4JCWA

Crystal structure of clavibacter michiganensis expansin in complex with cellopentaose
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
202
structure length
202
Chain Sequence
b'MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and D78N mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
total genus 47
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jcwA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jcwA02
1L8FA 2PNWA 5GLXA 4ENGA 2G5DA 2ENGA 3X2MA 2AE0X 2PICA 2PI8A 3SUKA 3X2JA 4JCWA 4L48A 3SUJA 1BMWA 3D30A 3SULA 1WHPA 2JNZA 5H4UA 3SUMA 3M3GA 4JP7A 4ZM7A 3FT9A 3X2HA 2GAEA 5GLYA 3X2GA 2G6GA 2HCZX 4FG4A 1BW4A 3X2LA 3X2PA 1BW3A 3CZBA 1OA9A 5GM9A 4JS7A 3X2OA 2KQAA 1N10A 1OA7A 4FFTA 2PJJA 4FERA 2VXQA 1WHOA 4FG2A 3FT1A 1HD5A 3X2KA 4JP6A 4JJOA 1WC2A 2BH0A 3ENGA 3X2IA 4AVRA 3X2NA
chains in the Genus database with same CATH superfamily
1FORH 3LMJL 2B8OT 3HZ3A 4PLJD 1RHHA 2MCMA 5SWZA 3TZVA 4ZYKB 2WB1A 3L4YA 1DQDH 1BZQK 3SDYH 4OLVL 3U2JA 2IWFA 3HFFA 4G8GA 4QRRD 1YEEL 1IAKA 4YFDB 5I15H 1JGLL 1KJ2B 5JQ6L 4L4TE 5I5RA 3L8QA 3DGCR 1IEAA 2NY5L 4M1GH 3PHSA 3V6FA 4WTXA 4HG4K 3GMLA 1GGIH 4RRPG 2XN9B 5BOZG 3GBNL 3II1A 1RURL 4G8FA 1UKTA 2LU5A 3LD8C 4KQ4L 1IC1A 4PJ8C 3L95B 3MHZA 1OGSA 1QD0A 3WIHH 1AS6A 2IH9A 4J3XA 4M1DL 3IK2A 3HG3A 3UCQA 4B5EA 5C2UB 3T9WA 4PWFA 4ZMXA 2XNAA 5H4YA 3WFCL 2V6HA 5GRVL 3BMVA 3S4SG 4EDXB 1QO3B 3RU8H 2W9EH 3FHAA 3B9KB 3IEAA 5TE6L 1BFOA 4HFUL 3KPSE 2L3BA 3M8OL 2BC4B 3ZR5A 2NAPA 1C5DA 4NQVB 3KZ8A 3HI6H 4OCXL 4YXHL 2A4CA 5J06A 1URIA 4JO8A 1JTOA 1YUKB 1D7FA 1Q38A 4KWUA 4ZFZB 2NSXA 4F15B 1Z5LB 3CN4A 4OQ1A 3LQMA 4KK6C 5CZXD 5L8LB 3PPEA 1GGBH 1QLRA 1E8YA 4JG0H 9PCYA 4R4BA 1A4CA 2R29A 2V5SA 3EO1A 3QXWA 2XZCH 4ZMVA 2NY6C 4X8JA 3UAEA 2G2RB 2VQ1A 4K3GA 3MCKA 1YDPA 3NZUA 4MDJA 2NOYA 3GTTA 4FQXB 2EYTA 5JA8B 1HI6B 5DJDB 1JPFA 3WFBH 4AEFA 3BVWA 1Y1VA 4AYFA 5B7FA 1EHAA 2GBAA 1X4XA 3UMTA 2IQAB 4ODXA 3C8KA 1NLBL 3PQYB 5ICYB 3FU0A 1Z9PA 4KVCH 4Y19B 1B3IA 3K2IA 3HHMA 2E59A 4MFHA 4Q9CA 3SJVA 2NNAB 5K39B 1XGQA 4MJIE 1YAZA 2Z31A 3RAJH 5TQ2L 1AC0A 3QEHB 1SQMA 1ET7A 3G5WA 4M5YH 2QSCL 5HHNA 4R6UA 4CNIA 3C8DA 2Y5EA 1ONQB 3FT9A 1S9VB 2G9KA 3WUWA 4BM7A 3FB8B 2GJ6A 3KH3A 4WUKH 3AXIA 2CBMA 2M83A 2ZP9A 2C9AA 2CIKB 3NFNB 4IS6A 4QHKI 5I8CA 1WS8A 2HFGL 2VLMD 3ZU8A 4FAAB 5I6XB 3QDGE 3SDDB 1A14L 5IOPB 5G4MA 4L0YA 5GLFA 4S1SH 3W81A 5F7UA 2VDRH 1KY6A 4IOSD 5C3IA 3E6HA 5T1JA 5CD3A 2VYRE 3CIQA 5JHBA 4TNWF 3FTUA 1Z2KA 4FTVA 2IJ0C 5AVQB 4LLQA 5DZ9A 1FO0L 4J3SA 2YJLA 4UAOB 3BE1L 4UINH 1KCRH 4LIQH 1OA9A 1M05A 3EJRA 3NDYE 4KKBD 3SDXB 3HC2A 1TMQA 2BSRB 4ZUSB 4Z8FH 4YSOA 4OZIB 4MA8H 2D2CC 2KDGA 2IV9A 5DFVC 3R8BB 1F86A 1HWWA 2NNRA 4MAUH 5TE4L 1FQ9C 4KY1H 3OAZK 4BK8A 1WCBA 3FBQA 2J8UA 4LCWB 5I0YA 1NCGA 2BNUB 4FADA 1MAMH 3NABL 4R7DB 4DTGH 1CTOA 4OD1L 4F33A 3GMNB 3BUIA 4JFOA 5DUMH 1EHLL 2Y22A 32C2B 4BQ9A 1MELA 1ZJBA 2IALB 3QUXD 4JRXA 1VB9A 4KTDH 3SCMD 4WKZA 4JQIH 8FABA 4Z7QE 4KVNH 4TQHA 1LWHA 1CD0A 3TO4C 1WD9A 3UL4A 3ESUF 1GC1H 2PLTA 3QBTB 1UACH 4WJ5B 3FDWA 4JJ5A 3O3BB 4BSWA 4J3OD 5ENWA 3S2CA 4UQ9A 5BUAA 2XZQH 1RUAL 4M02A 4G6FB 1QP1A 3VGBA 1K3ZA 3F6IA 4WCYL 2HX8A 3C60A 3I50L 2VW4A 3HPLA 5E7BA 3IMRA 1D5MA 2IQ9H 3GGWB 1B6UA 2GEEA 2BE5D 1ZA3B 1J5OH 3BQUC 4HCFA 2V5YA 1UCBL 4GRLC 3SDCD 4JE0A 4YH6A 5J3HD 4JG1L 1OL0A 4X6BA 3LZFH 5F7MC 4ELME 4JHBA 1ZLDA 1JP5A 2FQGA 2XU9A 1AZBA 3MRBA 3WTSA 3TBVA 4B50A 2UZIH 4RRPM 4ALAH 2CLZA 1UXWA 2VLKD 3CMOH 3M46A 4ZJ9A 4YPJA 3OD3A 4KNSA 4OF7A 4NQXA 4DP5X 1BQHG 3MBEC 1MCRA 3B7UX 4A55A 2J8OA 4I3SH 3AG4B 2C9UA 1NLDH 3JWNC 1XGPB 2VJ0A 1AQKH 2X4UB 4BFKA 4W9KC 5KBLA 2I27N 5IY5B 4R7LA 4PS7A 5LBSA 1WBZA 3DRQA 1MHCA 1KN2L 5JHMA 4ZXBA 1MI5E 3T0BA 4MTMA 3ZTCC 1DE4A 3T2PA 4M3HA 4XN4A 4ZDHA 3IAPA 3WDIA 2K3TA 3LXAA 5AOLA 5F9WB 4TTDD 4PTUB 5H4UA 3L5XL 1YG9A 1OTSC 2ESVA 1PX8A 1WC7A 2Q3AA 4PJAB 3RHWK 4LLDB 2LQRA 3WDHA 2CJSA 4JB9L 1FL3A 4ZO6A 4Z7OE 4LGRB 4XP5L 1LE9A 1CE6B 2VN4A 2PXYC 3HNTL 2PPFA 5I30H 3A3YB 3LSOA 3X3FH 1FJ1A 3KLKA 1DJHA 4RAVB 3QDME 3WS3B 4X5QA 3AG1B 4LARL 2AKRA 3IWVA 4BDVB 3C08L 4GOSA 1J86A 2ZUSA 1G8JA 4M62L 2XVLA 4GUCA 4Q9RH 3O4LA 3JWDH 1A7OH 5TF1L 1NM9A 4PJCE 4DGVH 2V2WA 1L9NA 2GUYA 3R1GL 1FVEB 1XGTA 1AGDA 1SHMA 3QFJA 3P54A 1RI8A 5DXWA 3TVMA 2QVIA 4BKSC 5IVOA 1ODUA 3CZGA 2OJZH 4Y5XA 3V0EA 2ADYA 5F1OB 1U3YA 5KSAD 5BCAA 4NUGH 3TEYA 2BVPA 3L3JA 4YIQA 2BIIA 4RA0C 2VDQL 5FKPB 1TEFA 2QHLA 1R3JA 3O6ML 4FG2A 4G7YH 7PCYA 2NQDA 5D7SL 1KNOA 1T6BX 4K9EH 3CSYB 3K74B 4KAQL 3OC8A 2HG5A 1SIWA 5BW7C 1ASQA 1ZJAA 5L4IA 4G72B 4OLUL 2YGQA 2UY7A 1TWCA 5CLXA 2IANA 2CUIA 4PLKC 4XOEA 1FYTB 1L7TH 2B59B 1NCAL 4U0QB 4CW1A 3T0AA 4E9LA 4O00A 1R7RA 2DEYX 4WUUB 2FX7L 3ZKND 1G7IA 4PV1C 4OQTL 5AW6B 5IQ7H 3RWGA 1OGTA 5HHXL 1H5NA 5F96L 3BP4B 2P5EA 5CJXC 1WGOA 5DR5L 5EZLA 3X12B 4R0LC 3UAJD 1UZGA 3DARA 4XPGL 2KBGA 4AQOA 2KHAA 4TN9A 4NPYB 