4JCWA

Crystal structure of clavibacter michiganensis expansin in complex with cellopentaose
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and D78N mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 47
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jcwA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jcwA02
3ENGA 1N10A 2AE0X 4FFTA 4ZM7A 3SULA 4ENGA 1BMWA 2HCZX 2PJJA 3X2GA 3M3GA 2PI8A 3FT1A 3FT9A 2KQAA 1WHOA 5H4UA 4AVRA 2G5DA 2PNWA 3X2KA 2GAEA 4JP7A 3X2MA 1L8FA 2G6GA 4FG2A 2JNZA 1WC2A 3X2HA 1WHPA 1HD5A 5GLXA 4JP6A 3X2NA 3SUMA 3X2OA 4L48A 1BW4A 2VXQA 2ENGA 3CZBA 2BH0A 1OA7A 3X2JA 1BW3A 3SUKA 3X2PA 1OA9A 4JCWA 5GLYA 3X2LA 4FERA 4JJOA 4JS7A 5GM9A 3SUJA 3D30A 2PICA 3X2IA 4FG4A
chains in the Genus database with same CATH superfamily
2ZUQC 3UAJC 4Y2DA 3G6AB 3ME0B 4OAWB 1TDQA 4E68A 4PR5B 3IDNB 5BRQA 2APFA 2X87A 1KC5L 4MASA 1ETZB 1R24A 1OTUD 1NLBH 3B3BA 1YECL 2YBRB 1TQWA 3OJVC 1PX4A 1FYTE 1BZ9A 2W0KA 1BQ5A 5DJ0B 1IGYB 4LSRL 3U83A 2IALB 1AA6A 1Z3GL 2O5ZL 2OMNA 2NSXA 2WAQA 2AEOA 1CICD 2X4QA 3BN9C 4LBEB 4HWEL 2VRAA 3BGMB 4WFFE 5IOPB 4JFZL 4L1LA 1UADC 3GC3A 3GTKA 1AMYA 1YMHB 1NMAH 4APQA 3N50A 4IGBB 2QKSA 5INCA 1NFDE 4NRZA 3JTTB 3CFJB 3J07A 3CSYA 1PLBA 3QWOB 2VNCA 3VFMB 3X2OA 3PQYD 4OGXH 4F7TB 5BRZE 1SPDA 3RYMA 5I16A 2E6JA 3IMRA 4PJFA 4RMRA 3BJLA 2IAMD 4PBWD 5TPWL 5F8QC 1J0IA 3MUGB 3OF6A 3WEXB 4YHYB 5JDJA 3KPRE 5CMAB 1FZOB 1JPTL 4G6MH 3HFFA 2JXMB 2W92A 4GKOA 5HDQH 2W9EH 5FKPA 1KIUA 5EUKB 1R27A 5IBUG 1MAJA 2EKSA 1FH2A 3EG9B 4XP6L 5IQ7L 3ARBD 2HLFC 4Z7AA 5CEZL 1VZGA 1FP5A 3QUZD 1ZT1A 4NN6C 4X5LA 4ZMWA 1I9RL 3H3KA 1QSEB 4Y4FB 1KBGL 4U6XB 2WIMA 4W9EC 3BZEA 4PJ9A 4D9QE 1JWUA 1PL3A 2UZYA 2A0LC 3V4PA 5DD5H 3RWHB 5DC2A 3GRWL 4PJDA 2CO4A 5DO2C 1OPOA 1S78C 4Q74A 1KBPA 3V9FA 4DK5A 4KTEL 5C2BL 5FOBB 4QHMB 5CN1A 2CBMA 4P4KC 1FAIH 2XA8L 1QEWB 1OO2A 1WZ1L 5DHVH 1BZ9B 3BUQA 5E99L 2VN7A 3V4UL 1N6QL 5LDSA 4FG0A 1SN5A 3WIHA 2BFVL 3KYOB 4J28A 1AE6L 4GQ9H 5DQ9A 3AQYA 4NXSA 1CLYH 3QDAA 4NJAH 2LOEA 4JN1H 1SOQA 3CH1B 1IQWL 2MCPH 2UWEE 4G2AA 1KYAA 1GW6A 3KL5A 3GTQA 3KPLA 1GTFA 1CXIA 1YZZA 1TSHA 2X7LB 3NTCL 4G9DB 2VMDA 5CP7A 3FUHA 3PL6B 4KX9A 3TZVA 1NMCB 1LMKA 3HBZA 2D7TH 1NOFA 1KQGA 5CIPA 4AT6B 1OE3A 5B1KA 3CVBA 2BO0A 3CFJA 5D7EA 4QYAA 4NUJA 4U1JB 5HYJE 3M8OH 4B5EA 2E47A 3KJ6H 4ZO9A 2R8SL 1UZ8B 4G8GE 2J5LB 1BOGB 4JPQA 3SPCA 3VTMA 4TULH 1T7YA 1SHSA 4YMPA 2NDFA 2K70A 1NANH 1NLBL 4ZW6A 3QEHA 1KIQB 1INEH 3NBNA 5EV7A 1EFXD 1RV6X 3OSKA 3QDJB 5D7JD 1A9BB 3VFMA 1S7VA 3BPLC 1T5WA 5JORB 3QR0A 7CGTA 2WXOA 1UWEL 2FT7A 4JVPA 3AZUA 2AJZB 2PPCA 3DX6B 1SBSL 3DIFB 4HS6A 2X6BA 3ZKQD 1NWOA 2G2PA 3JV0A 1Q9OA 2I27N 4A2MA 4ZSOE 1RI8A 1ZTMA 3AT9A 1D5MB 1BFSA 1KN2L 5GS3A 1XL6A 3RL2A 2YEZB 1PQEA 3CZSA 4WO4B 1MXGA 3KPQB 2ZOTA 3V0HA 4UT7L 5BZWB 4Y4FA 1ZA6A 5HD8C 1P4BH 1SFDA 4P2QD 4PH8A 1NCWH 1BVKA 1DDHA 1FYHB 3GEWB 1ZLWK 4B41A 2PYFA 3RBSA 1FLRL 2XXFA 5F6IC 1HAWA 4FG6C 1FE8L 1ET8A 4UT6A 1CGWA 2WMPA 3BH4A 4GP5B 4DF9A 3TO4C 4S1RH 3G5YA 2AQ2A 3HLKA 1BZ7B 5IHZA 4YHYC 4WKXA 3EH3B 4Y4KB 3TO2A 3CZEA 3FN0L 5C0BA 3SDCB 1QFWI 2IV2X 2OTPA 3MV7E 1MY5A 4O58L 4PB0L 1BVLA 5AB0A 2AXGB 1RJLA 1E18A 1T1YA 1G1CA 1HHKA 4LU5L 1MFMA 2BC4B 4JANA 3FN3A 3SDCC 2EE6A 1G7QA 4QIRA 5IM7A 4H26A 1N5AA 4RV0A 4DJMA 2AXFB 1N6QH 1J9QA 4BV1A 1A8ZA 4PWJA 2DLTA 2PCXA 1ECYA 5GZNC 4QTHA 1AR1D 2Y0SA 1XB8A 3NCBB 1OP9A 3ZYIA 3U2SB 4X7DC 3W0WE 2NY7H 5CEZD 4BFEA 5DVNA 2F7QA 2RFXA 5IK3B 2G0KA 3P9MB 3NA9H 1R3JA 1ZYRD 2CZNA 4IKIA 1MCNA 4LKCA 1H3UA 1CTMA 5EU6B 3V6OC 2C7UA 3HJ0A 4L4TB 1U58A 3ARFC 3BUPA 2A4CA 3D85B 1UQSB 3VRJB 4S1SH 4FADA 4NKOB 2I07A 3VH8G 3ROOA 1BLIA 1MCRA 5DUPH 4PD4J 3MXWL 3O2DL 3VXSE 4KWUA 3QC8A 3CUPA 3ULAB 2K8QA 5CZVL 3SDDC 4AEFA 3O6LL 3KYNB 1O5PA 3ABMB 3IDJB 5CCHE 3UTSB 3FSWA 3T1FA 3SUKA 5DUBB 5EFIA 3WJJC 3D85D 3WO4B 5TK4A 1MRCH 3OKOB 2H32B 1LO0L 4OUOA 2ZPKL 2OJZL 3QFJB 3V8OA 4HUWB 2ICWJ 3ZTNH 1CGTA 2CG9X 1QR1A 3I02B 4RRPA 2VDOL 3KGSA 3C5ZB 2ZXGA 4WJ5B 4NRYB 3NUKA 1H3XA 1W72B 1JGIA 4XNZB 3TF7C 1E61A 2CBQA 2BVYA 2QKIC 3ZZSA 3ECBB 3NCJL 5TFSL 2PYEB 3UTQB 1FFQA 2JE8A 4DOHB 3X13B 4G80B 1RUAH 4AZDA 3JWOL 1HEHC 2R1YA 2V3FA 3D18B 5ITBL 3QUYA 1W80A 3V5DA 4MA7L 2Q76A 1ZEAL 1T7ZA 2JA5A 3VQLA 3IJ8A 4RFEB 3JV6A 5F44A 1FE8H 4D8PA 5GZOC 3MRLA 4KO7A 4FZ8L 2ADIB 3BSHA 3DETC 1F18A 1L6XA 3F6JA 3UO1L 4XMLL 1JWMB 5D6DC 1AKJB 1EHXA 3BUDA 2VKXA 1B4JH 3EJSA 4P9HL 2BCKA 5JOFB 4YLBA 4HU2A 1SHWA 1AIFB 3SKJH 3ARDB 2FWLB 3WYRA 1ZMYA 2OM5A 2QHRH 4IEFB 3A4EA 2PKDA 4UNIA 5C09E 1SLWA 4ZMZA 3ATDA 2IPUG 2ZKMX 4IQHA 2A69D 5I5MA 3HS8A 3B3IA 5D7IB 3POHA 2ZNXA 4X0KA 4GG6F 2WM0A 4EZLA 1TQSA 1ZSDB 1JGUL 1QNIA 5T33H 1KCRL 3BUYB 2Q7NA 3CFEB 1HZKA 3CK0L 3UBFA 3JV4B 2B39A 2VN3A 3LKSB 1L9MA 3QAZC 1E6JH 4UIKL 5F6HJ 3QNZB 5HHOD 4JK0D 1AR1B 1RJZB 4P4RA 4QD2E 4GT0A 4X7TA 4ZX3A 1P2CA 1PD6A 4UZGA 1G9MC 1P7HL 1K4CB 3HBGA 1NGYA 4F7EB 3VA6A 1D3CA 3ZE0B 1A65A 3OKEA 3X3FL 3B3IB 4O02A 5D7IA 1A1OA 4JGNA 4MJ2A 5AAWC 1U8KA 4JW3A 5DRNB 3PHSA 2HPOA 3S4SA 5FDWA 3GSQA 5H4UA 4RAUA 1MCBA 2LVCA 3CFEA 5K9JH 3P4MB 5IVZA 3F6IA 3QC5X 4YDLC 3NAAL 