4JCVE

Crystal structure of the recor complex in an open conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
214
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQESEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An 'open' structure of the RecOR complex supports ssDNA binding within the core of the complex.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
molecule keywords Recombination protein RecR
total genus 51
structure length 214
sequence length 224
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02565 RecO_C Recombination protein O C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4jcvE02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jcvE01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4jcvE03
1L1OA 3G48A 3AQQA 3G4SA 1H95A 2LSSA 4DR7Q 4IFDG 4WJ4A 2R7DA 4L5RC 2JA8G 5M5XH 1HNZL 1SFOH 3CF5A 3RLFA 4EX5A 3PIOA 4A3LG 1C0AA 4R4QA 1EUJA 1YIJA 4YWKA 1Q1EA 4P75A 4APVA 1KXLA 1QUQA 2A19A 4OXPA 4HIKA 4J15A 1J5EQ 3PF5A 2B3GA 3GTPH 1VQDA 2NN6G 1XMOQ 1Z47A 1HNXQ 1JJCB 1X56A 1J5EL 4HJ7A 2YYZA 1XMOL 4TVAB 2NZOA 1TWGH 3M9BA 3ICEA 2E2HH 3S17H 4L5SA 4BY7H 1WCMH 1VQAA 2K14A 3I4MH 1JJ2A 1EQRA 2UUAL 4LF6L 2PMZE 5C3EG 3LGJA 4JG2A 2VQEQ 3JAMi 4QQBX 3HOVG 2PNHA 2ZTCA 4ME3A 4JBMA 4JBWA 5GAEC 4DV1L 4NPSA 1OXUA 3GDEA 5AJ3L 2EQSA 1D8LA 1BBUA 2NZHA 4LF4L 5C4XG 4IJLA 3PUZA 4C2MH 1WJJA 5LMNL 1XNRQ 2H5XA 1XPOA 1VQ7A 4BY1H 4JI6L 3CXCA 1SR3A 4DR5Q 3FKIH 2RHQB 3PUVA 4IOCA 3NBHB 4XTCS 4R4TA 4P72A 1VQEA 3J81c 2IX1A 3PF4A 3I55A 5K36G 1QUQB 1XMQQ 1C9OA 4DV0L 4QL5A 1I94Q 3CCLA 4B3SL 1V9PA 1VQGA 4LF8L 4FDBA 3TS0A 3M4QA 4DR3Q 2ASBA 4KLKA 2R93H 3NELA 1YNXA 5C0XG 3K8AA 4GN3B 1HR0W 3PIPA 1B7YB 1PH7A 2ZTEA 4NB3A 3HOZH 2PI2A 1GO3E 4NXNL 3M4OH 5GQOA 1EQQA 4DUYL 4DNIA 1QVCA 3A0JA 1XJVA 3CPWA 4JI5L 2HIXA 3H3VI 1OXXK 4GOPC 1Y1WG 2B63G 2NVQH 1PH1A 5HY6A 4MNOA 4PMWA 3I56A 2Z6KC 5FLMG 3TREA 4DR2L 2UXDL 2WB1G 2RCNA 4PZ6A 3F2DA 4A3FH 3MXNB 4DV1Q 3UDXA 3T1HL 3KYHC 4DV2Q 2UUCQ 2MO1A 1HR0Q 5BR8Q 3M85A 2N3SA 3A74A 4HJ5A 1LM0A 1VQIA 4DR6Q 4IPGA 2IHFA 1E24A 1Q12A 2Z0SA 1W2BA 1CKOA 4OX9L 1HJPA 4GN4B 4EQ5A 4GLXA 2WB1E 1EIFA 1X3EA 2GVBA 4R1JA 1SLJA 2K52A 1PYBA 1A0IA 1Y14B 4X66L 3OTOL 4JI4Q 4LF5L 1N33Q 1VQMA 2EXDA 1JMCA 4C3HH 1EIYB 2AKWB 3SGIA 3A5UA 4JBKA 3HOUH 1WYDA 1Y1VG 3HOYG 3EN2A 3NENA 1U0LA 1K83H 3HOXG 4LF5Q 1N33L 4KHPQ 3Q8DA 2MNAA 2UXBL 3K7UC 3UDFA 5ELNA 4LNQA 1I6HH 5GAHC 4A4IA 5IYBH 1IBKQ 3TEHB 1PH2A 5M3FH 1JE5A 2D62A 4HIOA 5JJIA 4HIMA 3J81i 2ID0A 4IFDI 4LF7Q 3HOWH 4LFAL 2OTJA 1QVGA 1TWAH 1UEBA 4HJ8A 2WAQE 3D0FA 3L0OA 4Y7NH 2JA5H 1O7IA 1VQCA 2IT1A 2VQFL 4YCWA 3RLOA 2R93G 1YHBA 4LFCL 1KD1C 1Z9FA 4P74A 2UU9L 3DLLA 4A93G 3U4VA 1NY4A 2NN6I 2E8GA 1XPUA 3HOZG 3RNUA 1CSQA 2VY3A 4B3ML 1GD7A 4A75A 5E7NA 3UDGA 3CCQA 4X6AH 1X65A 2LXKA 2PQAB 1UE7A 1TXYA 5IYDH 1J6QA 4A3MG 2NVTH 4IPDA 3CC4A 2K5NA 3M7NA 2ZJQA 4DR4L 3J7ZC 4LF6Q 3M3YH 4A3FG 1B8AA 3KDFB 1G6PA 5DLQE 4O2DA 4LF9Q 3S1NH 4DR4Q 1L1OC 3DM3A 1NMGA 1G291 5JEAG 1YVCA 1YJWA 1Q81C 4TQUS 1QVFA 2VS1A 3GTOH 1CKNB 1SRUA 1YJNA 2D0PA 5C4JH 1HNWL 1E1TA 2UXBQ 1MJCA 4YWMA 1X3GA 4UP8A 4DV6L 1WCMG 2N49A 4JOIC 1PH8A 2VL6A 1RIPA 1N36Q 1X6OA 1Q82C 3WWVA 1HNWQ 3G71A 5LMNQ 1GVPA 2ZJRA 1FGUA 4DV3Q 1R9TH 4DUZL 4YCUA 1SN8A 1XNQQ 4JV5L 1Q1BA 4GKJL 1W3SA 4LUOA 3HOUG 5IYCH 2GVAA 4GLAC 3PGZA 4GOPB 1IBML 4LFAQ 4LF7L 1K3RA 4YHHL 4A3CH 4QGUA 4IPCA 1VQOA 2VZAA 5IP7G 1UE1A 3K7AH 1XMQL 3D31A 3GD7A 2K50A 5GADC 3AFPA 4GKKL 3GTGH 4JI8L 3CQZH 3UE1A 2N8NA 2AWNA 4DV4L 3CMAA 3GTLH 1AE2A 1X3FA 2CCZA 1X54A 2R7ZG 2I5HA 4MZ9A 1HZBA 3UE0A 1KC8C 2Q2UA 1T9HA 1VCIA 4JI2Q 5LMNW 4A3IG 1WFQA 1IBLL 1L2FA 1TWHH 3CCSA 4DUYQ 5AJ3Q 4A3KG 2I0QA 2OCEA 3F2BA 1VQ9A 3I7FA 5C4XH 4JI5Q 1IBLQ 4DKAC 1E7ZA 2RF4A 1CKNA 5BR8L 5C0XI 2ZM6L 1YITA 1YBYA 4BY1G 2EIFA 4A3JG 1JT8A 1KL9A 3H0GG 2JJQA 1KRTA 2IY5B 4LW1A 3KJOA 1HR0L 2Y0SG 2HHHQ 4JCVE 4DK3C 2UUAQ 4UY8C 1EOVA 3AEVA 4PZ8A 4WJ3M 1HZ9A 4OWXB 3HKZE 4JI7Q 2CFMA 2R92G 4GNXC 2QA4A 4HJAA 2YV5A 3AFQA 1TWFH 1LYLA 2OQKA 3HKSA 1PYSB 1X9NA 1XNQL 4KHPL 3NEMA 1GKHA 1Q7YC 4DAYB 1A62A 1ASYA 1Q86C 3K0XA 1PHJA 2LXJA 2VUMG 3CPFA 5C44G 1B70B 4DR1Q 2Q2IA 4K0KL 4A3EH 4NXNQ 3KFUA 4B3RL 3PSIA 4LUZA 4OO1I 1JJGA 3K81C 2JA8H 2ATWA 1A63A 3STBD 2BA0A 4BXXH 3CAMA 3RZOH 2V1CC 2NVYH 5LMUQ 3I4NG 4BBRH 2KCMA 2PI2E 3CP0A 3E9IA 3KF6A 4DV5Q 1RL2A 1I3QH 2Q2HA 4QJFA 2JA7G 4DV0Q 4B3SQ 1P16A 5IY0A 3KJPA 4DV5L 3T1HQ 4JYAQ 4LF8Q 3PUXA 1VQPA 1N36L 1S40A 1JB7A 1K8AC 1VQ6A 3EBEA 3TQYA 4DK6C 4JI1Q 2MQHA 3CCMA 2JQOA 1IBMQ 3PUYA 1VQNA 3E0EA 3KDFA 4YCVA 3L2PA 4LFCQ 2R7ZH 3PO2G 2RHSB 2B29A 2JEAI 1FVIA 2YTVA 4UPAA 5JJLA 3OTOQ 4JI4L 3CC7A 4A3IH 4OO1G 1K8GA 4B3TQ 2A1AA 3IRBA 4JI8Q 5M5WH 1Y1VH 2QGQA 3HOYH 3TRZA 4DV4Q 4A3KH 1OXSC 1UE6A 3GO5A 2VW9A 4BY7G 4R4OA 1E1OA 4XIGS 5H1SE 2E2JH 2F4VQ 1P8LA 2MFIA 3I4MG 1XTDA 1SE8A 2N78A 2ZJPA 2UXCL 2JK8A 4IO9A 4GOPA 4AQYL 3PO3G 3RLNA 2GN5A 4DV7L 4BBSG 3M4PA 2K5VA 3HOVH 4B3RQ 5M3MH 4JI6Q 1KHIA 5IT9c 4L5TA 4DUZQ 4NXML 4GLVB 1NBWA 5IE8A 5FJ8G 4AYBG 3BZKA 2YU9H 2CWPA 3STBC 1YZ6A 5IWAQ 4DR7L 3S2HH 4GS3A 2XTIA 4A93H 1CUKA 2VUMH 1HNZQ 2OWOA 3CCVA 1U5KA 5EAYA 4A3EG 4JYAL 2R6GA 3S1MH 1X55A 2AWOA 2BA1A 2I5LX 3FKIG 2KBNA 4YY3Q 4LFBQ 1HH2P 3B6YA 3ULJA 1K0RA 1Q8KA 1VQBA 3F8TA 4YHHQ 5IYDG 1BBWA 4BXXG 4YY3L 3H15A 4LFBL 1WI5A 1N32Q 2K4KA 4DR1L 1OXVA 1WOCA 4DR3L 3W5OA 4AYBE 1Y1WH 1HNXL 2FXQA 4LWCA 3GTMH 2OTLA 1C7YA 2YTYA 1AE3A 3FHWA 2JA6G 3S14H 3CW2C 5JEAJ 1UWVA 4JI2L 3VDYA 3RZDH 2VQFQ 1V1QA 1E3PA 4RMFA 1IL2A 2F4VL 4C3JH 4A3GG 3RN5A 2B63H 4DR6L 4JBJA 1E22A 2CWAA 3U4ZA 3JC66 4AIMA 2ALYB 2IHEA 4OX9Q 4A3LH 2KHJA 2HHHL 1GM5A 4JI3L 1FJGL 1S72A 4LUVA 2JA9A 1N34Q 1EYGA 4DV2L 3RR5A 3J81j 2MO0A 2BH8A 2UUCL 3S16H 2WFWA 2AHOB 1MIUA 3PV0A 4A3CG 3CMEA 4L5QA 4NXMQ 2PQAA 2D0OA 3FP9A 4DPGA 2XGTA 2CQOA 1AH9A 3OW2A 1BKBA 3J80i 3T1YQ 3U58A 3ER0A 4BA2I 3KF8B 4R4CA 4A3BH 1M1KC 1OTCA 4X66Q 3MEFA 4X65Q 1LUZA 3K80C 1XPRA 3T1YL 1M90C 1KQSA 1G51A 2DUDA 1K73C 1VQ8A 1HZAA 4GN5A 1PH6A 3CCJA 3UDIA 3HOXH 2UXCQ 5FJ8H 2Z6KA 4QY7A 1N32L 4O0AA 1PH5A 2JA5G 3J7A5 5JJKA 2R92H 3S15H 1IBKL 3KLWA 5LMUL 2BH2A 3I4OA 1IYJB 3H0GH 1I5FA 4JOIA 5IP9H 1ASZA 5C44H 1IZ6A 1PV4A 2E5LL 1DGSA 1I50H 5IWAL 1PH9A 4RG1A 1L0WA 1KAWA 1S3OA 3AYHB 4A76A 3ULPA 1VQ4A 4B3MQ 3H3VH 1L1OB 1VS0A 3KF6B 4IJHA 1CKMA 4GNXA 2DGYA 1YJ9A 4JV5Q 3I4NH 2UU9Q 5FLXc 3CD6A 4IFDJ 1QZGA 1TWCH 2C35B 2KCTA 2R7FA 2JE6I 4HIDA 1K9MC 1Q46A 2F3IA 2VQEL 2Y0SE 4X64Q 5GAGC 2NVXH 3ZJYC 4HJ9A 4X62Q 3BZCA 3I2ZA 4MTNA 3S2DH 4A3DG 4PZ7A 1LTLA 1NTGA 3J80c 3KOJA 3ERSX 1HZCA 4X64L 1NJIC 2ZM6Q 4OWWB 5M5YH 4C3IH 4X62L 2VNUD 3GTJH 3W1BA 3S1QH 4JI0Q 3U50C 1YHQA 4A3BG 2UXDQ 4POGA 2Q2TA 2JA7H 5C0XJ 3CC2A 1VQHA 4AQYQ 4DR5L 3GTQH 1EWIA 3CCEA 2UUBL 4JI0L 5IYCG 3CCUA 2WP8J 1CSPA 1NMFA 4QIWE 3F2CA 4Y52H 4P73A 4YWLA 2KHIA 2HQLA 4OWTB 4DV6Q 3A5ZB 1BVSA 1V43A 5IP7H 1D7QA 3W1GA 1A8VA 1N9WA 4BA1I 2E2IH 3PCOB 2KENA 3PO2H 3OYYA 1VQKA 4P71A 4AH6A 5FLMH 4GKJQ 2CKZB 4GNXB 3S1RH 4UP9A 5M3MG 1VQLA 4PG3A 2K75A 1NE3A 3GTKH 1PH3A 1SMXA 1UE5A 1YHAA 1SROA 1XNRL 4KHZA 4UP7A 2IX0A 4DR2Q 3F1ZA 2HT1A 4JC0A 5IP9G 1PH4A 4IPHA 1PVOA 3PO3H 5IYBG 4BBSH 3HFZB 2OQ0A 4A3JH 3HKZG 3PUWA 1VQFA 3JAMc 4JI1L 5C3EH 2ES2A 3TS2A 4DAMA 5HGQA 1FL0A 2HIVA 1VQJA 4H02A 4LF9L 2F52A 4JI3Q 1FJGQ 1MKHA 1N34L 3ULLA 2QEXA 2JEBI 2E5LQ 1PA6A 4B3TL 1KIXA 4KI0A 1I94L 1MJEA 2JA6H 5M3FG 2UUBQ 1KRSA 2YTXA 4A3DH 3EIVA 2K5HA 2L15A 3HOWG 4DV3L 4K0KQ 4X65L 3S24A 1IXRA 2AMCB 1EFWA 5J3BA 1N8RC 4JI7L 2A8VA 4A3GH 4R4IA 1OXTA 4POFA 4ALPA 3E9HA 4A3MH 3BU2A 4DV7Q 5GROA 1VQ5A 4LF4Q 4IOAA 1YEZA 4BBRG 5ELOA 2WAQG 3L7ZC 4OONA 3RN2A 1PFSA 4GKKQ 2I5MX 1YI2A 2ZTDA 3CCRA 1QZHA 3BJUA 3G6EA
chains in the Genus database with same CATH superfamily
1B9MA 4CBVA 3G48A 4UXJA 3AQQA 2E2JB 1V1PA 2LSSA 4WJ4A 1CHOI 2JA8G 3NTKA 5M5XH 1KDCA 1SJED 1RF2D 1EIGA 2KCNA 3TJQA 1PTOC 3M7GA 4P75A 1KXLA 4OXPA 4CJ0B 1GUSA 2B3GA 5JOBA 2K5DA 3S15B 1J5EL 4HTHA 2J7ZA 2EYPA 4BY7H 4UHVA 4PNYA 4K8IA 3DM1A 3I4MH 1EU3A 4JG2A 2ENBA 4JBMA 1MJAA 1YU6C 2QPOA 2DNCA 3GDEA 5AJ3L 2NZHA 1V1IA 2OU2A 4CGYB 1I6VC 3NWSA 3H09A 1OMUA 3LJ1A 1PTOF 2H5XA 2WACA 5EQ0A 3CXCA 5BN5A 5L37A 3H0GB 3PUVA 4XTCS 5K36G 4R4TA 1XMQQ 4B3SL 4QL5A 1I4RA 1V9PA 4FDBA 1YTPA 1HR0W 2DY8A 3R5DA 3PIPA 3BVGA 1B7YB 4A3IB 2L7XA 3TZDA 1KLGD 4DUYL 1QVCA 2NWGA 3A0JA 4S3SA 3SE0A 2L1LB 4XQQA 1OXXK 2QEJC 1OYVI 3U9SA 3AU7A 2NVQH 1DCZA 1PH1A 4MNOA 1FYBA 2L4NA 1G6ZA 4PZ6A 1U4LA 2JXDA 1SE3A 4A3FH 2N55A 3MXNB 4R9WA 3M85A 4HJ5A 1EYCA 3VYRA 4G75A 5J39A 5CV4A 4WJWA 5JAVA 1EIFA 1QILA 3QIAA 1XWEA 3SVMA 4ME5A 5KGUA 2EXDA 1JMCA 3DEPA 5IT9L 1CI3M 1EIYB 4DNCA 3SGIA 4TKOB 1WYDA 5IGEA 3HOYG 3EN2A 3NENA 4LF5Q 1O78A 1N33L 4KHPQ 4EQOA 4PMBA 2V53A 4MPIA 1FAQA 5I4DA 2QDBA 4LNQA 1WGTA 1PH2A 1DYQA 5M3FH 5JJIA 4OO1H 2ID0A 1AN1I 3D4RA 3GP7A 4LF7Q 3HOWH 3S16B 3BYTB 2ROWA 3GQBA 3L0OA 2XRQD 1O7IA 2IT1A 2VQFL 2R93G 4LFCL 2G9HD 2K7VA 3DLLA 3OMGA 2E8GA 1ENFA 3KP9A 5A2QL 1ET6A 4IUTA 4CJ2C 4ZLTF 2O2LD 3ITPA 4R8IA 2PQAB 3Q6SA 9WGAA 5C44B 1GJXA 4A3MG 3G7LA 4G7OC 4IPDA 5ELDA 4DR4L 3PMFA 4O1OA 4Z7HA 1RD9D 3KDFB 1HHVA 3MA2B 5JEAG 1YVCA 1B4OA 3C2PA 2D0PA 1A2TA 5CBEE 2UXBQ 4R8NA 3NK9A 1VMPA 1Q82C 1SGQI 4G76A 4Z7GA 1R9TH 2F0PA 1BMOA 3SK6A 1SN8A 4JV5L 2F0NA 3I3CA 4GOPB 3PGZA 1FNWA 2E2DC 2NVXB 2B8GA 4QGUA 4A3CH 5HQ8A 1HDLA 5IP7G 4XT1B 3K7AH 4GKKL 2R7ZB 2K50A 5FO8B 3GTGH 3M4YA 3UE1A 2N8NA 1X3FA 1SGNI 1Z2IA 1KC8C 2Z8LA 2Q2UA 2CJSC 5C4HA 4U673 1QCBD 4A3IG 3S2DB 1L2FA 1TWHH 1XTCD 2OCEA 3I7FA 1A3UA 1TBNA 3DEOA 5BR8L 5C0XI 2K04A 4A3JG 2K03A 1KL9A 1JT8A 1I4GA 5M3FB 2B2UC 2IY5B 4IUUA 1DZ1A 4LW1A 1E2VA 2MHVA 3SK8A 1RCVD 4KN7C 3S2HB 1C4QA 2Z4IA 4OWXB 1VF7A 4HJAA 3AFQA 1A2UA 1XNQL 4IUVA 3NEMA 1GKHA 4DAYB 1A62A 1ASYA 1Q86C 3CPFA 1B70B 3M3YB 3H94A 1CGJI 1G91A 1PFNA 1PTQA 2JA8H 1A63A 4KMUC 1KMAA 2BA0A 1BBXC 4CDDC 5EGTA 2NVYH 5LMUQ 3RZOH 2L12A 3E9IA 4DV5Q 1W4RA 2FMCA 1Q90A 2Q2HA 3FVVA 1A6XA 1WTQA 4B3SQ 1WVLA 3PUXA 1N13A 2A6EC 3I4LA 1X3QA 4JI1Q 4DK6C 1VQNA 3N6RA 1IBMQ 5JHWC 3E0EA 2D5DA 4LFCQ 2RHSB 1OMTA 4CKBA 2YTVA 1Y8FA 1F9SA 4U68A 5CGKA 1STYA 1D1IA 1JCKB 2XRSD 3FVQA 4K8JA 5M5WH 2CQAA 3TRZA 4DV4Q 3HH2C 1V1OA 3S1MB 3GO5A 4R4OA 1E1OA 3G6JB 4HFVA 1LT3D 3QR8A 2K5WA 2N78A 1Q3LA 2FHTA 2ZJPA 1JR0D 4AQYL 3RLNA 4OAUC 3HOVH 4B3RQ 5M3MH 4JI6Q 1LABA 5ELFA 1G8ZD 5M5XB 4NXML 2F66B 3OXLA 1IYUA 2F3CI 5DM73 1SYCA 3Q0AA 2VUMH 1TBQR 1HNZQ 2OWOA 3SDJA 4GI3C 3NUCA 5EAYA 4A3EG 4JYAL 5FLXL 1X55A 2AWOA 5E3PA 4H7BA 4LFBQ 1PCEA 3R2TA 1Q8KA 2SGPI 1BBWA 4BXXG 2YUUA 2PNRC 2K4KA 4DR3L 1OXVA 1Y1WH 3IAYA 2NVTB 1UAPA 2OTLA 2RC4A 5E3FA 4V190 2YTYA 3RU0A 1EYAA 1AE3A 4HMJA 3S14H 1CHQD 4JI2L 4NDXA 3TN2A 1E3PA 3I73A 4NV2A 3I91A 2Q8TA 4DR6L 4AIMA 3RZOB 4IN3A 2KHJA 2HHHL 4XQJA 