5KBMA 4CSZA 3MTRA 4GP8B 1UJ3C 5ECGA 3F83A 3UYPB 1RERA 2DQUL 1BVLB 3NZHH 3VM7A 1E2WA 3GMQB 1ZPUA 1KTDB 3SE4C 2NCMA 3CQQA 5E4OA 1B2WH 5EORL 3ZHFA 1BZ7B 3LVTA 2ZIDA 3NK4A 3EO0A 3O45B 3AADB 5I9QB 4ZNEE 4YDZA 1VEMA 5ALCL 4OFPA 1EJ8A 4RMQA 1XTLA 2ITDB 4QT5A 1QG3A 4V2CB 4MBOA 5CWSB 4RFNC 4BFRA 4ZMZA 4OGQC 3ABKB 1MHPH 1BWMA 1QHOA 4X5RA 3QFDB 3IU4L 3RNQA 3QVAA 5TH2A 4WU7B 5AW2B 2XFGB 3NP3A 4IJTA 1J9QA 3PP3H 1SBBA 2IGFH 3LAFA 3LKQB 1C08B 2ZCHL 3DGGB 5EZJA 2E27H 4B97A 3DVFA 3B7TA 4Z78B 2R69A 4FMKA 1P4BH 2QT6A 2BZDA 3TWCH 5IVXE 1AGBA 3M1BA 3BKMH 1E5VA 1JNLH 3H0GA 3G9VA 1LEGB 1RJLB 3I02B 1C7TA 4YN3A 5DMGD 3UTZB 1GZHA 5IKCB 2Q0ZX 4JGMA 4JM2B 3O0RL 4FGMA 3BHBA 5MENA 5CINL 5ITBL 1R3KA 3H7LA 2ICCA 1BOGB 4PRIB 3IDYB 1XMEB 2DQFB 4O2EA 5HYJD 4UV7H 3UC2A 4CA4A 5I1JH 4Q8BA 2NZ9C 3ZRSA 1DLFH 1LDSA 2C1PB 4L4VD 5IFAL 3BT0A 2EXWD 3GDBA 3RIAK 3PHOB 1BJMA 3FJTA 4FQIH 5F88B 2WXLA 3FQ1A 4OF5A 1MVUA 1FFQA 4AC4A 2NY7L 1A22B 3C9NA 4HAKA 2OMXB 1QABA 3N41B 4X0KA 4BHUI 4GFTB 1RHHB 4PJ9C 4FJ6A 3WIIL 1CFVL 5SWZB 3TZVB 5T8IA 1HHJB 3LNIA 3BUTA 2C26A 1CICC 2CO3A 3BFQG 1WFUA 4UV4H 4K94H 4NAMA 5CIPH 3WJJC 4G8GB 3UACA 3ELAT 1IAKB 4LPWA 2OAAA 3ALWA 4GO9A 3ARED 4A2EA 1AR1C 4WTWA 3FTGB 3Q8EA 4DW2H 3ZMEA 4POZC 1NCWH 1TJXA 1WFNA 1QSVA 2VLJB 2JB6A 1XF5A 1GGYA 4QRRE 4CN4A 1Y1WA 3T71A 3V6FB 4QUOA 4L0PB 5I8EA 3FQUA 4U1HA 4NKOA 4FNUA 3M45A 3ARWA 3N9GH 4G8FB 4LNRA 5CGTA 2OXHA 4JZJC 3TV3L 2B4CH 3BLPX 1WIUA 3DX2A 4K73A 2HH0H 1CF8L 2DQHL 5IB3B 5JR1H 2G75A 1WT5A 2ADFL 2UXGA 4EKXA 3H42L 1EFXD 3UBGA 1E90A 4Z3GA 2DL9A 2FHBA 1MPAL 1YY9C 1ED3A 1G84A 4Y2DD 4NENA 5LGKA 2R2HB 3ZHDA 1JZ4A 4F1ZA 3B8YA 3BPNB 4HWNA 4PCSA 1BBDL 4AXWA 4B9IA 4J3UA 5DQJA 2ROXA 3ZPDA 1QFWL 3VE0A 4S0TD 5HVHC 2L8AA 4KXAA 5EEXA 1TWFA 1PF3A 3MRGA 3IMVA 3U4BH 5C09D 4C55A 4TVPD 5D7KD 5EOCJ 4W4OC 4LQFL 4P23B 4Z7UA 2XETA 3T77A 2GCYA 4JO3L 4MXWH 2JKSA 3FFOA 2L7QA 1QLRB 2UVFA 4U1LA 3IFNH 4R4BB 3CN1A 3MJ9L 4X8JB 3L6FB 2VQ1B 4XHJC 3RJOA 3MCKB 3I9GH 4Z7VA 3LZPA 5ID0A 5IBUB 2EYTB 2RD0A 4NN5B 1JHLL 5JHLA 4QRBA 3MO1A 3U4AA 2XTJD 4AYFB 3NFPA 2X4SA 2X1XR 4GB9A 4ODXB 4QXGH 3QCUH 4UZSA 4Y16D 3C8KB 2VDML 2MTAA 1X5KA 3SOBH 3TT1L 1CLYL 4NQTA 1JZIA 4TSCL 2BFVL 5E56A 2RALA 1TSHA 3KPRD 1IGCH 2V8LA 1OF2A 3RKDD 4MMXA 4JO4H 1MFCL 3SJVB 1XGQB 4FYSA 2Z31B 1XAKA 4FG0A 5A3ID 1QDNA 1FPTL 2CRZA 4PY7A 4PAZA 5FYLL 3S34H 4EF3A 5JOFA 5FHBL 4K3DH 1M42A 2DV6A 2I32A 3MV8D 2VDNB 3VRJA 3T2NL 1TYJA 5HHNB 4D9LL 4O02L 4EXKA 2X41A 3RBSA 3SZ6A 3QA3B 3WUWB 3L45A 3QDJA 2ZWYA 5CZVH 1R3LA 2GJ6B 3K4ZA 3X2KA 2D3LA 4IS6B 3W9DB 5I8CB 2K3HA 1EPFA 2PNWA 4XNQA 1DQDL 3SDYL 2GY7B 1CYGA 3US0A 5MI0C 4U3HA 4OZGF 1WE5A 4PGBA 5I15L 4GAJH 5LNDA 3LRKA 3E6HB 3OZKA 1Z1WA 4IGBA 2VLME 3W56A 4BH8A 1DEEA 1CBJA 3MX0A 5CD3B 5FO8A 5AW0B 2XA3A 4L1BA 1G4MA 1YPZB 3QE5A 5GZNC 3D08A 2QADC 3EFOB 2R2CA 4LLQB 3HR6A 1MCLA 1GGIL 2R0WL 2VDLB 4OF3A 1UD5A 1M05B 1O7DC 4HKBA 2V7NA 3B5GA 3O3DA 1QEXA 1GSKA 4M6MH 2Q86B 3LRGA 2H7WA 2WOYA 3GMOA 4EJ1C 4HH9A 3QCVH 3BDXA 4YSRA 1LEIA 3ZT7A 4ADGA 4ZX5A 1XHHA 5AAWA 2W9EL 4DZ8A 4F33B 2AVFA 5FM8A 4JFOB 3VGAC 2AFNA 1K8IA 3FCSA 2Q3ZA 2DIJA 1TCMA 2HLEB 3ZIYA 5J1SC 1SVZA 1UD6A 1AR2A 1ZA6A 3TIDB 1QLFA 2YPVA 3DSFH 3OAZH 4NT6B 2CAKA 3QUMA 3HI6L 4WKZB 3RWJA 8FABB 4MA7H 3CFIC 2CJUL 2OSXA 3K2UL 2V9TA 1I1YA 3O8XC 1JGIA 4JJ5B 3MA7A 1SJXA 2AV1A 4DCQA 1HKLH 5AYUH 4BSWB 5GZOD 5F1IA 5ENWB 3KEDA 1ILSA 1FNSH 1NFDA 4XPTH 1JNHA 1GGBL 5IHZA 4JG0L 5CEZE 4R3SA 1YNND 1ZSHA 4XP9L 1DQTA 1U3HB 1A65A 5I16A 5EMYA 3HPLB 4UNVA 5FK9A 3V7AG 1D5MB 3OX8B 4Z3JA 1E7UA 1WICA 4DN4H 3GI8L 3WFBL 1FA4A 2DQ6A 5D2LA 1MG2C 5BVJA 4OCWH 1HZKA 2DQEH 3MOBH 4R83A 2CO7A 3MRBB 4R5VA 4XNAA 5CN2A 4HIQA 1DSFH 1TPXC 2AJZA 3TBVB 1B88A 4KVCL 3VRLF 1UB6B 2CLZB 1LEKA 1UXWB 2NX5D 4AM0A 2BVEA 1GGTA 3L9EA 2OL3A 4NQXB 2MH4A 1EZSA 1OAZH 2ZCLL 4QWWC 5D5MA 3RAJL 5T1LD 2Z4QA 1YEDB 3DX8A 4KOBA 2O6FA 2Y07H 3ZOAA 2VLKE 3ZK0A 1V3KA 1UATA 4JKPL 3BN3B 3L7FA 1WBZB 1WTLA 2EZ0C 3VFSA 4UT9A 4G8IA 2P43B 3NJHA 4YBQD 2Q87A 1MHCB 5T5MD 3ECQA 5D96C 4A7GA 4WUKL 4ZXBB 1LD9A 4Z7WF 4LL4A 3WIFA 4RGMB 1C1EL 1UM4H 4UANA 1MJUL 3MMEA 4ZDHB 2JJSA 3VWKA 1FNEA 4MYWB 1R5WA 1WUNT 3WN5A 3NJXA 4S1SL 2ESVB 1WC7B 4LSRH 2VDRL 1KXVC 1NIBA 2P80A 4AEHH 4GLRI 4L3ED 4IQHA 1FL3B 2D0FA 1WV7T 2F53D 1FZJA 4IBSA 5DA0B 2IO5A 3MLRH 1DBBH 5KVDH 2UY6A 4CU6A 3HFMH 4HV8A 4F7EA 4HEPG 3HG1A 4UINL 1KCRL 3LSOB 5DLMH 1FJ1B 4HLZH 4LIQL 5CAYB 1UKQA 2AEPH 2FX8H 1JVKA 2H1PH 2NZ1A 3GWJA 4MHHI 2AKRB 5A6MA 4Z8FL 5L8JB 4MA8L 3NJGA 4D0DA 3O4LB 4XWGH 2CO6A 4JFZH 2V2WB 4U05A 5DJXA 4MAUL 5EUOF 1J0IA 1Z66A 4KY1L 1XGTB 1AGDB 3MYJA 3NSDA 3VFPA 2JXMB 3QFJB 3D18A 3FUHA 3UBXA 4LAJH 1O5PA 3VA2C 2BY2A 5DGRA 2EE6A 4DTGL 1FAKT 4UI2A 5DUML 1IC5H 1X5FA 2BVPB 3L3JB 4BH7A 3WD5H 1XH1A 3MN8A 1R3JB 1EJ6A 2DJUA 3FO9A 1TTFA 3PHAA 4KTDL 1KNOB 4YK4C 4FQ1H 4FNSA 3SE6A 5T1KA 4GLRH 4WW1A 1UACL 3MLUH 3QI9D 3NA9L 