4JI7 Q;  2MQH A;  3LJ1 A;  1DS3 I;  4DAM A;  1YBY A;  4JI0 Q;  4E1R A;  4JV5 L;  2NU2 I;  1RL2 A;  5C0X G;  1LR8 A;  3CC4 A;  2N78 A;  4JBJ A;  2E8G A;  1TWA H;  4C3I H;  2GVI A;  5FUX A;  1M8C A;  3CCJ A;  5AJ3 L;  1UWV A;  1CUK A;  1VQ7 A;  1XNQ Q;  2JEA I;  4O1P A;  3TRZ A;  1KAW A;  2HHH Q;  1WFQ A;  3PIP A;  1CKN B;  2I0Q A;  2FUG 1;  4LF4 L;  3AYH B;  1GKH A;  1P8L A;  3LJ2 A;  3PUZ A;  4JI1 Q;  4LF7 Q;  2IHF A;  4Y7N H;  4GNX B;  4LF5 L;  1RIP A;  2A19 A;  2HQL A;  1MIU A;  4X62 L;  4JI5 L;  4YCW A;  3E0E A;  2K5V A;  3BJU A;  2UUA Q;  4R4Q A;  3W1B A;  3M85 A;  2F3I A;  1FVI A;  3TEH B;  3S16 H;  2L8E A;  2V1C C;  4NV2 A;  3M9B A;  1YJ9 A;  1E7Z A;  1NTG A;  4LF8 L;  1CT4 I;  1N34 Q;  3CF5 A;  3STB C;  2VS1 A;  1XBT A;  3CP0 A;  1VQG A;  1SGE I;  1YU6 C;  4LFC L;  1TWH H;  2EXD A;  1PYB A;  4JI0 L;  2I5H A;  1CT2 I;  3FKI G;  2QGQ A;  5JEA J;  1PTQ A;  3I9V 1;  5DLQ E;  5JJK A;  1EUJ A;  3KOJ A;  4JI8 L;  3M3Y H;  1BBU A;  1UE5 A;  3CCV A;  1Z47 A;  1HH2 P;  4HIK A;  2CJS C;  1VQK A;  4OX9 L;  4DV4 L;  1H95 A;  2R7D A;  2HHH L;  4JCV E;  3OYY A;  5IYC H;  3WWV A;  2NN6 G;  4IOC A;  2LXK A;  1N33 Q;  4NXN L;  1OMT A;  4LF7 L;  2YYZ A;  4EX5 A;  2D62 A;  3CC2 A;  3IAS 1;  5GAD C;  4A3J H;  2AHO B;  2PQA B;  3G71 A;  3OTO Q;  1QVF A;  3L0O A;  1BKB A;  4KHP Q;  2BA0 A;  1Y1W G;  2OQ0 A;  4GN4 B;  1UVG A;  2V53 A;  4DPG A;  4HIO A;  1S3O A;  2K52 A;  1M8B A;  2P22 B;  1DGS A;  4L5Q A;  2GVB A;  1X6O A;  1OXX K;  1Y1W H;  4B3R Q;  1IYJ B;  1N34 L;  1IL2 A;  3AJF A;  1HZA A;  3SEK C;  4YY3 L;  4A3F G;  4HJ5 A;  1YHB A;  1Q1B A;  4LW1 A;  2JE6 I;  4B3M Q;  1J6Q A;  4X65 Q;  1IY5 A;  2K19 A;  4A3F H;  5FLM H;  2NU3 I;  3HOV H;  2ZTC A;  1NJI C;  5J3B A;  3FBV A;  4A3B G;  1N8R C;  4LF6 Q;  4LFB Q;  4WJ3 M;  4GNX C;  1X74 A;  3GDE A;  2KMR A;  3PUY A;  4AYB E;  1SJ8 A;  3UE1 A;  4P73 A;  4YWL A;  3S14 H;  2K75 A;  1YI2 A;  2F3C I;  3HH2 C;  4A3B H;  4DUZ L;  2AKW B;  1N33 L;  2KCX A;  3PIO A;  1J5E L;  3HFZ B;  1X65 A;  2D0P A;  1CKN A;  2UXD L;  4P75 A;  2IHE A;  2VUM G;  4OAV B;  3J7A 5;  1CGI I;  3PUX A;  1UE6 A;  4KHP L;  4OWX B;  3KY9 A;  4A3D H;  4YZC A;  2UUB Q;  3GO5 A;  1UE1 A;  2QQD A;  2JA6 G;  1E1O A;  2JA8 H;  4LUO A;  2VRW B;  2K9H A;  3OVO A;  2WAQ E;  3CME A;  1HJP A;  1TIH A;  2XTI A;  1Q86 C;  1OXT A;  3S2H H;  3KYH C;  2CAZ B;  2KMP A;  3PF4 A;  2UXC L;  4BY1 G;  2Z6K C;  4UY8 C;  4YWK A;  2D0O A;  1CKM A;  4JI3 Q;  3TRE A;  3I4N G;  3DA4 A;  2NZH A;  1A8V A;  1PH7 A;  4LFB L;  1IY6 A;  1N32 Q;  3AFP A;  2GN5 A;  3UE0 A;  1PH8 A;  5FJ8 G;  1OXV A;  2JEB I;  4QY7 A;  4QJF A;  5C3E H;  1FAR A;  2LUY A;  3I4N H;  3E59 A;  2KBN A;  1K83 H;  1K9M C;  4DKA C;  5K36 G;  2YU9 H;  2DB6 A;  4P71 A;  5FJ8 H;  1X56 A;  4R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...