3ZYYX 3S1RB 1LO5D 1GM5A 1FJGL 1BCPD 2JA9A 3S16H 1OVOA 3J81j 1TS3A 2LFNA 4J1MA 1H9RA 3PV0A 4KD4A 1EY9A 2QDLA 4FXDA 4NXMQ 2QW7A 4L5QA 1KBEA 4DPGA 2XGTA 2CQOA 2CAZB 2O5JC 3ER0A 5D65A 4BA2I 2YQPA 3LWUA 1M1KC 1OTCA 4X66Q 3ERQA 4C56C 2D2CC 2A5HA 2DUDA 1SNCA 2QQCA 4GN5A 2JA6B 1EFID 3S1QB 5HGTA 3TO6A 3UDIA 2UXCQ 1SE2A 2B0UC 1N32L 5JJKA 3VYTA 4DK1A 1M8CA 2BE5C 1Y8OB 2BH2A 3I4OA 1CQFA 1IYJB 1I4HA 1JWMD 1BOSA 2X6GA 3J7AV 1DGSA 1DS2I 5IWAL 1KABA 1L0WA 2F0OA 1VS0A 2AQ2B 4B9XA 1CKMA 4JK1C 2DGYA 4F88A 3K57A 1YNNC 4A3MB 5I2XA 2OF1A 3CQZB 3CD6A 2A6HD 5FUYA 1F2LA 1XA6A 2A6ED 2KCTA 3R2IA 2K1BA 4DFAA 4OAVB 2F3IA 2VQEL 2B39A 1Z7KB 3ZJYC 3BZCA 5EPJA 3KOJA 1ESFA 3ERSX 4X64L 2ZM6Q 1PRTF 5M5YH 4X62L 2VNUD 2B2YA 5FK9C 3FEWX 2RDGA 2GIVA 1HQMC 5C0XJ 4AQYQ 4DR5L 1EWIA 3CCEA 4KHVA 2JZMA 4QIWE 3F2CA 4K6LA 4P73A 4Y52H 4DV6Q 3A5ZB 5IP7H 2WGCA 1A8VA 1N9WA 2XVSA 4BA1I 1FNUA 2E2IH 2KENA 5JVG3 1VQKA 2UVOA 1FYCA 5E4WC 5FLMH 3GOXA 3L0IA 3S1RH 3OHXC 4UP9A 3BDCA 3E59A 2B8TA 2XN9C 4PG3A 1XXGA 2KCCA 1SMXA 5EPKA 1IYVA 1SROA 4Q9VA 3EJIA 1KDAA 1LT5D 4IPHA 3PO3H 1ULKA 4A3JH 3HKZG 4JI1L 5D3IB 2L55A 2GKTI 2A20A 5M9OA 1MKHA 1MI2A 3KF8A 1KBFA 2SGEI 1PA6A 2JN4A 4CHTB 4ZUIA 1IY6A 1HQRD 1QWYA 2JA6H 3P7JA 4A3DH 1K7UA 4AS3A 4DWLA 4E6IA 2L15A 3I9V1 3VDPA 3BVMA 5J3BA 1N8RC 3K5NA 4BWGB 4A3MH 4H13C 1VQ5A 2RLDA 1ZYRC 1EY5A 1YEZA 3RN2A 2IWHA 2I5MX 3MXPA 1YI2A 2B2VC 3CCRA 3TOBA 4OL7A 3G4SA 2L8EA 1SYDA 1S20A 4L5RC 2VB2X 1STEA 3RLFA 3QOJA 3CF5A 3QTLD 2E5RA 1AN8A 4O42A 5C3XA 3PIOA 1C0AA 1EUJA 5CBAE 1YIJA 3MFGA 1Q1EA 2XSCA 2A19A 1J5EQ 5FUVA 1K8MA 1VQDA 2M9VA 3GTPH 2NU4I 1K8OA 3LWEA 5EBCA 5LNK1 4TVAB 3ICEA 1TWGH 2E2HH 2MPMA 2FEFA 4L5SA 2K14A 5FLXE 2B2TA 1EQRA 2UUAL 4LF6L 2PMZE 3J7AF 1D5XC 1SYBA 3LGJA 3LX0A 5ELEA 4QQBX 3UI2A 3QG1A 2SGDI 3X3NA 3OOCA 4RCOA 2E2IB 1BBUA 1ONLA 4LF4L 1EU4A 4OELB 2A69D 4RWSC 3W2DA 1TIHA 2HCCA 2J87A 1VQ7A 4JI6L 4DR5Q 3SDZA 3SXHA 1GUOA 3UFFA 4TSSA 1B3AA 2IX1A 2B2UA 3FPPA 3B55A 1MHWC 1H0ZA 3CCLA 1TT2A 4B08A 4OVOA 3E6ZX 4LF8L 3O13A 3NELA 5BN3A 2NU2I 3K8AA 4GN3B 2M5XA 1PH7A 2ZTEA 4NB3A 2PI2A 3M4OH 2GA4B 5KIXA 2PZTA 1EQQA 2MJFB 4DNIA 3CPWA 3EA6A 1EZ6A 3MAQA 2IJ0A 4GOPC 2B63G 2EY5A 1SYEA 3CRLC 4PMWA 3PDNA 2Z6KC 1HTLD 5FLMG 2WB1G 2MGSA 3F2DA 4MTKA 1JC7A 4DV1Q 4U6RA 3T4AC 3T1HL 2JA7B 3KYHC 4RKLA 2F3WA 2N3SA 1LM0A 1VQIA 3J80L 2IHFA 2Z0SA 1STAA 1HJPA 4GN4B 1S5DD 2WB1E 1PYBA 1SSOA 4X66L 3OTOL 4JI4Q 1KLUD 4C3HH 3GV6A 1SMYD 5CV5A 1LTRD 4DK0A 3HOXG 1SYGA 2JB3A 1QNUA 2B8FA 2MNAA 2UXBL 3UDFA 4JPBW 3HOYB 1STGA 1IBKQ 3HRZC 1UEAB 1SGPI 2JAEA 1KAAA 1SE4A 4HIOA 1LR9A 2CWGA 5A35A 4LFAL 2OTJA 2FU2A 5C5MA 4F7XA 4ZYSA 2YU9B 3D0FA 2EY2A 1L0YB 4Y7NH 2JA5H 2F0TA 4G4KA 1KD1C 1Z9FA 4IALA 4ILWA 2UU9L 4E1PA 1HCZA 2NN6I 4DA2A 1XPUA 4DNRB 4N8X1 2BDOA 3MFYA 3PQIA 2ZRRA 5E7NA 2R61A 4A75A 4CDFC 3UDGA 2F0KA 2DY7A 2F0LA 1CT4I 2KEDA 2ZJQA 3PIP3 2PQEA 1X74A 4HAEA 4A3FG 3URYA 1G6PA 4FF4A 3F2UA 5DLQE 4O2DA 4LF9Q 3S1NH 1L1OC 1NMGA 1QVFA 2A73B 2GKRI 1JQYD 1SRUA 2EPBA 4PL4A 2HQEA 4GZYC 4YWMA 4DV6L 3PO3B 2TSSA 2VL6A 1TS4A 3WWVA 5EX3A 3G71A 4HGUA 5A2QE 1XNQQ 1TWGB 1Q1BA 2V6EA 2M00A 1W3SA 4LUOA 4FXGC 1E2WA 1K3RA 1NXUA 3TO7A 3AFPA 5HGIA 4QB4A 3CQZH 2FJ2A 4PMCA 4DV4L 3GTLH 1AE2A 2O4XA 2R7ZG 5EKIA 2I5HA 4MZ9A 1HZBA 2PPBC 4EQNA 4DXGA 4JI2Q 4CDEC 1WFQA 4DUYQ 2KA7A 5DAEA 3F2BA 4OGQC 3TP5A 5C4XH 1II3A 3QWPA 2RF4A 2RADA 4IUNA 3GTMB 5C0XH 1YBYA 4BY1G 4MHEA 3H0GG 2EDGA 2JJQA 3I72A 4F87A 1I4XA 5C6AA 3OSOA 3KJOA 1HR0L 4JCVE 2UUAQ 1TWAB 4JW0A 2EYMA 3UITA 3HKZE 4GNXC 3VYSA 2E73A 2N1AB 2BL7A 5FUWA 1NUCA 2F3VA 4K6DA 1Q7YC 3FC3A 1CK1A 1XX6A 3U9OA 1LR8A 5FUXA 5C44G 3RZDB 2Q2IA 2N88A 4A3EH 4B3RL 5KNDA 3PSIA 5J22A 1LACA 1HFNA 3SEKC 4BXXH 3FPUB 2EYLA 3I4NG 3KF6A 1ENAA 1TOTA 1I3QH 1ESRA 4XXEA 3H3VC 1P16A 4HR7B 2G9DA 3T1HQ 4LK1C 2WVJA 1VQPA 1N36L 1S40A 1JB7A 2ETDA 3FDTA 3L9AX 2B2WC 1TWFB 3PUYA 2JBWA 1E2ZA 3PO2G 2KUMA 3RMHA 1FVIA 3A55A 5IGDA 1ULMA 1EY0A 1T5XD 5JJLA 4A3IH 4B3TQ 2A1AA 3HOYH 2QGQA 2Z1CA 4A3KH 3QJYA 2VW9A 1X32A 1NCVA 2OXPA 4XIGS 2E2JH 3F4MA 1P8LA 3I4MG 4QMGA 1NAPA 4WORA 3QWNA 2UXCL 1RJTA 1XX8A 1TWCB 4BBSG 1PLFA 1DM0B 1H9SB 3M4PA 2CVRA 2MP1A 1FD7D 4B9WA 5C4XB 3UEJA 4AYBG 1XBTA 3BZKA 4DR7L 1PTRA 4P2CB 2CW0D 4O1NA 5G3LF 3CCVA 5TSSA 3S1MH 3T53B 4YY3Q 2WCYA 2NVQB 4YHHQ 5IYDG 1ZEQX 4YY3L 4SGBI 1YNJC 2TMPA 1VDZA 3FBVA 1C7YA 2KJXA 2V4DA 4DU9A 2QILA 3CW2C 3P1HA 4ODGA 5CV7A 5JEAJ 3VA5A 3T56B 3VDYA 3RZDH 2VQFQ 3J81E 1FY7A 3VA9A 4BS9A 1EYDA 1B2TA 3RN5A 1H9SA 2PYKA 1GUNA 4RGMA 2EE1A 4QUFA 1AZPA 2R92B 4LUVA 4JV5Q 4DV2L 2UUCL 2BH8A 2WFWA 2DJGC 1T5EA 5E4XA 3CMEA 5D3DA 2PQAA 3D00A 3FP9A 2ERWA 1SNPA 1BKBA 3T1YQ 4E1RA 4UAIA 2MJ8A 1DOLA 3VR5A 4ULLA 1RFHA 1XPRA 2B2TC 2F0HA 3TZUA 1M90C 2A69C 3K59A 3I8ZA 2KQ3A 1VQ8A 1HZAA 2ZT9C 2F4IA 1KDBA 1MD2D 1PZKD 1STHA 5FJ8H 1MSGA 4N8FA 4QY7A 3S14B 4O0AA 3J7A5 1IBKL 4XYOA 5EJWA 2F0QA 3DWQA 5HI7A 1Z7TA 4JOIA 5IP9H 1IZ6A 1IKLA 1PV4A 2JA8B 4ZRZA 3OXGA 4RG1A 4B3MQ 3AYHB 2F0GA 3ULPA 3H3VH 1L1OB 3KF6B 4IJHA 1V1PB 4GNXA 5IT9E 5FLXc 4IFDJ 1TWCH 2LKVA 1O7ZA 5CMDA 4FF2A 1TU2B 3HP3A 2EZVA 5GAGC 2NVXH 2JSOA 3I2ZA 4MTNA 5K36H 2K32A 5EPLA 4PZ7A 1HZCA 4K5WA 1R9TB 3EROA 4C3IH 1WD1A 4JI0Q 1BQQT 4POGA 3PIO3 3BG3A 2JA7H 2UUBL 1KNAA 1TWHB 1D7QA 3W1GA 3C1EA 4RGOS 4LAAA 1MJ9A 1BXTA 2RIOA 5J1ZA 4HEA1 2RSNA 1HA5A 3R8BA 4AH6A 4DGZA 4GNXB 4DAYA 1X3PA 1HFGA 3NQTA 4TRDA 1SNOA 4DAVA 3LJ2A 3IAM1 2H4OA 2PQ8A 2K75A 1NE3A 4ZKCB 2M2LA 3GTKH 1PH3A 1ICFB 1G2TA 3HZXA 4KHZA 5J8FA 4DR2Q 2HT1A 3SEBA 2IP6A 5IYBG 1WTVA 1HXYD 4G57A 2V1CA 3PUWA 2K9HA 1VQFA 3MEKA 4DAMA 1XYIA 4I7AA 4H02A 2E76C 2F52A 1FJGQ 1Y1CA 1N34L 2QEXA 3HKZB 1CSOI 4ZCKA 4NP5A 4B3TL 3CKIB 1K28A 1W6JA 3BDOA 4KI0A 5DM63 2J0TD 3OPOA 5D14A 1F2ZA 4A93B 2RKSA 1B50A 3HOZB 3EIVA 3MXNA 1BCPB 1QB5D 4X65L 4ABNA 2CH4A 4C3JG 1EFWA 4R4IA 1OXTA 1Y8NB 4DV7Q 2QF7A 1LTAD 2RBMA 1SXTA 3DWAA 4B6DA 2JE6I 3VR6A 2HDMA 1H95A 1F9RA 4DR7Q 3R5BA 4IFDG 3NBIA 4X3SA 1HNZL 1IL8A 3E3XA 1A15A 4DAPA 4EX5A 2F0DA 4A3LG 4R4QA 2L9HA 4YWKA 3DXJC 1SGYI 3H6MA 2F0FA 1QUQA 2F0IA 5KEEA 4J15A 4RGTA 3PF5A 4KV6A 1PRTB 1Z47A 1HNXQ 3TBIB 3HOWB 1PTOD 2KHSA 1XMOL 1JORA 1RKNA 1ZKOA 2EXZA 1NSNS 2XWJB 3S17H 1WCMH 1EQTA 1PPFI 3IL8A 5NUCA 2F0VA 1I50B 5EKLA 1HPCA 3CU7A 1TVXA 1L0XB 1HTPA 1TBOA 2NZ1D 2ZTCA 4ME3A 4JBWA 2OD1A 1VDDA 3VDUA 2EQSA 1D8LA 4ZKBB 5FKAC 5C4XG 4C2MH 4C1NI 3R5AA 1CFMA 5LMNL 3K58A 3J81L 1XNRQ 3KBXA 4FO2A 4BY1H 2BDNA 3FKIH 2RHQB 2ZW3A 1SGRI 3P23A 3PF4A 3SR1A 2XIWA 1QUQB 2IL8A 2EY6A 4L6TB 2K6AA 4K2LA 3WOEA 4DV0L 4C3IG 1VQGA 1LTTD 3MC0B 3IKJA 4HSVA 3J80E 3TS0A 4DR3Q 4KLKA 4L63B 1DS3I 4AS2A 4QF4A 3HOZH 4XQNA 1GO3E 2VRWB 2RIJA 2FINB 1XJVA 3SK5A 2HIXA 1Y1WG 2UXDL 3TREA 5CV6A 2RCNA 3OW7A 4FNFA 3UDXA 4DV2Q 2UUCQ 2MO1A 1HR0Q 1SDFA 4IPGA 1E24A 1CKOA 2R93B 3VE5A 1TS2A 3BZDB 2RDFA 4EQ5A 4I65A 4GLXA 4OEMB 3S9WA 1A0IA 4IUPA 4LF5L 1N33Q 1P9ZA 2XTQA 1GXDC 3A5UA 3HOUH 4JBKA 1SEBD 1Y1VG 1K83H 1H9KA 3L3OC 4KTAA 5M5YB 3K7UC 4KK7A 5IOCA 1WGCA 2BUSA 1WTWA 1EY4A 2RQXA 5GAHC 2L0CA 4PQXA 3C3LA 4L9MA 1S5CD 4RHRA 2D62A 4Q0FA 4A3GB 2KVMA 3J81i 1S5BD 4IFDI 1EOTA 5C3WA 2WAQE 3NPPA 2PO4A 4YCWA 1YHBA 2PW5A 3KBGA 4C2MB 1FR3A 3C46A 1SNDA 1S5ED 3U4VA 2L1BA 1EZ8A 1CSQA 4YZ9A 3CCQA 1O7LA 4X6AH 1X65A 2VUMB 3LJ0A 1UE7A 2ZXRA 1AFPA 2CH4W 2LUYA 5IYDH 4PL3A 1J6QA 4GXTA 3CC4A 3OMCA 2EYHA 3M7NA 3I70A 3NP8A 2DIPA 3J7ZC 2JXMB 4LF6Q 3M3YH 1B8AA 3FMCA 3P20A 1SGDI 4FF1A 1YJWA 2K05A 3SGQI 1G291 5LL6X 2VS1A 1CKNB 2QZGA 5CYUA 1HNWL 1E1TA 4NMZA 1MJCA 4UP8A 1WCMG 1KNEA 2BL8A 1CM9A 1N36Q 1X6OA 1HNWQ 1GVPA 4DUZL 4YCUA 2E2HB 1BNZA 1CA5A 2OVOA 3R5CA 1JICA 4C1NK 2GVAA 4GLAC 4LF7L 2Y0MA 2ZXPA 1STBA 2VZAA 1HPTA 1MJBA 1UE1A 5GADC 2LY7A 5AFWA 3EFXD 1D6EC 4JI8L 1O7YA 4WP4A 3T13A 4RHSA 2CCZA 4N9TA 3VR4A 3NBHA 1WKXA 1T9HA 1ET9A 5G3LD 5KNBA 1IBLL 3CCSA 1E0BA 2FMMA 4A3KG 2I0QA 1VQ9A 4JI5Q 2XNAC 1TY0A 3V2TA 2WKDA 2I46A 2ZXOA 2NUCA 1YITA 4DNTB 2EIFA 3OWEB 2P22B 3AJFA 1RHPA 2LS01 1KRTA 3NTIA 2Y0SG 1W6KA 2SEBD 5ISRA 1JE4A 4UY8C 3AEVA 2NBFA 4WJ3M 1HZ9A 1SJ8A 4JI7Q 2CFMA 3TP6A 2EJGC 4RCNA 4ZUJA 1TWFH 2OQKA 2K5QA 1PYSB 4KHPL 2EY1A 2FUG1 2O5IC 3K0XA 1PHJA 3JAME 4FP5D 4K0KL 3VYUA 3KFUA 2F0JA 4OO1I 3T16A 1SGEI 3DUZA 2P6AC 2ATWA 3DMUA 4HMIA 2P5ZX 1B53A 3CAMA 3KLRA 2KCMA 3CP0A 2C5CA 1ZYRD 1RL2A 4KKSA 4QJFA 2JA7G 4DV0Q 3A54A 5IY0A 5I2YA 4LF8Q 3OIPA 3OVOA 1YNND 1GUTA 4KJOA 1K8AC 1VQ6A 3QB3A 5LHY1 5IGCA 3MXGA 3TQYA 4AMLA 2MQHA 3KDFA 3L2PA 2R7ZH 3RUZA 2JYOA 4A3EB 2EJFC 3FRPB 3OTOQ 4JI4L 3CC7A 4OO1G 1K8GA 5E1FA 2A68D 3SK4A 1DONA 1UNSA 3ND9A 3HOXB 1PYWD 1TDPA 5LL6S 3K7AB 5CC4A 2MFIA 4FVMA 1HUMA 1EL0A 4GOPA 4IO9A 5EKKA 2PCFB 2GN5A 1SMYC 1EEFD 2MUYA 5IT9c 4L5TA 1PTOH 4DUZQ 4GLVB 1NBWA 5IE8A 5FJ8G 5FO9B 3GV3A 2CWPA 3STBC 2HDLA 5IWAQ 2YU9H 3S2HH 2KMPA 2G5DA 5T1IA 1CUKA 4A93H 2GKVA 1U5KA 3TOAA 1AW7A 1PXUA 2I5LX 1EEID 1HH2P 1GUGA 3B6YA 4NV5A 4KN4C 1K0RA 1VQBA 3I90A 3Q23A 3CHBD 2FNFX 1DOMA 2ICIA 3H15A 3S17B 4LFBL 1WI5A 2Q8RE 3W5OA 2YFBA 4AYBE 4LWCA 2KMQA 4G7HC 1WTJA 3MVVA 3TP7A 3BVZA 2JA6G 3R93A 1YO7A 1V1QA 5F2DA 1Y69U 1BCPC 4A3GG 1CHPD 2B63H 1M8BA 2A2DA 4JBJA 4K5VA 1C48A 1IY5A 5J8CA 3KK7A 3A8JE 2CWAA 1BF4A 3JC66 1WD0A 2ALYB 2IHEA 4A3LH 4H44C 4IQZA 4JI3L 1PRTD 1N34Q 3RR5A 2MO0A 2AHOB 1MIUA 1P9GA 3NXWA 5M5WB 3HS0C 2JYYA 1JWSD 1CQVA 2Y0SB 3OW2A 3J80i 1PFMA 1ZXTA 3KF8B 4R4CA 4X3KA 1PJUA 3K80C 3QAHA 1KQSA 1G51A 1K73C 1U4RA 2J4XA 3A8IE 2NN6H 3I4MB 2W0TA 3CCJA 1UVFA 3HOXH 2Z6KA 2LEOA 1BDOA 3JSBA 1PH5A 2E74C 4WRDA 2N17A 4NKLA 2NU0I 3S15H 1LTGD 2RDHA 3NWTA 5I9PA 3H0GH 3R3OA 2E5LL 4OHJA 5KNCA 1K7VA 1I50H 1PH9A 1K7TA 1VQ4A 1KAWA 1S3OA 4AYBB 1WTHA 2ENNA 2NB0A 3E5SA 1PDQA 3OIQA 1YJ9A 1QZGA 4A3DB 2C35B 1K9MC 2Z9HA 4OIJA 4X64Q 4HJ9A 3EVQA 4X62Q 3NQIA 1NTGA 3J80c 2PW7A 1SFOB 4OWWB 5EBDA 3AB9A 4KD3A 3W1BA 3GTLB 2C9OA 4HCSA 1YHQA 4A3BG 2UXDQ 3N52A 2Q2TA 2IPKD 1VQHA 3CC2A 3GTPB 1RTNA 1NNXA 1HJAI 1TURA 1EY8A 1IW7D 1BO0A 5HURA 2WP8J 5DEHA 1CSPA 1NMFA 1Z6HA 1U4MA 2HQLA 1QJOA 2K01A 5JJZA 1V43A 3GTKB 2SGFI 3PCOB 1MBYA 3PO2H 5I6YA 4X3UA 1UVGA 4M1UB 2CKZB 3HOUB 1WTXA 1QNKA 5M3MG 3Q24A 5E3RA 1VQLA 3MXUA 2BE5D 4RKBA 1UE5A 1YHAA 2XMXA 2RCFA 5T1GA 2L11A 4KKTA 3JAML 5IP9G 1PH4A 1V8QA 4BBSH 1SJHD 1R4QB 3HFZB 5C4ZA 3HGBA 3VR2A 2ES2A 1LLRD 2VB3X 1IW4A 3TS2A 5HGQA 1FL0A 2HIVA 4LF9L 2I07B 4CKEA 1VMCA 1J8IA 5CORA 2DN8A 2E5LQ 1DOKA 2JA1A 1I94L 2KKMA 2RSOA 2R3ZA 2XRCA 2DJFC 1F2MA 1KRSA 2YTXA 2NU1I 5COYA 1SNQA 5JVH3 2K5HA 2HCIA 3A56A 4DV3L 4K0KQ 4HN7A 1HA6A 4A3GH 2AMCB 4JI7L 1U4PA 2NU3I 4POFA 3E9HA 2K33A 3BU2A 3NTHA 4M8AA 2WAQG 3L7ZC 4OONA 3UOEA 2ENZA 2ZTDA 2IX3A 1MJEA 3BJUA 3G6EA 5JEAH 1L1OA 4KY5A 2R7DA 3IFTA 2PZWA 1SFOH 4A24A 4F8MA 2RA4A 5DNFA 2ORVA 1I6HB 1LV9A 4APVA 1M4VA 4HIKA 5E3QA 4C3HB 1LT4D 2NN6G 1XMOQ 4I1TA 