3UH8A 3VG0H 4N22A 4NT6B 3Q43A 2NY2B 3KHOA 4B60A 4OZHE 5JHDA 1CZ5A 3ECBA 3RHWK 2Y7NA 5T1JA 4H20L 3FTYA 3MBEA 4EXPX 1KTBA 5EOCJ 2AV1A 5D5MF 4C56E 4ZNEE 3QA3B 1A3LL 2BY2A 4QXWA 3ZE0F 1LO0H 2PCPA 4ZSOA 4H4NA 3CMOH 2NY0C 4LSVL 4DK6A 5E70A 2EZ0D 5HHMD 3BPLB 4G5AA 1ZA3A 4JRXD 5GISL 3T3MF 2MTAA 2Q7YB 5AUMA 1RZJC 1JNJA 3MOAL 1OY3B 3ZDZE 5ILTH 3WGUB 1OTSD 2QQKL 2FYYB 3ZLQC 4X8JB 4AXWA 1PKOA 2Z93B 4PYHA 3HAEA 1MJJB 2LV4A 1TJGL 2BIMA 4ONFH 2E4TA 4PRID 3T0EC 1R3IL 2OTUB 5FF6A 2QKIB 1RJYA 3T2NH 2DI8A 4UTBL 3TZVC 3UC0H 4U4BA 3V0VB 5E6SB 2UZXB 2XBZA 3DVNB 3C6SA 3SJVB 1NBZA 2IPTL 4BK5C 4JGJA 3BPNB 1FL6B 5JPMA 3PGFH 1MHHB 4PLOB 3QARA 4PVMA 4OLVH 1VFOA 3T3MB 1P6FA 2XWTA 4KXZI 3AS1A 3PIQB 3RL1B 4MCYA 1M9WA 1ULVA 1HVXA 4JFED 4NO5B 1KB5B 4XMLH 3SDDA 4IU2B 1IAOA 2VE6A 3F2LA 2FJSA 1RULL 4I89A 3U1PA 5HGGS 1BVZA 1QSFB 3HE6C 3EH5B 1XGQA 3D8MA 1Q9OB 5AKVA 5DWPA 5SWSB 1IIKA 3L4CA 5MP6L 3G04A 4H40A 1YEKH 5HYJD 2CDEB 3UBXB 1UXWA 3CF2A 2GJJA 3FKUS 3GSNH 4V11A 2J25A 3M07A 1CD9B 3MR9A 5DK2B 1AGEA 1CFMA 5EO0A 4EI6B 4Q9QL 2X4OA 1E5ZA 5F9JB 5C2UB 4DAGH 2XYBA 4YBLC 2NXZB 3DX4A 5C0RH 5EZIL 3TH4T 1BIIB 5BUPA 5MEQB 1M05B 1IGJB 3UBHA 5KZCB 1ZGLA 3FO1A 5FM5M 2WNGA 3QCUH 4KAQL 1T21A 1HL5A 3EJZC 1RUKH 4AT6A 2XQ0A 2HWZH 4C55A 3MGOA 3WNOA 2ITFA 4MNGB 4TOYH 5KOMC 5AWNH 1P7BA 3DI2B 2BNRD 2R2BA 4DSYA 1WBYB 2YU9A 2WANA 3FMGL 3DVGB 1ZLUK 5I26A 4KKZA 4E36A 4BD4A 4Y19D 4JPWH 3CFKA 4WSGA 3CVIL 1I3QA 3BAWA 3KWXA 1U3NA 4MNHB 3WO3B 1HIML 1NM4A 4X2UA 3GXTA 1EAOA 1HOEA 1I53A 4P5MA 4TN9A 1R3KA 1VHPA 3HAEB 5F9WC 2DV6A 4L9LA 1I9JL 3BQUC 4WWKB 1FNHA 3GSUA 5DD6B 4X5XA 4NSKA 1ZVSA 2QTEA 3LIZL 4N2LA 3P4NB 4Y19E 3QZLA 2OMZA 1FGVH 1FORH 3IDMB 3OJMB 1BM3H 2VSMB 4CNIA 2CPUA 2X6VA 5EU4B 3ESVF 1FL3A 2I9LB 2O6FA 4NO2B 4EZJA 3N6YA 1A6TA 1D5RA 1QW9A 3GTVA 5KVGE 1NSNH 5E2VH 1F4WL 2VLRA 3RNKB 1LTXA 4JPIB 5C1BA 4PTUB 3B2UD 3KW8A 1T2QH 1AGBB 2IOIA 3LN5B 5CIPH 4EI5A 1CE1H 2J8OA 5I1LA 4MKTA 4DQAA 3GSVA 2BW5A 3O6ML 3TM6A 5IJVA 2HUHA 4M03A 4WGVB 1T2XA 1DR9A 1TU2A 1URIA 4O9HH 2EYTA 4J3TA 2D7QA 4YXHL 1IU1A 5I30L 3OKLA 4MDIB 4WIQA 4GS7B 1ZA3B 1PIGA 1VEPA 3HAEH 3JWNG 1XBRA 2Q6WB 4JUTA 5J6HB 3TA3B 1EO8L 3GFUA 1A9BA 5JORA 1SGKA 2ZUXA 2VL5B 1J86A 1Q0YH 2ICWB 2C3VB 5IVXE 4N2IA 3VE0A 1SVBA 4ZMNA 4QRRD 4N0UB 2WZPA 1F1AA 2Y24A 3NABL 2JELH 4P5MB 1XF5B 3MRKB 1IBHA 1M2VA 2CDGB 1GGTA 5FUOL 3RVWC 4LCUB 4DN3H 5GJTH 5AG8A 1KXTB 1URZA 2EO1A 2YPLD 3B8SA 2NX5D 4JO1H 5CXPA 3CDFA 3IETB 1FNSL 1KTDA 3TJEH 4Z7WB 5C0RL 1KGCE 3SQOH 4NKOA 3H2WA 4I85A 4OSUL 5J9PB 2CM5A 5L8JB 1F02I 2KZ1B 1ADQH 4WHCA 1IC4L 1VCBC 1NTDA 1SBBA 2R2EA 1CLVA 2OS7A 2OL3A 2AK1H 3MV9A 4Z7UF 4KNTA 5D72L 3GXPA 2F7RA 4YZWA 2A6DB 2DWDB 4FP8H 2JIXD 2AEQH 4HJGB 2VWEE 1ZDQA 1MW2A 1JGEB 3IK2A 1MG2C 1VZIA 3QXAA 5F3HB 1KXTA 5JHMA 3IDGA 1OAYH 3ZXAC 3RKPA 5T3ZE 1SJHA 4KJQC 3A6CH 1N0XH 1NCCL 1X7QA 4UMSA 3PP4L 1X5AA 2BK8A 3EJYC 1YEWA 1EANA 3EGXA 2WO4A 4QCIA 1UUNA 4X4YB 1FDLH 3FU3A 2VZ3A 3TIEB 3IPEA 1F6LL 3LNHA 3BRFA 1JZGA 3IJEA 3IFPA 4FQXA 2VRKA 1D9KA 1JIBA 1G7QB 2X9WA 1FZKA 3IU4L 5HDBE 2EYRB 1MFUA 1J8HD 1SXSA 3HZKB 1ZHNB 3FQTA 3U7YL 3KXFB 3QUKA 1PVHA 2JCCA 2NTFB 3IDIB 2OYPA 4JGUA 2AKRA 3I02A 2ZUWA 5I0VA 4R2GB 3ASNB 4QF1B 5G55A 5TE6H 4EIGB 4F37K 4X7FC 4LVNC 4N3TA 1WGOA 4MNQD 4GXFA 4WUKH 1CFVH 1QFPA 1TF4A 3AB0B 3VO0A 4K07A 4XP9L 4HGWA 5HTSA 1HH6A 5E00B 4A7GA 4JGMA 4GUOA 3SO3C 3AQDA 4I8DA 3RWFA 1A0QH 2J55A 4OCRH 4OM1H 1FVEA 1LYQA 1TZHB 3KDPB 3ESNA 5IMOA 5B39B 1ZVHA 1Y1VA 4G9FD 1KJ2A 3VFSB 3MA9H 2Y5QA 4HCRA 4KDTC 4FNSA 2P5PA 3CU7A 1UFGA 3CFQA 4JKPL 5HSFA 3AUWB 3B37A 5EU5B 2YRLA 1NCAL 1LEGB 3NIGF 3ULSB 4Z8FH 1QFWM 2YGPA 3MRHA 1U8PB 3NSJA 2YA1A 1NFDF 4FYQA 4O2EA 4EBQH 5T5NF 4JHZA 3E0GA 1INQA 1WIUA 1A9VA 4HAFA 4M6AA 4G8IB 3WIFB 4JM4L 4PRAB 1IEBA 3ZTEA 2DIEA 3QEGL 3WFZA 4PWGA 5FX3A 3QRGH 3VXOB 2OMXA 1BMWA 4MD5A 1ACYH 4G6FD 3TC9A 1U30A 3W3BA 2EUXA 5B38G 1MHCA 2V5SA 4NI3A 3NPZB 2G3NA 4PMEA 5C0IB 3Q5TA 3QG6A 5J11C 1GA2A 4HDIA 4IBQA 4LOVA 1UD2A 2EDTA 2RH0A 1CXHA 3ATBA 2OXGA 4OSUH 2I7SA 3VD4A 1T0NB 1DP0A 2WBJB 4JX0A 1T22A 3SPVA 4JG0H 4WCYL 5BO1L 1W0WA 4LVOB 4UDTA 5CR1A 1NL0H 1HZHH 3FTGB 3PIQA 3BP6B 3L17A 4JRXE 4LAQH 4X4ZA 1PG7W 4WW2A 1N10A 3B1UA 3AGVA 1XCQB 1MW3A 3W11C 4G83A 3ESMA 2R9HC 1OSPH 3MLXL 3D07A 5IMKB 3M45A 3W1ZA 1N0XL 3LIUA 4L4VE 1AO7D 2BDNL 5DEGA 1HINH 1UXWB 4JQXC 2ZXAA 3QDGA 5CJ5A 4BELD 3SE8H 4X6DE 4DETA 2H3NA 1XGUB 3C12A 3FU9A 5KSBB 4JZOA 4HMDA 5T1MA 2YC1A 4JRWA 5HGAB 4M1CC 4MMYB 4XVUD 2HVBA 3C2AL 1U95A 4N1HB 2ZOUA 5EBGA 4NO0A 5C8JA 5KJRH 3GSRA 2VQTA 3IMUA 3KPSA 4N0FB 1F4YL 1A3QA 1ZTXE 3WO4C 1E32A 2P24B 5BZZA 4Z3EA 3JTBA 2XVKA 4JB9L 4LHUG 3ELAT 3DX7B 4M5ZL 5AVQB 3QJFB 4YHLL 3U25A 1OAZL 4JDEA 4DGYH 2QGCA 4JO8A 3HMXL 3QQ4A 4LDEB 3NIDF 3L9RB 4B9IA 2OTUA 5DUMH 2ADGA 3GHBH 5F7FA 3T8MA 4HCIA 1DBKL 4HJEA 2GG1A 3WAJA 5GGQL 3C8KB 3QO0A 4KJPD 4MZ3A 5KBPA 3CVHL 5TE7L 1RHFA 5EBMA 3VU2A 4XI5C 4OF0A 5BRPA 5FDWB 3JWNH 2RGSA 3GRBA 3KBFA 3OKKA 4KROB 5T1DH 5AW1B 3HRZB 1HEJC 2K0RA 2YEQA 1T1XB 2YUVA 3L3DB 1QBLH 5HYIA 2IIJA 3RJOA 1FFOA 5I6MA 1BECA 4D7PA 4R3SA 3TYFB 