3O9WA 4IIQA 3ZDZE 2BY0A 1PAMA 1SFDA 1HKFA 2UY7B 4FEIA 2XZQL 4K23H 3C6LA 4YDJA 2IANB 2CBQA 4CW1B 1EO5A 2KZWA 2HLAA 2WUCH 2F9BT 3EYQC 4M29A 1FSKB 1G7IB 3CN3A 1A6TA 5JYMA 4HXAL 4FMVA 3RWGB 3N1FC 1OGTB 2IQ9L 4Z18A 4LKXA 1J5OL 2P5EB 5EZLB 3KXFD 5GS2D 4BA0A 2DMCA 1URLA 2OJEA 3QZWA 3ZMRA 5AB9A 2IC2A 4XZ4A 4XNXH 4PJ6A 4U6XA 1JPSH 3NJFA 5FTLA 1OK8A 5JW4Q 1ROWA 3ZYZA 2UZIL 1HZLA 4ALAL 1AO7A 3CMOL 4H8PA 2K7QA 3BVNA 2YAPA 4HHAA 5E8OA 1RZJH 3BKJH 1BSIA 2PP9A 1IARB 1NLDL 3A47A 4WWID 3EO0B 3VXUA 1ML0A 5ALBL 5E6ZA 1XCXA 2YA1A 2ICWA 1P7HL 2YZ1A 3FRPG 1DBAL 4UQDA 4JY6A 4LFHD 2AANA 4BBWA 1USZA 5FPIA 2R0ZL 1RUMH 3BAJA 3VQ1C 5IR1A 1HK6A 4FS0A 4JL1A 1HHKA 2EDLA 3AROA 3RNQB 5TH2B 2EEOB 2K70A 1IM3A 4ODVH 4XMZA 4ZO7A 3S5LB 3TU6A 3OTTA 4QXVA 1EGJA 1PY4A 3OF6A 5D4HA 2XT1B 1CVRA 5EZJB 3UBFA 3WY2A 4L37A 4CMHC 3VXRD 5EU6D 4HLZG 1IBBA 5E2TL 5ADPL 1UURA 4LLAA 5HDBE 4UCFA 1AGBB 2P48B 3M1BB 4XVUD 3IMUA 4QRQA 5HI5D 4ZFOB 3RB7A 5I1EL 2J5WA 1YJDC 5I30L 1QVOA 3X3FL 4KVPA 1ASPA 1CZ8H 2AXJA 2EDTA 4FP8H 3ZDWA 4DF9A 4Q9RL 3JWDL 3BHBB 5MENB 3G6JA 2EEAA 4DGVL 1R3KB 3VMPA 5E6IA 4K5MA 3D50A 3WMQA 1JYVA 3CFBA 4O2EB 5I1LA 4HU2A 1DBJH 1CD9B 1T89A 2OJZL 4FKEA 2WKLA 2OMYA 4P46D 2GTWB 25C8H 4NUGL 5J12C 2WVVA 2JJTA 4Y16A 5HYJE 5KSBF 4YSEA 2CJTA 4YWGH 5BO0D 1FGVH 1MVUB 1NBVH 4K9EL 4D8OA 3ULUH 3C9NB 3TJEH 4FX5A 1CWVA 4ABVA 2Q7YA 2VXVH 1BD2D 3IS1X 2VQTA 4N0YH 2HT3C 3I2CH 2MNWA 4ODBD 4MHHG 5JIQA 5LUMA 4X80H 1D6VH 3VYOA 1MOEA 3F6LA 1KUMA 4HJUA 3REVB 1L7TL 2D4FA 5E9NA 5K69A 4EIZC 3HBQA 3CZUB 4YDKL 2YGPA 2B20A 4JJHA 4M6NH 4UMGA 2JB6B 3U0WH 4IDLA 1E4XI 3ARDD 4WZ9A 3TX4A 5I8EB 4C4KT 3SGKA 1E8XA 15C8L 1WCQA 5EBMA 3FQUB 4U1HB 3HPJA 4NKOB 4WIQA 5BV7C 5LWYH 1T5WA 4LNRB 5KYWB 2OXHB 2ZAGA 1AQHA 3U6XS 5FDWA 3BPOC 3GJFK 4L1TA 2K8MA 3VGDA 2X9XA 3NSJA 1B4TA 4KJPD 1TCRB 4LVNC 2G75B 4PJ8A 1C8QA 3QO1A 4O4YH 3VI3A 2XCMC 4ZI8A 1PYWA 2EVJA 5D8JL 1MCCA 1ZC1A 1B2WL 5DCCA 4KMTH 1R34A 5I0XA 4W4NA 1NAMH 4NENB 4JQXC 3GRGA 2DWDA 3T09A 3VGGA 4AXWB 2FE0A 1U95A 1J05B 4R7VA 4U1GC 1BQKA 5DQJB 3RVWC 5LNGA 3AXHA 3SQRA 1MHPL 4KKPA 1F5WA 5IW3A 2AS5M 1E4XH 1JZJA 5B39G 3MRGB 1UCTA 4JQVC 4OD2A 4PJEF 2IGFL 3T77B 4Z7UB 5FS5A 3VD2A 1T2XA 2GCYB 3LH9A 3ZDXF 3CFEA 3PS6A 4U1LB 5KSAC 3IDIA 1OO2A 2E27L 3L9RA 2WINA 1DDHA 3W37A 1RZIA 5DJYB 5C09E 1P4BL 5MP6H 4TVPE 4Z7VB 5D7KE 4IEFA 3RFRA 2UWEF 5ID0B 5CUSL 1XF2A 2G3XA 4GSDH 3T4AA 4YVUA 4AJYV 3MO1B 4WFFD 3KL0A 2X4SB 1IIKA 3K5SA 4XAWL 1A6ZA 4ZFGL 1D7BA 1SOXA 2XPYA 4UYPA 4JVUA 1Z9MA 2Y7QA 3QIBD 2LU4A 4WI0A 1E5UI 1SLWA 2DJMA 4E9RA 3RZCD 2E6PA 3CX5K 4X4KA 4MMXB 1I3VA 1GOFA 4UV7L 3ZKNC 3LN9A 4IOFD 2RJMA 4KX8A 1BVOA 2ZOKB 3QNXA 4N9GA 4NSKB 2ZSVA 1DLFL 1H15A 1YY8B 1M7IA 3KPRE 3MUJA 1G7JA 5IEKB 2R2EA 1T20A 4CC4C 2VERA 4R4FH 3VRJB 5FB8A 3QNYA 2CDEA 1NUNB 3EJTA 2EC8A 3NAAH 2CWRA 1QR4A 2KL6A 1SOSA 3KYMA 4UT6H 3TO2A 1YQVH 3WFHA 4CILA 3QDJB 3ZTJH 1R3LB 3E3QC 3MV8E 4P2OD 2Y7NA 1FFOA 4XNQB 5AUMA 1G43A 4LASH 1QX1A 4GG6F 3CQZA 4UV4L 2XN1A 4K94L 4Q0XH 4DGIH 5KVMC 4UIKH 3KH4A 4AJWA 4KKZA 3L4ZA 4PGBB 4YSSA 3P3TA 4EMZA 4D94A 4DW2L 3NSXA 4IGBB 4BH8B 1NCWL 1DEEB 3MX0B 4EI5D 5FO8B 2ODHA 1G94A 4X98A 4H20L 3TOPA 1CPUA 2PYED 4NNYA 4PD4K 1XCTA 2EACA 3ZX1A 4OJAA 2NVXA 2IADA 4HKBB 2V7NB 2B4CL 2J2ZB 4Q2ZA 2OK0H 1KJ2H 2JJWA 3IB4A 1T7WA 2DH2A 3NQIA 4HBCH 4N5ED 4PJFE 5IHWA 2X6VA 3GMOB 3OXSA 5JR1L 2BWDA 2VPWA 1AD9B 1A6WH 2EDYA 2ALWA 2KMWA 4FJZA 4I3GA 3RL1B 1LEIB 5DHEA 2AK4D 4E9VA 4IIZA 3J7HA 1GGUA 4PWKA 1HXMA 2C3WA 4DZ8B 5AYTA 3X2QB 5IG7A 2X3BA 3NPSC 1K8IB 2VLRA 5A1AA 2ZG3A 1B4LA 4G11A 2X6CA 3LQAC 1ZA6B 1UXLA 2V5TA 5CJQH 4YS4A 1QLFB 4LPVA 3RWJB 1XIWC 5K9OA 5HD8C 4Y4HD 1CIDA 3O2DA 4TUUA 5TQ0H 5JW4R 4HWEH 4QJ4B 3MA7B 2AV1B 5JORA 2DLTA 3BSGA 3TO4A 4GMSH 5F1IB 4Y4FD 3U4BL 1NOLA 1LO5A 1NFDB 4OLWH 3CLFL 4MXWL 1JNHB 1AZRA 5IHZB 4MMYA 4UBDC 3IFNL 4R3SB 1I3GH 4Y89A 4AYMC 3CK0H 4TMPA 5I16B 3ENEA 1OB0A 5D1ZD 4C4UA 5FK9B 1PSKL 3H2PA 3I9GL 2CO2A 2KZBA 3QSKB 2OYKA 4XPBH 3ZT5A 2EIEA 3QJHA 4KHTH 1M2VA 5IB2A 1DMRA 4XODA 5BVJB 5DUBA 3AACA 3KG5A 2CO7B 3FZUC 1H3WM 1ZTXL 3OSKA 4PJDF 4L3CA 3T5WA 3TFKC 4WHYG 4B60A 3CXDH 2CHXA 2VR5A 2AJZB 2AW2A 3SOBL 4G8AC 1IILE 3LXUX 4XVSH 2HRLA 1TZHA 3V5HB 4AIXA 5GIRA 1KBWA 1LEKB 3F58L 4AM0B 3CFQA 3AREC 4IYKA 5EIQA 1A6VH 1XD1A 4JO4L 3GRWH 2HSIA 4QYOA 5FV1L 2Z4QB 1HYRC 4Z9KB 1NIAA 5IT2H 2QMKA 1REIA 1TZ8A 2QTEA 3GXFA 3K6OA 3MBEA 2NX5E 3S34L 3HNSL 1G0YR 3FQTA 3ZTJG 1FLRL 4K3DL 2EE2A 5GJSH 1BEYH 3F7RA 1ZT4A 1WZMA 2D7OA 2FNBA 1WAAF 3Q2NA 4HFWB 4P2QA 3VFSB 3L7FB 4H8WH 5E6RB 4G8IB 2OKMA 3VDBA 1RZKL 4FFZH 5CZVL 1QSEA 1OGAE 4MZ2A 1YUHA 1JE6A 1LD9B 3ASNB 5C0EA 3QJQB 3WIFB 2XOTA 3VD3A 3MMEB 3VWKB 1FNEB 1R5WB 2DYSB 3WN5B 5AVZB 1LO0L 2AV7A 1N64H 4HOZA 3BISA 1HL9A 1N12A 2NQ3A 3BZ5A 3Q3GA 4Y2DC 4YUEH 2CKNA 4RGNB 4P57A 4B9CA 4X7FC 4PB0H 1UHVA 1BGXL 3HJEA 3MRKA 5E4EB 4YAQA 2QHRH 1FZJB 2WYZA 4PJGA 5CHNB 5FF6A 