3QOLA 1JJCB 1X56A 4HJ7A 2YYZA 3K5OA 2NZOA 3M9BA 3TMEA 3DHQA 1VQAA 3IFDA 1JJ2A 1JWUD 4YZCA 2NVYB 1LTBD 4XYQA 5C3EG 2VQEQ 3JAMi 1AEXA 2EYJA 3LNNA 1F9QA 2PNHA 3HOVG 3SGBI 2X69A 2BCOA 5GAEC 4DV1L 1STNA 1TY2A 4NPSA 1OXUA 2X52A 1ML0D 1A3TA 2PMZB 4A3FB 3HEJA 4IJLA 5JPNC 3PUZA 1WJJA 1Q8IA 2F03A 2NYZD 2L5TA 4QIWB 1XPOA 4A3BB 5K5PA 2KCXA 1SR3A 2F1MA 4A3JB 3T51B 3NBHB 4DN4M 3J81c 4P72A 1VQEA 4IOCA 3GTJB 3I55A 3GTOB 1I94Q 2A2CA 1C9OA 2F0SA 1SBBB 1F9PA 2AUJD 1D1KA 2QKIC 3M4QA 4ZK9B 2ASBA 2R93H 2IW3A 1YNXA 5C0XG 1CZWA 3FKIB 4RFBA 4NXNL 5GQOA 1B44D 4X3TA 3CXLA 3HG9A 4JI5L 3H3VI 5EX0A 5HY6A 3I56A 1TR5A 4DR2L 2AQ3B 2WINB 3DO9A 2SNMA 5BR8Q 2JB1A 3A74A 1JB3A 4DR6Q 3Q22A 1Q12A 3BDLA 1W2BA 4OX9L 4XDXA 2B2WA 1X3EA 2GVBA 4R1JA 1SLJA 2K52A 2EOTA 1B1ZA 1Y14B 4FXKC 1VQMA 1HRJA 2AKWB 1F77A 2YFAA 2X3TA 4IUQA 1U0LA 2ODDA 3OXFA 3Q8DA 3A7LA 3OL0A 2B63B 5ELNA 1I6HH 1Y1VB 1BUSA 4A4IA 5IYBH 2QSBA 3TEHB 4KKUA 2SDFA 4CJ1B 1JE5A 3CRKC 4HIMA 2QGMA 1I4PA 1UUCA 1PMRA 2EVBA 1QVGA 1TWAH 1UEBA 4Z9CB 2WV6D 4HJ8A 1VQCA 3W3AA 5CCMA 3RLOA 4J6HA 4ZAIA 5CCLA 4P74A 2KMRA 7WGAA 4A93G 5I9OA 1NY4A 3HOZG 3K5MA 1DD2A 3RNUA 2VY3A 3KLSA 5ELBA 1GD7A 4B3ML 2LXKA 3MWYW 2HUGA 3WOFA 4ID6A 1TXYA 2ARPF 2HD3A 2NVTH 1CZGA 1MSHA 1PZJD 1S4ZA 1DXMA 2K5NA 1ILPA 4HSPA 1PTOB 1C8CA 2X6LA 4KY7A 2B2VA 2CWHA 2QQDA 1ULNA 4DR4Q 3DM3A 1Q81C 4HEDA 4TQUS 3GTOH 2QQ0A 1B9NA 2XTRA 1YJNA 4MIUA 5C4JH 3A8KE 1X3GA 2N49A 4JOIC 1PH8A 4BBSB 1R0RI 2ELIA 1RIPA 3FSXA 4V0BA 3BS1A 4RAUC 3D8GA 2ZJRA 1FGUA 2Z6BA 5LMNQ 4DV3Q 1XNRL 5I6WA 1D5ZC 4GKJL 3HOUG 5IYCH 1IBML 4LFAQ 1U9RA 1YNJD 3KY9A 4YHHL 3K6OA 4IPCA 1VQOA 1XMQL 1Q9BA 3D31A 3GD7A 1QOHA 3AMUA 5DAUA 3E0JA 2AWNA 3CMAA 2K19A 4H0LC 1X54A 1EWHA 3B4VC 3SHLA 4J8QA 1QG7A 3UE0A 1VCIA 1PFBA 5LMNW 1F2YA 2B2YC 2WAQB 1AP0A 4DF7A 2DNEA 5AJ3Q 1TGSI 3DA4A 2CWFA 2KMOA 1IBLQ 1JOKA 1E7ZA 4DKAC 2RVLA 1CKNA 5KYIA 1SNMA 2ZM6L 1LTID 4LJZC 3UGLA 2H1EA 2HHHQ 4DK3C 1EOVA 4PZ8A 2BOSA 3ONAB 1CT0I 2R92G 2EJMA 3PO2B 3M4OB 2QA4A 2YV5A 1LYLA 2WKCA 3HKSA 1X9NA 1I4QA 3RD4A 4RA8A 1G2SA 2VUMG 2LXJA 1R79A 4DR1Q 1O80A 4Q5VA 1SAPA 4NXNQ 4K2KA 4LUZA 2VXWA 1IW7C 4CKCA 1JJGA 3K81C 4Y7NB 5C3EB 2JA5B 3UGDA 2OEOA 4IURA 2K28A 2AUKA 5KYLA 3STBD 2V1CC 5IIFA 4BBRH 1B3QA 2PI2E 1GUWA 3MHBA 4EQPA 1H9MA 1TBRR 4C3HG 3KJPA 4DV5L 4JYAQ 5C5LA 1PZID 1WCMB 3EBEA 4QUCA 2UZ3A 1EY7A 1J9OA 3CCMA 2JQOA 5KRUA 4WFN3 4XT3B 4YCVA 1K83B 2B29A 2JEAI 2FFKB 3DA3A 4UPAA 1TQOA 2KEEA 2DKVA 2LB7A 3IRBA 4JI8Q 4O1PA 3HOVB 1Y1VH 4FYDA 2KOLA 1OXSC 1UE6A 4BBRB 5BN4A 4BY7G 2QCPX 5H1SE 2F4VQ 2EYFA 2N71A 2A6HC 4JVZA 3V96A 5IODA 2JW6A 1XTDA 2DB6A 2Q8IB 4I7ZC 1SE8A 1FNVA 1D5MC 2JK8A 3PO3G 4DV7L 2K5VA 3BYYB 3FNBA 1KHIA 4KY6A 1GHKA 1NUBA 2AQ1B 3ND8A 1M8AA 1UHAA 1TUSA 3QO2A 1DJRD 3TSSA 3K0YA 3UGIA 4K14A 4HCEA 3V05A 1YZ6A 4YIJA 4GS3A 2XTIA 4N9PA 2HGKA 2R6GA 4NW2A 1WTOA 2BA1A 3FKIG 2KBNA 3MTSA 3ULJA 4FF3A 1ICWA 3F8TA 2GSCA 2CHBD 3BJIA 1NR2A 2SGQI 1BR9A 3K5LA 1N32Q 4DR1L 1WOCA 1HNXL 1SYFA 5ELCA 3GTMH 2FXQA 1S5FD 2KECA 5C4JB 1AZQA 1HUNA 3FHWA 5IGBA 5CR3A 4FKDA 1FGBD 1UWVA 1CGII 3TO9A 3A7AB 2XWBB 1CT1D 4BY1B 1JQOA 1A3VA 4L8JA 4RMFA 1IL2A 2F4VL 4C3JH 3MZ5A 1RTOA 1IKMA 1E22A 1K3BC 1LR7A 2NTTA 3D3RA 4RGNA 3U4ZA 4OX9Q 1LTSD 3D6WA 3GTQB 1QE6A 4PV1C 1R4PB 4YZDA 3GTGB 1S72A 4A3BH 1EYGA 3IAS1 1TKWB 4A3CG 2NTSA 3KUPA 1RDPD 2D0OA 2F0WA 4IFDH 1AH9A 5IGFA 5CV9A 3X3MA 3U58A 1VF5C 1BUVT 4K5XA 4RH6A 5IGGA 3MEFA 4X65Q 3P75A 1LUZA 3T1YL 1GHJA 3C1FA 3UEYA 2D9UA 3I4NB 1CTMA 4C3JB 1OO9B 3DWPA 4DXFA 1PH6A 1FARA 4A3KB 1NR4A 5CV8A 2JA5G 3KLSX 3NSWA 4ZQ3A 2R92H 4QCLA 3EQLC 3KLWA 5LMUL 4G7ZC 4CDCC 1I5FA 2ORWA 1ASZA 1TS5A 5C44H 2EYOA 3TP8A 2JB2A 4A76A 4PL5A 2ICEC 2A68C 1ENCA 3I4NH 2UU9Q 1UUPA 4OIKA 2R7FA 4EVOA 4HIDA 4UXIA 1EQVA 1Q46A 3D6CA 2Y0SE 1WTPA 2F0UA 4A3DG 3S2DH 1LTLA 1MGSA 4EGVA 1NJIC 2F6MB 1HEVA 4BY7B 3GTJH 1RODA 3S1QH 2OT2A 1JOQA 3U50C 1GOZA 2GVIA 2JP1A 3GTQH 2N52A 2WB1B 4JI0L 5IYCG 1Y1BA 1JOOA 3CCUA 1WTRA 3H91A 5FOBB 1EIHA 4YWLA 2KHIA 4OWTB 3S1NB 1BVSA 4LMQD 3J7YW 5JPMC 4UDUC 3OYYA 4P71A 4GKJQ 2SOBA 3NE5B 1KTKA 4IZ8A 4UXHA 3VA7A 2CW0C 3NHHA 1EY6A 2A74C 4C3IB 1ILQA 1IHZA 2F0EA 5M3MB 3D4DA 1BCPF 4UP7A 2IX0A 2J9RA 3F1ZA 1PVOA 4JC0A 1CE3A 1EWCA 2OQ0A 3OWFA 2Z4HA 1CA6A 3WDNA 2OZUA 3MEHA 2WIIB 2QQEA 2SNSA 3JAMc 1PRTC 5C3EH 1Y1WB 1VQJA 4JI3Q 1D2BA 3ULLA 2F0MA 2JEBI 1TIID 1I3QB 1X4SA 4KJNA 1KIXA 3E2IA 2E75C 3TDQA 2PZUA 1CT2I 5M3FG 2UUBQ 1K0SA 3HOWG 1V1HA 1H9JA 3S24A 1IXRA 2A8VA 1Y8PB 4ALPA 1MT1A 1LT6D 5GROA 4LF4Q 3D4WA 4IOAA 4BBRG 5ELOA 4GKKQ 1PFSA 3VR3A 5FO7B 4MN3A 3FSYA 1QZHA 2LMCB
chains in the Genus database with same CATH topology
1L1OA 3G48A 3AQQA 3G4SA 1H95A 2L8EA 4UXJA 2LSSA 4DR7Q 4IFDG 4WJ4A 2R7DA 1CHOI 4L5RC 2JA8G 5M5XH 1HNZL 1SFOH 3CF5A 3RLFA 3QTLD 4A24A 2E5RA 4EX5A 3PIOA 4A3LG 1C0AA 3TJQA 4R4QA 1EUJA 1YIJA 4YWKA 2ORVA 1Q1EA 4P75A 4APVA 1SGYI 1KXLA 1QUQA 2A19A 4OXPA 4HIKA 4J15A 1J5EQ 3PF5A 1BMOA 2B3GA 5FUVA 3GTPH 1VQDA 2NN6G 1XMOQ 4I1TA 2JYYA 2NU4I 1Z47A 1HNXQ 1JJCB 1X56A 1J5EL 4HJ7A 2YYZA 5LNK1 4TVAB 2NZOA 1TWGH 3M9BA 1XMOL 2E2HH 3ICEA 4L5SA 3S17H 1WCMH 1VQAA 1PPFI 2K14A 3I4MH 1JJ2A 4YZCA 1EQRA 2UUAL 4LF6L 2PMZE 5C3EG 3LGJA 4JG2A 2VQEQ 3JAMi 4QQBX 1TBOA 3HOVG 2PNHA 3SGBI 2ZTCA 4ME3A 4JBMA 2SGDI 4JBWA 5GAEC 4DV1L 2OD1A 4NPSA 1YU6C 2QPOA 1VDDA 1OXUA 3GDEA 5AJ3L 2EQSA 3VDUA 1D8LA 1BBUA 2NZHA 1V1IA 4LF4L 5C4XG 4IJLA 3PUZA 4C2MH 1WJJA 5LMNL 1XNRQ 1OMUA 3LJ1A 1TIHA 2H5XA 1XPOA 1VQ7A 4BY1H 4JI6L 3CXCA 1SR3A 4DR5Q 2J87A 2KCXA 3FKIH 2RHQB 3PUVA 3UFFA 4IOCA 3NBHB 4XTCS 4R4TA 4P72A 1VQEA 3J81c 2IX1A 3P23A 3I55A 3PF4A 1SGRI 1QUQB 1XMQQ 2A2CA 1C9OA 4QL5A 4DV0L 1I94Q 3CCLA 4B3SL 4OVOA 1H0ZA 4BY7H 1V9PA 1VQGA 4LF8L 4FDBA 3TS0A 3M4QA 4DR3Q 1YTPA 2ASBA 4KLKA 2R93H 3NELA 1YNXA 5C0XG 2NU2I 3K8AA 4GN3B 1HR0W 1DS3I 4AS2A 3PIPA 2M5XA 1B7YB 1PH7A 2ZTEA 2L7XA 4NB3A 3HOZH 2PI2A 1GO3E 4NXNL 3M4OH 2VRWB 5GQOA 1EQQA 4DUYL 2MJFB 4DNIA 1QVCA 3A0JA 1XJVA 3CPWA 2L1LB 2HIXA 4JI5L 3H3VI 3CXLA 1OXXK 4GOPC 1Y1WG 2B63G 1OYVI 2NVQH 5EX0A 1PH1A 5HY6A 4MNOA 4PMWA 3I56A 2Z6KC 5FLMG 3TREA 4DR2L 2UXDL 3PDNA 1FYBA 2WB1G 2RCNA 4PZ6A 3DO9A 3F2DA 2JXDA 4A3FH 3MXNB 4DV1Q 4U6RA 3OVOA 3UDXA 3T1HL 3KYHC 4DV2Q 2UUCQ 2MO1A 1HR0Q 5BR8Q 3M85A 2JB1A 2N3SA 3A74A 4HJ5A 1LM0A 1VQIA 4DR6Q 4IPGA 2IHFA 1E24A 1Q12A 2Z0SA 1W2BA 1CKOA 5K36G 4OX9L 3VE5A 1HJPA 4GN4B 4EQ5A 4G75A 4GLXA 2WB1E 1EIFA 1X3EA 2GVBA 4R1JA 1SLJA 2K52A 1PYBA 1A0IA 1Y14B 4X66L 3OTOL 4JI4Q 4LF5L 1N33Q 1VQMA 2EXDA 1JMCA 2XTQA 4C3HH 2AKWB 1EIYB 3SGIA 3A5UA 4JBKA 2YFAA 3HOUH 1WYDA 1Y1VG 3HOYG 3EN2A 3NENA 1U0LA 1K83H 3HOXG 4LF5Q 2JB3A 1N33L 4KHPQ 2ODDA 3Q8DA 2V53A 2MNAA 2UXBL 3OL0A 1FAQA 3K7UC 3UDFA 2BUSA 5ELNA 4LNQA 1I6HH 5GAHC 1BUSA 4A4IA 5IYBH 1IBKQ 4L9MA 3TEHB 1PH2A 1SGPI 5M3FH 1JE5A 2D62A 2JAEA 4HIOA 5JJIA 4HIMA 3J81i 2ID0A 1AN1I 1LR9A 4IFDI 4LF7Q 3HOWH 4LFAL 2OTJA 1UUCA 2ROWA 1QVGA 1TWAH 1UEBA 4HJ8A 2WAQE 3D0FA 3L0OA 4Y7NH 2JA5H 1O7IA 1VQCA 2IT1A 2VQFL 4YCWA 5CCMA 3RLOA 2R93G 1YHBA 4LFCL 5CCLA 1KD1C 1Z9FA 4P74A 2KMRA 2UU9L 3DLLA 4A93G 4E1PA 3U4VA 1NY4A 2NN6I 2E8GA 1XPUA 3HOZG 3RNUA 1CSQA 2VY3A 3KP9A 1GD7A 4A75A 4B3ML 2ZRRA 5E7NA 3UDGA 3FC3A 4YZ9A 3CCQA 4X6AH 1X65A 2PQAB 2LXKA 3LJ0A 1UE7A 2LUYA 1TXYA 5IYDH 2ARPF 4PL3A 1J6QA 4A3MG 2NVTH 1CT4I 4IPDA 4GXTA 3CC4A 5FUXA 2K5NA 3M7NA 2ZJQA 4DR4L 2DIPA 3J7ZC 4O1OA 1X74A 4LF6Q 4Z7HA 3M3YH 4A3FG 1B8AA 3KDFB 1G6PA 5DLQE 4O2DA 4LF9Q 3S1NH 1SGDI 2QQDA 4DR4Q 1L1OC 3DM3A 1NMGA 1G291 5JEAG 1YVCA 3BJUA 1YJWA 1Q81C 3SGQI 4TQUS 1QVFA 2VS1A 3GTOH 2QQ0A 2GKRI 1CKNB 2XTRA 1SRUA 1YJNA 2D0PA 4PL4A 5C4JH 1E1TA 1HNWL 2UXBQ 1MJCA 4YWMA 1X3GA 4UP8A 4DV6L 1WCMG 2N49A 4JOIC 1PH8A 1R0RI 2VL6A 1RIPA 1N36Q 2ELIA 1X6OA 1Q82C 3WWVA 1HNWQ 3G71A 1SGQI 4G76A 4Z7GA 5LMNQ 1GVPA 2ZJRA 1FGUA 4DV3Q 1R9TH 4DUZL 4YCUA 1SN8A 1XNQQ 2VUMG 1Q1BA 2V6EA 4GKJL 1W3SA 4LUOA 3HOUG 5IYCH 2GVAA 4GLAC 3PGZA 4GOPB 1IBML 4LFAQ 4LF7L 1K3RA 3KY9A 4YHHL 4A3CH 4QGUA 4IPCA 1VQOA 2VZAA 1HPTA 5HQ8A 5IP7G 1UE1A 3K7AH 1XMQL 3D31A 3GD7A 2K50A 5GADC 3AFPA 4GKKL 3GTGH 5HGIA 4JI8L 3CQZH 3UE1A 2N8NA 2AWNA 4DV4L 3CMAA 3GTLH 2K19A 1AE2A 1X3FA 1X54A 2CCZA 2R7ZG 2I5HA 4MZ9A 1HZBA 1SGNI 3B4VC 3UE0A 1KC8C 2Q2UA 1T9HA 1VCIA 4JI2Q 2CJSC 5LMNW 4A3IG 1WFQA 1IBLL 1L2FA 1TWHH 3CCSA 4DUYQ 5AJ3Q 1TGSI 5DAEA 4A3KG 2I0QA 2OCEA 3DA4A 3F2BA 3I7FA 5C4XH 1VQ9A 4JI5Q 2KMOA 1IBLQ 4DKAC 1E7ZA 1TBNA 3QWPA 1XX6A 2RF4A 1CKNA 5BR8L 5C0XI 2ZM6L 1YITA 1YBYA 4BY1G 2EIFA 4A3JG 1JT8A 1KL9A 2P22B 3AJFA 3H0GG 2JJQA 1KRTA 2IY5B 4LW1A 3KJOA 1HR0L 3UGLA 2Y0SG 2HHHQ 4JCVE 4DK3C 2UUAQ 4UY8C 1EOVA 3AEVA 4PZ8A 4WJ3M 1HZ9A 1SJ8A 3UITA 3HKZE 2CFMA 4OWXB 4JI7Q 2R92G 4GNXC 1CT0I 2E73A 2QA4A 2N1AB 4HJAA 2YV5A 3AFQA 1TWFH 1LYLA 2OQKA 3HKSA 1PYSB 1X9NA 1XNQL 4KHPL 5FUWA 3NEMA 1GKHA 1Q7YC 2FUG1 1A62A 4DAYB 1Q86C 3K0XA 1PHJA 2LXJA 1ASYA 3CPFA 5C44G 1B70B 4DR1Q 1LR8A 2Q2IA 4K0KL 4A3EH 4NXNQ 3KFUA 4B3RL 1CGJI 3PSIA 4LUZA 4OO1I 1SGEI 1JJGA 3K81C 3UGDA 1PTQA 2JA8H 2ATWA 2P6AC 3D00A 1A63A 1KMAA 3STBD 2BA0A 4BXXH 3CAMA 3RZOH 2V1CC 2NVYH 5LMUQ 3SEKC 3I4NG 4BBRH 2KCMA 2PI2E 3CP0A 3E9IA 3KF6A 4DV5Q 1W4RA 1TOTA 1RL2A 1I3QH 2Q2HA 1TBRR 4QJFA 2JA7G 4DV0Q 4B3SQ 1P16A 5IY0A 3KJPA 4DV5L 3T1HQ 4JYAQ 2WVJA 4LF8Q 1OVOA 3PUXA 1VQPA 1N36L 1N13A 1S40A 1JB7A 1K8AC 1VQ6A 3EBEA 2OVOA 2UZ3A 3TQYA 4DK6C 4JI1Q 2MQHA 3CCMA 2JQOA 1IBMQ 3PUYA 1VQNA 5JHWC 3E0EA 3KDFA 4YCVA 3L2PA 4LFCQ 2R7ZH 3PO2G 2RHSB 2B29A 2JEAI 1OMTA 1FVIA 2YTVA 3DA3A 4UPAA 1Y8FA 5JJLA 3OTOQ 4JI4L 3CC7A 4A3IH 4OO1G 1K8GA 4B3TQ 2A1AA 3IRBA 4JI8Q 4O1PA 5M5WH 1Y1VH 2QGQA 3HOYH 3TRZA 4DV4Q 4A3KH 3HH2C 1OXSC 1UE6A 1CE3A 3GO5A 2VW9A 1PVOA 4BY7G 4R4OA 1E1OA 4XIGS 5H1SE 2E2JH 2F4VQ 3F4MA 2N71A 2JW6A 1P8LA 4HFVA 2MFIA 3I4MG 1XTDA 2DB6A 1SE8A 5EX3A 2N78A 2ZJPA 2UXCL 2JK8A 4IO9A 4GOPA 4AQYL 3PO3G 3RLNA 2GN5A 4OAUC 4DV7L 4BBSG 3M4PA 2K5VA 3HOVH 4B3RQ 5M3MH 4JI6Q 1KHIA 1NUBA 5IT9c 1TUSA 4L5TA 4DUZQ 4NXML 4GLVB 2F66B 1NBWA 5IE8A 3OXLA 5FJ8G 2F3CI 3UEJA 3UGIA 4AYBG 1XBTA 3BZKA 2YU9H 2CWPA 3STBC 1YZ6A 5IWAQ 4DR7L 3S2HH 1PTRA 4GS3A 2XTIA 4A93H 1CUKA 2VUMH 1TBQR 2KMPA 1HNZQ 2GKVA 2OWOA 3SDJA 3CCVA 1U5KA 4GI3C 5EAYA 4A3EG 4JYAL 2R6GA 3S1MH 1X55A 2AWOA 2BA1A 2I5LX 3FKIG 2KBNA 4YY3Q 4LFBQ 1PCEA 1HH2P 3B6YA 3ULJA 4NV5A 2WCYA 1K0RA 1Q8KA 1VQBA 3F8TA 4YHHQ 2SGPI 5IYDG 2FNFX 1BBWA 4BXXG 2SGQI 2YUUA 3BJIA 4YY3L 3H15A 4LFBL 4SGBI 1WI5A 1N32Q 2K4KA 4DR1L 1OXVA 1WOCA 4DR3L 3W5OA 4AYBE 2YFBA 1Y1WH 2FXQA 4LWCA 1HNXL 3GTMH 2KMQA 2OTLA 3FBVA 1C7YA 2YTYA 3RU0A 1HDLA 1AE3A 3FHWA 2JA6G 3S14H 4FKDA 3CW2C 5JEAJ 1UWVA 1CGII 4JI2L 3VDYA 3RZDH 2VQFQ 1YO7A 1V1QA 1E3PA 3VA9A 4RMFA 1IL2A 2F4VL 4C3JH 4A3GG 4NV2A 3RN5A 2B63H 1M8BA 2A2DA 4JBJA 4DR6L 1IY5A 1E22A 1LR7A 2CWAA 3U4ZA 3JC66 4AIMA 2ALYB 2IHEA 4OX9Q 