4QRTA 2I26N 3QA3A 3LKPB 3RWJA 3LS5H 4OQTA 4TQ8A 2R69H 3V5KB 3VFNA 3S6CA 3DJSA 3FAXA 2CDEA 4J4PC 3VRLF 1VACA 4XP5L 2L7EA 3QIBB 1GKEA 1ED3B 3RVXD 3ISWA 4HH8A 5G4NA 3OSVA 3JUZA 4GMSL 4JFFB 4ORGB 1U91B 2IADB 2WP3T 2E9GA 3EJCA 3IPBA 4LP5A 1U8NB 3RX9A 1N5YL 3X3GL 3MGTA 4U1MA 4PR5A 3TEYA 3SUMA 4GKZB 4I5BB 2NY6D 5FGBA 3SHSA 3HNSH 1TWHA 1NUNB 5I9QC 2ETWA 3MX0A 3BOVA 1S6NA 3NCFB 1G4RA 3MNVB 3ML8A 1AP2A 2OI9B 2ZCLH 3I3BA 1KJ3H 4NM4L 5INDB 4HEPG 3QULA 2G0LA 3BUTA 3H0TA 4UDUB 2B0SL 3VFRA 1NGZA 4AYMC 1ZAGA 4PCTA 1FVDB 4NCDA 4CBPA 3U2JA 2XJLA 5GRWA 5DS2A 4OZFA 3PUUA 2M83A 1N7ML 1NDGB 2W80C 3DXAE 1S8DA 5CLZA 5E0QA 1OWWA 4NQDB 2XT1B 2FGWL 5ICXB 2NY1D 4GG8A 5DQJB 3N43F 5B1BB 4KHXH 1IC7L 1MREL 3L48A 1UASA 2HAZA 8FABB 4ONGH 4KUZL 4LLUA 5I75C 3UIZA 1KTLA 1NIBA 4HJ1A 4Y4HD 1GSKA 3IBOA 4BH8B 2ZQKA 3QJSB 2FYVA 1YEEL 4PGZA 4GW1A 4DGYL 3LEXA 1RUML 4AKPA 1EH9A 4UZUA 2WYTA 4YDIH 3D87B 5EZLB 1VRSA 2EDRA 1FRGH 3C5JB 3GXIA 3D2UB 5BMFH 4JM2F 3OC8A 4GUQA 4TUJA 1ETZA 1ZJAA 4FNUA 4HWBL 2OP4L 3CLFL 4ZXBC 2FSDA 5C0AE 4Z3JA 5B8CC 4PG9B 4TUOA 4KFMA 1BYOA 2P48B 2ZXDA 1PZ5B 4YDZA 4XE0A 3VSQA 5C09D 3UPRB 3STLA 3D0VA 5T5FL 4D8OA 3D9AH 4NI6A 4F2ME 4M5YL 1HHJA 5LBGA 4XC3H 4L9LB 4ZW7A 5ANMB 3WS3A 3CCHA 1VADB 2BWQA 4NQEA 4FI8A 5FK9B 1IFHL 4C4KT 2VDNB 2DB8A 2I24N 3NEXA 3ULUH 5AYTA 4WDIA 2VSCA 3RWEA 1WCBA 3NFPA 5C2BH 3ECQA 1FNEA 1IVLA 1J0HA 2VDPL 4PJEA 4JMXA 4Q6IC 1TWCA 3G6DH 2A6ED 1G4MA 2DEYX 2GFBB 4L3CA 4WUUD 1ACXA 1W91A 5DK3A 5SV3A 4TNWF 3FB8A 3KH4A 3N0AA 2GUOA 3U9UA 4DKEL 4WEBH 2DQEH 3OZ9H 2R0WL 3MCKA 5HI3C 4KJWD 1VKXB 3QPXH 3ZGHA 2J21A 4N6QA 5AZUA 3X14B 1KLGA 3FFDA 3WI9A 4P0DA 3OKLB 2WLIB 4UINH 2PJHB 1Z66A 1I1YA 1AHWB 2R23A 1H3VA 4MMZB 1XGRB 3X12A 2R4RL 2Z8WC 2YAQA 4WV1A 3KYMB 1F6AA 2N3JA 1PKQA 1S7QA 1CD1B 4M48L 3RY5A 5T3XE 1I7TA 1D5IH 3FSAA 2EUWA 4HU8A 1JMXA 2D3JA 2HVJB 2KYIA 4ANWA 1OHQA 2IAAC 3WY1A 1EZVY 2DLFL 5DS8A 5IROC 3VGAB 4KBPA 3IRZA 2BSEA 1BGXH 2WTRA 5ENWA 3FOLB 1D2OA 4AI7A 2WVUA 2RMNA 4ESKA 2HX8A 3PPSA 1NDMB 1M6UA 5CZXD 2F5BL 3LKOA 4U1IB 5IWLC 2V2TA 4OI7A 3TX4A 2WB1A 1FVEB 4G7QB 4LEBA 2I32A 5D2LB 3V6OE 1JWMA 2A83B 1MCOH 4OY9A 1I7RA 2W65A 2XV3A 4TVPD 3S36L 2DI7A 1MUJB 3TBYA 3TTSA 3VH8B 1XCQA 3D08A 3V6FB 3HEIB 3IYLW 1CLZH 4PY7A 3ARZA 4XT1C 3HPLA 3IGAA 1DANT 4FTVB 4HKZB 4FQIH 4I3SH 3T0BA 2VZUA 5BW7A 1IM3D 4QHKJ 3ZL1A 2P8PB 5F7DA 2WXIA 1XQ4A 4FQPA 4PV8B 4WUUA 4ZQKB 2OP4H 3CLFH 2OAAA 3OD3A 4AL8H 4FULA 1AS8A 4M1GL 2V9TA 3K1DA 4R5VA 1CR5A 3MPCA 4EF3A 4NZRH 2X1OA 3T6VA 5T5FH 5T3ZL 5TDOA 4U1LA 4FQXB 2ZSVB 4LK4A 3BUYA 3KG5A 2NY4D 4LSDA 3K2MC 1OVZA 4JJ5B 4K3EH 3ZUNC 5IUSA 1FNFA 2IGLA 2BXYA 3HMWH 2ZOLB 3HHRB 2YN3A 3V4VH 4PRAA 1WITA 1QRNB 3UP6A 3MZGB 3VYNA 2CKBA 3RPIB 2VXQH 2D3LA 4W70A 3KWVA 3NFSH 4A1RA 5L8KB 2WBKA 5MENB 4JFSA 4G6AD 4S2SA 4R7LA 4HJ0D 4OGAC 4YDLB 2PPAA 4YNYA 4N90D 4FF9A 3AXLA 1WAPA 4GLRI 4AUUA 3OM3B 3ROOB 4L48A 1HHHB 4IKJA 4XVJH 2K3HA 3GK8L 1C8PA 1LEIB 1THAA 1JNNH 4J23A 4L1SA 3ZSTA 1XO8A 2KZKA 4FABH 1EEZB 1JF1B 3C60C 3I2CL 4GEJA 5E5MB 1J1PH 5SWZE 1ZE3C 1KIUB 2XUWA 4HV8A 1V5JA 3QIWB 3T0AA 4DFHA 3AB0C 5IHLB 1CD8A 1H3PH 1UH2A 4QUOA 1AQDB 2NUTB 2W9DL 4HGMA 4L8DA 5CSBA 3IDUA 5CEZE 3ZZLA 4YJZL 3OG6B 5IQMA 4WI0A 4KKAD 5IV2B 1D5IL 2J8UE 4ODSL 4R2GC 4TPRL 4WZ9A 3LD8C 4P3WA 3W0WD 3ZMNA 4Z77B 4HBCL 4P5TD 1KF9B 5C0ND 3CX5J 1FNGA 3EOBB 4ZMPA 5DK0A 1ZS8B 1UATA 1BGXL 4H5SB 3CFUA 2ATPA 5D4IA 3ZTJG 2P24A 5D1QD 5I1AB 2A99A 1OGAB 3BAJA 3IS1X 3V10A 4W4NA 3ZTNL 4BZYA 5ALBL 1EXUA 1O5DT 1NCDL 2DWXA 3QK0A 4QY8A 4POZD 3RE0A 2KHAA 1C1EL 5CLWA 3B56A 2NVYA 3MOBH 3SN6N 3OR6B 2D7NA 1JI2A 1S7UB 3QORA 3J2PA 1CGSL 1H15B 3D7PA 2BVPB 3MV7D 1SEQL 4DT2A 4YSUA 3QDHA 4UT9A 3S36H 4PJFB 4OJYA 3SPJA 4NQXB 1RJCA 3K72B 5FOJA 3WNMA 5CP7B 2EINB 1JNLL 1DQTA 4X8GA 4OZIB 1HK6A 1RVFL 5F1NA 4S0TD 1JYXA 3N1QC 3UZVA 2JB6B 4G7VL 1MFDL 1MNUL 3ULVF 4YBQC 3F83A 3GEFA 4A2GA 3UZEA 2Y36L 5C9JA 3U2IA 4YZFE 3HZYA 3MLZL 1Y1UA 3PWJA 4PS8A 1AZZC 4U1NA 1N9PA 3V9EA 3TEXA 1DBJH 4MMYA 1EZVX 3N44F 2WN3A 4N2EA 2YUZA 2QSCH 2YC1B 3BFOA 4GAFB 4YQXH 3VAEA 5L2KB 2YZ1A 4N0RA 1BFOB 2XN0A 4FDWA 4K94L 3KLDA 1UYWL 3D0LB 1DEEB 5MERA 2W0FA 4YHZL 1HCVA 1DQQA 3QEUB 4JLRA 3JXAA 3V4VL 4ABUA 4QKXB 4D0CB 4GXUM 4ZM7A 1T5WB 5SV4A 5I6KA 1WAAA 1JRHH 1YY8B 1ITBB 1EBPA 2VAAA 5C9JB 4O2FB 1BD2E 4DTGH 5B4MC 5HVFB 4JY5H 4EIUA 4X50A 5GS1A 4A68A 2Z7YA 1CVSC 3OKNA 4W93A 4DCQA 1CR9H 1AANA 1P69B 1UWGH 1G6VK 4FQCL 5D7LD 5LWYL 1WVZA 2UWEA 4LRIA 4NGHL 4ODUA 5KYUB 1A7OH 3JSSA 2YUXA 1HE8A 2ZCHH 4N20A 4P2OB 4YFEA 1YNTA 1I8MA 4PU2A 5IESH 3LHPL 5EMYA 4ELKA 1EAJA 4JFFD 3IB4A 4N5ED 3FQ2A 4NWUL 4AIZA 4GOSA 3TASA 5DQDL 1KFGA 1XD1A 2PYFB 1AZUA 2WVVB 4QNPF 3BW9B 3IR7A 4JO2L 3BWAB 5IF0B 4P5TB 1WEJH 5C9KA 3DO7A 1Z0MA 4AX3A 2OXHA 1DVFC 3C6LA 2Z1PA 4OLWL 5FWQA 4MNQE 1BW3A 1O9VA 2JA7A 1M7DB 2HTKD 4MCNA 3KZ8A 4A7SA 2G2RB 2YN5A 1MI5B 4QWWC 1G9HA 1O7SA 2VXTL 5CD5D 1RZIB 4MQTB 1IQDB 2VSKB 4ZO6A 4BM7A 3L3IA 1MRDH 3KDMB 1FGNL 5I23A 4HS6B 5DJ6B 2VN4A 2R1WB 4NM8L 3B7SA 3REVB 3M1CA 3X2MA 3C08L 3JTSA 1U21A 1U8HB 3T6QC 1G0YR 4ZG1A 2YKLH 1DL7L 4M29A 1AZCA 2WLZA 