2VISA 2UY6B 3AY4C 4HV8B 4F7EB 3H3BC 3B9EA 1BFVH 1Q0YH 3HG1B 4HJ1A 1P1ZA 1CTNA 4L3EE 4TNGA 2F53E 4OLXL 2JI3A 4LCVA 4M6ML 4ZW5A 1MFEL 1PZDA 3ETTA 3RUGF 4D0DB 2H47C 1O9VA 3VXRA 2R0KH 3Q1EA 1M56B 4CRYG 3CLEL 4LSSH 5EDXA 1U30A 3FRUA 1DANT 3AMLA 2R15A 3VFPB 1K4CA 2Y5TB 3D18B 3UBXB 3LVEA 4OD3H 4JHUA 3D0AA 4X9GA 5CJ5A 1CT8A 2VXUL 4X9YA 1CGWA 4BH7B 1S78D 4E5XG 2IAAC 4KK9C 1XXDC 3SYAA 2GBVA 2HJFB 3FO9B 4V1DD 4R4ND 4FD0A 3DSFL 4YL9A 3R4RA 4A39A 4MA7L 5DC2A 4DPAX 2DBLH 2NY0B 4IBTA 4B3VA 5T1KB 4WW1B 1VEOA 1I1CA 3Q6FA 3O9WB 1LP9A 1HKLL 3A6CH 4IIQB 2D8KA 2ZTBA 3B1UA 4L4VB 4OVVA 5FO2A 5AYUL 3GYRA 4ZO8A 4PJXA 4YDJB 5CD5C 4RDQG 3H85A 3QEQA 1L6ZA 2Q7AA 3TEUA 1GVIA 2HLAB 1JI1A 1K2DA 1OP4A 1PEWA 3HI5H 3TJHD 2QFRA 4F92B 1A6TB 5KBKA 1BD2A 2YOAA 3CVHA 3P3YA 3ERXA 3QFGA 4LKXB 4DN4L 3BH9A 4ZMYA 1YEJH 1A7RH 3VYNA 3MOBL 4LDLB 2QPDB 1HH9A 3QZWB 1MAKA 4HGWA 5C08E 5CJXA 3RTQD 2WQVA 4U6XB 3UMNA 1FC2D 1X4YA 3KXFE 1NC2D 4N3TA 4ZUUA 3HAEA 4JO1H 1AO7B 3MVSA 4PIBA 5ACMA 4I4WA 5C0NC 3EG9A 4HHAB 2IH3A 5E8OB 2XV3A 3PWUA 2NYZA 2OCCB 4TL5A 2Y07L 2YD9A 3NJIA 1PPIA 4QNPF 3SE4A 1K72A 3VXUB 2NDGA 1J18A 4B41A 5FECA 1U8JA 1SY6A 4GQ9H 5A2CA 3OC5A 2H5UA 4MJ4A 1OAKL 4Z76A 5B3JF 3IVKA 2HA1A 2BLFA 5E1GA 1G9MC 3MAWA 5IM7B 4JY6B 1EFXB 1BYOA 1MVYA 1WFTA 3JVGC 5D70H 3K6SB 3GDCA 3M86A 1VA9A 2L0DA 3BOVA 5IR1B 2YZ8A 3JVFC 2OZ4H 1HHKB 1BA9A 3TA3C 1UM4L 4GRWE 3LKOA 4FEMA 1IM3B 3A4EA 3SD2A 3VWJC 4CDHA 3BC9A 4JFEA 2NZIA 3LRHA 4LSRL 3QAZC 3V4VB 1HNYA 4L37B 4AEHL 2C7UA 2MWCA 1C9SA 4B53A 4JNXA 3IPFA 4ZW6A 3VO0A 3WCYA 1DBBL 5KVDL 2QELA 3HFML 5JYLA 4GW4A 3QUKA 4YZFF 4AYDC 4BRJA 1J8HD 1QVOB 5EU6E 3U7WH 4I8DA 2AEPL 2FX8L 5F7LB 2H1PL 1ACZA 3CFUA 5KVFH 2RIKA 2XIIA 1KGUA 4NJAH 2WQUA 3F01A 3UADA 3PP4H 4P4RA 4XWGL 5LAXA 2V9RA 3QXAB 2IAMA 2VSDA 4L0ZA 3CFBB 5I1LB 4F2EA 1KXQE 3VGHA 5GLYA 1TQUA 4JHZA 3X1FA 1NGWB 1WUZA 2OMYB 2EC9U 3KAAA 2XTJB 3KYOA 1FFNA 1IC5L 1CBVL 2WVVB 4Y16B 4AQAA 1SJVA 4OSUH 1QEWA 4ELMA 4EZJA 4RMRA 1KGYE 1AZNA 2WLZA 3U4EA 4F2ME 3O6FD 1OOWA 3ZO0A 1L9PA 2YC1A 2Q7YB 5DEGA 1F18A 4M5SA 1N18A 4LHUD 2J3SA 3SBRA 2D0GA 1JUFA 2X89D 1IVLA 3ATFA 3ZZ1A 2BNQA 3MPCA 3LHPH 1I85C 1J1OH 5EU5A 2ZXQA 1A7PL 4WO0A 3V4PL 4Y4KA 1CICA 1JF1B 4KQ3L 2WUCL 2VPXA 3BYTA 4K71C 1HINH 2ZKYA 1QKZH 5KS9F 2W07A 3WJJA 3IXTB 4OGZA 1QW8A 5D4IA 2PYFA 2VN6A 4XXWC 4B7LA 1MH5B 3HI1A 1CXLA 2V17H 4DWHA 5GJTH 3HPJB 2XACC 4P48A 1T5WB 2QJDA 4GXUM 2O61A 1CFQA 1JPTH 2B14A 3NN8A 4EDWH 1HWGB 5IVNA 4N86A 4AI7A 2EXYD 4DGWC 1RK7A 4XNXL 3H2WA 1BMWA 2Z92A 4N8PA 3TN0D 2Y1ZA 3LD8B 3VI3B 2W88A 3QO1B 4BSVA 3HUJA 1WAEA 4N90D 4DK5A 4MD5A 4DO5A 1VACB 3SB3A 3BKJL 4IBQA 4DN3H 4U1IB 1TZGL 2BHFA 4BE6A 3RHWF 3W57A 2YUWA 1E42A 2B9BA 2EXSA 4L4JA 4JHWH 2DWDB 3T8MA 5HI4C 3L3HA 5KG9B 1L9QA 4LCUA 4L5FL 3SKMA 3T0ED 5AVXB 2WNWA 1GHFL 5E95B 1RUML 3QG7L 1SXZA 4YSCA 4U1MA 4PWEA 3ULVF 2YBRA 2NY5C 5AW5B 4PHZA 4DAGH 4OD2B 5GM9A 2EIKB 5IEHB 3SPHA 3PGFH 3AS0A 3CFEB 5LDSA 3IDIB 3Q06A 3D3VD 3L9RB 4WWNA 5IVZB 2WINB 1DDHB 5LCVH 1RQ5A 3HU3A 3MLWH 4JFFA 1RZIB 4W4OA 1JK8A 2XWDA 3BVUA 4IEFB 3HIZA 4DK3A 1BLIA 2H3NA 4LPCA 4XMVA 3T4AB 1JERA 4H7VA 2B63A 3FT4A 4ANXA 1P6AB 2UX6A 3RPIA 1G7LA 4LT7A 2AP2A 1A9EB 1DJIA 1NMBL 1CDCA 4FP8L 3OBAA 1E40A 2QEJA 4F9PC 3FTZA 2F0CA 5BOJA 4FI6A 1KFAH 2WWKT 3QPQD 2Y7QB 4WFFE 2IF7A 2BY1A 4WI0B 4B9ZA 3UIZA 1UH3A 1DBJL 2FLRT 4FYTA 4HF5H 4OY9A 3V5KA 1X5AA 1YYLL 3QNXB 2HLFC 4N9GB 2ZSVB 4K7FA 2H0PA 1H9VA 1H15B 2IPUK 25C8L 1KTKE 4LU5L 1M7IB 2Q2LA 1ODAA 1G7JB 2G5DA 2R2EB 1T20B 4X4MA 5FB8B 3QNYB 2CDEB 4PVBA 1A9BA 4YWGL 1HYSC 1FGVL 3ULUL 4N5UA 2VM3A 3KYMB 4OGAD 3PAZA 5DMJB 3TO2B 3BWUF 3P30H 3OR6A 4N0YL 1NEPA 3I2CL 4M03A 1D9KC 4HC1A 3ILPA 4HBQA 3GKWH 2WUBL 3V0WH 4D9QD 3KYNB 3IR6A 4EO5A 3GRBA 4X80L 1D6VL 1FFOB 1TYRA 1U8KA 4OZFA 3EH3B 5AUMB 4AV5A 1XR9A 1PFOA 2E2IA 3O3AA 3UC0H 1M53A 5T3ZD 5C1BA 1BJ1H 2B7DT 3WHE1 5FKAA 4W1TA 3WFDH 3SKJL 1ZEAH 4PRHD 1GS8A 1DFXA 4M6NL 1LL1A 1F6FB 4Z3FA 3T6XA 4YOKA 2QV2A 4JFWA 2BM3A 4NNYB 2OYPA 3X2HA 2FB4L 1XCTB 4HKZA 2KZKA 5GZNA 2PW1A 4RNRA 1TJIH 1M3IA 2IADB 3MA9H 2F58L 4MQ7A 2ZKHH 3D48R 3OXSB 5C70A 3BSHA 2HT2D 3OSVA 4JY4A 5I6OA 4MD0B 5I6LA 3UGEA 2NYYD 1NCUA 5J11C 1JGDA 4X99A 2DN7A 3AG3B 3DKHA 4KH9A 1IGJA 1OGPA 4KMTL 4JPKL 5D1XD 2DLIA 3B1TA 3QZBA 4GBXC 5IG7B 4YFEA 2VLRB 1JIBA 4N1EA 4UOW1 1F3DH 2FWOA 1YNTA 2OR7A 1KTJA 8CGTA 4BGDA 2AK4E 4AWJC 4ZM7A 1U92A 3D7PA 2MPAH 3JTTA 2BIMA 3VUAA 3ZMNA 3FKIA 5K9OB 3OKKA 2N7SA 4OH2A 1ETB1 1HXKA 3QAQA 4MA1B 4JFXA 3QUZA 1MJ7L 4CMMA 5JORB 4XO9A 3KD4A 3W5MA 5TE7L 3TO4B 1XCWA 3CFJA 1NDMB 3TBYA 2OLDA 3RGVA 3IJ8A 5GS1A 3O8XA 2CPCA 1E5YA 2WLHA 1ZVHA 4MMYB 1KXTA 3KLHD 2CHNA 1I1AA 2HTLC 3NIGE 1BXVA 1T4WA 2VH5H 1OQOA 1KPUA 4GSQA 4Z95H 5MP6L 4ETYA 5AAPA 2YPKA 3QI9B 2Y3NA 2E9JA 1KV7A 2FIRT 3ISYA 1M2VB 3RIAF 4FQJH 4QHMB 5IB2B 3DBSA 3N2JA 4O2FA 5DUBB 5FA3A 1H3VA 3NIDE 4KXDA 3H9SA 1CFBA 1N8ZA 