4A3LH 2KHJA 2HHHL 4YZDA 1GM5A 4JI3L 1FJGL 1S72A 4LUVA 2JA9A 1N34Q 1EYGA 3IAS1 3RR5A 3J81j 2MO0A 2BH8A 4DV2L 2UUCL 2WFWA 3S16H 2AHOB 1MIUA 3PV0A 4A3CG 3CMEA 4L5QA 4NXMQ 1KBEA 2PQAA 2D0OA 3FP9A 4DPGA 2XGTA 2CQOA 4JV5L 1AH9A 3OW2A 2ERWA 1BKBA 3J80i 2CAZB 3T1YQ 3U58A 4E1RA 3ER0A 4BA2I 2YQPA 3KF8B 4R4CA 4A3BH 1M1KC 1OTCA 1PJUA 4X66Q 3MEFA 4X65Q 1LUZA 3K80C 1XPRA 3T1YL 1M90C 1KQSA 3UEYA 1G51A 2DUDA 1K73C 1VQ8A 2QQCA 1HZAA 4GN5A 1PH6A 2W0TA 1FARA 3CCJA 3UDIA 3HOXH 2UXCQ 5FJ8H 1UVFA 2Z6KA 4QY7A 2LEOA 2B0UC 1N32L 1R79A 3JSBA 4O0AA 1PH5A 2JA5G 3J7A5 5JJKA 2N17A 2R92H 2NU0I 3S15H 1IBKL 3KLWA 5LMUL 1M8CA 2BH2A 3I4OA 3OXFA 1IYJB 5HI7A 3H0GH 1I5FA 2ORWA 4JOIA 5IP9H 1ASZA 5C44H 1IZ6A 1PV4A 2E5LL 1DGSA 1DS2I 3OXGA 1I50H 5IWAL 1PH9A 2JB2A 4RG1A 1KAWA 4PL5A 1S3OA 3AYHB 1L0WA 4A76A 3ULPA 1VQ4A 4B3MQ 3H3VH 2ENNA 1L1OB 1VS0A 3KF6B 4IJHA 1CKMA 4GNXA 2DGYA 1YJ9A 4JV5Q 3I4NH 2UU9Q 5FLXc 3CD6A 4IFDJ 1XA6A 1QZGA 5FUYA 2KCTA 1TWCH 2C35B 2R7FA 4HIDA 4UXIA 1K9MC 1Q46A 4OAVB 2F3IA 2VQEL 2Y0SE 4X64Q 5GAGC 1Z7KB 2NVXH 3ZJYC 4HJ9A 1RFHA 4X62Q 3BZCA 3I2ZA 4MTNA 3S2DH 4A3DG 4PZ7A 1LTLA 1NTGA 3J80c 3KOJA 3ERSX 1HZCA 4X64L 1NJIC 2ZM6Q 4OWWB 2F6MB 5M5YH 4C3IH 4X62L 2VNUD 3GTJH 3W1BA 3S1QH 4JI0Q 3U50C 1YHQA 4A3BG 2UXDQ 4POGA 4HGUA 2Q2TA 2JA7H 5C0XJ 2GVIA 3CC2A 1VQHA 4AQYQ 4DR5L 3GTQH 1EWIA 2N52A 1TURA 3CCEA 1HJAI 2UUBL 4JI0L 5IYCG 1Y1BA 3CCUA 2WP8J 2JZMA 1CSPA 1NMFA 4QIWE 3F2CA 4Y52H 4P73A 4YWLA 2KHIA 2HQLA 4OWTB 4DV6Q 3A5ZB 1BVSA 1V43A 5IP7H 1D7QA 3W1GA 1A8VA 1N9WA 4BA1I 2E2IH 3PCOB 2SGFI 2KENA 3PO2H 3OYYA 1VQKA 4P71A 2RIOA 1UVGA 4HEA1 4AH6A 5FLMH 4GKJQ 2CKZB 4GNXB 3L0IA 3S1RH 3GOXA 4UP9A 4UXHA 3E59A 5M3MG 2B8TA 1VQLA 3LJ2A 3IAM1 4PG3A 2K75A 1NE3A 3GTKH 1PH3A 1SMXA 1UE5A 1YHAA 1SROA 1XNRL 2XMXA 4KHZA 4Q9VA 4UP7A 2IX0A 2J9RA 4DR2Q 3F1ZA 2HT1A 4JC0A 5IP9G 1PH4A 2IP6A 4IPHA 3PO3H 5IYBG 4BBSH 3HFZB 2OQ0A 4A3JH 2V1CA 3HKZG 3PUWA 2K9HA 1VQFA 3JAMc 4JI1L 5C3EH 2ES2A 2QQEA 3MEKA 3TS2A 1IW4A 4DAMA 5HGQA 1FL0A 2HIVA 1VQJA 4H02A 4LF9L 2A20A 2F52A 4JI3Q 1FJGQ 1Y1CA 2GKTI 1MKHA 1N34L 3ULLA 2QEXA 1CSOI 2JEBI 2E5LQ 1KBFA 2SGEI 2JA1A 1PA6A 4B3TL 1X4SA 1KIXA 4KI0A 1I94L 2KKMA 1MJEA 3E2IA 1IY6A 2JA6H 2NU3I 1CT2I 5M3FG 2UUBQ 1KRSA 2YTXA 4A3DH 2XRCA 4AS3A 2NU1I 4DWLA 3EIVA 2K5HA 2L15A 3HOWG 1V1HA 3I9V1 4DV3L 4X65L 4K0KQ 3VDPA 3S24A 1IXRA 2AMCB 1EFWA 5J3BA 1N8RC 4JI7L 2A8VA 4A3GH 4R4IA 1OXTA 4POFA 4ALPA 3E9HA 1MT1A 4A3MH 3BU2A 4DV7Q 5GROA 1VQ5A 4LF4Q 4IOAA 1YEZA 4BBRG 5ELOA 2WAQG 3L7ZC 4OONA 3RN2A 1PFSA 4GKKQ 2I5MX 1YI2A 4B6DA 2ENZA 2ZTDA 3CCRA 1QZHA 2JE6I 3G6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O A;  3G48 A;  3AQQ A;  3G4S A;  1H95 A;  2LSS A;  4DR7 Q;  4IFD G;  4WJ4 A;  2R7D A;  4L5R C;  2JA8 G;  5M5X H;  1HNZ L;  1SFO H;  3CF5 A;  3RLF A;  4EX5 A;  3PIO A;  4A3L G;  1C0A A;  4R4Q A;  1EUJ A;  1YIJ A;  4YWK A;  1Q1E A;  4P75 A;  4APV A;  1KXL A;  1QUQ A;  2A19 A;  4OXP A;  4HIK A;  4J15 A;  1J5E Q;  3PF5 A;  2B3G A;  3GTP H;  1VQD A;  2NN6 G;  1XMO Q;  1Z47 A;  1HNX Q;  1JJC B;  1X56 A;  1J5E L;  4HJ7 A;  2YYZ A;  1XMO L;  4TVA B;  2NZO A;  1TWG H;  3M9B A;  3ICE A;  2E2H H;  3S17 H;  4L5S A;  4BY7 H;  1WCM H;  1VQA A;  2K14 A;  3I4M H;  1JJ2 A;  1EQR A;  2UUA L;  4LF6 L;  2PMZ E;  5C3E G;  3LGJ A;  4JG2 A;  2VQE Q;  3JAM i;  4QQB X;  3HOV G;  2PNH A;  2ZTC A;  4ME3 A;  4JBM A;  4JBW A;  5GAE C;  4DV1 L;  4NPS A;  1OXU A;  3GDE A;  5AJ3 L;  2EQS A;  1D8L A;  1BBU A;  2NZH A;  4LF4 L;  5C4X G;  4IJL A;  3PUZ A;  4C2M H;  1WJJ A;  5LMN L;  1XNR Q;  2H5X A;  1XPO A;  1VQ7 A;  4BY1 H;  4JI6 L;  3CXC A;  1SR3 A;  4DR5 Q;  3FKI H;  2RHQ B;  3PUV A;  4IOC A;  3NBH B;  4XTC S;  4R4T A;  4P72 A;  1VQE A;  3J81 c;  2IX1 A;  3PF4 A;  3I55 A;  5K36 G;  1QUQ B;  1XMQ Q;  1C9O A;  4DV0 L;  4QL5 A;  1I94 Q;  3CCL A;  4B3S L;  1V9P A;  1VQG A;  4LF8 L;  4FDB A;  3TS0 A;  3M4Q A;  4DR3 Q;  2ASB A;  4KLK A;  2R93 H;  3NEL A;  1YNX A;  5C0X G;  3K8A A;  4GN3 B;  1HR0 W;  3PIP A;  1B7Y B;  1PH7 A;  2ZTE A;  4NB3 A;  3HOZ H;  2PI2 A;  1GO3 E;  4NXN L;  3M4O H;  5GQO A;  1EQQ A;  4DUY L;  4DNI A;  1QVC A;  3A0J A;  1XJV A;  3CPW A;  4JI5 L;  2HIX A;  3H3V I;  1OXX K;  4GOP C;  1Y1W G;  2B63 G;  2NVQ H;  1PH1 A;  5HY6 A;  4MNO A;  4PMW A;  3I56 A;  2Z6K C;  5FLM G;  3TRE A;  4DR2 L;  2UXD L;  2WB1 G;  2RCN A;  4PZ6 A;  3F2D A;  4A3F H;  3MXN B;  4DV1 Q;  3UDX A;  3T1H L;  3KYH C;  4DV2 Q;  2UUC Q;  2MO1 A;  1HR0 Q;  5BR8 Q;  3M85 A;  2N3S A;  3A74 A;  4HJ5 A;  1LM0 A;  1VQI A;  4DR6 Q;  4IPG A;  2IHF A;  1E24 A;  1Q12 A;  2Z0S A;  1W2B A;  1CKO A;  4OX9 L;  1HJP A;  4GN4 B;  4EQ5 A;  4GLX A;  2WB1 E;  1EIF A;  1X3E A;  2GVB A;  4R1J A;  1SLJ A;  2K52 A;  1PYB A;  1A0I A;  1Y14 B;  4X66 L;  3OTO L;  4JI4 Q;  4LF5 L;  1N33 Q;  1VQM A;  2EXD A;  1JMC A;  4C3H H;  1EIY B;  2AKW B;  3SGI A;  3A5U A;  4JBK A;  3HOU H;  1WYD A;  1Y1V G;  3HOY G;  3EN2 A;  3NEN A;  1U0L A;  1K83 H;  3HOX G;  4LF5 Q;  1N33 L;  4KHP Q;  3Q8D A;  2MNA A;  2UXB L;  3K7U C;  3UDF A;  5ELN A;  4LNQ A;  1I6H H;  5GAH C;  4A4I A;  5IYB H;  1IBK Q;  3TEH B;  1PH2 A;  5M3F H;  1JE5 A;  2D62 A;  4HIO A;  5JJI A;  4HIM A;  3J81 i;  2ID0 A;  4IFD I;  4LF7 Q;  3HOW H;  4LFA L;  2OTJ A;  1QVG A;  1TWA H;  1UEB A;  4HJ8 A;  2WAQ E;  3D0F A;  3L0O A;  4Y7N H;  2JA5 H;  1O7I A;  1VQC A;  2IT1 A;  2VQF L;  4YCW A;  3RLO A;  2R93 G;  1YHB A;  4LFC L;  1KD1 C;  1Z9F A;  4P74 A;  2UU9 L;  3DLL A;  4A93 G;  3U4V A;  1NY4 A;  2NN6 I;  2E8G A;  1XPU A;  3HOZ G;  3RNU A;  1CSQ A;  2VY3 A;  4B3M L;  1GD7 A;  4A75 A;  5E7N A;  3UDG A;  3CCQ A;  4X6A H;  1X65 A;  2LXK A;  2PQA B;  1UE7 A;  1TXY A;  5IYD H;  1J6Q A;  4A3M G;  2NVT H;  4IPD A;  3CC4 A;  2K5N A;  3M7N A;  2ZJQ A;  4DR4 L;  3J7Z C;  4LF6 Q;  3M3Y H;  4A3F G;  1B8A A;  3KDF B;  1G6P A;  5DLQ E;  4O2D A;  4LF9 Q;  3S1N H;  4DR4 Q;  1L1O C;  3DM3 A;  1NMG A;  1G29 1;  5JEA G;  1YVC A;  1YJW A;  1Q81 C;  4TQU S;  1QVF A;  2VS1 A;  3GTO H;  1CKN B;  1SRU A;  1YJN A;  2D0P A;  5C4J H;  1HNW L;  1E1T A;  2UXB Q;  1MJC A;  4YWM A;  1X3G A;  4UP8 A;  4DV6 L;  1WCM G;  2N49 A;  4JOI C;  1PH8 A;  2VL6 A;  1RIP A;  1N36 Q;  1X6O A;  1Q82 C;  3WWV A;  1HNW Q;  3G71 A;  5LMN Q;  1GVP A;  2ZJR A;  1FGU A;  4DV3 Q;  1R9T H;  4DUZ L;  4YCU A;  1SN8 A;  1XNQ Q;  4JV5 L;  1Q1B A;  4GKJ L;  1W3S A;  4LUO A;  3HOU G;  5IYC H;  2GVA A;  4GLA C;  3PGZ A;  4GOP B;  1IBM L;  4LFA Q;  4LF7 L;  1K3R A;  4YHH L;  4A3C H;  4QGU A;  4IPC A;  1VQO A;  2VZA A;  5IP7 G;  1UE1 A;  3K7A H;  1XMQ L;  3D31 A;  3GD7 A;  2K50 A;  5GAD C;  3AFP A;  4GKK L;  3GTG H;  4JI8 L;  3CQZ H;  3UE1 A;  2N8N A;  2AWN A;  4DV4 L;  3CMA A;  3GTL H;  1AE2 A;  1X3F A;  2CCZ A;  1X54 A;  2R7Z G;  2I5H A;  4MZ9 A;  1HZB A;  3UE0 A;  1KC8 C;  2Q2U A;  1T9H A;  1VCI A;  4JI2 Q;  5LMN W;  4A3I G;  1WFQ A;  1IBL L;  1L2F A;  1TWH H;  3CCS A;  4DUY Q;  5AJ3 Q;  4A3K G;  2I0Q A;  2OCE A;  3F2B A;  1VQ9 A;  3I7F A;  5C4X H;  4JI5 Q;  1IBL Q;  4DKA C;  1E7Z A;  2RF4 A;  1CKN A;  5BR8 L;  5C0X I;  2ZM6 L;  1YIT A;  1YBY A;  4BY1 G;  2EIF A;  4A3J G;  1JT8 A;  1KL9 A;  3H0G G;  2JJQ A;  1KRT A;  2IY5 B;  4LW1 A;  3KJO A;  1HR0 L;  2Y0S G;  2HHH Q;  4JCV E;  4DK3 C;  2UUA Q;  4UY8 C;  1EOV A;  3AEV A;  4PZ8 A;  4WJ3 M;  1HZ9 A;  4OWX B;  3HKZ E;  4JI7 Q;  2CFM A;  2R92 G;  4GNX C;  2QA4 A;  4HJA A;  2YV5 A;  3AFQ A;  1TWF H;  1LYL A;  2OQK A;  3HKS A;  1PYS B;  1X9N A;  1XNQ L;  4KHP L;  3NEM A;  1GKH A;  1Q7Y C;  4DAY B;  1A62 A;  1ASY A;  1Q86 C;  3K0X A;  1PHJ A;  2LXJ A;  2VUM G;  3CPF A;  5C44 G;  1B70 B;  4DR1 Q;  2Q2I A;  4K0K L;  4A3E H;  4NXN Q;  3KFU A;  4B3R L;  3PSI A;  4LUZ A;  4OO1 I;  1JJG A;  3K81 C;  2JA8 H;  2ATW A;  1A63 A;  3STB D;  2BA0 A;  4BXX H;  3CAM A;  3RZO H;  2V1C C;  2NVY H;  5LMU Q;  3I4N G;  4BBR H;  2KCM A;  2PI2 E;  3CP0 A;  3E9I A;  3KF6 A;  4DV5 Q;  1RL2 A;  1I3Q H;  2Q2H A;  4QJF A;  2JA7 G;  4DV0 Q;  4B3S Q;  1P16 A;  5IY0 A;  3KJP A;  4DV5 L;  3T1H Q;  4JYA Q;  4LF8 Q;  3PUX A;  1VQP A;  1N36 L;  1S40 A;  1JB7 A;  1K8A C;  1VQ6 A;  3EBE A;  3TQY A;  4DK6 C;  4JI1 Q;  2MQH A;  3CCM A;  2JQO A;  1IBM Q;  3PUY A;  1VQN A;  3E0E A;  3KDF A;  4YCV A;  3L2P A;  4LFC Q;  2R7Z H;  3PO2 G;  2RHS B;  2B29 A;  2JEA I;  1FVI A;  2YTV A;  4UPA A;  5JJL A;  3OTO Q;  4JI4 L;  3CC7 A;  4A3I H;  4OO1 G;  1K8G A;  4B3T Q;  2A1A A;  3IRB A;  4JI8 Q;  5M5W H;  1Y1V H;  2QGQ A;  3HOY H;  3TRZ A;  4DV4 Q;  4A3K H;  1OXS C;  1UE6 A;  3GO5 A;  2VW9 A;  4BY7 G;  4R4O A;  1E1O A;  4XIG S;  5H1S E;  2E2J H;  2F4V Q;  1P8L A;  2MFI A;  3I4M G;  1XTD A;  1SE8 A;  2N78 A;  2ZJP A;  2UXC L;  2JK8 A;  4IO9 A;  4GOP A;  4AQY L;  3PO3 G;  3RLN A;  2GN5 A;  4DV7 L;  4BBS G;  3M4P A;  2K5V A;  3HOV H;  4B3R Q;  5M3M H;  4JI6 Q;  1KHI A;  5IT9 c;  4L5T A;  4DUZ Q;  4NXM L;  4GLV B;  1NBW A;  5IE8 A;  5FJ8 G;  4AYB G;  3BZK A;  2YU9 H;  2CWP A;  3STB C;  1YZ6 A;  5IWA Q;  4DR7 L;  3S2H H;  4GS3 A;  2XTI A;  4A93 H;  1CUK A;  2VUM H;  1HNZ Q;  2OWO A;  3CCV A;  1U5K A;  5EAY A;  4A3E G;  4JYA L;  2R6G A;  3S1M H;  1X55 A;  2AWO A;  2BA1 A;  2I5L X;  3FKI G;  2KBN A;  4YY3 Q;  4LFB Q;  1HH2 P;  3B6Y A;  3ULJ A;  1K0R A;  1Q8K A;  1VQB A;  3F8T A;  4YHH Q;  5IYD G;  1BBW A;  4BXX G;  4YY3 L;  3H15 A;  4LFB L;  1WI5 A;  1N32 Q;  2K4K A;  4DR1 L;  1OXV A;  1WOC A;  4DR3 L;  3W5O A;  4AYB E;  1Y1W H;  1HNX L;  2FXQ A;  4LWC A;  3GTM H;  2OTL A;  1C7Y A;  2YTY A;  1AE3 A;  3FHW A;  2JA6 G;  3S14 H;  3CW2 C;  5JEA J;  1UWV A;  4JI2 L;  3VDY A;  3RZD H;  2VQF Q;  1V1Q A;  1E3P A;  4RMF A;  1IL2 A;  2F4V L;  4C3J H;  4A3G G;  3RN5 A;  2B63 H;  4DR6 L;  4JBJ A;  1E22 A;  2CWA A;  3U4Z A;  3JC6 6;  4AIM A;  2ALY B;  2IHE A;  4OX9 Q;  4A3L H;  2KHJ A;  2HHH L;  1GM5 A;  4JI3 L;  1FJG L;  1S72 A;  4LUV A;  2JA9 A;  1N34 Q;  1EYG A;  4DV2 L;  3RR5 A;  3J81 j;  2MO0 A;  2BH8 A;  2UUC L;  3S16 H;  2WFW A;  2AHO B;  1MIU A;  3PV0 A;  4A3C G;  3CME A;  4L5Q A;  4NXM Q;  2PQA A;  2D0O A;  3FP9 A;  4DPG A;  2XGT A;  2CQO A;  1AH9 A;  3OW2 A;  1BKB A;  3J80 i;  3T1Y Q;  3U58 A;  3ER0 A;  4BA2 I;  3KF8 B;  4R4C A;  4A3B H;  1M1K C;  1OTC A;  4X66 Q;  3MEF A;  4X65 Q;  1LUZ A;  3K80 C;  1XPR A;  3T1Y L;  1M90 C;  1KQS A;  1G51 A;  2DUD A;  1K73 C;  1VQ8 A;  1HZA A;  4GN5 A;  1PH6 A;  3CCJ A;  3UDI A;  3HOX H;  2UXC Q;  5FJ8 H;  2Z6K A;  4QY7 A;  1N32 L;  4O0A A;  1PH5 A;  2JA5 G;  3J7A 5;  5JJK A;  2R92 H;  3S15 H;  1IBK L;  3KLW A;  5LMU L;  2BH2 A;  3I4O A;  1IYJ B;  3H0G H;  1I5F A;  4JOI A;  5IP9 H;  1ASZ A;  5C44 H;  1IZ6 A;  