4M1DH 4R8WL 4XMXA 2APXA 3K80A 5FO7A 2FWSA 4L1DA 4TOYL 3D39A 3F85A 2PNDA 5H4YA 5SWQB 1MZZA 2YD9A 4Y16A 3TV3H 1F1GA 3PWNA 3DSFL 3LPGA 3R8BB 5F1IB 3S4SB 4F5CE 3VD5A 4DP7X 4XCCH 4HUNB 4OCXH 4W6WB 4M43L 2UXTA 5CLYA 2Y69B 4D94A 1KGUA 3OPZL 2VISA 1T4KB 2R56L 4YGVB 4JO5A 4Q9BA 5IJDC 4PBVC 1IKFL 3B9KC 1YSOA 4JO4L 3I50L 5DHVB 1V27A 3HR5A 2AJYL 3OKNB 4IGBC 3SE9L 2VC2L 2GTQA 1ZGLP 4PJHB 4JHUA 1ZT7B 4RCAA 2QSCL 3TLRA 3NH7L 3Q3GA 3IJSB 4OFYA 1Z9SA 3KJ4C 5E9DB 5IOPA 1TITA 2E7CA 3CXFA 2YRZA 5TPWH 4ZI8A 4P2AA 2AJSL 3RWGB 5DK2A 5AVXB 4KXAA 3WTUA 4M62L 3LXAA 2YRBA 4LDCA 5ANHA 4WEMB 3II3A 1YAZA 5ISZA 1IM3B 5I74B 4DKDC 4Q9QH 3IDGB 1I1AD 3LNDA 1CFTB 3F8UB 3IBEA 3FJTA 2WXRA 3FUKA 4NIYE 1IRAY 2YEVB 4A39A 2KQMA 2ZAHA 4FTVA 1EFXA 2AW2A 4PJDF 2XPYA 1I4FB 2VXVH 2YLHA 4PV9B 4WI7A 3KLHD 3PJSB 1UACL 5EBWA 5JPMB 1MHHA 1NCBL 2VN5A 4NQQA 3MV8A 4M6OL 4JDTH 1WWAX 2XG4A 3D12B 3EIFA 1BFVL 3L45A 4IMLA 3D4YA 4P5KA 4HK0A 3SYQA 1O75A 1WYJA 1WBZA 1XGRA 1B6UA 4WTWA 3ZE1E 1XF1A 2Q76B 1A8JH 1DQLH 5BQDA 4J2XA 3LVEA 5I75B 4IRSB 1OF2A 1NBVH 4LEOA 3KR3L 3VXSA 4GQ9L 4A2EA 3PFUA 3QUZB 3PABB 2MOQA 4H0LC 1K5NA 5H8DA 4YHKH 3CVIH 2WLNA 2DYPD 3L4YA 3QVAA 4WWKC 2N1TE 1MDAA 4RZCA 4M6MH 3MTRA 4PMFA 4ZUUB 2CLVB 3P3UA 1PQFA 1P1ZB 4XWGH 3TH3T 2R29H 1OCCB 2HRGA 1A1NA 4NKMA 4BFGA 1FN4A 1IE5A 4OB5L 1MFAH 2CR0A 4H1LA 3PQYB 4CNIB 3BE1L 3Q48A 5KSUB 3LD8B 1E5UI 4IBSA 4WLCA 1FGVL 3A4FA 3QXUA 3BWSA 5IROA 2ISDA 5IF0A 3OX8B 2H26A 3UTTE 4GXVL 4BBWA 1C7TA 5DJXB 4HBQA 5FCSH 5DUBA 4LOUC 3WBDA 4LPVA 1L9PA 4BK8A 2D9CA 3WL9A 1Z5LA 1WFIA 4PJBA 1U6AH 1MUJA 1DJZA 2VM3A 3G5VB 2PTTB 3S8FB 4KRMB 5FYKU 3TN0D 4A7UA 5LG1A 4NC1C 2WNWA 4DGVL 3KBEA 4PV8A 5FTLA 1E2WA 2Z34A 4IHOB 4MWFA 1DLHB 2BHYA 5LNGA 1CXFA 4ICXA 5L0QB 4XNMA 2CKNA 3BZDA 3HG4A 4KTEH 4N9GB 4EUPB 1E2ZA 1E8XA 4LSTL 5DVOA 1J8HB 1OCWL 1FAIL 2XA8H 3EOAB 4Y5YC 4ZAKA 2BIOA 3PDGA 4FC3E 5BCAA 1IKFH 4BFRA 1WZKA 5DD6A 6FABL 3L5WA 4KK5C 3IVKB 3A3YB 4J8RA 2DMKA 3T2OA 1CLYL 3PV6A 4PJEE 4XN1A 2BSCA 3UYRL 1DCLA 5SWZD 3NH7H 4U1IA 3O4OC 2V2TB 3GMQA 3IM1A 1KCVL 5GRJH 4G3YH 1G7LB 4FFTA 1I75A 1G7JB 3NTCH 3QUXD 5HPMA 4XPGH 2Z92A 3C8DA 4QAMB 1ZY9A 1S7XA 3NSDA 3BP7A 4ZOEA 1FHGA 3FN0H 1N19A 2BNRE 3BPNC 3L95B 5GJTL 5CO1A 1KDJA 5CBAB 4JY6A 5EUOF 5AVWB 3H9HB 4OZIA 4K9EC 1B9KA 2P80D 1ETJA 4ZS6D 3T1WA 1ODUA 1IC4H 4YK4C 2XTJB 1I8AA 1MEXL 4PQXA 5J11B 5AYUH 1KSRA 3QS2A 3ZBMA 1EZLA 2VDRH 1NCBH 3HUJB 3SKNB 4GFXA 4QXUL 3VWKD 1T1WB 3DX9A 3W81A 4OF6A 5J3HD 2FX7L 2F53B 4CGUB 2YPKB 4JRYE 1Z5LB 2Z8RA 1JAEA 1XGTA 1WFTA 3OAWA 5A6MA 2A7BA 3DIVA 3K0WA 1FL6A 4NNYA 1BVKB 1DDHB 1NBZB 2BIIA 2O6DA 4PJ8B 1TJIH 5CBAA 4N2DA 3DX7A 3ZKSD 5T3XH 2OMBA 5JQIB 3HI1A 2AVFA 2R4SH 5CJXA 5D1XC 3VW3L 4TVUA 2WOYA 4ZNEA 1L6PA 1U4FA 2IQ9H 4X8CA 2DQTL 1QLFB 4KOCA 5I0WA 5ECJE 1KELL 4FXKA 4X4XA 5T1LB 2ZWSA 5BQ7A 1Z9LA 2COVD 1P4BL 3I84A 4NQVB 3SCMC 3Q1SH 4RWYL 1HNFA 1QASA 4LSQH 1PZAA 1I7UB 2DKSA 3AG2B 2EDMA 4NP4L 3UYPB 3QUZA 3AXHA 3SDYH 4EI5D 1TYJA 2XOTA 1V3LA 5DJ0A 4BXVA 1AG0A 3CN0A 4P99A 5G5DB 4AWJC 5DVLA 4P46B 2B7DT 4XOCA 3NESA 3MUZ1 3J27A 3LQAL 4HIPA 3SO3B 3VB8A 4FXLA 2XKNA 5FYLH 4ZMAT 2J1KA 2PO6A 4NQTA 3QAZB 4XWOC 1MHPL 2B3IA 2C7UB 5EO1A 1U58B 1QHPA 2H6PA 3KLAB 3K7UA 1JMZA 4CU7A 4PP1D 4PRNA 1BOYA 2CUHA 5EOTA 1GYAA 3LZRA 3T0EB 4UIMB 2QDVA 2ZP9A 1V3MA 5GRXG 2EH8L 2EXWD 2A3TA 3LEYH 4L0PB 4P46A 3SPIA 2BP8A 6PCYA 4Y5VB 4IBVA 3RJDA 1NCUA 2G3ZA 5KYWB 1G6RL 2CRIA 1HCZA 2J12B 4G11A 1MELA 3K4ZA 4OF3A 4XBEH 5I9QB 5C6TH 3TH2T 4A2LA 1QBAA 4PRDB 4M00A 2DLHA 2ZSWA 2HFGH 5HBBA 5IEKA 2PR4H 1P9MC 4MA7H 3O6FC 3G04B 1PYQA 1C16A 2X44D 1C08B 1WZMA 1A6WL 5K9KB 2D03H 4MDRA 1RK0A 3H7BA 1RLWA 2QJDA 4MKMA 3Q8CA 4F9PA 3RIAF 5FCUH 4UU9A 2FTAA 3S48A 4GBXD 4AVRA 2V8LA 1LE5A 2XRAL 4ZAKB 1OANA 3QIBC 3O11B 4JP7A 2YXFA 2YXWA 1OD7A 3K6DA 5I76B 3MO1A 4D7BA 3B9EA 3RTLA 2AZAA 1X44A 2FX8L 3BEVA 1NFDA 5CILL 2HA1A 3QORC 3CN2A 3PPEA 3T09A 2VDNH 1WDAA 3JWDC 4M3JA 2IWEA 1KCKA 1CFBA 3NSCA 4LXFA 1T1XA 4KZEH 2OMYB 3O3DB 2DMGA 2C1OA 3CFTA 2QHRL 1VC3B 2VDRL 3ES6A 3PFQA 4G80A 1L7IL 2ADIA 1KZQA 1JYNA 3BP5B 1VSCA 43C9B 1NC4A 4WK0B 4K3JL 3R8QA 2KPWA 4PWKA 5KAQG 1OSPL 3AG3B 3GBMH 2LTQC 1T04B 4CGTA 4N2NA 1HHGB 5SWSD 2XZQH 2ZCKL 4X5WB 3NN8B 3GMNA 3CSYB 1AIFA 1O9WA 2X2YA 4JZOB 4YE0A 4U6XA 3QUMB 3SE8L 4NX0A 3LRMA 3O4LD 1RZIA 4C8XA 1S3KH 2L7JA 2GITA 3DTXA 2D3NA 4XXDA 2J8UA 4MSWA 3K6FA 2IQ9L 4TS6A 5E6IB 4N0FA 1NC4B 1EDHA 4Y1AB 1GGBL 1CXLA 1M1XB 4AGOA 1N2RB 5FKPB 3Q1SL 4RWYH 2CLZB 4PRIA 4S10A 4K3DH 5EBMB 3BDYH 4CMMA 1AP2B 4IKKA 1EPFA 1E42A 3ARFB 4JB9H 4V33A 5KYYA 3GTPA 3BP4A 2VLLB 3VD7A 2CRZA 3T8VA 4TQIA 4KKLC 5KYWA 2ROYA 3VFRB 1AQHA 4NC0B 1BYNA 2VDML 3N04A 5HYQA 4LBAA 1ASPA 1SVZA 2FD6L 3O11A 1A3LH 2VITB 5L7XL 5DT1H 3IXAB 3PL6A 1VENA 4HOXA 4X99B 1XTMA 5I18L 2DQGL 3K8MA 4WJG3 1DUYA 2DH2A 2Y2WA 2AJXH 4N2HA 1G9MH 3CSPA 5E5LA 3ORJA 3VGEA 4AMKH 4KV5F 3LKNB 4FTVD 3GWJA 3FB5B 4IS6A 4JKWA 4KHTL 1C5DA 2E8ZA 4FFVC 5DQ9B 5ISZB 5IKCB 4N0YL 4JFFA 4DK3A 4P23A 1TJGH 1OXYA 4BUQA 5GS2H 5IW1A 5D1ZI 2J8HA 1HXMB 1DO5A 1EFQA 3EDDA 4PJ5D 5I6LA 4P4KB 2B1HL 1DSYA 2WLMA 1BWMA 