3CFCH 4N85A 4L3CB 4DKDC 1MCNA 1EBAA 1I8UA 3NJNA 3KJ6H 4NIYE 4AVIA 4F8TA 3KWWB 5GIRB 3PAYA 3SY6A 1AVAA 2WQ8A 4QYOB 4B7IA 4KV5E 2D3NA 3OV6A 3ARDC 3MBEB 4X6DF 5E4IA 2CE6A 4KJWC 3BMWA 4I88A 4N0UE 5DZVA 1ZT4B 1YLEA 1OAYH 1NOAA 4P2QB 2CLRA 4QOKD 5LXVA 2CG9X 5CSZB 3IMBA 4YR6B 4PRBA 2NT1A 5BZDB 1QSEB 1EQWA 5F7AA 4KJPC 2P9RA 3A6BH 5C0EB 2QKIA 3DUSA 4RVBA 4LASL 4LMQI 3TV8A 5E8NA 4Q0XL 4DGIL 4KK5D 2VDNH 1KZYA 3P2DA 4M7LH 1U2CA 2A4ZA 1U21A 3NGBB 4N2AA 3DIVA 4P57B 4WK2B 1F0LA 3TYGH 4GAGH 3G6DH 2WBWB 2ENSA 1CXEA 4PJGB 3UTPD 1OTUC 2VISB 4NN6C 3V9EA 4R84A 5K59E 1IX2A 1P5UC 1AKJA 1U8IB 5CP7A 1P1ZB 1DDTA 3PWPD 5L4JA 5KYYB 4G8EB 2YPLA 1JCKA 4NZUH 1TNMA 3MRFB 3B6SA 3GIVA 3ZE2F 2OK0L 2I26N 1X9LA 3FF7A 4LEOA 2LT9A 2Q76A 3VXRB 4HBCL 2WCPA 4HJJL 3I3BA 2ISDA 5HGGS 4X9FA 3FRUB 1A6WL 2VW6A 4NQEE 2AQPA 1K4CB 3D51A 2VDLH 3DJTA 3STZA 2I60H 1J8HA 4KI5F 1CT8B 3X11A 3VXMD 3NQKA 1PG7X 2GBUA 4RBPH 3OMZA 5C3TA 3MLVH 5CJQL 5IFHH 5C0FA 1N6UA 2KQMA 1BG9A 2HMID 3KWTA 3NOIA 4KX7A 2XG5B 5F93C 3S37X 5TQ0L 1GCYA 1R0AL 4V1DE 2E9IA 2NYKA 2WXMA 1MFMA 3Q6FB 4X7SH 4Z3HA 3IDNA 1LP9B 3APFA 1W15A 3H56A 2R7EA 3PIQA 4QF1A 4GMSL 4PJXB 4UF7C 2XN0A 3CJJA 1INEH 3QEQB 3IPBA 4H0IA 4J28A 2YUVA 4OLWL 2EXTA 2KC0A 2JIOA 1K2DB 4MBRA 1I3GL 3A21A 3NSYA 2KQAA 2Z8VC 1BD2B 4ZOAA 3H3KA 1PY9A 2CDFA 1A47A 1DVXA 4UWQB 5FYJH 4HG4J 4XPBL 3DDFA 3L5IA 1X9UA 4KHTL 4OZGE 4XAKD 3IN0A 2X89A 3T0DA 2JIXA 3TA4D 3BH9B 4DO6A 2JKNA 4BE5A 3NEXA 1WCMA 2MCPL 2OW6A 4XMLH 4HGWB 1HH9B 3X1NA 2AXGB 4P5TC 4FHBD 3V79C 5D6DA 3CXDL 1HVXA 3ARGC 1JL8A 1K6QL 1NL0L 3GKZA 4NC1E 1CGSL 4NO0D 2HXAA 4RIRA 5F6HI 4ZUUB 3HAEB 2DDQL 3DRTA 1ZSDA 4I4WB 5JLZA 4G70B 1A6VL 1DFBH 2FBJH 3EG9B 5EFIA 3WMSA 2IH3B 4BELD 5JIPA 5TTRA 3VFOA 1OE3A 3GRWL 3PWUB 1UZ6F 1S5HA 1MRDH 5FV2A 5AKRA 5K1JA 3GJEA 5FECB 1U8JB 1ULVA 3BKCH 7PAZA 4RV0A 5GJSL 1BEYL 4XX5A 2NT0A 4Z76B 2W0PA 3GC3A 2ODIA 4H8WL 1IE4A 5FM4A 4TSAH 3EJZC 4FFZL 5DDHA 2EO1A 3BZ4A 3VG9C 3RDTC 1MW2A 2WM0A 3EOBA 3LKOB 5JHDD 4BFEA 3D69A 5CR1A 4G7RB 3SGJC 4WWKC 3WKNA 1F11B 4JFEB 1IGFH 5AW7B 1JZ7A 5DC4B 5LBSH 2EH8L 3JWOH 3QQ4A 4RMUA 1GAFH 1H8OA 2X2JA 3C5ZC 1BCIA 3FF8A 2J1YA 2C7UB 3PWNB 4MVBD 3DX7A 3GINA 2XWCA 3P4MA 4PB0L 4PHXA 5FUOH 4GIPD 5FYLE 3GSOA 3UZQB 3IETA 2QHRL 4WI9A 4KMLB 1Y1DA 4PJHA 5GGRY 3ESPA 4GW4B 3QUKB 1BFVL 1Q0YL 5KVEH 2IPKA 2DL2A 3VMOA 5C71A 1OHQA 2ZT9C 3FC8A 1KCUL 4JO2H 1C16B 1QFPA 3IF1A 4GKOA 3BGFB 4P4RB 4N2KA 3QUYD 4N25A 5I8KL 5LAXB 4MMZC 3OUGA 2R0KL 4HIPA 2IAMB 3P3RA 3PDOA 3B37A 4C56E 4OCMC 2EDBA 1XSKA 1MCEA 4JDZA 4WFGD 1E4KA 4BFFA 2DQTH 3IKCA 4TQ8A 2JLLA 4L1DA 5D1ZC 1BFSA 3I75A 4DERA 2AC0A 2DS4A 3F00A 2Y72A 3KYOB 1FFNB 4PVNA 5JQIB 4NGHH 4AQAB 1RIVL 1QEWB 3OQ3B 5IZ7A 2EABA 3W39A 2IDSA 3P0YL 1JPGA 1BQLH 2P49B 4GEJA 4CDGC 3U4EB 1O7VA 2J6WA 1UQSA 1PFCA 3FT2B 3RZCB 3EAKA 3KJ4B 5DEGB 4N2MA 3EHBB 2NY3C 1S7UA 1OT4A 1JUFB 2VXSH 3A6CL 3VB8A 2WANA 1CZ5A 1EJFA 2BNQB 4LP5A 4TVSa 4HKXA 5EU5B 3WXVH 5B7EA 3WSQL 1O6VA 4Y4KB 1RIHL 4LEBA 2QTVA 1HX0A 2BK8A 5FUZL 4Z7WE 3UTSA 4PG9A 4XH2A 2X05A 2JH2A 3ULSB 2W07B 4UQCA 1HIMH 2PYFB 3MOAH 2AERT 3VTMA 3HI1B 4B5ZA 3JT2A 1MCJA 2GJZA 2O61B 1NCBH 4PGZA 1CFQB 5CP3A 1QTSA 1BF2A 4ZZFA 1X7QA 2WNGA 3MV9A 3G6AA 1INDL 1IO4C 2Z92B 3KWXA 1OM3L 3FQ2A 4ZFFA 3PJSA 1TTGA 4BSVB 4G1MA 3HUJB 2FJGB 4KKQA 4MD5B 3BXNA 2PYEB 1IEBA 2ZAHA 3HLKA 4NAQA 1J87A 3P77B 4RQQA 4YSDA 5EUOE 2DMHA 2EDEA 2F19H 3S2AA 3W1ZA 2DLFH 4AGOA 2IBZY 3K46A 3L3HB 3PF2A 4ZQKA 1WEJL 4OZHA 3SYPA 4JQXA 4LCUB 3SKMB 2O93L 1Y7VA 2LR4A 1B0GB 4KNTA 5D70L 1AIFA 4POUB 2JQAA 2YLKA 2GVYA 4U1MB 4ABQA 3DVNA 4AY0A 2OZ4L 3SDXF 1I7TB 1NEZG 4HSCX 2YBRB 4OZIF 2AJYL 4OAWA 3FK3A 5AOZA 3GXUB 3MGOA 5KSBA 2E56A 3WKQA 4F58H 3L1OH 1Y4ZA 4YHYB 2AJUH 1S78C 1IKFH 4JFFB 2CHWA 1JK8B 4JDTH 4I7ZC 2VZOA 4DGUA 3ZE0E 3HJ0A 2DY2A 2IDCA 5G4OA 1XH0A 2H3NB 2KLTA 1W72A 4Y4FB 1MJ8H 4G59C 3FT4B 3U7WL 3RPIB 2X4PA 3BZFA 4L1LA 1G7LB 5E8PA 5KVFL 2L4OA 3CHRA 2NLJA 3NJMA 3PP4L 1UOKA 2DZEA 4HWUA 1QASA 5CMAA 2X0UA 1MFAH 1JVOA 2X42A 1B9KA 2CCWA 3BAYA 3BP5A 3MQIA 4F5CE 4LOUC 5I1AA 1T6VN 2GK2A 3FSVA 1PT0A 1UWXK 1NDGA 3IJEA 3NDZE 4R5XA 3V5KB 4WGKA 2AGJL 4K7FB 2LLLA 3FO1A 3CAFA 5A2LH 3UH8A 1ZIAA 5LN4A 2UYLA 2F68X 5HHQA 1YEFL 5AW9B 4OGXH 2X87A 3ARFD 4TLKA 4FI7A 1F4WH 1A9BB 5DJ0A 3LOWA 3RTQC 2E7LC 5L7XH 2Y69B 1MCSA 3OR6B 5D2NE 2HPTA 3ZKMD 3ILPB 1ORQA 2Z8RA 2CLVA 2WBJA 3R7QA 3TBWA 1E5BA 2SEBA 1FNLA 4OZFB 3LHPL 2WZPD 1XR9B 1J1OL 1R5IA 2J71A 3HTLX 4QY8A 2HRHA 2PCFA 3X1GA 4FQLL 2D7QA 3FSOA 3KBFA 3U82B 3NCYS 4D9QE 2JMRA 4LESA 3AW5A 1QKZL 2EVIA 2APSA 4HCRA 1BXAA 1SVBA 5J57B 4JN1H 5EDSA 2V17L 4PWIA 4O51A 5E8EA 2H9GA 4P5SA 1QTPA 2R9HD 5FTMA 1PLBA 4HKZB 4PRHE 5GJTL 4ZMLA 2PW1B 2QADB 4HISA 4RNRB 1WH0A 2Q6WA 4YHZH 3T0XA 4EDWL 2BXZA 5JXED 2J5LC 4N28A 2QFPA 3VH8A 3L4WA 3OLGA 2CR3A 4HP5A 2NY1C 5F8RC 2YUXA 2HRPH 1UT9A 4JY4B 2JQMA 1KB5A 2UWEA 4OFQA 1JGDB 4X99B 1G1YA 