1PV4 A;  2E5L L;  1DGS A;  1I50 H;  5IWA L;  1PH9 A;  4RG1 A;  1L0W A;  1KAW A;  1S3O A;  3AYH B;  4A76 A;  3ULP A;  1VQ4 A;  4B3M Q;  3H3V H;  1L1O B;  1VS0 A;  3KF6 B;  4IJH A;  1CKM A;  4GNX A;  2DGY A;  1YJ9 A;  4JV5 Q;  3I4N H;  2UU9 Q;  5FLX c;  3CD6 A;  4IFD J;  1QZG A;  1TWC H;  2C35 B;  2KCT A;  2R7F A;  2JE6 I;  4HID A;  1K9M C;  1Q46 A;  2F3I A;  2VQE L;  2Y0S E;  4X64 Q;  5GAG C;  2NVX H;  3ZJY C;  4HJ9 A;  4X62 Q;  3BZC A;  3I2Z A;  4MTN A;  3S2D H;  4A3D G;  4PZ7 A;  1LTL A;  1NTG A;  3J80 c;  3KOJ A;  3ERS X;  1HZC A;  4X64 L;  1NJI C;  2ZM6 Q;  4OWW B;  5M5Y H;  4C3I H;  4X62 L;  2VNU D;  3GTJ H;  3W1B A;  3S1Q H;  4JI0 Q;  3U50 C;  1YHQ A;  4A3B G;  2UXD Q;  4POG A;  2Q2T A;  2JA7 H;  5C0X J;  3CC2 A;  1VQH A;  4AQY Q;  4DR5 L;  3GTQ H;  1EWI A;  3CCE A;  2UUB L;  4JI0 L;  5IYC G;  3CCU A;  2WP8 J;  1CSP A;  1NMF A;  4QIW E;  3F2C A;  4Y52 H;  4P73 A;  4YWL A;  2KHI A;  2HQL A;  4OWT B;  4DV6 Q;  3A5Z B;  1BVS A;  1V43 A;  5IP7 H;  1D7Q A;  3W1G A;  1A8V A;  1N9W A;  4BA1 I;  2E2I H;  3PCO B;  2KEN A;  3PO2 H;  3OYY A;  1VQK A;  4P71 A;  4AH6 A;  5FLM H;  4GKJ Q;  2CKZ B;  4GNX B;  3S1R H;  4UP9 A;  5M3M G;  1VQL A;  4PG3 A;  2K75 A;  1NE3 A;  3GTK H;  1PH3 A;  1SMX A;  1UE5 A;  1YHA A;  1SRO A;  1XNR L;  4KHZ A;  4UP7 A;  2IX0 A;  4DR2 Q;  3F1Z A;  2HT1 A;  4JC0 A;  5IP9 G;  1PH4 A;  4IPH A;  1PVO A;  3PO3 H;  5IYB G;  4BBS H;  3HFZ B;  2OQ0 A;  4A3J H;  3HKZ G;  3PUW A;  1VQF A;  3JAM c;  4JI1 L;  5C3E H;  2ES2 A;  3TS2 A;  4DAM A;  5HGQ A;  1FL0 A;  2HIV A;  1VQJ A;  4H02 A;  4LF9 L;  2F52 A;  4JI3 Q;  1FJG Q;  1MKH A;  1N34 L;  3ULL A;  2QEX A;  2JEB I;  2E5L Q;  1PA6 A;  4B3T L;  1KIX A;  4KI0 A;  1I94 L;  1MJE A;  2JA6 H;  5M3F G;  2UUB Q;  1KRS A;  2YTX A;  4A3D H;  3EIV A;  2K5H A;  2L15 A;  3HOW G;  4DV3 L;  4K0K Q;  4X65 L;  3S24 A;  1IXR A;  2AMC B;  1EFW A;  5J3B A;  1N8R C;  4JI7 L;  2A8V A;  4A3G H;  4R4I A;  1OXT A;  4POF A;  4ALP A;  3E9H A;  4A3M H;  3BU2 A;  4DV7 Q;  5GRO A;  1VQ5 A;  4LF4 Q;  4IOA A;  1YEZ A;  4BBR G;  5ELO A;  2WAQ G;  3L7Z C;  4OON A;  3RN2 A;  1PFS A;  4GKK Q;  2I5M X;  1YI2 A;  2ZTD A;  3CCR A;  1QZH A;  3BJU A;  3G6E A; 
#chains in the Genus database with same CATH topology
 1B9M A;  4CBV A;  3G48 A;  4UXJ A;  3AQQ A;  2E2J B;  1V1P A;  2LSS A;  4WJ4 A;  1CHO I;  2JA8 G;  3NTK A;  5M5X H;  1KDC A;  1SJE D;  1RF2 D;  1EIG A;  2KCN A;  3TJQ A;  1PTO C;  3M7G A;  4P75 A;  1KXL A;  4OXP A;  4CJ0 B;  1GUS A;  2B3G A;  5JOB A;  2K5D A;  3S15 B;  1J5E L;  4HTH A;  2J7Z A;  2EYP A;  4BY7 H;  4UHV A;  4PNY A;  4K8I A;  3DM1 A;  3I4M H;  1EU3 A;  4JG2 A;  2ENB A;  4JBM A;  1MJA A;  1YU6 C;  2QPO A;  2DNC A;  3GDE A;  5AJ3 L;  2NZH A;  1V1I A;  2OU2 A;  4CGY B;  1I6V C;  3NWS A;  3H09 A;  1OMU A;  3LJ1 A;  1PTO F;  2H5X A;  2WAC A;  5EQ0 A;  3CXC A;  5BN5 A;  5L37 A;  3H0G B;  3PUV A;  4XTC S;  5K36 G;  4R4T A;  1XMQ Q;  4B3S L;  4QL5 A;  1I4R A;  1V9P A;  4FDB A;  1YTP A;  1HR0 W;  2DY8 A;  3R5D A;  3PIP A;  3BVG A;  1B7Y B;  4A3I B;  2L7X A;  3TZD A;  1KLG D;  4DUY L;  1QVC A;  2NWG A;  3A0J A;  4S3S A;  3SE0 A;  2L1L B;  4XQQ A;  1OXX K;  2QEJ C;  1OYV I;  3U9S A;  3AU7 A;  2NVQ H;  1DCZ A;  1PH1 A;  4MNO A;  1FYB A;  2L4N A;  1G6Z A;  4PZ6 A;  1U4L A;  2JXD A;  1SE3 A;  4A3F H;  2N55 A;  3MXN B;  4R9W A;  3M85 A;  4HJ5 A;  1EYC A;  3VYR A;  4G75 A;  5J39 A;  5CV4 A;  4WJW A;  5JAV A;  1EIF A;  1QIL A;  3QIA A;  1XWE A;  3SVM A;  4ME5 A;  5KGU A;  2EXD A;  1JMC A;  3DEP A;  5IT9 L;  1CI3 M;  1EIY B;  4DNC A;  3SGI A;  4TKO B;  1WYD A;  5IGE A;  3HOY G;  3EN2 A;  3NEN A;  4LF5 Q;  1O78 A;  1N33 L;  4KHP Q;  4EQO A;  4PMB A;  2V53 A;  4MPI A;  1FAQ A;  5I4D A;  2QDB A;  4LNQ A;  1WGT A;  1PH2 A;  1DYQ A;  5M3F H;  5JJI A;  4OO1 H;  2ID0 A;  1AN1 I;  3D4R A;  3GP7 A;  4LF7 Q;  3HOW H;  3S16 B;  3BYT B;  2ROW A;  3GQB A;  3L0O A;  2XRQ D;  1O7I A;  2IT1 A;  2VQF L;  2R93 G;  4LFC L;  2G9H D;  2K7V A;  3DLL A;  3OMG A;  2E8G A;  1ENF A;  3KP9 A;  5A2Q L;  1ET6 A;  4IUT A;  4CJ2 C;  4ZLT F;  2O2L D;  3ITP A;  4R8I A;  2PQA B;  3Q6S A;  9WGA A;  5C44 B;  1GJX A;  4A3M G;  3G7L A;  4G7O C;  4IPD A;  5ELD A;  4DR4 L;  3PMF A;  4O1O A;  4Z7H A;  1RD9 D;  3KDF B;  1HHV A;  3MA2 B;  5JEA G;  1YVC A;  1B4O A;  3C2P A;  2D0P A;  1A2T A;  5CBE E;  2UXB Q;  4R8N A;  3NK9 A;  1VMP A;  1Q82 C;  1SGQ I;  4G76 A;  4Z7G A;  1R9T H;  2F0P A;  1BMO A;  3SK6 A;  1SN8 A;  4JV5 L;  2F0N A;  3I3C A;  4GOP B;  3PGZ A;  1FNW A;  2E2D C;  2NVX B;  2B8G A;  4QGU A;  4A3C H;  5HQ8 A;  1HDL A;  5IP7 G;  4XT1 B;  3K7A H;  4GKK L;  2R7Z B;  2K50 A;  5FO8 B;  3GTG H;  3M4Y A;  3UE1 A;  2N8N A;  1X3F A;  1SGN I;  1Z2I A;  1KC8 C;  2Z8L A;  2Q2U A;  2CJS C;  5C4H A;  4U67 3;  1QCB D;  4A3I G;  3S2D B;  1L2F A;  1TWH H;  1XTC D;  2OCE A;  3I7F A;  1A3U A;  1TBN A;  3DEO A;  5BR8 L;  5C0X I;  2K04 A;  4A3J G;  2K03 A;  1KL9 A;  1JT8 A;  1I4G A;  5M3F B;  2B2U C;  2IY5 B;  4IUU A;  1DZ1 A;  4LW1 A;  1E2V A;  2MHV A;  3SK8 A;  1RCV D;  4KN7 C;  3S2H B;  1C4Q A;  2Z4I A;  4OWX B;  1VF7 A;  4HJA A;  3AFQ A;  1A2U A;  1XNQ L;  4IUV A;  3NEM A;  1GKH A;  4DAY B;  1A62 A;  1ASY A;  1Q86 C;  3CPF A;  1B70 B;  3M3Y B;  3H94 A;  1CGJ I;  1G91 A;  1PFN A;  1PTQ A;  2JA8 H;  1A63 A;  4KMU C;  1KMA A;  2BA0 A;  1BBX C;  4CDD C;  5EGT A;  2NVY H;  5LMU Q;  3RZO H;  2L12 A;  3E9I A;  4DV5 Q;  1W4R A;  2FMC A;  1Q90 A;  2Q2H A;  3FVV A;  1A6X A;  1WTQ A;  4B3S Q;  1WVL A;  3PUX A;  1N13 A;  2A6E C;  3I4L A;  1X3Q A;  4JI1 Q;  4DK6 C;  1VQN A;  3N6R A;  1IBM Q;  5JHW C;  3E0E A;  2D5D A;  4LFC Q;  2RHS B;  1OMT A;  4CKB A;  2YTV A;  1Y8F A;  1F9S A;  4U68 A;  5CGK A;  1STY A;  1D1I A;  1JCK B;  2XRS D;  3FVQ A;  4K8J A;  5M5W H;  2CQA A;  3TRZ A;  4DV4 Q;  3HH2 C;  1V1O A;  3S1M B;  3GO5 A;  4R4O A;  1E1O A;  3G6J B;  4HFV A;  1LT3 D;  3QR8 A;  2K5W A;  2N78 A;  1Q3L A;  2FHT A;  2ZJP A;  1JR0 D;  4AQY L;  3RLN A;  4OAU C;  3HOV H;  4B3R Q;  5M3M H;  4JI6 Q;  1LAB A;  5ELF A;  1G8Z D;  5M5X B;  4NXM L;  2F66 B;  3OXL A;  1IYU A;  2F3C I;  5DM7 3;  1SYC A;  3Q0A A;  2VUM H;  1TBQ R;  1HNZ Q;  2OWO A;  3SDJ A;  4GI3 C;  3NUC A;  5EAY A;  4A3E G;  4JYA L;  5FLX L;  1X55 A;  2AWO A;  5E3P A;  4H7B A;  4LFB Q;  1PCE A;  3R2T A;  1Q8K A;  2SGP I;  1BBW A;  4BXX G;  2YUU A;  2PNR C;  2K4K A;  4DR3 L;  1OXV A;  1Y1W H;  3IAY A;  2NVT B;  1UAP A;  2OTL A;  2RC4 A;  5E3F A;  4V19 0;  2YTY A;  3RU0 A;  1EYA A;  1AE3 A;  4HMJ A;  3S14 H;  1CHQ D;  4JI2 L;  4NDX A;  3TN2 A;  1E3P A;  3I73 A;  4NV2 A;  3I91 A;  2Q8T A;  4DR6 L;  4AIM A;  3RZO B;  4IN3 A;  2KHJ A;  2HHH L;  4XQJ A;  3ZYY X;  3S1R B;  1LO5 D;  1GM5 A;  1FJG L;  1BCP D;  2JA9 A;  3S16 H;  1OVO A;  3J81 j;  1TS3 A;  2LFN A;  4J1M A;  1H9R A;  3PV0 A;  4KD4 A;  1EY9 A;  2QDL A;  4FXD A;  4NXM Q;  2QW7 A;  4L5Q A;  1KBE A;  4DPG A;  2XGT A;  2CQO A;  2CAZ B;  2O5J C;  3ER0 A;  5D65 A;  4BA2 I;  2YQP A;  3LWU A;  1M1K C;  1OTC A;  4X66 Q;  3ERQ A;  4C56 C;  2D2C C;  2A5H A;  2DUD A;  1SNC A;  2QQC A;  4GN5 A;  2JA6 B;  1EFI D;  3S1Q B;  5HGT A;  3TO6 A;  3UDI A;  2UXC Q;  1SE2 A;  2B0U C;  1N32 L;  5JJK A;  3VYT A;  4DK1 A;  1M8C A;  2BE5 C;  1Y8O B;  2BH2 A;  3I4O A;  1CQF A;  1IYJ B;  1I4H A;  1JWM D;  1BOS A;  2X6G A;  3J7A V;  1DGS A;  1DS2 I;  5IWA L;  1KAB A;  1L0W A;  2F0O A;  1VS0 A;  2AQ2 B;  4B9X A;  1CKM A;  4JK1 C;  2DGY A;  4F88 A;  3K57 A;  1YNN C;  4A3M B;  5I2X A;  2OF1 A;  3CQZ B;  3CD6 A;  2A6H D;  5FUY A;  1F2L A;  1XA6 A;  2A6E D;  2KCT A;  3R2I A;  2K1B A;  4DFA A;  4OAV B;  2F3I A;  2VQE L;  2B39 A;  1Z7K B;  3ZJY C;  3BZC A;  5EPJ A;  3KOJ A;  1ESF A;  3ERS X;  4X64 L;  2ZM6 Q;  1PRT F;  5M5Y H;  4X62 L;  2VNU D;  2B2Y A;  5FK9 C;  3FEW X;  2RDG A;  2GIV A;  1HQM C;  5C0X J;  4AQY Q;  4DR5 L;  1EWI A;  3CCE A;  4KHV A;  2JZM A;  4QIW E;  3F2C A;  4K6L A;  4P73 A;  4Y52 H;  4DV6 Q;  3A5Z B;  5IP7 H;  2WGC A;  1A8V A;  1N9W A;  2XVS A;  4BA1 I;  1FNU A;  2E2I H;  2KEN A;  5JVG 3;  1VQK A;  2UVO A;  1FYC A;  5E4W C;  5FLM H;  3GOX A;  3L0I A;  3S1R H;  3OHX C;  4UP9 A;  3BDC A;  3E59 A;  2B8T A;  2XN9 C;  4PG3 A;  1XXG A;  2KCC A;  1SMX A;  5EPK A;  1IYV A;  1SRO A;  4Q9V A;  3EJI A;  1KDA A;  1LT5 D;  4IPH A;  3PO3 H;  1ULK A;  4A3J H;  3HKZ G;  4JI1 L;  5D3I B;  2L55 A;  2GKT I;  2A20 A;  5M9O A;  1MKH A;  1MI2 A;  3KF8 A;  1KBF A;  2SGE I;  1PA6 A;  2JN4 A;  4CHT B;  4ZUI A;  1IY6 A;  1HQR D;  1QWY A;  2JA6 H;  3P7J A;  4A3D H;  1K7U A;  4AS3 A;  4DWL A;  4E6I A;  2L15 A;  3I9V 1;  3VDP A;  3BVM A;  5J3B A;  1N8R C;  3K5N A;  4BWG B;  4A3M H;  4H13 C;  1VQ5 A;  2RLD A;  1ZYR C;  1EY5 A;  1YEZ A;  3RN2 A;  2IWH A;  2I5M X;  3MXP A;  1YI2 A;  2B2V C;  3CCR A;  3TOB A;  4OL7 A;  3G4S A;  2L8E A;  1SYD A;  1S20 A;  4L5R C;  2VB2 X;  1STE A;  3RLF A;  3QOJ A;  3CF5 A;  3QTL D;  2E5R A;  1AN8 A;  4O42 A;  5C3X A;  3PIO A;  1C0A A;  1EUJ A;  5CBA E;  1YIJ A;  3MFG A;  1Q1E A;  2XSC A;  2A19 A;  1J5E Q;  5FUV A;  1K8M A;  1VQD A;  2M9V A;  3GTP H;  2NU4 I;  1K8O A;  3LWE A;  5EBC A;  5LNK 1;  4TVA B;  3ICE A;  1TWG H;  2E2H H;  2MPM A;  2FEF A;  4L5S A;  2K14 A;  5FLX E;  2B2T A;  1EQR A;  2UUA L;  4LF6 L;  2PMZ E;  3J7A F;  1D5X C;  1SYB A;  3LGJ A;  3LX0 A;  5ELE A;  4QQB X;  3UI2 A;  3QG1 A;  2SGD I;  3X3N A;  3OOC A;  4RCO A;  2E2I B;  1BBU A;  1ONL A;  4LF4 L;  1EU4 A;  4OEL B;  2A69 D;  4RWS C;  3W2D A;  1TIH A;  2HCC A;  2J87 A;  1VQ7 A;  4JI6 L;  4DR5 Q;  3SDZ A;  3SXH A;  1GUO A;  3UFF A;  4TSS A;  1B3A A;  2IX1 A;  2B2U A;  3FPP A;  3B55 A;  1MHW C;  1H0Z A;  3CCL A;  1TT2 A;  4B08 A;  4OVO A;  3E6Z X;  4LF8 L;  3O13 A;  3NEL A;  5BN3 A;  2NU2 I;  3K8A A;  4GN3 B;  2M5X A;  1PH7 A;  2ZTE A;  4NB3 A;  2PI2 A;  3M4O H;  2GA4 B;  5KIX A;  2PZT A;  1EQQ A;  2MJF B;  4DNI A;  3CPW A;  3EA6 A;  1EZ6 A;  3MAQ A;  2IJ0 A;  4GOP C;  2B63 G;  2EY5 A;  1SYE A;  3CRL C;  4PMW A;  3PDN A;  2Z6K C;  1HTL D;  5FLM G;  2WB1 G;  2MGS A;  3F2D A;  4MTK A;  1JC7 A;  4DV1 Q;  4U6R A;  3T4A C;  3T1H L;  2JA7 B;  3KYH C;  4RKL A;  2F3W A;  2N3S A;  1LM0 A;  1VQI A;  3J80 L;  2IHF A;  2Z0S A;  1STA A;  1HJP A;  4GN4 B;  1S5D D;  2WB1 E;  1PYB A;  1SSO A;  4X66 L;  3OTO L;  4JI4 Q;  1KLU D;  4C3H H;  3GV6 A;  1SMY D;  5CV5 A;  1LTR D;  4DK0 A;  3HOX G;  1SYG A;  2JB3 A;  1QNU A;  2B8F A;  2MNA A;  2UXB L;  3UDF A;  4JPB W;  3HOY B;  1STG A;  1IBK Q;  3HRZ C;  1UEA B;  1SGP I;  2JAE A;  1KAA A;  1SE4 A;  4HIO A;  1LR9 A;  2CWG A;  5A35 A;  4LFA L;  