1ASQA 1S7VB 5DJXA 4K23H 2YLKA 4MLSA 1A6PA 2H1PH 3EYFA 4PP2B 5IG7B 1XGYH 4ZW8A 1BF2A 1Y18A 3T2QA 3GBDA 4Q97A 1BG1A 3NIFB 1Z2KA 2BVQA 1U4EA 5JQ6H 4AOKB 2OMUA 4P3DB 4RQQB 3VI4E 4TUOB 4XCFH 1HHKB 1U3JA 1HTYA 4OCMC 3RGHA 4IIQC 4UYPA 4J3OH 1A7PH 1FVCB 1YMME 3CDZA 4Y2NA 2V2WB 5DJ8B 5I17A 4G72B 1IBBA 2X53A 2YAHA 3GSXA 4H2CA 3NAAH 3TONA 3CPLB 2GK0B 1E65A 2DICA 4JFYB 1XCXA 3IFOA 1V10A 1O7DE 1JK9B 3FB6B 1U8IA 4YIQA 2AS5M 2B0SH 1XGZA 1KBVA 1QYGH 3Q01A 5CR8A 4XCYA 5T1KB 2YUJA 1PW3A 1T5XB 4OD3L 3OTTA 5JZ7D 1YPZF 4TSCL 1MCPH 3OKDA 4JP6A 1SHMA 3CFDA 4WKZB 1YC7A 1IAIL 1ZXKA 1T3FB 5IVXA 1CURA 5J7CC 4M7LT 3EYUH 4ZTEA 1N7MH 4R4NC 3MHZA 3RY6A 3WFCH 1JZ8A 1ZC1A 2YMOA 4K7FA 1RUKL 1EBAA 1XEDA 2WIIB 4OZHF 5FYJU 3K2UH 4BE6A 1QWUA 3KM2A 1E9QA 3Q8BA 4MJ4A 3X1BA 32C2A 1A6UH 2JCCB 2VLRD 5GIRA 1IEBB 3ARGD 2OR7A 5CLTA 5F88B 3CUPB 5DD3H 4C54A 2CRYA 4K7PY 1U41A 3IFPB 2VDLH 4ELME 5I8EB 1NH6A 3N1MC 2J6EA 3E9UA 2C26A 2ZICA 3DX8A 5DD1H 1AVAA 2XG4B 2EDQA 4HIXL 4ZX4A 2A74C 1FLTX 3EBIA 1C5DB 3X12B 3QEQD 4KXDA 5HDWA 4HGWB 5C07D 2ADJB 1W6LA 5BOJA 1YEEH 4BKSC 2VR8A 3DV6A 4HDIB 1GGYA 3U46B 4Z3HA 2VDMH 2XWBB 1NEZB 1GJWA 1F8TH 3QO1A 4I3RH 3ARYA 3EJUA 1J9RA 3HI5L 4UDTB 1T22B 2EEDA 1SJEA 1YYLH 2QPSA 1BXUA 4K8RL 4U1KB 3S3DB 1RZGA 2HJFA 4YHNB 4FFZH 4WHTA 3X1EA 5FO8A 3QI9C 5EZOH 2P45B 2KMWA 1SQMA 1TZ8A 1OAKH 3NZHH 4JZJB 4HD9A 4TLKA 3VVVA 1ACCA 4DAGL 1EO7A 5ID0A 1AFVL 3WFBH 5CJXC 5CP3A 1E4WH 2J44A 4HOWA 2D0FA 3I85A 4WTQA 4RBPK 4E5XG 3B9DA 1EJFA 2WUBH 4Y8DC 1WT5A 1G0XA 5TF0A 4ALAH 3E3QC 5DR5H 4N0UA 1CDUA 5FPIA 4Q14A 2H1PL 2Q20A 2J6EL 1VEOA 5E2WL 1WFNA 2FT6A 2F18A 3KMDA 1YG9A 3O9WD 4BFBD 2LW3A 1PZCA 1A6AA 1S7TA 3B2PA 3HE7B 5TDPA 5I66B 2HRPH 3NJLA 5T1KA 1OAQL 1YLEA 3G5VA 4PRBA 2BERA 3U4EB 4P5RA 1UJ3B 1YMMA 4TL4A 1B2WH 5KVMC 1LO5B 3CFCH 2RJMA 2ORBH 2WK2A 1E9PA 2XQYA 5E8DH 4U3CA 4PJ6A 1WUNT 2WO3B 3L9RA 5I1DB 3RU8L 4A37A 3F58H 4ETQB 3WTVA 1TTGA 1GZQB 3WXWL 2HG5A 1DE4A 4Z5RA 3MYJB 3MROB 3ALXA 5HHVH 1AHKA 2BCMA 1TTRA 5BQ7B 1IL1A 2PXYC 5C7ZA 2R7ZA 1I31A 3FFOA 3H4FA 1FORL 2VPXA 1ZK5A 2DL9A 2OMVB 5MI0C 4F7CB 2NT0A 2JI3A 5IFAL 2IAMC 4AVKA 1F4WH 2DLFH 2GB2A 2V6HA 3WD5H 3RIKA 1RIHL 4BFIB 4BFOA 4R5XA 3FQTB 1T2QL 4B50A 1IFRA 4F57L 4N8VB 3H2QA 4PLJD 3Q6FB 2VWEC 4KFZC 4L9LC 1T66D 2EO9A 5DMIL 3ARBC 1UG9A 2JB5L 3E6HB 3A5VA 3VXTB 2FBJH 1R9FA 2ROXA 5CJ8A 3VXMD 2PF6A 3MLUH 1AHWA 1I1YB 5E5MA 5ECGA 5KZCD 5L88H 3IDXL 2IEPA 4U7MA 4R97B 4EPSA 4BSWB 5L9DL 4G9FA 5GGVH 1R75A 4MTMA 3HI6H 1JGEA 1EO8H 5F8RC 5C08E 1NLDH 3GIVA 1RJZA 3GKZA 2EKJA 1G1OA 3LB6C 3UG4A 1J9CT 4WWID 1IGIH 2OL3B 4L5FL 4G1EB 4DGIH 4Z3GA 3D0AA 2WWKT 4OD2B 2WP3O 2Y7SA 2P28B 3GRWA 4CAGA 5HHQB 2CBTA 3NIDE 3EO9H 5KBMA 2IV9A 1D6EA 5C92A 4M1GH 4ZPTB 2IV8A 4DVRL 3EJQA 1W16A 4JFDB 2A9CA 4NNXB 4BZ2L 4HUMB 5DZJA 3RTQB 4PJGE 4W9LC 3WFHA 1N2RA 2Z0UA 4M7JL 2F7OA 1FNSH 2AXHA 4HS3A 4UV7L 1PMYA 1C08A 1IGYA 2FHBA 3KVDD 1BWWA 2QFRA 2W5PA 1AKPA 3BKJH 3F7YB 3HG5A 3EHBD 4X8XA 4IRZA 4ALAL 5EU3B 5IQ9A 3OXSB 4JR9H 4F7MB 3ECUA 4XPTL 1AKJA 3GIZH 2YD5A 1LP9F 5F71A 1UXSA 3PL6D 3ULVC 3C6EA 3B83A 1K85A 1KV7A 2JKXA 4YFDB 2WBJC 1AGDA 4N2FA 4NFBA 3EJJX 4NO0D 4X6FB 5DZVA 3UTTA 5J5EA 1OAQH 5KSAC 2XXGA 4Y4FC 3VXMB 1KNOA 4EBQL 2E5EA 3T0EA 3LRLA 4NOFA 4WHYG 4YXLH 1I85A 1JNNL 4L3EB 4CVXA 3CFCL 3D69A 4E9QA 1OGYA 1I3GL 4ERSL 4RMUA 3MACL 4TSAL 1HH6B 3SDAB 1D5BA 4GRLB 3OJDA 2Y25A 4APQD 4JFEE 3LRHA 4RGNB 1WA0X 3CFIC 4OJDH 5L4MA 4QT5B 1E4XH 1KIRB 1J1PL 3NT0A 4KNSA 1A21A 1KG0B 2N7BA 3BX7C 2NR6D 4MXQC 2CCVA 5JLZB 3DOSA 1CBJA 5AW3B 5FYKH 4CSZA 4ZQTA 2FJHB 5D8JH 2X4TB 3EDFA 3AREC 3N42B 3VCLA 2AK4D 3BQVA 4WNJA 4XPAL 2HVKB 2YBGA 1GVIA 5GS1B 1JXFA 1XH1A 1RK0B 5BO1H 4XP9H 3ARBB 1HZHL 1AHMA 3MYZA 3DVGA 5AOLA 3U4BL 3HNVL 2DJ4A 4F7PA 2BSSB 4AM0A 4KJYB 1IBDA 2KZWA 4NQCE 1F4AA 3RTQA 3TO4D 3VFUB 3FO0L 2Z4TA 2IAMA 4OCRL 4P48A 5J13C 3ZOAA 3CZNA 1GGCL 5E8OA 4G6JL 2IGFL 3B5HA 1Z1WA 4U2YA 4AQAA 2MRYA 3DPBB 3M17A 2JB5H 3VGDA 3MJ7B 4N8CL 3U0TB 2O61B 4LSRH 3IJHB 3TIDA 1VDGA 4JKKA 4PEEA 4NO5A 5GGRA 5DYGA 2ZP8A 4AVIA 2JKRM 2QSTA 5CCKH 2X4NA 2RACA 1M3JA 3QHFL 1XSJA 1F86A 5L9DH 1B2YA 2ZX6A 5IOKA 2Z4QA 4TTDD 5F1NB 3EJRA 2Z91B 1X5ZA 4FNRA 4YSEA 3CX2A 4RMWA 1JNLH 4V2BA 1M42A 1KJVB 1BQUA 5TDNA 1AGEB 3TBTA 5E8OB 5E4OA 1SUJA 4ZD3H 5AW9B 2VQ4A 1DQQB 4KGLA 4BQ6A 1AS6A 1H8SA 4YSPA 2Z1KA 4M5ZH 1CS6A 4HWNA 5IBLD 4R7DB 1AXIB 5EPMA 4ZX5A 5MEQA 1ACYL 4ISVB 4QEGA 3SIKA 1AR1C 3KPOA 2NX5E 32C2B 5KYXB 1UHEA 4ZUWA 3BAYA 1QLEB 5D1XE 3IAQA 4BZ2H 2Y5TA 4OJFH 4JS7A 3LNGA 3KLSA 2BNQE 5GS1C 1GTNA 5FYKE 1MAML 1BP3B 1QPXA 5DS8B 1OP3H 2HT3D 5F7AA 3PG2A 4LIQL 1UGKA 2X88A 1YN7B 1CE6A 1QACA 2FNWA 3LKRB 3PNRB 4YOKA 5T1DL 1DJWA 1PGRB 4QRPA 4ZFFB 3G5XB 4LAQL 4YH6A 5E23A 1Q90A 3SDDB 3FQXA 3MUUA 4JFOA 2DWYA 3JT2A 1JE6A 4N68A 4V1DA 3VXUA 1U2CA 5A2JH 1X4YA 3T0VA 5LKNA 4NGHH 3LS5L 5DD5L 2X4TA 5K9QG 1YECH 4WWNA 3SY0A 4O5LH 2Q8BH 5HGHB 1S9XB 1PAMA 1I7RB 3QJTB 2ENQA 3CZFA 5KSAB 2HXAA 1SLXA 2FHFA 4LVOC 3D25B 4KMLB 1CL7H 2WVVA 2VLRB 1OW0C 2Y6TE 3UFIA 3CC1A 3VSVA 3P0YL 2AC0A 3MCKB 2NYYD 4KK6D 3C2AH 3C75A 2Q1EA 3N5AA 4HC1H 2NY3D 