4G6KH 3N1QC 3FT0A 4DN3L 3AT8A 1IGJB 5DWUH 3VXOA 1PZAA 4K9JA 4PJAF 3MACH 1C7SA 3WAJA 2E7BA 2FWOB 5MEOA 4WNQA 4JHWL 3WTTA 2E9BA 3QQDA 3VGAB 3ATAA 3JTTB 5AOMA 2A6JA 3OKKB 3T0VA 5D1XE 3VSUA 3P2TA 2OMTA 1EU1A 2ZZUT 3INUH 1JWSA 1NGYA 2FAUA 3C09C 3N6YA 3QUZB 4HZAA 4JFXB 1NPUA 3GPEA 4CMMB 3SE3C 3WG7B 2CW0D 4W9FC 4ETQA 3TBYB 3CFJB 1T4KB 5FW6A 3RGVB 5GS1B 3O8XB 1JZ8A 4NUMA 1KXTB 3OXRA 1FDIA 1QHQA 3OKEA 4QI3A 1I1AB 3S5LG 2XTSA 1KPUB 3U1SH 1BECA 5FCUL 2X2HA 5FA3B 4O2FB 5HYSA 1XF1A 3FTYA 3DOSA 4M48H 3H9SB 1N8ZB 1MCPH 4YHLL 4MASA 2ZKXA 1QSFD 1KFAL 1E5AA 2Z7YA 1N6QL 3L5HA 3NJJA 4NZJA 2EE0A 4AQ8C 3WTUA 4HF5L 4J3OH 5JHLH 1GW0A 1NJ9A 3A23A 4YX2H 2NY2D 4Y9EA 1YMMA 1Q8MA 2XQYA 1BF5A 4KDTC 1BZ9B 4I0CC 2DTSA 2VAAA 3NP4A 4NO0A 2Q8AH 3RYMA 4OJFH 3W82A 1E6JH 2MMXA 1TLMA 2CLRB 4DP0X 4EKJA 3L5WA 5CJ8A 2EXYC 1J48A 2HPOA 3FULA 2X3AA 2R4RL 3P30L 5KZCB 1M3JA 3V0WL 3GKWL 5GS0D 1YEKL 2QKIB 3DUSB 3ULVD 1L9MA 1YN6A 3K4DA 4RFEA 1U8OA 5E8NB 5EEWA 1L3NA 2OMBA 2UUDH 4M1CD 3DA0A 2GQHA 1YN7A 1ZEAL 2A9CA 4I9XA 4PJIE 3SIKA 3ASOB 4PJEE 5B3SB 3GS0A 3Q9PA 3ZDXE 3L2NA 5CP7B 3RWFA 5I18L 2XWZA 5I5JA 2YPLB 3K6NA 1TJIL 4BFJA 3AY4A 3B6SB 2E4TA 3GIVB 1UZ8A 3MA9L 2A69D 2GAZA 4ILDA 5HPOA 4L18A 3UTPE 1CS6A 3R18A 1EZLA 1T21A 4LEOB 4X5LA 5GRWA 3NEEA 5BNXD 2VZ1A 5F6IB 1NFAA 2ZKHL 3IBEA 3PWPE 1KIRA 4PGEA 1YNLH 1RY7B 1HEZA 4TS6A 4Y5VC 4IRJC 3O41A 3STZB 1J8HB 3B7RL 3CFTA 2K1MA 5DQ9A 2H3XC 1QBBA 5LO7A 3X11B 2ZXAA 1KSRA 1TETH 1MIEH 1SF5A 4OIBA 3UG3A 2X28A 3FU8A 3K6DA 3II2A 4TM9A 4QXTA 2MPAL 5C0FB 1XCQA 2Y1VA 1A4KA 5GQBA 1T66D 4JREC 5D7LA 4JRYD 4MJ6A 4FLHA 1IC0A 2CIIA 3FN0H 4OF8A 2ATPA 2EIDA 3IMTA 4YK4B 3EADA 1UOWA 2R7EB 3PIQB 1OW0C 4QF1B 4KGJA 1PEZA 4HOXA 4Z1PA 4LDOB 1TTAA 4DPRA 5BS0D 5DO2D 3D33A 2GKIA 3SDAC 3C8HA 1SMDA 1JZ2A 4PJ5D 4YGVA 4I0PD 4Z95L 2F54D 1PDKA 2CDFB 3PFUA 1TQSA 5EZIH 4XMTA 2CSPA 2JIXB 2GABA 1S3RA 4FQJL 4OGAC 4L23A 4MRCA 5L0QC 1H0DA 2BO0A 5TF0A 3I6SA 4XR8C 1OTTC 4J3OG 5H37A 3GI9H 4XAKE 3BAWA 1L9OA 4RIRB 3N41F 3S35X 3I6LD 5SX5H 3DETD 4O5LH 3QQ9D 3WO3B 4IKLA 3DRTB 3UFIA 1ZSDB 2V5RA 4KJQC 5B1BB 5JLZB 3PV6A 4HUXA 1B0IA 1HESA 3VFOB 2CHZA 1CFSA 1S5HB 1VF5C 5AB0A 4RA3A 4HHWA 3ARYA 3GJEB 2IBZX 3HEIB 5B1JA 4R7NA 1EHNA 3TN0B 2VUMA 1OAYL 2W92A 2XWXA 1IBFA 4UTBL 4ONGH 1DJGA 4K15A 3LZQA 1JMXA 3ILEA 3TIWA 1I7UB 4CVWA 5FIEA 2M2DA 3BZ4B 1VFAA 3STBA 4A7VA 3VTTA 4L1SA 1S3SA 5C0IA 2YD1A 1H5BA 3JVGA 3EOBB 3D69B 4ISVA 2AVGA 4FFYH 3DXAA 5E6YA 1YMHB 1MEXH 3FUMA 3TA3A 3QQ4B 5HVGB 2D7NA 1HN1A 1PYUB 5EA0L 3T0EB 3UBXI 3VWJA 3TYGL 3DX7B 1WAPA 1D5IL 3P4MB 3QJTB 4GAGL 4R96A 1S5IH 5JHDE 4OI7A 1SZNA 2WXOA 3IETB 3ISWA 4PJHB 4P9HH 3POHA 4CMHB 4HAGA 4R90H 2CDGA 1CCZA 2OYMA 5D93B 4ALAC 4KQ0A 1BLNA 4WW2C 2IPKB 4M6OH 1IFRA 3HC0A 3MODL 2YUJA 5SWSD 5C0AA 4QRTA 2BS9A 3D3VB 3VD1A 3IF1B 4OCSH 1LO4H 2VAJA 4PMFA 5DRZA 5IIEB 2PO6A 5C0CD 1J5HA 3PU7A 2ZUXA 4AG4L 1L6XA 2W9DH 5DHVA 4JDZB 4KNUA 3ZSTA 5AENA 2EIJB 3IKCB 4QXWA 2I60L 3I75B 4AVJA 2VMFA 4TXVB 4IHOA 5FM5O 2E7HA 2WXFA 4WFGE 3W39B 4IRZH 4M4RA 1JPGB 4HUVA 5CJOH 4S0SD 2WP3T 4YVNA 1UQSB 2WAQA 3ELQA 3D85D 4ZPTA 5DZJA 5J5EA 5AAMC 4G6JH 2Y36H 5IROC 1HILB 3VQMA 1S7UB 4X7SL 3FT1A 1WAAE 2G5BA 3HBGA 5DFTA 1EVTC 4XE5B 2NXYC 3L4XA 2XWBA 4N8VA 5CLWA 4HKXB 1INEL 1NBYA 4YFLF 3EGXA 1GJWA 4A6YA 4JUSA 2TSBA 2ORBH 3BAEH 3UTSB 2OMZA 3FONB 4PG9B 1DBMH 4H13C 4XH2B 3CVIH 4D0CA 1PZ5A 1ZHLA 3JWDC 1PQZA 3TNMA 5GSRB 4HJTA 4Z5RA 1NKGA 1ZLUH 1OGAA 4PSPA 1DJXA 2GJZB 3HE6C 2F74A 1NGQH 1U33A 4XXWA 4KTYA 4TV3A 4XMLL 4TUKH 5BRZE 1T03H 1X7QB 3TYFA 3MV9B 3G6AB 4OJYA 3SY0A 5BV7B 4QRPD 4ZFFB 4RWHA 3B3IA 3PJSB 4GKSA 3T6ZA 3VFGH 1E18A 1OPOA 3F62A 4G1MB 2QSVA 4HK0A 4LXFA 3RJQB 3BPOB 3BXNB 1DFBL 1W6LA 1IEBB 4K9EC 4NQDD 3RUGE 4P59H 4RQQB 1JRHI 3MC0A 2QQKH 4KI5D 1Q72H 2WXHA 1Y0LA 4HWBA 2BMKB 4UOQA 4XO3A 2EP6A 2VB5A 5D7JC 4E41D 1GR7A 4ZQKB 2MHAA 4OZHB 1CFMA 3KL3A 1EJOH 4TSAL 4LLMA 1AIFB 2JELH 4N20A 2FJHA 3DV4A 3DVNB 4U1JA 5EC2A 5DMYA 1WPCA 1IGFL 5KSBB 4ODHH 1MSPA 1MLBA 3JWOL 2XPZA 2IGLA 4D7PA 3QRLA 1GAFL 4L29A 1QHPA 2BWQA 5DA4A 1OE2A 4W9EC 3WEAA 4F7CA 5FUOL 2J8UF 2JSFA 2XPGA 3WEXA 1OEZW 2NVYA 4YE4L 5HHOA 3OLDA 2DJSA 4BFNA 4MDRA 3GZPA 3M1CA 4F93B 1NSNH 4PB9H 4WKXA 3RE0A 1TVHA 3QWOA 3INOA 1OA7A 1W72B 3GHBH 1I8LC 3O3UN 2X4PB 3BZFB 1JRHH 1IBZA 2WMPA 5E8PB 4MNQD 4PPTA 3O81A 3V4VH 4XPAH 1TMOA 4UQAA 5I1IL 3MV7E 2WTRA 1HOCA 3SUKA 5KS9A 4WI4A 5CMAB 3BP5B 4ATTA 3IKKA 3JTSA 4CC1A 4MWFA 4ZUTA 5I1AB 1IBYA 4M5TA 1NDGB 3IJEB 4GP5B 1KBGH 2DQTL 2VQUA 4NDMA 4QTHA 4TVPH 5AW1B 2HKAA 2WXQA 3OWRA 3U2SA 4MNGA 2QQLH 3S5ZA 2PP7A 3FO1B 1AQMA 2DQIH 2UYLB 2VXTH 5HHQB 2AJVH 3FO2B 4WEBH 4J6RL 4NO5B 5C08A 3ZKXC 4FXKC 5IUCA 4Q6IA 5DJ0B 3OR7A 2AQ3A 2BHYA 3HN3A 1SFHA 2GYSA 2XN9D 4WI7A 1ORQB 2VXSL 3T65B 4ZNCD 2CLVB 2BCMA 2WBJB 2X0VA 1HJBC 5IJKA 4H88H 2B1OA 4JFSA 4RGOH 1MNUH 1R5IB 2G3ZA 4ZMWA 2BJMH 3WXVL 2DLHA 3ECBA 3FFCE 4NJ9H 