2OTJ A;  2FU2 A;  5C5M A;  4F7X A;  4ZYS A;  2YU9 B;  3D0F A;  2EY2 A;  1L0Y B;  4Y7N H;  2JA5 H;  2F0T A;  4G4K A;  1KD1 C;  1Z9F A;  4IAL A;  4ILW A;  2UU9 L;  4E1P A;  1HCZ A;  2NN6 I;  4DA2 A;  1XPU A;  4DNR B;  4N8X 1;  2BDO A;  3MFY A;  3PQI A;  2ZRR A;  5E7N A;  2R61 A;  4A75 A;  4CDF C;  3UDG A;  2F0K A;  2DY7 A;  2F0L A;  1CT4 I;  2KED A;  2ZJQ A;  3PIP 3;  2PQE A;  1X74 A;  4HAE A;  4A3F G;  3URY A;  1G6P A;  4FF4 A;  3F2U A;  5DLQ E;  4O2D A;  4LF9 Q;  3S1N H;  1L1O C;  1NMG A;  1QVF A;  2A73 B;  2GKR I;  1JQY D;  1SRU A;  2EPB A;  4PL4 A;  2HQE A;  4GZY C;  4YWM A;  4DV6 L;  3PO3 B;  2TSS A;  2VL6 A;  1TS4 A;  3WWV A;  5EX3 A;  3G71 A;  4HGU A;  5A2Q E;  1XNQ Q;  1TWG B;  1Q1B A;  2V6E A;  2M00 A;  1W3S A;  4LUO A;  4FXG C;  1E2W A;  1K3R A;  1NXU A;  3TO7 A;  3AFP A;  5HGI A;  4QB4 A;  3CQZ H;  2FJ2 A;  4PMC A;  4DV4 L;  3GTL H;  1AE2 A;  2O4X A;  2R7Z G;  5EKI A;  2I5H A;  4MZ9 A;  1HZB A;  2PPB C;  4EQN A;  4DXG A;  4JI2 Q;  4CDE C;  1WFQ A;  4DUY Q;  2KA7 A;  5DAE A;  3F2B A;  4OGQ C;  3TP5 A;  5C4X H;  1II3 A;  3QWP A;  2RF4 A;  2RAD A;  4IUN A;  3GTM B;  5C0X H;  1YBY A;  4BY1 G;  4MHE A;  3H0G G;  2EDG A;  2JJQ A;  3I72 A;  4F87 A;  1I4X A;  5C6A A;  3OSO A;  3KJO A;  1HR0 L;  4JCV E;  2UUA Q;  1TWA B;  4JW0 A;  2EYM A;  3UIT A;  3HKZ E;  4GNX C;  3VYS A;  2E73 A;  2N1A B;  2BL7 A;  5FUW A;  1NUC A;  2F3V A;  4K6D A;  1Q7Y C;  3FC3 A;  1CK1 A;  1XX6 A;  3U9O A;  1LR8 A;  5FUX A;  5C44 G;  3RZD B;  2Q2I A;  2N88 A;  4A3E H;  4B3R L;  5KND A;  3PSI A;  5J22 A;  1LAC A;  1HFN A;  3SEK C;  4BXX H;  3FPU B;  2EYL A;  3I4N G;  3KF6 A;  1ENA A;  1TOT A;  1I3Q H;  1ESR A;  4XXE A;  3H3V C;  1P16 A;  4HR7 B;  2G9D A;  3T1H Q;  4LK1 C;  2WVJ A;  1VQP A;  1N36 L;  1S40 A;  1JB7 A;  2ETD A;  3FDT A;  3L9A X;  2B2W C;  1TWF B;  3PUY A;  2JBW A;  1E2Z A;  3PO2 G;  2KUM A;  3RMH A;  1FVI A;  3A55 A;  5IGD A;  1ULM A;  1EY0 A;  1T5X D;  5JJL A;  4A3I H;  4B3T Q;  2A1A A;  3HOY H;  2QGQ A;  2Z1C A;  4A3K H;  3QJY A;  2VW9 A;  1X32 A;  1NCV A;  2OXP A;  4XIG S;  2E2J H;  3F4M A;  1P8L A;  3I4M G;  4QMG A;  1NAP A;  4WOR A;  3QWN A;  2UXC L;  1RJT A;  1XX8 A;  1TWC B;  4BBS G;  1PLF A;  1DM0 B;  1H9S B;  3M4P A;  2CVR A;  2MP1 A;  1FD7 D;  4B9W A;  5C4X B;  3UEJ A;  4AYB G;  1XBT A;  3BZK A;  4DR7 L;  1PTR A;  4P2C B;  2CW0 D;  4O1N A;  5G3L F;  3CCV A;  5TSS A;  3S1M H;  3T53 B;  4YY3 Q;  2WCY A;  2NVQ B;  4YHH Q;  5IYD G;  1ZEQ X;  4YY3 L;  4SGB I;  1YNJ C;  2TMP A;  1VDZ A;  3FBV A;  1C7Y A;  2KJX A;  2V4D A;  4DU9 A;  2QIL A;  3CW2 C;  3P1H A;  4ODG A;  5CV7 A;  5JEA J;  3VA5 A;  3T56 B;  3VDY A;  3RZD H;  2VQF Q;  3J81 E;  1FY7 A;  3VA9 A;  4BS9 A;  1EYD A;  1B2T A;  3RN5 A;  1H9S A;  2PYK A;  1GUN A;  4RGM A;  2EE1 A;  4QUF A;  1AZP A;  2R92 B;  4LUV A;  4JV5 Q;  4DV2 L;  2UUC L;  2BH8 A;  2WFW A;  2DJG C;  1T5E A;  5E4X A;  3CME A;  5D3D A;  2PQA A;  3D00 A;  3FP9 A;  2ERW A;  1SNP A;  1BKB A;  3T1Y Q;  4E1R A;  4UAI A;  2MJ8 A;  1DOL A;  3VR5 A;  4ULL A;  1RFH A;  1XPR A;  2B2T C;  2F0H A;  3TZU A;  1M90 C;  2A69 C;  3K59 A;  3I8Z A;  2KQ3 A;  1VQ8 A;  1HZA A;  2ZT9 C;  2F4I A;  1KDB A;  1MD2 D;  1PZK D;  1STH A;  5FJ8 H;  1MSG A;  4N8F A;  4QY7 A;  3S14 B;  4O0A A;  3J7A 5;  1IBK L;  4XYO A;  5EJW A;  2F0Q A;  3DWQ A;  5HI7 A;  1Z7T A;  4JOI A;  5IP9 H;  1IZ6 A;  1IKL A;  1PV4 A;  2JA8 B;  4ZRZ A;  3OXG A;  4RG1 A;  4B3M Q;  3AYH B;  2F0G A;  3ULP A;  3H3V H;  1L1O B;  3KF6 B;  4IJH A;  1V1P B;  4GNX A;  5IT9 E;  5FLX c;  4IFD J;  1TWC H;  2LKV A;  1O7Z A;  5CMD A;  4FF2 A;  1TU2 B;  3HP3 A;  2EZV A;  5GAG C;  2NVX H;  2JSO A;  3I2Z A;  4MTN A;  5K36 H;  2K32 A;  5EPL A;  4PZ7 A;  1HZC A;  4K5W A;  1R9T B;  3ERO A;  4C3I H;  1WD1 A;  4JI0 Q;  1BQQ T;  4POG A;  3PIO 3;  3BG3 A;  2JA7 H;  2UUB L;  1KNA A;  1TWH B;  1D7Q A;  3W1G A;  3C1E A;  4RGO S;  4LAA A;  1MJ9 A;  1BXT A;  2RIO A;  5J1Z A;  4HEA 1;  2RSN A;  1HA5 A;  3R8B A;  4AH6 A;  4DGZ A;  4GNX B;  4DAY A;  1X3P A;  1HFG A;  3NQT A;  4TRD A;  1SNO A;  4DAV A;  3LJ2 A;  3IAM 1;  2H4O A;  2PQ8 A;  2K75 A;  1NE3 A;  4ZKC B;  2M2L A;  3GTK H;  1PH3 A;  1ICF B;  1G2T A;  3HZX A;  4KHZ A;  5J8F A;  4DR2 Q;  2HT1 A;  3SEB A;  2IP6 A;  5IYB G;  1WTV A;  1HXY D;  4G57 A;  2V1C A;  3PUW A;  2K9H A;  1VQF A;  3MEK A;  4DAM A;  1XYI A;  4I7A A;  4H02 A;  2E76 C;  2F52 A;  1FJG Q;  1Y1C A;  1N34 L;  2QEX A;  3HKZ B;  1CSO I;  4ZCK A;  4NP5 A;  4B3T L;  3CKI B;  1K28 A;  1W6J A;  3BDO A;  4KI0 A;  5DM6 3;  2J0T D;  3OPO A;  5D14 A;  1F2Z A;  4A93 B;  2RKS A;  1B50 A;  3HOZ B;  3EIV A;  3MXN A;  1BCP B;  1QB5 D;  4X65 L;  4ABN A;  2CH4 A;  4C3J G;  1EFW A;  4R4I A;  1OXT A;  1Y8N B;  4DV7 Q;  2QF7 A;  1LTA D;  2RBM A;  1SXT A;  3DWA A;  4B6D A;  2JE6 I;  3VR6 A;  2HDM A;  1H95 A;  1F9R A;  4DR7 Q;  3R5B A;  4IFD G;  3NBI A;  4X3S A;  1HNZ L;  1IL8 A;  3E3X A;  1A15 A;  4DAP A;  4EX5 A;  2F0D A;  4A3L G;  4R4Q A;  2L9H A;  4YWK A;  3DXJ C;  1SGY I;  3H6M A;  2F0F A;  1QUQ A;  2F0I A;  5KEE A;  4J15 A;  4RGT A;  3PF5 A;  4KV6 A;  1PRT B;  1Z47 A;  1HNX Q;  3TBI B;  3HOW B;  1PTO D;  2KHS A;  1XMO L;  1JOR A;  1RKN A;  1ZKO A;  2EXZ A;  1NSN S;  2XWJ B;  3S17 H;  1WCM H;  1EQT A;  1PPF I;  3IL8 A;  5NUC A;  2F0V A;  1I50 B;  5EKL A;  1HPC A;  3CU7 A;  1TVX A;  1L0X B;  1HTP A;  1TBO A;  2NZ1 D;  2ZTC A;  4ME3 A;  4JBW A;  2OD1 A;  1VDD A;  3VDU A;  2EQS A;  1D8L A;  4ZKB B;  5FKA C;  5C4X G;  4C2M H;  4C1N I;  3R5A A;  1CFM A;  5LMN L;  3K58 A;  3J81 L;  1XNR Q;  3KBX A;  4FO2 A;  4BY1 H;  2BDN A;  3FKI H;  2RHQ B;  2ZW3 A;  1SGR I;  3P23 A;  3PF4 A;  3SR1 A;  2XIW A;  1QUQ B;  2IL8 A;  2EY6 A;  4L6T B;  2K6A A;  4K2L A;  3WOE A;  4DV0 L;  4C3I G;  1VQG A;  1LTT D;  3MC0 B;  3IKJ A;  4HSV A;  3J80 E;  3TS0 A;  4DR3 Q;  4KLK A;  4L63 B;  1DS3 I;  4AS2 A;  4QF4 A;  3HOZ H;  4XQN A;  1GO3 E;  2VRW B;  2RIJ A;  2FIN B;  1XJV A;  3SK5 A;  2HIX A;  1Y1W G;  2UXD L;  3TRE A;  5CV6 A;  2RCN A;  3OW7 A;  4FNF A;  3UDX A;  4DV2 Q;  2UUC Q;  2MO1 A;  1HR0 Q;  1SDF A;  4IPG A;  1E24 A;  1CKO A;  2R93 B;  3VE5 A;  1TS2 A;  3BZD B;  2RDF A;  4EQ5 A;  4I65 A;  4GLX A;  4OEM B;  3S9W A;  1A0I A;  4IUP A;  4LF5 L;  1N33 Q;  1P9Z A;  2XTQ A;  1GXD C;  3A5U A;  3HOU H;  4JBK A;  1SEB D;  1Y1V G;  1K83 H;  1H9K A;  3L3O C;  4KTA A;  5M5Y B;  3K7U C;  4KK7 A;  5IOC A;  1WGC A;  2BUS A;  1WTW A;  1EY4 A;  2RQX A;  5GAH C;  2L0C A;  4PQX A;  3C3L A;  4L9M A;  1S5C D;  4RHR A;  2D62 A;  4Q0F A;  4A3G B;  2KVM A;  3J81 i;  1S5B D;  4IFD I;  1EOT A;  5C3W A;  2WAQ E;  3NPP A;  2PO4 A;  4YCW A;  1YHB A;  2PW5 A;  3KBG A;  4C2M B;  1FR3 A;  3C46 A;  1SND A;  1S5E D;  3U4V A;  2L1B A;  1EZ8 A;  1CSQ A;  4YZ9 A;  3CCQ A;  1O7L A;  4X6A H;  1X65 A;  2VUM B;  3LJ0 A;  1UE7 A;  2ZXR A;  1AFP A;  2CH4 W;  2LUY A;  5IYD H;  4PL3 A;  1J6Q A;  4GXT A;  3CC4 A;  3OMC A;  2EYH A;  3M7N A;  3I70 A;  3NP8 A;  2DIP A;  3J7Z C;  2JXM B;  4LF6 Q;  3M3Y H;  1B8A A;  3FMC A;  3P20 A;  1SGD I;  4FF1 A;  1YJW A;  2K05 A;  3SGQ I;  1G29 1;  5LL6 X;  2VS1 A;  1CKN B;  2QZG A;  5CYU A;  1HNW L;  1E1T A;  4NMZ A;  1MJC A;  4UP8 A;  1WCM G;  1KNE A;  2BL8 A;  1CM9 A;  1N36 Q;  1X6O A;  1HNW Q;  1GVP A;  4DUZ L;  4YCU A;  2E2H B;  1BNZ A;  1CA5 A;  2OVO A;  3R5C A;  1JIC A;  4C1N K;  2GVA A;  4GLA C;  4LF7 L;  2Y0M A;  2ZXP A;  1STB A;  2VZA A;  1HPT A;  1MJB A;  1UE1 A;  5GAD C;  2LY7 A;  5AFW A;  3EFX D;  1D6E C;  4JI8 L;  1O7Y A;  4WP4 A;  3T13 A;  4RHS A;  2CCZ A;  4N9T A;  3VR4 A;  3NBH A;  1WKX A;  1T9H A;  1ET9 A;  5G3L D;  5KNB A;  1IBL L;  3CCS A;  1E0B A;  2FMM A;  4A3K G;  2I0Q A;  1VQ9 A;  4JI5 Q;  2XNA C;  1TY0 A;  3V2T A;  2WKD A;  2I46 A;  2ZXO A;  2NUC A;  1YIT A;  4DNT B;  2EIF A;  3OWE B;  2P22 B;  3AJF A;  1RHP A;  2LS0 1;  1KRT A;  3NTI A;  2Y0S G;  1W6K A;  2SEB D;  5ISR A;  1JE4 A;  4UY8 C;  3AEV A;  2NBF A;  4WJ3 M;  1HZ9 A;  1SJ8 A;  4JI7 Q;  2CFM A;  3TP6 A;  2EJG C;  4RCN A;  4ZUJ A;  1TWF H;  2OQK A;  2K5Q A;  1PYS B;  4KHP L;  2EY1 A;  2FUG 1;  2O5I C;  3K0X A;  1PHJ A;  3JAM E;  4FP5 D;  4K0K L;  3VYU A;  3KFU A;  2F0J A;  4OO1 I;  3T16 A;  1SGE I;  3DUZ A;  2P6A C;  2ATW A;  3DMU A;  4HMI A;  2P5Z X;  1B53 A;  3CAM A;  3KLR A;  2KCM A;  3CP0 A;  2C5C A;  1ZYR D;  1RL2 A;  4KKS A;  4QJF A;  2JA7 G;  4DV0 Q;  3A54 A;  5IY0 A;  5I2Y A;  4LF8 Q;  3OIP A;  3OVO A;  1YNN D;  1GUT A;  4KJO A;  1K8A C;  1VQ6 A;  3QB3 A;  5LHY 1;  5IGC A;  3MXG A;  3TQY A;  4AML A;  2MQH A;  3KDF A;  3L2P A;  2R7Z H;  3RUZ A;  2JYO A;  4A3E B;  2EJF C;  3FRP B;  3OTO Q;  4JI4 L;  3CC7 A;  4OO1 G;  1K8G A;  5E1F A;  2A68 D;  3SK4 A;  1DON A;  1UNS A;  3ND9 A;  3HOX B;  1PYW D;  1TDP A;  5LL6 S;  3K7A B;  5CC4 A;  2MFI A;  4FVM A;  1HUM A;  1EL0 A;  4GOP A;  4IO9 A;  5EKK A;  2PCF B;  2GN5 A;  1SMY C;  1EEF D;  2MUY A;  5IT9 c;  4L5T A;  1PTO H;  4DUZ Q;  4GLV B;  1NBW A;  5IE8 A;  5FJ8 G;  5FO9 B;  3GV3 A;  2CWP A;  3STB C;  2HDL A;  5IWA Q;  2YU9 H;  3S2H H;  2KMP A;  2G5D A;  5T1I A;  1CUK A;  4A93 H;  2GKV A;  1U5K A;  3TOA A;  1AW7 A;  1PXU A;  2I5L X;  1EEI D;  1HH2 P;  1GUG A;  3B6Y A;  4NV5 A;  4KN4 C;  1K0R A;  1VQB A;  3I90 A;  3Q23 A;  3CHB D;  2FNF X;  1DOM A;  2ICI A;  3H15 A;  3S17 B;  4LFB L;  1WI5 A;  2Q8R E;  3W5O A;  2YFB A;  4AYB E;  4LWC A;  2KMQ A;  4G7H C;  1WTJ A;  3MVV A;  3TP7 A;  3BVZ A;  2JA6 G;  3R93 A;  1YO7 A;  1V1Q A;  5F2D A;  1Y69 U;  1BCP C;  4A3G G;  1CHP D;  2B63 H;  1M8B A;  2A2D A;  4JBJ A;  4K5V A;  1C48 A;  1IY5 A;  5J8C A;  3KK7 A;  3A8J E;  2CWA A;  1BF4 A;  3JC6 6;  1WD0 A;  2ALY B;  2IHE A;  4A3L H;  4H44 C;  4IQZ A;  4JI3 L;  1PRT D;  1N34 Q;  3RR5 A;  2MO0 A;  2AHO B;  1MIU A;  1P9G A;  3NXW A;  5M5W B;  3HS0 C;  2JYY A;  1JWS D;  1CQV A;  2Y0S B;  3OW2 A;  3J80 i;  1PFM A;  1ZXT A;  3KF8 B;  4R4C A;  4X3K A;  1PJU A;  3K80 C;  3QAH A;  1KQS A;  1G51 A;  1K73 C;  1U4R A;  2J4X A;  3A8I E;  2NN6 H;  3I4M B;  2W0T A;  3CCJ A;  1UVF A;  3HOX H;  2Z6K A;  2LEO A;  1BDO A;  3JSB A;  1PH5 A;  2E74 C;  4WRD A;  2N17 A;  4NKL A;  2NU0 I;  3S15 H;  1LTG D;  2RDH A;  3NWT A;  5I9P A;  3H0G H;  3R3O A;  2E5L L;  4OHJ A;  5KNC A;  1K7V A;  1I50 H;  1PH9 A;  1K7T A;  1VQ4 A;  1KAW A;  1S3O A;  4AYB B;  1WTH A;  2ENN A;  2NB0 A;  3E5S A;  1PDQ A;  3OIQ A;  1YJ9 A;  1QZG A;  4A3D B;  2C35 B;  1K9M C;  2Z9H A;  4OIJ A;  4X64 Q;  4HJ9 A;  3EVQ A;  4X62 Q;  3NQI A;  1NTG A;  3J80 c;  2PW7 A;  1SFO B;  4OWW B;  5EBD A;  3AB9 A;  4KD3 A;  3W1B A;  3GTL B;  2C9O A;  