3QEQE 5C07E 1WA2X 1URLA 3IS0X 5K1VA 4JO2H 4Y4HA 4W4OA 4ABVA 3MODH 2LU7A 2J43A 2CMRH 1Q9WA 2DI9A 4QRRE 4OLWH 4G70B 3EYFB 3UBXI 1H6EA 4YHLH 3QUHA 5KOVC 1KDIA 1KPVA 1P4LB 2AQTA 2L8AA 1AZVA 1LK3H 5T1KD 4M8RA 2BRRL 3X2IA 4GAJH 2DWSA 5I0ZA 1TYEB 4NQEB 4QO1A 4K94C 3ZQ9A 1DBKH 2OBGA 2HX9A 5D2NE 3ZE2E 4L4TD 4FL4B 5GRVL 2CUMA 2MQCA 5KANI 4MJID 3FO0H 5JIIA 4J1UA 3P2BA 1AC0A 1QI4A 3C08H 3CVDA 1X4ZA 3U4KA 1MWAA 4XP6H 4LGRB 4R8WH 5EPMB 5SX5K 5IQ7H 1YEFH 2XN2A 4XNBA 3O3EB 3RHWF 1RZKL 4Z95L 3PUCA 4IRJB 3PXHA 5FDYA 3MV01 1VGEL 3DSFH 2FGWH 4GG6B 2EVJA 5FO9B 3MA7B 1BZQK 1LP9E 4XCCL 2E7LA 4PG9A 3VFUA 5HJGA 3FT9A 4A63A 4XP5H 3X2KA 2GSIB 1G94A 5DA0B 3QZNA 1W8EA 5KVFL 2N56A 1KN2H 1IGFL 4PJ5B 4U1HB 1RIVH 2VDQL 1CTNA 3JT0A 5K39B 1H3WM 2XIIA 1VB9A 2XV6B 4GMSH 5D7LE 3SE9H 3PQYA 5B1CA 4WK2B 2L7QA 2MCAA 3DO4A 1VPOH 1D9KC 3FRUA 2P8LA 3GNMH 4NUGH 1IC5H 3FQNB 2X0UA 5BMFL 1R4XA 1RHHA 1UD6A 2AJSH 2CR6A 3F6LA 3K8LA 4GSXA 1NDGA 1KJVA 1NCOA 1MFBH 2X70B 4QRPE 2ATPB 2AV7B 4Y9EA 3LH2L 2WLLB 5ICXA 3MTXA 1T1YB 5J6HA 3U82B 4M5YH 2DPKA 4HJSA 1J48A 4LCCC 5B1JC 2C34A 3GIVB 3NCYP 3M8OL 4IHOA 4K8RD 2A6KA 5EZLA 5HYSG 2AK4B 2VL4A 4XRCB 3QEHB 5A16A 3VXRE 4Z9KB 3U30C 3KPPA 1ZV5A 2VLMD 2HYMA 3MREB 3BZFA 4M6OH 4P2OC 1P7QD 1X9UA 2PP9A 4BH7A 1UXMA 4W6XB 2XVGA 1F11A 3MRNB 5K1JA 5BS0A 3AFLA 2N0KA 4HFWA 5DEFB 5FEBA 1B6DA 4GQPH 4A2DA 5GS0D 1N4XH 3CXDL 1BXAA 4DMRA 3PAYA 3WU1A 5JHLH 1G7IB 1DJYA 1OTSC 1A14L 2VMFA 3F7LA 3QPXL 3E1F1 1MREH 3KPLB 4G1MA 1TIUA 1WPCA 2HFEA 3GS7A 1FDIA 4JHBA 3ZIYA 3OF6D 3QNXA 5CSZA 4AKQA 5I8OH 1R0AH 3DA0A 3TFKC 1FFPA 3H4HA 3SDCA 1GGIH 2WXKA 2ZX9A 3P69A 2IDCA 2IMMA 3U9PH 1QCSA 2DQUL 4YSDA 2QR0A 3DBSA 1J1OH 3LS4H 2W0FB 5DI8B 4F9PC 3VD2A 3BE1H 2ZJSL 2ZAIA 3SPGA 3K46A 1QRNA 1HU8A 1MPAH 1JZFA 3NDZE 1F4HA 1AR2A 5F1OB 2TAAA 1KJMA 4KH2A 4AW4A 4RGMB 2YXVA 3ILPA 4QI3A 2ED9A 1B0GA 2WY3B 3AW5A 5I1HL 3RTQD 3TO4A 2WXFA 2EE9A 5I8CB 1LQSR 3TYGL 4DVBB 1MRCL 2NTSP 4YK4B 1W2KT 1RZKH 1CQKA 2R59A 2OJZH 1TTAA 1YNTB 2X3CA 3N40F 4KXCA 1IFHH 1I8UA 3IN2A 3MYJA 4XXWA 1AO7E 2XC8A 3DI3B 3N0PB 4FNPA 4H8VA 4JY4A 3G5ZB 4ETYA 5JQHC 2YGNA 4ZQKA 2VABA 4U33A 1FNLA 2XTSA 1UENA 2IQAA 5EO9B 3SJVD 1ZHLB 3QPKA 1ND0A 1OCWH 3G6DL 5I1JH 2VOTA 2KERA 3ZDZF 5EULV 3VDCA 3WFHB 1ETA1 2VDQH 3GB7A 1RUAL 4EJ1C 2X2HA 1PDKB 3VXNA 4UI2A 4OGZA 5KJ4A 3US9A 4H1LB 4EEEA 2DQEL 3OZ9L 5MEPA 3Q6FA 4B9YA 5JPNC 3EJZD 4D3CL 3JTTA 1UD5A 3V7AG 4RMQA 1V05A 3G5YB 4N2GA 4MQ7A 1X5HA 4DZBA 3G7TA 4XNXL 2B2XL 3IEAA 2KL6A 3WNNA 1F42A 1PTZA 3UO1H 5KSVB 3LH2H 4Q8BA 5HGAA 3NOIA 3UJJL 4K5NA 4GKNB 3IJ9A 5D4HA 3QAQA 4A04A 2OQJB 3L4VA 1NA8A 1TLKA 3F7RA 4KQ4H 3SKJL 4R97C 1MEXH 4Y16B 5LCVH 4N5UA 4WI9A 4QRSB 2HX7A 4Q4EA 1IGCH 5E95B 3G3LA 2AFNA 5D71L 1E4JA 4MYWB 2BVPA 4JG1H 5B3JE 3HZMA 4ODUB 1N3NB 5J06A 1U3HD 3L7FB 3OLIA 1LO2L 2VCOA 3S5LA 1F58H 4GKNA 5D7KE 2RTTA 3V7AE 4N9OB 5FGCB 5FECB 2NXZC 1WHPA 2QFPA 5DMKA 3KEDA 3MMEB 4OM0L 2B59B 1T0NA 5F7KC 2O6CA 2PETA 3GK8H 1OARH 3V52H 2R4SL 3B2UC 3F7YA 3FB7A 4JO3H 4G6KH 4WFEE 4XO3A 3T3PB 3HE7D 4EN3C 4MAUL 5EO9A 1R0AL 1FNGB 3EOBA 1MLBA 1OL0A 3ILEA 4LCWB 4EZKA 3IJSA 1RIUL 1DQVA 4LCYA 3TCXA 3VWKB 3GB7B 1E2VA 4JRYD 3U9PL 3AWGA 1SZNA 2GJ6B 2RD0A 5CIPB 1UD3A 4ZS7L 4AVJA 3BT2L 3VRIA 3VJ6A 1MPAL 3LV3A 3O2VL 2Y1YA 2J5LC 1CMOA 2VJ8A 2BP8B 3H42L 4P23B 5I1HH 4CBZA 5AOIA 5T3ZH 4F3FA 4CC0A 3LZPA 1EEZA 2VIRA 2E4FA 2WXJA 5EOTB 1AKJD 1UWFA 2EO7A 3UAJA 1LDPL 2K9FB 3MJWA 5CNHA 2MHAA 4JHAL 4Y1TA 1IAKB 1G84A 4KDLA 4KVCL 1DTUA 3D39B 3DUHA 1NCDH 1NMBL 3AU1A 3QUMH 3MLRH 4PVBA 2Z8SA 5DHYB 3SYAA 2X4QB 4I7ZC 1RZFL 4X0KB 5E03A 5CFHA 4PJHF 4AYBA 5T3ZD 5KBNC 3RFZA 4Y1AA 3FS9A 4XOAA 1M53A 4FTDA 1JCKA 3P9LB 2MSPA 3V0WL 3T2NL 5T33L 4UWQB 1Z5YD 3REWB 2PR4L 1SMYD 3NEEA 4KRLB 4XVJL 1KWGA 5KEZA 1RVFH 4JFPB 4B97A 1AZNA 3OAZK 5AW6B 1PT1A 1A9EB 1ZS2A 3AAZA 3PWLB 3HMXA 2IANE 2ZONA 1HL8A 2H2PD 1T1ZB 2KKQA 4PY8J 1I50A 2B4CH 2P5WD 1HEZB 3BP5A 1Z5HA 3Q2CA 5G2NA 4JHWL 3OKDB 1EGJH 5AB2A 3CZBA 1CPUA 3E6FA 2VZ1A 1HT6A 3VFPB 4X98A 3X2PA 4NQXA 1H3PL 4MXVE 1DVZA 1HHGA 3AC0A 3RGVC 4UQBA 1UYWH 4IS6B 1YEKL 4KQ4L 3NJKA 4YHZH 4HSQA 3SQRA 4ELKB 4U1GB 1GJUA 3QORB 3LXCA 4PJAB 4RGOH 3GSWA 2A4ZA 43C9A 2P5WE 1L7IH 4FFWD 1UHVA 4AIEA 4DTGL 1CB4A 5CJOH 3SDXA 5KSVA 2WSKA 3J7HA 2V7NA 1AYOA 1NQBA 2CDFB 5EU6D 3DTUB 3IE4A 4J12A 4FQCH 1X5MA 1F58L 2P52A 2DYSB 2YHGA 5IR1B 3GTMA 1OTTC 5JIQA 1JVLA 2AGJH 1ANUA 2VH5L 1NGXB 2P80A 3F7VA 4NBZB 2E76C 4HX1A 2OW7A 5ILTL 3AWEA 2V0AA 3BP4B 3GJEA 4O02H 4E41E 1ESOA 1FZMA 1U42A 4Y4KC 4WW1A 2YO3A 4ODTL 3SBWA 1LE5B 1CGSH 5DHYA 2H0PA 1HI6A 2ICWA 2EIMB 2J2ZA 3ZMRA 2NRDA 4X5QA 1EO5A 5I5IA 1R3IH 3RWEB 3SGEI 1IT9L 4NN7C 4KLNA 3WN5A 1PCXA 1U3YA 1WHOA 3QDME 2ZX5A 3ZMEA 3D34A 3MFGB 2NZIA 1QHOA 3BT2H 3VGFA 1X5YA 3OZLA 3RL1A 2ICEC 4IIZA 2I07B 2WNXA 1IV8A 2WB7A 4AKOA 4EN2A 3B9AA 1SEBB 4WO4C 4XMUA 3MLVL 1F11B 1A25A 3MLZH 1GHFH 4Y2DB 4AE1A 4BYHA 5J56B 2GT9A 5ISZD 1AO7A 3KBHE 4ZPVB 2DKMA 5J9PA 1IBZA 5F1IA 4P07A 3Q2LA 4JFTA 3SEPA 2RR3A 4DFIA 1S7RA 3RG1C 4MLIA 4KRPD 4LASL 4P06A 4X99A 5JIMA 3D2TA 3K6SB 3MRMA 3VQMA 4D7ZB 4GRWE 1BYPA 4OD1L 