3AITA 4QOKB 1J88A 4GMTH 5LGHH 4C83A 2WZ5A 3B9AA 3AU0A 2H2PD 5HGDA 2X2IA 5IMMA 1QA9A 1QZ1A 1HIML 3RVTD 3DK2A 3GXDA 4XNMA 1AFVH 3ZUCA 4Q97A 5EWIH 2ERJB 5AVWB 1R3HA 2AJXH 1F3RB 4ORZC 5HJ3A 5E8EB 5B8CA 5CFAA 2H9GB 1EZUA 3VD9A 5DTFA 1NCBL 4XN8A 2VC2B 1OARH 2W38A 4G5AA 4X0NA 2Q6WB 3QIWC 1D7CA 5IMOA 5LN8A 3TBCA 4TRPH 1KLUB 4RMSA 2YQBA 2YAFA 4R8WL 2BZ7A 2QMJA 1VCAA 1CR9L 4C2MA 3GSWA 3P11H 4NKQB 3UYOD 1KB5B 2UWEB 4I2XE 4ABWA 1CG9A 4LCYA 4XO4A 1A7BA 1EAQA 4HK3N 3VXOB 1MFBH 4OFYD 5TFSH 2F19L 1X5XA 2YSSB 1ZHNA 2DLFL 3NG5A 4LK4A 2QDWA 4PS4L 3IJYA 4WNQB 5IOKA 4ZW8A 5MEOB 4KPHH 3QQDB 4GBXA 4PH8A 4XBPA 3NPSB 1M7XA 2A6JB 2BERA 4K94C 3AVEA 1W9XA 2OMTB 1LK2A 2A6KA 4GIOA 5IBTH 1JWSB 1NGYB 2WKGA 3QUYC 1CDHA 3ILQD 4RETB 4ODTH 5GGQH 1ZK9A 1UGKA 2WCSA 3VXMB 4ETQB 1RLBA 4NI3A 2X4QA 3GM8A 5EOQH 4NZTH 3WI9A 4I89A 2R8SH 4DOHB 1KJVA 3L1OL 3OXRB 5ICUA 2AJUL 3DVGA 3OKEB 1FO0A 3ZTNH 2B4CC 4JFPA 1IKFL 2FQFA 2X2YA 2AK1H 2Z6FA 3PJNA 4JDTL 5LBVA 3JV0A 3MNZB 4GQPH 5BMFH 5HYFA 3NH7H 2JIRA 5F0PB 1TWGA 4ZS6C 5EOCH 2ZF9A 3ALXA 1MJ8L 5HYSB 2J4WH 1CGTA 1ETJA 2FHCA 1FH5H 1VEPA 3DOSB 4GG6B 4AE0A 2X4RA 3MBWA 4GW5A 1LMIA 1N26A 2CA4A 1NGZA 2W5PA 4CADB 1IGMH 2KS0A 2B16A 1MFAL 2VRQA 3HBZA 3SBQA 4ZFOL 5DURB 1A66A 2ZXCA 4BZ1L 1P9MC 3ARZA 2FYVA 4L3FA 2FNWA 4NN7B 1SMYD 2EYSA 1EHXA 5HGHA 1QSFE 3L4VA 1YMMB 4AGMA 2BINA 2UVEA 2VZTA 3FO0H 1WITA 2E6JA 4IKJA 4N2OA 4OJEH 1PLGL 1AANA 1Z5HA 4KFZC 4ACPA 2VAAB 2VSMB 4NO0B 5DFWH 4OGXL 5KVDE 1PYQA 3CBKB 3GBMH 4N2NA 4MB5A 1F4WL 5KBNC 3L5WB 3TT3H 3TBTA 5JW5A 4ZUWB 1GYVA 5L7XL 3K6FA 1WZKA 1MCWW 2FT7A 4AEEA 3D6GA 4F37K 4Y9BA 3PABA 2DMRA 3N85L 4J8RA 2FO8A 1YN6B 3APDA 1B0RA 2N3JA 4RFEB 1U8OB 4RWYH 3WJLA 3HN5A 2XTLA 1THCA 1DQJA 2C5DC 4OJCA 2Y6SD 2WO3B 4WTZA 4P05A 1A25A 1L6PA 1YN7B 3EFDH 4LCWD 2A68D 4HS3A 2EDFA 2VMCA 4JN1L 3PDGA 2Y1YA 3RWFB 5ACZA 4WV1C 3BPLC 5HVWA 3T3ME 4YHZL 1UZ8B 1ORSB 4LPXA 2GAZB 1TG8A 5GS3A 1QI4A 1KB9K 1T21B 3T6WA 3CSFA 3MUY1 1U6AH 1KIRB 2HRPL 4AQ1C 4PGEB 1VADA 5J8OA 2APTA 1HEZB 5I66A 2CPUA 5ANMA 2IWKA 3O41B 1OOAA 4CJ0A 5DQ9B 4I13B 4G6FD 4G6AD 5DWUL 3PL6D 5CLYA 4G9FA 5BXFB 1LQBC 4M4PA 1MCBA 2G0LA 3MACL 5DJAA 4JDVA 4RFOH 3S97C 4S1QH 2FRGP 4PJDB 2R1XA 4HOWA 4QXTB 4XP1L 1J8KA 3MBXH 1XCQB 1H9DA 3CFKA 4PTTA 1T5XB 3INUL 4L05A 5D7LB 4MJ6B 2CIIB 2ATPB 3GMPA 3MCLH 5D7EA 4WEUD 3VB9A 3KMDA 2DQDH 1IRAY 3UAAA 4JRYE 4DKEH 5I76A 2XBZA 3GSUA 5JNYA 3V4UH 3O2DH 2JIMA 2F7PA 4YGVB 1AJ7H 2NW3B 2XXFA 3P9LA 3U1SL 1PDKB 5L88H 4XP4H 4BEIA 4DKFH 2WQAA 1SHWA 4MB3A 4MAYA 3Q7JA 5C97A 4FTDA 2YOCA 1TR7A 1JZHA 3UTTA 4PJ5E 5MEPA 1H0DB 2QL1A 4M48L 3NA4A 2F54E 3AGWA 4KKNA 1IQDB 1IBGL 1XEDA 1TTRA 1FL6B 1MCPL 4KDWA 4KKRA 5EO0A 3SE9H 1VC3B 2ZOOA 2XXCB 1FZKA 1L4IA 1NZRA 2JKTM 2ALAA 3MGTB 3PWJA 1R46A 5IB1A 4WO4A 4U1NA 2QSQA 2FGWL 3PV6B 4LOFA 4HUXB 1PKQB 1KELH 4ES8A 3ZL4H 4YX2L 1CFSB 3I6LE 2UX7A 4ODUB 3WFEH 5C92A 3S8GB 3TWYA 1QTYT 1E32A 4R7NB 5T3XH 5FO9A 2BP3A 2Q8AL 1Q9KA 4OJFL 3HRZC 2N0KA 1E6JL 1D3CA 4ODWA 4R97C 3CMGA 2LFGA 3JYCA 3SBPA 5JXEC 3JUZA 3E9UA 3CH1B 4AVHA 3CGTA 1VFAB 3DMMC 3WLWD 5A2AA 5C0IB 3Q5TA 4GS7C 1GYAA 4UDUA 1H5BB 1FCGA 3D0VA 5FTKA 3NZSA 3B7SA 4ISVB 1QBML 4OQTA 3NJKA 4NOHA 3DXAB 1NKRA 3JWNH 3RDTA 3TA3B 4OUOA 3I3DA 1ZV9A 2AXWA 2P44B 3BUDA 5EV7A 5DEFB 3VWJB 3SGJA 4WWKA 2R23A 1KBBA 1SNRA 1ZMYA 4NPJA 1IL1A 2DYRB 2YGOA 3RWEA 5A6LA 3C5ZA 3TC9A 1P4IL 3C5XA 2CDGB 4F3FA 3OAYH 3QWZA 2H2SC 3L5JA 5C0AB 3B56A 4QRTB 1OP3H 5DRZB 4B9GA 2PO6B 5E2JA 3CX5J 4JFUA 5GHWL 2XBDA 2J21A 5JOEA 5SWSE 1YNLL 3AS3A 3F12A 2DOCA 3HB3B 4HMEA 3DWTA 4M56A 5DHVB 5KOMC 2XWRA 3W0WA 2R2BA 4XVJH 4MMZA 5KW9L 5D71H 2K6WA 4WNSA 3FUKA 3B4NA 1SOQA 2VR6A 1XGRA 2KH2B 1FYTD 5C0CE 4IHOB 5SWQA 1TOXA 3CF2A 2X4TA 1EXGA 1AGFA 4JGJA 4M4RB 4WUUD 1WWAX 4HUVB 3FTWA 5FGRA 3NESA 1SN2A 4KROC 3TCTA 2WTOA 4ZPTB 3KPOB 4AL8H 4WQOA 4Q14A 2JI1A 3KGSA 5C2BH 4GEIA 3D1MC 5CCJA 4FDWA 1AQDA 3FN0L 2DIEA 2G5BB 1LK3H 2QVFB 3GEFA 1U8LA 2XWBB 1OM9A 1KTBA 1P7QA 3PLYA 1AGCA 2WPGA 4GAYA 4N8VB 1NBYB 1L9RA 2EDKA 3ARFB 3EGXB 4APQC 1BW4A 1U8CA 4HPYL 2VRKA 4P3CH 4XN5A 3RTLA 5I1HH 2OMZB 4N0UA 1CR5A 2JCCA 4D0CB 3RB5A 5GSVB 1PZ5B 1ZHLB 2HKHH 2VL5A 3C6SA 1PQZB 3TNMB 3WY1A 2V8MA 3O2VH 4K71B 5EZIL 2O5ZH 4PD4J 4B9KC 3L08A 4FG6D 1IFHH 1RULL 1YO4A 4FQCH 4M7KH 4UZGA 4BFBD 1KULA 4DEPB 3BSZH 5GISL 1T6WA 3TYFB 3SY0B 4ZOEA 4D9RD 1WFMA 3B2UC 3B3IB 4GKSB 1PZ2A 5ESAA 3QS3A 4N1CA 1A0QL 4HMDA 2HTKD 5CBAA 3K8MA 3QDHA 3NCFB 3KHQA 2FR4A 2OSLA 2Z35B 4KGLA 4UB0H 1Y0LB 2L7UA 4BZ2H 4U0RC 2ATAA 4NQDE 3Q1SH 4QRUA 1CLCA 3HAEH 1L9TA 2MHAB 3ABGA 3UTOA 4ONGL 4V11A 2NR6D 3L3IA 2R39A 4LLMB 2YJQA 1EMTH 2VDOL 3NRFA 2AQ1A 4E41E 3MR9B 1O7SA 1UD8A 5KN5A 2FJHB 2DEWX 3DV4B 3KS0J 3PHQA 3Q2WA 4NRXA 3RI5K 1HSBA 5GXBB 1KG0B 3CIAA 4W6WB 4U1JB 2MQCA 3JT0A 3V6OE 4UM9A 1T22A 1SY6H 2ZCKH 3VGFA 1I9RH 4ODSH 4FFYL 2BOCA 1GTNA 3HVNA 1F02I 1MLBB 1J1PL 2Y7MA 1TQCC 1CGYA 