4HCS A;  1YHQ A;  4A3B G;  2UXD Q;  3N52 A;  2Q2T A;  2IPK D;  1VQH A;  3CC2 A;  3GTP B;  1RTN A;  1NNX A;  1HJA I;  1TUR A;  1EY8 A;  1IW7 D;  1BO0 A;  5HUR A;  2WP8 J;  5DEH A;  1CSP A;  1NMF A;  1Z6H A;  1U4M A;  2HQL A;  1QJO A;  2K01 A;  5JJZ A;  1V43 A;  3GTK B;  2SGF I;  3PCO B;  1MBY A;  3PO2 H;  5I6Y A;  4X3U A;  1UVG A;  4M1U B;  2CKZ B;  3HOU B;  1WTX A;  1QNK A;  5M3M G;  3Q24 A;  5E3R A;  1VQL A;  3MXU A;  2BE5 D;  4RKB A;  1UE5 A;  1YHA A;  2XMX A;  2RCF A;  5T1G A;  2L11 A;  4KKT A;  3JAM L;  5IP9 G;  1PH4 A;  1V8Q A;  4BBS H;  1SJH D;  1R4Q B;  3HFZ B;  5C4Z A;  3HGB A;  3VR2 A;  2ES2 A;  1LLR D;  2VB3 X;  1IW4 A;  3TS2 A;  5HGQ A;  1FL0 A;  2HIV A;  4LF9 L;  2I07 B;  4CKE A;  1VMC A;  1J8I A;  5COR A;  2DN8 A;  2E5L Q;  1DOK A;  2JA1 A;  1I94 L;  2KKM A;  2RSO A;  2R3Z A;  2XRC A;  2DJF C;  1F2M A;  1KRS A;  2YTX A;  2NU1 I;  5COY A;  1SNQ A;  5JVH 3;  2K5H A;  2HCI A;  3A56 A;  4DV3 L;  4K0K Q;  4HN7 A;  1HA6 A;  4A3G H;  2AMC B;  4JI7 L;  1U4P A;  2NU3 I;  4POF A;  3E9H A;  2K33 A;  3BU2 A;  3NTH A;  4M8A A;  2WAQ G;  3L7Z C;  4OON A;  3UOE A;  2ENZ A;  2ZTD A;  2IX3 A;  1MJE A;  3BJU A;  3G6E A;  5JEA H;  1L1O A;  4KY5 A;  2R7D A;  3IFT A;  2PZW A;  1SFO H;  4A24 A;  4F8M A;  2RA4 A;  5DNF A;  2ORV A;  1I6H B;  1LV9 A;  4APV A;  1M4V A;  4HIK A;  5E3Q A;  4C3H B;  1LT4 D;  2NN6 G;  1XMO Q;  4I1T A;  3QOL A;  1JJC B;  1X56 A;  4HJ7 A;  2YYZ A;  3K5O A;  2NZO A;  3M9B A;  3TME A;  3DHQ A;  1VQA A;  3IFD A;  1JJ2 A;  1JWU D;  4YZC A;  2NVY B;  1LTB D;  4XYQ A;  5C3E G;  2VQE Q;  3JAM i;  1AEX A;  2EYJ A;  3LNN A;  1F9Q A;  2PNH A;  3HOV G;  3SGB I;  2X69 A;  2BCO A;  5GAE C;  4DV1 L;  1STN A;  1TY2 A;  4NPS A;  1OXU A;  2X52 A;  1ML0 D;  1A3T A;  2PMZ B;  4A3F B;  3HEJ A;  4IJL A;  5JPN C;  3PUZ A;  1WJJ A;  1Q8I A;  2F03 A;  2NYZ D;  2L5T A;  4QIW B;  1XPO A;  4A3B B;  5K5P A;  2KCX A;  1SR3 A;  2F1M A;  4A3J B;  3T51 B;  3NBH B;  4DN4 M;  3J81 c;  4P72 A;  1VQE A;  4IOC A;  3GTJ B;  3I55 A;  3GTO B;  1I94 Q;  2A2C A;  1C9O A;  2F0S A;  1SBB B;  1F9P A;  2AUJ D;  1D1K A;  2QKI C;  3M4Q A;  4ZK9 B;  2ASB A;  2R93 H;  2IW3 A;  1YNX A;  5C0X G;  1CZW A;  3FKI B;  4RFB A;  4NXN L;  5GQO A;  1B44 D;  4X3T A;  3CXL A;  3HG9 A;  4JI5 L;  3H3V I;  5EX0 A;  5HY6 A;  3I56 A;  1TR5 A;  4DR2 L;  2AQ3 B;  2WIN B;  3DO9 A;  2SNM A;  5BR8 Q;  2JB1 A;  3A74 A;  1JB3 A;  4DR6 Q;  3Q22 A;  1Q12 A;  3BDL A;  1W2B A;  4OX9 L;  4XDX A;  2B2W A;  1X3E A;  2GVB A;  4R1J A;  1SLJ A;  2K52 A;  2EOT A;  1B1Z A;  1Y14 B;  4FXK C;  1VQM A;  1HRJ A;  2AKW B;  1F77 A;  2YFA A;  2X3T A;  4IUQ A;  1U0L A;  2ODD A;  3OXF A;  3Q8D A;  3A7L A;  3OL0 A;  2B63 B;  5ELN A;  1I6H H;  1Y1V B;  1BUS A;  4A4I A;  5IYB H;  2QSB A;  3TEH B;  4KKU A;  2SDF A;  4CJ1 B;  1JE5 A;  3CRK C;  4HIM A;  2QGM A;  1I4P A;  1UUC A;  1PMR A;  2EVB A;  1QVG A;  1TWA H;  1UEB A;  4Z9C B;  2WV6 D;  4HJ8 A;  1VQC A;  3W3A A;  5CCM A;  3RLO A;  4J6H A;  4ZAI A;  5CCL A;  4P74 A;  2KMR A;  7WGA A;  4A93 G;  5I9O A;  1NY4 A;  3HOZ G;  3K5M A;  1DD2 A;  3RNU A;  2VY3 A;  3KLS A;  5ELB A;  1GD7 A;  4B3M L;  2LXK A;  3MWY W;  2HUG A;  3WOF A;  4ID6 A;  1TXY A;  2ARP F;  2HD3 A;  2NVT H;  1CZG A;  1MSH A;  1PZJ D;  1S4Z A;  1DXM A;  2K5N A;  1ILP A;  4HSP A;  1PTO B;  1C8C A;  2X6L A;  4KY7 A;  2B2V A;  2CWH A;  2QQD A;  1ULN A;  4DR4 Q;  3DM3 A;  1Q81 C;  4HED A;  4TQU S;  3GTO H;  2QQ0 A;  1B9N A;  2XTR A;  1YJN A;  4MIU A;  5C4J H;  3A8K E;  1X3G A;  2N49 A;  4JOI C;  1PH8 A;  4BBS B;  1R0R I;  2ELI A;  1RIP A;  3FSX A;  4V0B A;  3BS1 A;  4RAU C;  3D8G A;  2ZJR A;  1FGU A;  2Z6B A;  5LMN Q;  4DV3 Q;  1XNR L;  5I6W A;  1D5Z C;  4GKJ L;  3HOU G;  5IYC H;  1IBM L;  4LFA Q;  1U9R A;  1YNJ D;  3KY9 A;  4YHH L;  3K6O A;  4IPC A;  1VQO A;  1XMQ L;  1Q9B A;  3D31 A;  3GD7 A;  1QOH A;  3AMU A;  5DAU A;  3E0J A;  2AWN A;  3CMA A;  2K19 A;  4H0L C;  1X54 A;  1EWH A;  3B4V C;  3SHL A;  4J8Q A;  1QG7 A;  3UE0 A;  1VCI A;  1PFB A;  5LMN W;  1F2Y A;  2B2Y C;  2WAQ B;  1AP0 A;  4DF7 A;  2DNE A;  5AJ3 Q;  1TGS I;  3DA4 A;  2CWF A;  2KMO A;  1IBL Q;  1JOK A;  1E7Z A;  4DKA C;  2RVL A;  1CKN A;  5KYI A;  1SNM A;  2ZM6 L;  1LTI D;  4LJZ C;  3UGL A;  2H1E A;  2HHH Q;  4DK3 C;  1EOV A;  4PZ8 A;  2BOS A;  3ONA B;  1CT0 I;  2R92 G;  2EJM A;  3PO2 B;  3M4O B;  2QA4 A;  2YV5 A;  1LYL A;  2WKC A;  3HKS A;  1X9N A;  1I4Q A;  3RD4 A;  4RA8 A;  1G2S A;  2VUM G;  2LXJ A;  1R79 A;  4DR1 Q;  1O80 A;  4Q5V A;  1SAP A;  4NXN Q;  4K2K A;  4LUZ A;  2VXW A;  1IW7 C;  4CKC A;  1JJG A;  3K81 C;  4Y7N B;  5C3E B;  2JA5 B;  3UGD A;  2OEO A;  4IUR A;  2K28 A;  2AUK A;  5KYL A;  3STB D;  2V1C C;  5IIF A;  4BBR H;  1B3Q A;  2PI2 E;  1GUW A;  3MHB A;  4EQP A;  1H9M A;  1TBR R;  4C3H G;  3KJP A;  4DV5 L;  4JYA Q;  5C5L A;  1PZI D;  1WCM B;  3EBE A;  4QUC A;  2UZ3 A;  1EY7 A;  1J9O A;  3CCM A;  2JQO A;  5KRU A;  4WFN 3;  4XT3 B;  4YCV A;  1K83 B;  2B29 A;  2JEA I;  2FFK B;  3DA3 A;  4UPA A;  1TQO A;  2KEE A;  2DKV A;  2LB7 A;  3IRB A;  4JI8 Q;  4O1P A;  3HOV B;  1Y1V H;  4FYD A;  2KOL A;  1OXS C;  1UE6 A;  4BBR B;  5BN4 A;  4BY7 G;  2QCP X;  5H1S E;  2F4V Q;  2EYF A;  2N71 A;  2A6H C;  4JVZ A;  3V96 A;  5IOD A;  2JW6 A;  1XTD A;  2DB6 A;  2Q8I B;  4I7Z C;  1SE8 A;  1FNV A;  1D5M C;  2JK8 A;  3PO3 G;  4DV7 L;  2K5V A;  3BYY B;  3FNB A;  1KHI A;  4KY6 A;  1GHK A;  1NUB A;  2AQ1 B;  3ND8 A;  1M8A A;  1UHA A;  1TUS A;  3QO2 A;  1DJR D;  3TSS A;  3K0Y A;  3UGI A;  4K14 A;  4HCE A;  3V05 A;  1YZ6 A;  4YIJ A;  4GS3 A;  2XTI A;  4N9P A;  2HGK A;  2R6G A;  4NW2 A;  1WTO A;  2BA1 A;  3FKI G;  2KBN A;  3MTS A;  3ULJ A;  4FF3 A;  1ICW A;  3F8T A;  2GSC A;  2CHB D;  3BJI A;  1NR2 A;  2SGQ I;  1BR9 A;  3K5L A;  1N32 Q;  4DR1 L;  1WOC A;  1HNX L;  1SYF A;  5ELC A;  3GTM H;  2FXQ A;  1S5F D;  2KEC A;  5C4J B;  1AZQ A;  1HUN A;  3FHW A;  5IGB A;  5CR3 A;  4FKD A;  1FGB D;  1UWV A;  1CGI I;  3TO9 A;  3A7A B;  2XWB B;  1CT1 D;  4BY1 B;  1JQO A;  1A3V A;  4L8J A;  4RMF A;  1IL2 A;  2F4V L;  4C3J H;  3MZ5 A;  1RTO A;  1IKM A;  1E22 A;  1K3B C;  1LR7 A;  2NTT A;  3D3R A;  4RGN A;  3U4Z A;  4OX9 Q;  1LTS D;  3D6W A;  3GTQ B;  1QE6 A;  4PV1 C;  1R4P B;  4YZD A;  3GTG B;  1S72 A;  4A3B H;  1EYG A;  3IAS 1;  1TKW B;  4A3C G;  2NTS A;  3KUP A;  1RDP D;  2D0O A;  2F0W A;  4IFD H;  1AH9 A;  5IGF A;  5CV9 A;  3X3M A;  3U58 A;  1VF5 C;  1BUV T;  4K5X A;  4RH6 A;  5IGG A;  3MEF A;  4X65 Q;  3P75 A;  1LUZ A;  3T1Y L;  1GHJ A;  3C1F A;  3UEY A;  2D9U A;  3I4N B;  1CTM A;  4C3J B;  1OO9 B;  3DWP A;  4DXF A;  1PH6 A;  1FAR A;  4A3K B;  1NR4 A;  5CV8 A;  2JA5 G;  3KLS X;  3NSW A;  4ZQ3 A;  2R92 H;  4QCL A;  3EQL C;  3KLW A;  5LMU L;  4G7Z C;  4CDC C;  1I5F A;  2ORW A;  1ASZ A;  1TS5 A;  5C44 H;  2EYO A;  3TP8 A;  2JB2 A;  4A76 A;  4PL5 A;  2ICE C;  2A68 C;  1ENC A;  3I4N H;  2UU9 Q;  1UUP A;  4OIK A;  2R7F A;  4EVO A;  4HID A;  4UXI A;  1EQV A;  1Q46 A;  3D6C A;  2Y0S E;  1WTP A;  2F0U A;  4A3D G;  3S2D H;  1LTL A;  1MGS A;  4EGV A;  1NJI C;  2F6M B;  1HEV A;  4BY7 B;  3GTJ H;  1ROD A;  3S1Q H;  2OT2 A;  1JOQ A;  3U50 C;  1GOZ A;  2GVI A;  2JP1 A;  3GTQ H;  2N52 A;  2WB1 B;  4JI0 L;  5IYC G;  1Y1B A;  1JOO A;  3CCU A;  1WTR A;  3H91 A;  5FOB B;  1EIH A;  4YWL A;  2KHI A;  4OWT B;  3S1N B;  1BVS A;  4LMQ D;  3J7Y W;  5JPM C;  4UDU C;  3OYY A;  4P71 A;  4GKJ Q;  2SOB A;  3NE5 B;  1KTK A;  4IZ8 A;  4UXH A;  3VA7 A;  2CW0 C;  3NHH A;  1EY6 A;  2A74 C;  4C3I B;  1ILQ A;  1IHZ A;  2F0E A;  5M3M B;  3D4D A;  1BCP F;  4UP7 A;  2IX0 A;  2J9R A;  3F1Z A;  1PVO A;  4JC0 A;  1CE3 A;  1EWC A;  2OQ0 A;  3OWF A;  2Z4H A;  1CA6 A;  3WDN A;  2OZU A;  3MEH A;  2WII B;  2QQE A;  2SNS A;  3JAM c;  1PRT C;  5C3E H;  1Y1W B;  1VQJ A;  4JI3 Q;  1D2B A;  3ULL A;  2F0M A;  2JEB I;  1TII D;  1I3Q B;  1X4S A;  4KJN A;  1KIX A;  3E2I A;  2E75 C;  3TDQ A;  2PZU A;  1CT2 I;  5M3F G;  2UUB Q;  1K0S A;  3HOW G;  1V1H A;  1H9J A;  3S24 A;  1IXR A;  2A8V A;  1Y8P B;  4ALP A;  1MT1 A;  1LT6 D;  5GRO A;  4LF4 Q;  3D4W A;  4IOA A;  4BBR G;  5ELO A;  4GKK Q;  1PFS A;  3VR3 A;  5FO7 B;  4MN3 A;  3FSY A;  1QZH A;  2LMC B; 
#chains in the Genus database with same CATH homology
 1L1O A;  3G48 A;  3AQQ A;  3G4S A;  1H95 A;  2L8E A;  4UXJ A;  2LSS A;  4DR7 Q;  4IFD G;  4WJ4 A;  2R7D A;  1CHO I;  4L5R C;  2JA8 G;  5M5X H;  1HNZ L;  1SFO H;  3CF5 A;  3RLF A;  3QTL D;  4A24 A;  2E5R A;  4EX5 A;  3PIO A;  4A3L G;  1C0A A;  3TJQ A;  4R4Q A;  1EUJ A;  1YIJ A;  4YWK A;  2ORV A;  1Q1E A;  4P75 A;  4APV A;  1SGY I;  1KXL A;  1QUQ A;  2A19 A;  4OXP A;  4HIK A;  4J15 A;  1J5E Q;  3PF5 A;  1BMO A;  2B3G A;  5FUV A;  3GTP H;  1VQD A;  2NN6 G;  1XMO Q;  4I1T A;  2JYY A;  2NU4 I;  1Z47 A;  1HNX Q;  1JJC B;  1X56 A;  1J5E L;  4HJ7 A;  2YYZ A;  5LNK 1;  4TVA B;  2NZO A;  1TWG H;  3M9B A;  1XMO L;  2E2H H;  3ICE A;  4L5S A;  3S17 H;  1WCM H;  1VQA A;  1PPF I;  2K14 A;  3I4M H;  1JJ2 A;  4YZC A;  1EQR A;  2UUA L;  4LF6 L;  2PMZ E;  5C3E G;  3LGJ A;  4JG2 A;  2VQE Q;  3JAM i;  4QQB X;  1TBO A;  3HOV G;  2PNH A;  3SGB I;  2ZTC A;  4ME3 A;  4JBM A;  2SGD I;  4JBW A;  5GAE C;  4DV1 L;  2OD1 A;  4NPS A;  1YU6 C;  2QPO A;  1VDD A;  1OXU A;  3GDE A;  5AJ3 L;  2EQS A;  3VDU A;  1D8L A;  1BBU A;  2NZH A;  1V1I A;  4LF4 L;  5C4X G;  4IJL A;  3PUZ A;  4C2M H;  1WJJ A;  5LMN L;  1XNR Q;  1OMU A;  3LJ1 A;  1TIH A;  2H5X A;  1XPO A;  1VQ7 A;  4BY1 H;  4JI6 L;  3CXC A;  1SR3 A;  4DR5 Q;  2J87 A;  2KCX A;  3FKI H;  2RHQ B;  3PUV A;  3UFF A;  4IOC A;  3NBH B;  4XTC S;  4R4T A;  4P72 A;  1VQE A;  3J81 c;  2IX1 A;  3P23 A;  3I55 A;  3PF4 A;  1SGR I;  1QUQ B;  1XMQ Q;  2A2C A;  1C9O A;  4QL5 A;  4DV0 L;  1I94 Q;  3CCL A;  4B3S L;  4OVO A;  1H0Z A;  4BY7 H;  1V9P A;  1VQG A;  4LF8 L;  4FDB A;  3TS0 A;  3M4Q A;  4DR3 Q;  1YTP A;  2ASB A;  4KLK A;  2R93 H;  3NEL A;  1YNX A;  5C0X G;  2NU2 I;  3K8A A;  4GN3 B;  1HR0 W;  1DS3 I;  4AS2 A;  3PIP A;  2M5X A;  1B7Y B;  1PH7 A;  2ZTE A;  2L7X A;  4NB3 A;  3HOZ H;  2PI2 A;  1GO3 E;  4NXN L;  3M4O H;  2VRW B;  5GQO A;  1EQQ A;  4DUY L;  2MJF B;  4DNI A;  1QVC A;  3A0J A;  1XJV A;  3CPW A;  2L1L B;  2HIX A;  4JI5 L;  3H3V I;  3CXL A;  1OXX K;  4GOP C;  1Y1W G;  2B63 G;  1OYV I;  2NVQ H;  5EX0 A;  1PH1 A;  5HY6 A;  4MNO A;  4PMW A;  3I56 A;  2Z6K C;  5FLM G;  3TRE A;  4DR2 L;  2UXD L;  3PDN A;  1FYB A;  2WB1 G;  2RCN A;  4PZ6 A;  3DO9 A;  3F2D A;  2JXD A;  4A3F H;  3MXN B;  4DV1 Q;  4U6R A;  3OVO A;  3UDX A;  3T1H L;  3KYH C;  4DV2 Q;  2UUC Q;  2MO1 A;  1HR0 Q;  5BR8 