2DQGH 2OLDA 5JR1H 3SDAD 2W9EL 2WKOF 25C8H 2WCSA 5IIEA 3LZNA 2CJ3A 1BAGA 2UY7B 4KUCF 4KVCH 5E9DD 4B9CA 1JZHA 4JKLA 2EUZA 4XNZC 5GSVB 3SGEH 3I74A 2VLME 4OZGE 4JFUA 1O9ZA 4H8QA 4JDVB 2C3GA 4N90E 1EWHA 5GIRB 3VGHA 4JZNA 4Z7UB 5GLYA 1UWGL 3WJJA 3L4TA 1CVRA 3OG4B 2ARWA 4BZ2A 3GI8L 2GSGA 2DM7A 5CD3B 1DQJB 3ESPA 3THML 4I1PA 4YLQT 4KI5D 1MWAH 2EJ1A 3PHOB 5G4MA 3TNNA 1PZ5A 5IR1A 2H1XA 1NPUA 3W11D 3LHPH 3MBXH 3GXNA 2QPUA 4MCYB 4W9KC 3AJ7A 4FQQA 4NDMB 3UXFA 5JXEC 3MRNA 3UYOD 1PKQB 1S7QB 2B4CL 2FJGB 4WGKA 5JHDD 3O4LB 1WV7T 2VC2H 3IGKA 1CJYA 2GABA 2X4RB 4N0CD 3QXDB 1KB5L 3AWFA 2ESVE 4I0CC 4DO5A 4TNWK 1IQWH 4S0HA 2JKIS 2A2QT 1Z9MA 3SZKC 1BLNB 4DQOL 4M1CD 4IBZA 1MCKA 4XVUC 4ZO8A 4MS8D 3BAEH 4UOJA 3PWPB 2JELL 4GPVA 5SX4I 4FOMA 4LP4A 3ZZ1A 1EAPA 3OV6A 2A4EA 4WSKA 1M05A 5ESQB 4P57B 2ODHA 4Z7QE 5AVUB 3MV9B 5AUMB 1VESA 4ZPVA 3ZQXA 1GS7A 1YPZB 4OD3H 1E90A 4HAGA 3TBVA 5D6CA 1L9NA 3QQNA 3SCMA 1OEZW 1RHHB 4PJBF 4PP2A 1MCSA 3RPKA 5I15H 5IG7A 3FAWA 1KJMB 4PRDA 4KRPB 4OU3A 3IRCA 3WFCL 3M88A 4PW9A 3KPNB 2E75C 1JSYA 5C3TA 4TVPL 2P49B 5J1SC 5E7FA 4UOQA 2QR0B 1GGUA 5DI8A 3TV3L 3VSUA 2QL1A 3AREB 3F00A 2O30A 3IN0A 4DGUA 1IVTA 3RY6C 5AEAA 3T4YA 1SBSH 4JJ5A 3P02A 4PSRA 1EHNA 3OLGA 1GRWA 3GMQB 1UC6A 4O9HL 2G5UA 5DD3L 5HJDA 1CYWA 2GBVA 5J4MA 2F7IA 2FB4H 5LGHH 5KTEH 4F92B 1TQCB 3LMJH 1A1OB 5I28A 1T0PB 4NUJB 4P46C 2BVTA 4EOWH 5DGQA 3PU7A 1S9WB 1QSED 3FRPG 3EJTA 3QT2A 5A2IH 3DKHA 3VGBA 1MOEA 2FLBT 4PS4L 4TXVB 3G08B 3A67H 3O4LA 3HI5H 4LASH 4MJ5B 3RVXC 4TQHA 1Q8MA 4FNLL 5LXGH 3UEZA 1SY6A 4OVVA 2MKLC 1W0VA 4R96A 4NZUL 4WUKL 4G7YH 2VR6A 2O5JD 1DQMH 5DUJA 2BVOB 2OTWB 3H55A 2AF2A 1U6AL 4KDIA 1TZAA 4OIIL 3PLYA 4Z3TA 4RNRB 2I25N 2J6WA 4C83B 2E56A 1PF3A 1QTSA 1XCTB 4DEPB 2MQ3A 2FX9L 3BPCB 3CZLA 1E8ZA 1UVQA 4CMHB 2X4SA 4FXKC 3T6WA 4M6NL 1CZ8L 1X3DA 2EIKB 3SCMB 1KULA 5IB4A 5D2NC 3II2A 1LNUA 2APVA 4F8QA 1PD0A 2EYRA 3ZYOA 2JNZA 3FFCD 4WFED 4XN7A 3SJVA 5JW3L 1CICB 2PWGA 3GSOB 2JJSC 3A6CL 3M86A 2X1QA 4M02A 2OYMA 1B2WL 2EDXA 4OLUH 5IVZB 1K4CA 1KPUA 5IUCA 2WQRA 4PI2A 4NEHB 4JM4H 1DQKA 1TPXB 3FQYA 4PJ8D 4XNMB 4UTBA 1YY9C 5D1QB 1DVQA 1DSWA 1SN0A 2D4FA 4IU3B 3NJNA 2I7OA 4XPGL 3ZZQA 1FCGA 4TNVK 4U1SA 3U7YH 1DVUA 3DJ9A 1WCQA 4AAYA 2C9PA 3QYMA 2RALA 2CR3A 1OGTB 1MCJA 3B7UX 2WQSA 3GTNA 3BUIA 4X9BA 4KTDH 5CN2A 4XHJD 2RCSL 5GLFA 3MBEB 3E6HA 5EU3A 1BIIA 4NYLA 4N2OA 2NYKA 2NSMA 2VAJA 3CZGA 3NFNA 5J6SA 4CRYG 1PD1A 5L0QC 1VFMA 3I6GB 4LCYB 4W9FC 3PCYA 4UQAA 2FDBP 4YVUA 4AK2A 1NEUA 4AYFA 3H9ZA 3UABA 4RBPH 3QDGB 1T03L 5K59F 2ZE0A 2ZKWA 4DGVH 2J72A 5DMIH 4W9GC 5CZRA 3PDDA 2FEEL 5GSRB 4GS7C 3IDNA 1KIRA 3SE4C 4ELDA 1FYTD 1JZ6A 3O3BB 2CHNA 1VFAB 1NCAH 1DE4B 1XD0A 5FAAA 4EOWL 1C5BL 2FQDA 3ARSA 3OHXC 4PRPA 4G8GA 2FIKA 3HB3B 1SLVA 1THCA 2CHWA 3CHQA 1IGIL 4L5FH 3A67L 3DTDA 3P11H 3CD4A 1S5IH 3CWGA 4JRYA 1YNJD 1IJ9A 4BWWA 5HJ3A 2DM3A 1JJUA 4TQPA 5H2BB 3VI3E 3ZKNC 1U3HB 4JFXB 2BSSA 3NJVA 2YD3A 4AM0B 3RX5A 1NKOA 3E38A 4P2RE 2BOLA 2ARJQ 1G7PA 4OIIH 4N8VA 3REWA 1MHPH 3UROR 2G2RA 5DF0A 2I9LA 1DBAH 5TE7H 3QRLA 4NRYA 2VLJD 1DJIA 4FG4A 1X7SA 5EBLB 5CF3A 3PHAA 1XH2A 3C6LB 4ZMOA 1YYCA 2G60L 1KXQE 4PWFA 3HU3A 3RZWA 4YXKH 3LPWA 4UNVA 5ESVA 4JVUA 2YMXH 4YHOL 4HOZA 2QKIA 4IKLA 2X38A 4AG4H 5IMKA 3DMMC 4Q9RL 4K71C 1OP5K 4HC1A 3SDXB 4X4YA 2XPGB 3BLKA 4XBEL 3V55A 1MFCH 2ZUQB 2PCFA 3CBRA 3NCWA 4F15C 4YL9A 2J20A 3CK0H 4CVXB 1OSZB 5CCJA 1KOAA 2LVEA 4GW5A 4LPYA 5IROD 2B9BA 1TETH 4YSSA 4EIBA 3EZ8A 5HY9A 3S96B 2DY2A 3L3OB 5DYIA 5IT2H 1NEZA 2XWBA 4HH9B 2AKRB 2R51A 2J88L 2ADFH 4GUPA 1SYVB 4NPJA 4JAMB 1SJXA 3NDYE 3UC2A 1IBGH 4GRMB 5GLXA 2NLJB 1K8IA 2Z6FA 4D0BB 1QVOB 2OJ1A 3N42F 5C7XH 1TO5A 2D7OA 2RCSH 2V45A 1QPPA 1OT2A 2EIJB 3TGXA 2QSQA 1QEWA 3TOPA 1N0LB 3LY6A 3S88H 4H20H 1Z7JA 1EMTH 1KEGH 3H54A 4YDKH 5J1AB 2E7ZA 4N2MA 1CDIA 1HXMA 2Y2YA 1A6ZB 3D5OF 2IBBA 3N1PC 4HOMA 4OIBA 3Q5YA 2GPZA 3ATEA 4OFIA 4P4RB 2XACC 1D5XA 4R4BB 2X89D 4W6YB 1M7DA 5I19L 3AS2A 2NQDA 1RJLB 2WQVA 4QTFA 2FR4B 2QQKH 2Q6WA 5HVHC 4Z7OB 2F8OA 4NHUA 5FC9A 3EAKA 2LFEA 2C45A 2DQIL 1G6RH 3E2HB 5D1ZD 5D96C 3KPRA 1HQ4B 4GW4A 2F08A 4JDZB 1BMZA 5EC1B 3QS3A 2WMPB 4J3OC 3DYMA 2VSDA 5DLML 4LEXH 5DJZA 2CJSA 3BDYL 1UCBH 4ZD3L 1S5IL 3PWUB 5JNYA 3L08A 4R7VA 4H7VA 3GJEB 2P7TA 1K2DA 2BOBA 4OLVL 1NGXA 3F7VB 4TLUA 1VCAA 2VL5A 3FT3A 2HJKB 1MLCB 1U3ZA 3LRGA 2AJZA 3T4AA 4G42A 3HG1B 3QG7H 1P7QB 3QWNA 5E6IA 4Y5XC 3VQ2C 4JM2B 2WWOA 4IM8A 1P1ZA 5IJKA 4F7CA 1EEYA 1TQBB 4BEIA 3C60D 1L0PA 3MJ6A 4OZFB 1Y5IA 4D9LH 3GSNL 3PWUA 2G60H 4L3FA 5CS7A 5JNYB 2ZCLL 2NUPB 3KGTA 4IK7A 5F9DC 2HPTA 3MRCB 5F9OL 3G6JB 5H2BA 5JUEH 4QDGA 2LFGA 4KHTH 5I1LB 4XN5A 3B4NA 1QFWL 2BRQA 2K4WA 4JFHD 4ZT1A 1SJHB 5IB1A 5HGBB 3RIFK 3X2JA 4F5CA 2MQ0A 3QGVA 4DPCX 3GBML 4AENB 1S9XA 3EF4A 3MRMB 3QRBA 3HS9A 4XNYL 3UGEA 1Y7VA 3C9NB 1BZEA 4OF5A 5C0NC 5IQNA 1IB5A 4X6BB 4KAQH 4L4TA 1ZSHA 3VFOB 2P46B 4UYQA 5KANG 4YC2B 3UP1A 4HUUA 2DMRA 5FTKA 1RKRA 2HWZL 3E8UL 1E4HA 3WLBB 1E60A 1PS3A 5ESVB 4NSKB 3U6XS 2QT6A 3ZW3A 4BRVA 3UPAA 4F20A 5I2IA 3PGCB 1LJMA 3NZ8B 4GO8A 4LFHD 4PJ9C 4AH2B 4AE0A 5JA8B 4HHAA 3FQ1A 3MODL 2NMSA 3DSNA 2WXGA 2A77H 1FFNA 5GGUB 3S34H 1TENA 2E0PA 4UINL 5F9JA 2X9XA 4W4OC 4CL7A 4JG9A 5IHBA 1LK3L 3LQZB 4YN3A 2XN9E 4EMZA 5EIIA 1GS6X 1DVFB 5CN3A 1KEGL 4YDKL 1S2EA 2ZWLT 4M9PA 4WY7H 1XF2B 3EFOA 2DQFA 4ATWA 5IW3A 4HLZG 4TNGA 4DW2L 3GI9H 4KVNH 3BDXA 4L37B 4Z76A 5KVEE 3VXPB 2XU9A 5JMRA 1T21B 3KD4A 2FEDC 3U36A 1EU1A 1FQ9C 3MJ9H 4K15A 3RWCA 4J6IA 2HRLA 1IAIH 3F65A 2ZUTA 5JOFA 3LZFL 3MZTA 4PGBB 4MNGA 12E8H 2I60L 1IFGA 2PCYA 1JGLL 2DQIH 4I9WE 1VGEH 2IH3B 3L54A 1XF3A 5FYJD 4XVOA 5DVMA 1ZGLM 5IB1B 3ZSSA 2V2WA 3OAYH 4MCZA 1YUHB 3WHXB 3QQ7A 3HC3H 3DHPA 4DP6X 4YXHH 3DRQB 1BJMA 3W82A 3HVNA 1XGYL 5FHBH 1BF5A 3O3UN 5JPMC 5A6LA 1LNUB 4ODBD 2YA0A 3KPSB 1GYCA 2V7HA 2DBLL 3GLZA 5JQ6L 4LB8A 5JW4N 3BPCA 2WXPA 3LVTA 3SGJA 1YNLL 3WKPA 1JZDC 3GNML 3FUFA 2C3WA 2ILLA 3ETSA 4N5EC 4RETB 1RZQA 2HCZX 3FT4A 5T5ID 1NCTA 1KMGA 4IJTA 3ULUD 3JBG7 3HA0A 4K8RH 1DN2A 5L2JA 3NABH 5C09A 4WV1B 5BZDA 5B7FA 5F9OH 4MQXD 1ZVNA 2ICEA 4B27A 1DVFD 3WFBL 2X9ZA 3WS6C 2IQAB 2HTKC 5I16B 4PJGF 2PWFA 1PIFA 1S7WB 5GZNA 5CD5C 2PYEA 5EC2B 4ODXA 3H7LA 1NGQL 3OKEB 5DR5L 4PRNB 3GMMB 4OF8A 3WJMB 2Z91A 4KY1L 4XMVA 1VF5C 3K2UL 1ZLWH 4QRPD 3BEVB 5FA3A 3UJIH 1YEIL 2CU9A 5EZJB 5D1ZB 1HHHA 4DO6A 5EB9A 4OLXH 2EVHA 2V8MA 2Y7QB 5CJQL 1QAWA 4HALA 2G4GA 1A14H 1UVQB 4Q4IA 3QBTB 4JVWA 5ICZA 4KX7A 1XF5A 4PJFF 3RLSA 4Z7VE 1QLRB 4P5SA 3MBWB 1XWVA 5TGBA 1BDYA 2OL3H 1MRFH 2JIXA 2BZDA 3KL0A 1TZGH 3F58L 3GS0A 4L0ZA 1HH9B 1RXLA 4F7PB 2OZ4L 5CP3H 1SF5A 4NPKA 3SYPA 1ZANL 3P73A 3HLAB 1GCYA 3BIBX 3PGDB 2YD2A 4AL8C 3B9KD 1YYLL 5B39A 2DMHA 4L4VD 3TO4B 2LLNA 3I6LD 3L4WA 3MJ9L 2QADC 4ODSH 4ZFGH 5JYMA 2XV0A 3HZVB 3GDCA 4OW6A 1B0WA 1CXKA 2NZ1A 5BS0B 2WZPD 3H9SD 2FEJA 5DEZA 4QHNB 1JGLH 1AFVH 4QOKE 4K3EL 2OMYA 4NB7A 4J3SA 5H4ZA 1IE4A 2CO6A 3E8VA 1KY7A 3QXTA 5FW7A 3SE3A 4GFTB 4RISH 1BPVA 2FCBA 3WIIL 5DZPA 2GAEA 1TQVA 4WWOA 3B2MA 2GEQA 1NCHA 4LZKA 3RKDC 2NQ3A 4FHBD 5DJDA 1JFQH 5I76A 3MA9L 5JHAA 1SY6H 5I1JL 4NYLB 5AOKA 4F91B 5I1IH 4PJXE 2B9AA 5JHDE 3AXIA 1H6TA 3H85A 4A2FA 4LVHC 2CE6A 5INCB 4ALAC 1CN4A 2VDQB 4IYKA 3NP4A 3V2AR 2RHEA 5JXEA 5KUKA 4Z1PA 5F89A 1QFUH 4XMZA 4CADB 5DHXB 3BVXA 3O8XC 4ISVA 5IV2A 1QHQA 4HF5L 1P0SE 4HZ1A 3T8XA 4WK4B 2N7SA 2DQHH 3HAEG 4YX2L 2VLJB 2IPKB 4BZ1A 1HYSD 2B2XH 3MUGA 4DVRH 4NN6B 1WD9A 5DFTA 1PQHA 3WXWH 3QB7C 5I73B 4E0RB 4PGDA 1I7TB 1R19A 1D5ZA 1J0ZA 1CDHA 4PJCA 5D7SL 3T6XA 3NCEB 4PRPB 4Y16C 3RWIB 3VWJB 4Z7IA 3AU1B 3K6IA 4HLZH 3MNVA 1HHJB 3MN8A 4HIIB 3D6GA 1O6TA 2XWXA 2Q86A 3UTTD 5EOCH 5GGRB 4K71B 2X5PA 2LAGB 2Z31D 4F33A 5D71H 4U3SA 1RZ8B 3RILA 3DV4A 3NG5A 2W07A 5EN2A 1LHZA 1LP9A 3QE5A 3WD5L 3QEQA 1KYFA 5C07A 3IKCA 3MO1B 3RI5F 5E24E 1XDTT 2Q3XA 3P0VH 1XTLA 2CO7A 5LWYH 1FNEB 1ZRUA 5EEUA 3QJUB 4PBXA 5F0PB 3T6ZA 3PGDA 4HUCA 3ZGIA 2IFFL 2MOVA 4XPBL 2BDNH 5K39A 4BFFA 1DUZA 1K3ZA 1YCSA 2GKIA 2OMXB 4YPJA 3WEBA 4YXLL 2EEFA 5D5MB 5DS1A 1A4AA 4G6KL 2PXYA 3U9WA 4JFVA 3TN0C 4CSTA 3BQUB 3MLUL 4LCWA 2JF1A 4GB9A 2W07B 5EN2B 3LQAC 4LCVA 2WXMA 3N41F 3OBAA 2O5YH 4R7NB 5ICYB 1CDBA 1OZUA 3S3JA 5KJRL 1J8KA 1NLDL 1ID2A 4PJCF 1DUYB 2X9YA 4IBTA 5E1QA 3V0GA 1CDJA 3MJ8B 1IKNA 4DPBX 3WLWC 5J57B 5FYJL 4ZS7H 3OKKB 3V0JA 2ZWKA 4MA8H 4OZ4A 3BSGA 3O2VH 3GSNA 2EH7H 2FZ3A 1F3DH 3H42H 5LCVA 1GXEA 3MV8E 3F3HA 5B3SB 4QOKA 2VLJA 2Z65C 4E9RA 4AY0A 3EYQC 4XAKE 4U6HB 3FQWA 4PJ7B 4XCEB 1N6UA 2ATKB 3U4BH 3HNVH 1YO4A 3ZDXE 1ONQA 3CLEL 1KEML 2ZXBA 4UM9D 2H32H 4JHAH 4PJCB 4KV5E 5IHHA 2FUQA 4U3XA 4NM8H 3WIIH 2G9KA 3E2HC 3D2UD 3MLRL 2XETA 3GHEH 4OZHA 3DX2A 1QBLL 1YLBB 1DHKA 3IDMA 1HI6B 1XH0A 3LKOB 1JFQL 1KLFB 3PWLA 1TLMA 4K7PH 1QD0A 4PJDB 2WQXA 3TA3D 1AD9B 1SY6L 4PJIF 1CR9L 3RWHA 4X5XB 1J1XH 4JM2A 4YSAA 4Y4HB 3WMQA 2NNAA 3JVGC 3QZBA 3CDCA 1ZIAA 3FFCB 5IB3B 1T89C 1XCWA 2R69L 2KLRA 1CLCA 4HHWA 5ETUB 2GAZB 4HAKA 4N6RA 3QYCA 3CFDB 2D9QB 2HVKA 3DX6A 1OPGL 1HSAB 1WF5A 3CC5A 5J3HC 1BJ8A 4M43H 4EDWH 4MRCA 4YHIB 1HHIB 1CIDA 3MACH 5CAYB 1VERA 3ABGA 3K3QA 2Q10A 1L8FA 3SOBH 2P44B 4PJHA 1DQDH 4NO3B 1XB3A 3LXBA 1OT4A 3TFBA 4V1DB 3VXUB 1HQ4A 2LAAA 3MXVL 1EJ8A 4PD4K 1WA1X 3GPSA 1WEJL 1ETB1 2DYRB 5E8EB 4DP4X 5I73C 1P5UB 2V37A 5IIEB 4J27A 1UOLA 4BK5A 4U1JA 5E08L 1U92B 2R93A 2UX6A 3O3EA 4AW7A 1NPNA 4K55A 4WJKB 4UAOC 4W68A 3BGFB 4NCC1 1FGNH 1Q9LA 4PRHE 4WUUE 4ZFOA 3FUDA 3CHSA 3KJ6L 3TN0A 5IREA 4M8VA 5AKRA 3P0VL 4JEGB 1BEYL 2YMTA 3BLBA 3DECA 5CD3A 2PN5A 2VPYA 1PFOA 4LHUD 2VXVL 1Q1PA 1GGCH 4L4JA 4XNQA 2IGFH 2NNXA 1ND0B 3NSFA 3JQOB 5ID0B 5J8OA 1K72A 1AMXA 1NFIB 1SDDB 4PCYA 1BFVH 5JMOC 4KQ3H 2BC4A 1DVFA 3C6LC 3H3PH 4JANB 4CSSA 4FQLH 4Q6IA 1CL7L 5CGMA 4DZ8A 3P0YH 4PSPA 4V2CB 4HETA 3QUYC 2Y06L 2EXWC 3KR3H 3QPQC 3WUWA 4MA1C 2HFEB 3QIUD 5HHOE 1LE9A 1WICA 2V3EA 3CDGB 4KY2A 4POYA 2WQAA 3OLEA 4Y88A 3D0VB 3H3BC 3VTAA 4MA8L 2XWRA 4GMTH 3S98A 3PAUA 1MW0A 1WZAA 4PUBH 1EVUA 4AYDC 1MCIA 2M26A 4NPYA 3ULUE 1HOCB 2YAOA 1LO5A 3TXAA 4XC1L 2V7NB 1AD0B 3VFOA 3S8WA 3KNBB 3ET9F 2H9GB 3NQKA 1UB6A 4OB5H 1D7DA 2NY5H 4WEUD 2QMJA 5HHPB 3KPPB 4JM0A 5JIDA 3FCTB 3H9SA 3ABLB 3ILQD 4GXUN 3D50A 4GIPD 5GGUA 4NZTL 4I1RA 5FLVA 3X11B 3WTXA 1ZHNA 3NJFA 1QR1B 2WZ5A 3VD1A 4O58H