Q;  3M85 A;  2JB1 A;  2N3S A;  3A74 A;  4HJ5 A;  1LM0 A;  1VQI A;  4DR6 Q;  4IPG A;  2IHF A;  1E24 A;  1Q12 A;  2Z0S A;  1W2B A;  1CKO A;  5K36 G;  4OX9 L;  3VE5 A;  1HJP A;  4GN4 B;  4EQ5 A;  4G75 A;  4GLX A;  2WB1 E;  1EIF A;  1X3E A;  2GVB A;  4R1J A;  1SLJ A;  2K52 A;  1PYB A;  1A0I A;  1Y14 B;  4X66 L;  3OTO L;  4JI4 Q;  4LF5 L;  1N33 Q;  1VQM A;  2EXD A;  1JMC A;  2XTQ A;  4C3H H;  2AKW B;  1EIY B;  3SGI A;  3A5U A;  4JBK A;  2YFA A;  3HOU H;  1WYD A;  1Y1V G;  3HOY G;  3EN2 A;  3NEN A;  1U0L A;  1K83 H;  3HOX G;  4LF5 Q;  2JB3 A;  1N33 L;  4KHP Q;  2ODD A;  3Q8D A;  2V53 A;  2MNA A;  2UXB L;  3OL0 A;  1FAQ A;  3K7U C;  3UDF A;  2BUS A;  5ELN A;  4LNQ A;  1I6H H;  5GAH C;  1BUS A;  4A4I A;  5IYB H;  1IBK Q;  4L9M A;  3TEH B;  1PH2 A;  1SGP I;  5M3F H;  1JE5 A;  2D62 A;  2JAE A;  4HIO A;  5JJI A;  4HIM A;  3J81 i;  2ID0 A;  1AN1 I;  1LR9 A;  4IFD I;  4LF7 Q;  3HOW H;  4LFA L;  2OTJ A;  1UUC A;  2ROW A;  1QVG A;  1TWA H;  1UEB A;  4HJ8 A;  2WAQ E;  3D0F A;  3L0O A;  4Y7N H;  2JA5 H;  1O7I A;  1VQC A;  2IT1 A;  2VQF L;  4YCW A;  5CCM A;  3RLO A;  2R93 G;  1YHB A;  4LFC L;  5CCL A;  1KD1 C;  1Z9F A;  4P74 A;  2KMR A;  2UU9 L;  3DLL A;  4A93 G;  4E1P A;  3U4V A;  1NY4 A;  2NN6 I;  2E8G A;  1XPU A;  3HOZ G;  3RNU A;  1CSQ A;  2VY3 A;  3KP9 A;  1GD7 A;  4A75 A;  4B3M L;  2ZRR A;  5E7N A;  3UDG A;  3FC3 A;  4YZ9 A;  3CCQ A;  4X6A H;  1X65 A;  2PQA B;  2LXK A;  3LJ0 A;  1UE7 A;  2LUY A;  1TXY A;  5IYD H;  2ARP F;  4PL3 A;  1J6Q A;  4A3M G;  2NVT H;  1CT4 I;  4IPD A;  4GXT A;  3CC4 A;  5FUX A;  2K5N A;  3M7N A;  2ZJQ A;  4DR4 L;  2DIP A;  3J7Z C;  4O1O A;  1X74 A;  4LF6 Q;  4Z7H A;  3M3Y H;  4A3F G;  1B8A A;  3KDF B;  1G6P A;  5DLQ E;  4O2D A;  4LF9 Q;  3S1N H;  1SGD I;  2QQD A;  4DR4 Q;  1L1O C;  3DM3 A;  1NMG A;  1G29 1;  5JEA G;  1YVC A;  3BJU A;  1YJW A;  1Q81 C;  3SGQ I;  4TQU S;  1QVF A;  2VS1 A;  3GTO H;  2QQ0 A;  2GKR I;  1CKN B;  2XTR A;  1SRU A;  1YJN A;  2D0P A;  4PL4 A;  5C4J H;  1E1T A;  1HNW L;  2UXB Q;  1MJC A;  4YWM A;  1X3G A;  4UP8 A;  4DV6 L;  1WCM G;  2N49 A;  4JOI C;  1PH8 A;  1R0R I;  2VL6 A;  1RIP A;  1N36 Q;  2ELI A;  1X6O A;  1Q82 C;  3WWV A;  1HNW Q;  3G71 A;  1SGQ I;  4G76 A;  4Z7G A;  5LMN Q;  1GVP A;  2ZJR A;  1FGU A;  4DV3 Q;  1R9T H;  4DUZ L;  4YCU A;  1SN8 A;  1XNQ Q;  2VUM G;  1Q1B A;  2V6E A;  4GKJ L;  1W3S A;  4LUO A;  3HOU G;  5IYC H;  2GVA A;  4GLA C;  3PGZ A;  4GOP B;  1IBM L;  4LFA Q;  4LF7 L;  1K3R A;  3KY9 A;  4YHH L;  4A3C H;  4QGU A;  4IPC A;  1VQO A;  2VZA A;  1HPT A;  5HQ8 A;  5IP7 G;  1UE1 A;  3K7A H;  1XMQ L;  3D31 A;  3GD7 A;  2K50 A;  5GAD C;  3AFP A;  4GKK L;  3GTG H;  5HGI A;  4JI8 L;  3CQZ H;  3UE1 A;  2N8N A;  2AWN A;  4DV4 L;  3CMA A;  3GTL H;  2K19 A;  1AE2 A;  1X3F A;  1X54 A;  2CCZ A;  2R7Z G;  2I5H A;  4MZ9 A;  1HZB A;  1SGN I;  3B4V C;  3UE0 A;  1KC8 C;  2Q2U A;  1T9H A;  1VCI A;  4JI2 Q;  2CJS C;  5LMN W;  4A3I G;  1WFQ A;  1IBL L;  1L2F A;  1TWH H;  3CCS A;  4DUY Q;  5AJ3 Q;  1TGS I;  5DAE A;  4A3K G;  2I0Q A;  2OCE A;  3DA4 A;  3F2B A;  3I7F A;  5C4X H;  1VQ9 A;  4JI5 Q;  2KMO A;  1IBL Q;  4DKA C;  1E7Z A;  1TBN A;  3QWP A;  1XX6 A;  2RF4 A;  1CKN A;  5BR8 L;  5C0X I;  2ZM6 L;  1YIT A;  1YBY A;  4BY1 G;  2EIF A;  4A3J G;  1JT8 A;  1KL9 A;  2P22 B;  3AJF A;  3H0G G;  2JJQ A;  1KRT A;  2IY5 B;  4LW1 A;  3KJO A;  1HR0 L;  3UGL A;  2Y0S G;  2HHH Q;  4JCV E;  4DK3 C;  2UUA Q;  4UY8 C;  1EOV A;  3AEV A;  4PZ8 A;  4WJ3 M;  1HZ9 A;  1SJ8 A;  3UIT A;  3HKZ E;  2CFM A;  4OWX B;  4JI7 Q;  2R92 G;  4GNX C;  1CT0 I;  2E73 A;  2QA4 A;  2N1A B;  4HJA A;  2YV5 A;  3AFQ A;  1TWF H;  1LYL A;  2OQK A;  3HKS A;  1PYS B;  1X9N A;  1XNQ L;  4KHP L;  5FUW A;  3NEM A;  1GKH A;  1Q7Y C;  2FUG 1;  1A62 A;  4DAY B;  1Q86 C;  3K0X A;  1PHJ A;  2LXJ A;  1ASY A;  3CPF A;  5C44 G;  1B70 B;  4DR1 Q;  1LR8 A;  2Q2I A;  4K0K L;  4A3E H;  4NXN Q;  3KFU A;  4B3R L;  1CGJ I;  3PSI A;  4LUZ A;  4OO1 I;  1SGE I;  1JJG A;  3K81 C;  3UGD A;  1PTQ A;  2JA8 H;  2ATW A;  2P6A C;  3D00 A;  1A63 A;  1KMA A;  3STB D;  2BA0 A;  4BXX H;  3CAM A;  3RZO H;  2V1C C;  2NVY H;  5LMU Q;  3SEK C;  3I4N G;  4BBR H;  2KCM A;  2PI2 E;  3CP0 A;  3E9I A;  3KF6 A;  4DV5 Q;  1W4R A;  1TOT A;  1RL2 A;  1I3Q H;  2Q2H A;  1TBR R;  4QJF A;  2JA7 G;  4DV0 Q;  4B3S Q;  1P16 A;  5IY0 A;  3KJP A;  4DV5 L;  3T1H Q;  4JYA Q;  2WVJ A;  4LF8 Q;  1OVO A;  3PUX A;  1VQP A;  1N36 L;  1N13 A;  1S40 A;  1JB7 A;  1K8A C;  1VQ6 A;  3EBE A;  2OVO A;  2UZ3 A;  3TQY A;  4DK6 C;  4JI1 Q;  2MQH A;  3CCM A;  2JQO A;  1IBM Q;  3PUY A;  1VQN A;  5JHW C;  3E0E A;  3KDF A;  4YCV A;  3L2P A;  4LFC Q;  2R7Z H;  3PO2 G;  2RHS B;  2B29 A;  2JEA I;  1OMT A;  1FVI A;  2YTV A;  3DA3 A;  4UPA A;  1Y8F A;  5JJL A;  3OTO Q;  4JI4 L;  3CC7 A;  4A3I H;  4OO1 G;  1K8G A;  4B3T Q;  2A1A A;  3IRB A;  4JI8 Q;  4O1P A;  5M5W H;  1Y1V H;  2QGQ A;  3HOY H;  3TRZ A;  4DV4 Q;  4A3K H;  3HH2 C;  1OXS C;  1UE6 A;  1CE3 A;  3GO5 A;  2VW9 A;  1PVO A;  4BY7 G;  4R4O A;  1E1O A;  4XIG S;  5H1S E;  2E2J H;  2F4V Q;  3F4M A;  2N71 A;  2JW6 A;  1P8L A;  4HFV A;  2MFI A;  3I4M G;  1XTD A;  2DB6 A;  1SE8 A;  5EX3 A;  2N78 A;  2ZJP A;  2UXC L;  2JK8 A;  4IO9 A;  4GOP A;  4AQY L;  3PO3 G;  3RLN A;  2GN5 A;  4OAU C;  4DV7 L;  4BBS G;  3M4P A;  2K5V A;  3HOV H;  4B3R Q;  5M3M H;  4JI6 Q;  1KHI A;  1NUB A;  5IT9 c;  1TUS A;  4L5T A;  4DUZ Q;  4NXM L;  4GLV B;  2F66 B;  1NBW A;  5IE8 A;  3OXL A;  5FJ8 G;  2F3C I;  3UEJ A;  3UGI A;  4AYB G;  1XBT A;  3BZK A;  2YU9 H;  2CWP A;  3STB C;  1YZ6 A;  5IWA Q;  4DR7 L;  3S2H H;  1PTR A;  4GS3 A;  2XTI A;  4A93 H;  1CUK A;  2VUM H;  1TBQ R;  2KMP A;  1HNZ Q;  2GKV A;  2OWO A;  3SDJ A;  3CCV A;  1U5K A;  4GI3 C;  5EAY A;  4A3E G;  4JYA L;  2R6G A;  3S1M H;  1X55 A;  2AWO A;  2BA1 A;  2I5L X;  3FKI G;  2KBN A;  4YY3 Q;  4LFB Q;  1PCE A;  1HH2 P;  3B6Y A;  3ULJ A;  4NV5 A;  2WCY A;  1K0R A;  1Q8K A;  1VQB A;  3F8T A;  4YHH Q;  2SGP I;  5IYD G;  2FNF X;  1BBW A;  4BXX G;  2SGQ I;  2YUU A;  3BJI A;  4YY3 L;  3H15 A;  4LFB L;  4SGB I;  1WI5 A;  1N32 Q;  2K4K A;  4DR1 L;  1OXV A;  1WOC A;  4DR3 L;  3W5O A;  4AYB E;  2YFB A;  1Y1W H;  2FXQ A;  4LWC A;  1HNX L;  3GTM H;  2KMQ A;  2OTL A;  3FBV A;  1C7Y A;  2YTY A;  3RU0 A;  1HDL A;  1AE3 A;  3FHW A;  2JA6 G;  3S14 H;  4FKD A;  3CW2 C;  5JEA J;  1UWV A;  1CGI I;  4JI2 L;  3VDY A;  3RZD H;  2VQF Q;  1YO7 A;  1V1Q A;  1E3P A;  3VA9 A;  4RMF A;  1IL2 A;  2F4V L;  4C3J H;  4A3G G;  4NV2 A;  3RN5 A;  2B63 H;  1M8B A;  2A2D A;  4JBJ A;  4DR6 L;  1IY5 A;  1E22 A;  1LR7 A;  2CWA A;  3U4Z A;  3JC6 6;  4AIM A;  2ALY B;  2IHE A;  4OX9 Q;  4A3L H;  2KHJ A;  2HHH L;  4YZD A;  1GM5 A;  4JI3 L;  1FJG L;  1S72 A;  4LUV A;  2JA9 A;  1N34 Q;  1EYG A;  3IAS 1;  3RR5 A;  3J81 j;  2MO0 A;  2BH8 A;  4DV2 L;  2UUC L;  2WFW A;  3S16 H;  2AHO B;  1MIU A;  3PV0 A;  4A3C G;  3CME A;  4L5Q A;  4NXM Q;  1KBE A;  2PQA A;  2D0O A;  3FP9 A;  4DPG A;  2XGT A;  2CQO A;  4JV5 L;  1AH9 A;  3OW2 A;  2ERW A;  1BKB A;  3J80 i;  2CAZ B;  3T1Y Q;  3U58 A;  4E1R A;  3ER0 A;  4BA2 I;  2YQP A;  3KF8 B;  4R4C A;  4A3B H;  1M1K C;  1OTC A;  1PJU A;  4X66 Q;  3MEF A;  4X65 Q;  1LUZ A;  3K80 C;  1XPR A;  3T1Y L;  1M90 C;  1KQS A;  3UEY A;  1G51 A;  2DUD A;  1K73 C;  1VQ8 A;  2QQC A;  1HZA A;  4GN5 A;  1PH6 A;  2W0T A;  1FAR A;  3CCJ A;  3UDI A;  3HOX H;  2UXC Q;  5FJ8 H;  1UVF A;  2Z6K A;  4QY7 A;  2LEO A;  2B0U C;  1N32 L;  1R79 A;  3JSB A;  4O0A A;  1PH5 A;  2JA5 G;  3J7A 5;  5JJK A;  2N17 A;  2R92 H;  2NU0 I;  3S15 H;  1IBK L;  3KLW A;  5LMU L;  1M8C A;  2BH2 A;  3I4O A;  3OXF A;  1IYJ B;  5HI7 A;  3H0G H;  1I5F A;  2ORW A;  4JOI A;  5IP9 H;  1ASZ A;  5C44 H;  1IZ6 A;  1PV4 A;  2E5L L;  1DGS A;  1DS2 I;  3OXG A;  1I50 H;  5IWA L;  1PH9 A;  2JB2 A;  4RG1 A;  1KAW A;  4PL5 A;  1S3O A;  3AYH B;  1L0W A;  4A76 A;  3ULP A;  1VQ4 A;  4B3M Q;  3H3V H;  2ENN A;  1L1O B;  1VS0 A;  3KF6 B;  4IJH A;  1CKM A;  4GNX A;  2DGY A;  1YJ9 A;  4JV5 Q;  3I4N H;  2UU9 Q;  5FLX c;  3CD6 A;  4IFD J;  1XA6 A;  1QZG A;  5FUY A;  2KCT A;  1TWC H;  2C35 B;  2R7F A;  4HID A;  4UXI A;  1K9M C;  1Q46 A;  4OAV B;  2F3I A;  2VQE L;  2Y0S E;  4X64 Q;  5GAG C;  1Z7K B;  2NVX H;  3ZJY C;  4HJ9 A;  1RFH A;  4X62 Q;  3BZC A;  3I2Z A;  4MTN A;  3S2D H;  4A3D G;  4PZ7 A;  1LTL A;  1NTG A;  3J80 c;  3KOJ A;  3ERS X;  1HZC A;  4X64 L;  1NJI C;  2ZM6 Q;  4OWW B;  2F6M B;  5M5Y H;  4C3I H;  4X62 L;  2VNU D;  3GTJ H;  3W1B A;  3S1Q H;  4JI0 Q;  3U50 C;  1YHQ A;  4A3B G;  2UXD Q;  4POG A;  4HGU A;  2Q2T A;  2JA7 H;  5C0X J;  2GVI A;  3CC2 A;  1VQH A;  4AQY Q;  4DR5 L;  3GTQ H;  1EWI A;  2N52 A;  1TUR A;  3CCE A;  1HJA I;  2UUB L;  4JI0 L;  5IYC G;  1Y1B A;  3CCU A;  2WP8 J;  2JZM A;  1CSP A;  1NMF A;  4QIW E;  3F2C A;  4Y52 H;  4P73 A;  4YWL A;  2KHI A;  2HQL A;  4OWT B;  4DV6 Q;  3A5Z B;  1BVS A;  1V43 A;  5IP7 H;  1D7Q A;  3W1G A;  1A8V A;  1N9W A;  4BA1 I;  2E2I H;  3PCO B;  2SGF I;  2KEN A;  3PO2 H;  3OYY A;  1VQK A;  4P71 A;  2RIO A;  1UVG A;  4HEA 1;  4AH6 A;  5FLM H;  4GKJ Q;  2CKZ B;  4GNX B;  3L0I A;  3S1R H;  3GOX A;  4UP9 A;  4UXH A;  3E59 A;  5M3M G;  2B8T A;  1VQL A;  3LJ2 A;  3IAM 1;  4PG3 A;  2K75 A;  1NE3 A;  3GTK H;  1PH3 A;  1SMX A;  1UE5 A;  1YHA A;  1SRO A;  1XNR L;  2XMX A;  4KHZ A;  4Q9V A;  4UP7 A;  2IX0 A;  2J9R A;  4DR2 Q;  3F1Z A;  2HT1 A;  4JC0 A;  5IP9 G;  1PH4 A;  2IP6 A;  4IPH A;  3PO3 H;  5IYB G;  4BBS H;  3HFZ B;  2OQ0 A;  4A3J H;  2V1C A;  3HKZ G;  3PUW A;  2K9H A;  1VQF A;  3JAM c;  4JI1 L;  5C3E H;  2ES2 A;  2QQE A;  3MEK A;  3TS2 A;  1IW4 A;  4DAM A;  5HGQ A;  1FL0 A;  2HIV A;  1VQJ A;  4H02 A;  4LF9 L;  2A20 A;  2F52 A;  4JI3 Q;  1FJG Q;  1Y1C A;  2GKT I;  1MKH A;  1N34 L;  3ULL A;  2QEX A;  1CSO I;  2JEB I;  2E5L Q;  1KBF A;  2SGE I;  2JA1 A;  1PA6 A;  4B3T L;  1X4S A;  1KIX A;  4KI0 A;  1I94 L;  2KKM A;  1MJE A;  3E2I A;  1IY6 A;  2JA6 H;  2NU3 I;  1CT2 I;  5M3F G;  2UUB Q;  1KRS A;  2YTX A;  4A3D H;  2XRC A;  4AS3 A;  2NU1 I;  4DWL A;  3EIV A;  2K5H A;  2L15 A;  3HOW G;  1V1H A;  3I9V 1;  4DV3 L;  4X65 L;  4K0K Q;  3VDP A;  3S24 A;  1IXR A;  2AMC B;  1EFW A;  5J3B A;  1N8R C;  4JI7 L;  2A8V A;  4A3G H;  4R4I A;  1OXT A;  4POF A;  4ALP A;  3E9H A;  1MT1 A;  4A3M H;  3BU2 A;  4DV7 Q;  5GRO A;  1VQ5 A;  4LF4 Q;  4IOA A;  1YEZ A;  4BBR G;  5ELO A;  2WAQ G;  3L7Z C;  4OON A;  3RN2 A;  1PFS A;  4GKK Q;  2I5M X;  1YI2 A;  4B6D A;  2ENZ A;  2ZTD A;  3CCR A;  1QZH A;  2JE6 I;  3G6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...