4L29B 5KYUA 3IFOA 5IW1A 4PRID 2R1YA 4F7CB 1GCFA 4CL7A 2XPGB 4LBEB 5HHOB 1RP9A 1BVZA 3HCVA 4FCHA 4IMKC 1TVHB 3FH5A 3QWOB 3IRPX 1SPDA 4LFHG 4P9HL 4R90L 3ZVVA 4BYHA 1T0PB 1GZQB 3TNNA 5CN1A 4XI5C 1T66C 1UXMA 4M6OL 1UWGH 2ZG2A 2MQ3A 1AXTL 3LN5A 5C18A 2WMPB 4Y0GA 1QBLH 1GYWA 3KWVA 3HVDA 3MRIA 1X3DA 4U1SA 4JP7A 4OCSL 3L4TA 1MWAB 1HOCB 2WTRB 5KS9B 1SUJA 1MDAA 4NCC2 1FF5A 4MWFB 4ZUTB 5SWZD 3TZVD 3CE1A 4MNQE 4WSGA 4EZLA 1BW8A 3CCHA 1X7TA 1MWOA 1JFQL 4H25A 4LDEB 4NDMB 3S4SA 1NFDF 3RIKA 3U2SB 4MNGB 1R3IL 4G8GD 2QSTA 3N44B 4OF0A 3IDUA 1UFGA 3EDKA 5AZEL 4AEIL 4HKJA 4IRZL 2WLJA 5CJOL 4Q6IB 2A6IB 2WIMA 3T2LA 4PY8J 1LQSR 4FLSA 1XF3A 4WGVB 3LQAL 6PCYA 5D2LF 5JXAH 1ET8A 2Y36L 4YDIL 2Z8SA 2NY2B 3QP3A 4GP4B 3DETC 3T1FA 3QQ9C 2E7LA 1KBKA 4OF6A 5JZ7D 3UZEC 5HGAB 1ZVNA 3E1F1 3LY6A 1LJMA 3FKUS 3CDYA 4DZBA 4HJGA 3VX0A 2XN9E 3ECBB 2EVFA 1IC7H 3SO3B 4C83B 4AUYA 2ORBL 2OXGA 3BAEL 4LHQB 1DBML 5L6YL 1G9HA 3QR2A 2FYYA 4NZ8A 5D5MF 2YD8A 1QA9B 5IMMB 3S36L 5D1QC 5AD0A 3VW3H 2ARJA 2VRAA 2VITB 1R33A 2ZE0A 1PG7H 1R3HB 5B8CB 1N68A 5HJ3B 3TBSA 3ROOA 1NGQL 2NMSA 3EGDA 5DTFB 2R51A 1W0VA 4QRFA 1HL5A 2QZQA 5DK0B 4K2UL 3U36A 3CSTA 3MRDA 4KHXL 5IMOB 4DQOH 4MNHA 2FEEI 4Y8AA 3S3CB 4AK2A 2YXVA 4UYQA 4H0HB 1SHXA 1T0MA 5FA4A 3NSCA 4A7GF 3VFGL 3GSWB 1DJZA 3R4DA 3CBJB 3DPDA 2Q5BA 2KI6A 2ENYA 3ULUC 4LCYB 2WWMC 4KZEH 3RVXD 3WS6C 4Y1AA 3OMNB 2QQKL 2ID5A 1VGKA 2BZCA 2YMOA 3D2UA 1KGIA 1Q72L 1ZHNB 5CSGA 5DYOA 3LKSA 4H26A 1R24A 3SGEI 4PWHA 5GGVH 1PL3A 3RWDA 3T6QC 1LE5A 3VD0A 1R75A 1NIDA 2VXQL 4YHOH 3SPVA 4BKLA 3KM2A 2H6PA 5I73C 1LK2B 2A6KB 4PMEA 3S98A 2JELL 1MNNA 3E2HC 4NKMA 3H7BA 5FEBA 4M7JL 1AA6A 1FIGH 1AACA 3TF7C 4Q6YA 1QOKA 4FQPA 2ZWKA 3FB6A 4EUPH 2X4QB 4JJOA 3SE3A 4ODHL 3IWUA 2W9LA 1JGUH 4Z23A 1KJVB 1NUFA 3NIFB 4IOIA 3DVGB 1FO0B 4AMXA 4JFPB 3AM8C 4Y2OA 5I28A 4EN3D 3PQYE 1U8NA 4PWGA 3SJVD 3W11D 1NSNL 4Y19E 2Z31D 2X4OB 3ROLA 3P0GB 5F9OH 4FG4A 3M7FB 2HP4A 1S7SA 2X4RB 4GW5B 3NCXA 4HUWA 5BS0B 3OB0K 2J12B 1E6OH 5TJWK 3V4VL 4XPAL 3ZZLA 4QXUH 5LJYH 1T0OA 4PJ7F 1NGZB 4QYAA 4DFIA 5DSCA 2NUTA 3SGEH 1MRCL 1EERB 2GJ6D 3GNMH 2BIHA 1HC1A 2WJ7A 1CLOH 4XGZA 1BXUA 2EYSB 3DSNA 4JPQA 2J73A 4ICXA 4TVPL 4YHKH 5HGHB 3EFFA 4AQ8A 2COQA 5JPMC 1TSRA 2OYLA 2BSBA 2DQIL 3TESA 2NTFA 3GXIA 2FBOJ 3X2LA 4WEBL 2JK5A 5A43C 2OZNA 5E00B 3RNKA 1F97A 4FTVD 1RSYA 4KDTA 2GJJA 5JW5B 2YN5A 4UILH 5EN2A 2DWYA 4HQQH 3ZHLA 4NWTH 3PABB 2YEVB 4J8RB 1ZGLP 4H88L 3KDPB 4RGOL 4DKAA 5LHDA 4WWPA 2P5WA 2ZWZA 2BJML 2K4WA 3RQ3A 1MLCB 1DQJB 5LGHL 4L3AA 2A38A 1JWMA 3SDXE 4OZIE 2FLMA 5DMIH 1AZUA 4HS3B 3X2PA 2E5EA 4HC1H 1AFVL 2CM5A 1J11A 4NZFA 2AJXL 4OZFH 5ACZB 2A73A 4ZSOA 4NQCA 3DNKA 2P24A 3VD5A 1OARL 4JRXD 4LCWE 4NN6B 5E03A 5KTEH 3BRFA 2DWSA 1E2VA 2AEIT 4TRPL 4KRPC 3GUTA 2BP0A 4GYBA 5E23A 1KTLB 1VADB 2GIXA 3P11L 5FYJD 2BCKB 1SEBB 5I66B 4LP8A 5ISZA 4OI9A 5ANMB 3ARRA 3UO1H 1ZANH 3ZQXA 2DM4A 1BQHA 5AG8A 4ZAKC 6TAAA 1UH4A 2AQSA 3I9AA 4G9FB 4Y5VA 5CNHA 5DJAB 2B1HH 4IRJA 4JDVB 4U6VH 5J6SA 3C60D 1OSEA 3SEPA 4KPHL 3VSQA 5BJTA 1LHZA 5CGYD 5HXMA 4NOFA 1QUNA 4OVUA 1I75A 3LPGA 4PTTB 4EUPG 4M43H 4HIJB 4ODTL 1G9ML 3GMPB 4GW1A 1MIML 4CU8A 4WSJA 5F7EH 1XQ4A 4X6DB 3U0TB 3G6JF 5EOQL 4D0BA 5I8OH 3U46A 5I76B 1OW0A 3QPKA 3GSUB 5JNYB 1K8DA 5EBLA 2AK1L 1MFDH 3P9LB 4NO2A 3D0LA 1UXSA 3SDAA 4W9DC 3F7LA 3LZOA 4LGPB 4MAYB 5EOCL 3ZE1B 4UQ3A 1AI1H 2YD2A 3UTTB 4F20A 5MEPB 3QULA 1FH5L 3U7YH 3EH4B 1BYPA 5EO0B 2WYIA 2FWLB 1MY5A 1FZKB 4GQQA 1ZCRA 1IGML 2JTYA 2CQVA 1IJNA 2CXGA 1RUPH 3PWJB 5IB1B 4WO4B 5K9JL 4U1NB 2CGRH 2EDJA 4Z3EA 1F4XH 1M1SA 4Y1TA 2F5AL 3UYRH 4OM1H 1G6RL 4AK1A 3P2BA 1ZLWK 2CUAA 3B9KC 3ZE2B 2ESVD 5FO9B 2XQYK 4QRPB 1Q9KB 1Q9OA 3GBML 3Q0HA 3VFMA 2FGZA 4ODWB 1AXSA 2IXQA 5BPPA 2Y2TA 2DEXX 4F1SA 3BIKB 4PJAE 2F1EA 4P9MH 4OCYL 2W0KA 1FFTB 3HS9A 1CXFA 4N2EA 2VGLM 1QNZL 2A5UA 3DK0A 1TDQA 1KIUA 3LB6D 4UDUB 3QHZH 3G04A 3FYIB 3X2GA 3O4LD 4LEXL 2A6HD 3VG9B 3OZ9H 4WWKB 4GUPA 5I0WA 5C0RH 3QFJD 3DMRA 3B7YA 3TVMD 4F7TA 2OBGA 2BSTA 4QHLA 4XOCA 5D7IF 2AQRA 3RWEB 3QEGH 4CN6A 2O5NA 2V0AA 4FQXC 3DHJA 3QZPA 3KLLA 5DC0A 1FVDA 1SMOA 4PBVC 4TVUA 4RZCA 5FFGA 1VPOL 1T7YA 4QMEA 2ED9A 2PP8A 3NTCH 2M8XA 2A2QT 2AI0H 3MLXH 1T7XA 5GRYA 1ACYH 1X5IA 5GRJH 2G2PA 4JM0A 4JZOA 2ZYSA 2IWGA 1CU4H 4N2GA 4OCRH 1U6AL 1TZIA 1UH2A 1WDAA 2A9AA 3FB5B 3F12B 3W0WB 3WELA 1FC1A 3BN9D 4YQXH 2R2BB 4H8WC 4MMZB 3WY4A 5HVFB 1G87A 3UCRA 1XGRB 2IAND 3LRLA 1IKNC 1PS3A 5SWQB 2X4TB 3D9AL 4RFOL 1OE1A 4S1QL 2BHZA 3UABA 1AGFB 5C07A 4PGCA 3LXBA 3BD5A 5JDSA 1IAII 4WVRA 3MBXL 1FYTE 2P46B 5E9DA 2HX9A 1DBKH 4RMBA 4J39A 2P5ED 2WBKA 5E08H 1AQDB 3IJ7A 4WUUE 3RBGA 2RQ8A 4O9HH 2EE3A 5INCA 4DKTA 1O6TA 1GYUA 3OVUB 4X6FA 3HU1A 5AAMA 5HYEA 4XCEA 1U8LB 3JBG7 5IROA 4J4PC 2NY3B 3I74A 1AGCB 5LAPA 1CE1L 3RPBA 4AJ0A 4AYEC 5I6XC 5C9JA 4DKEL 4M5ZH 1JZ3A 1U8CB 2GC4C 3SDDC 4UOZA 4NRYA 2JCCB 1AJ7L 1HXYA 3EJYC 3C6SB 3ARTA 1QZNA 5L88L 3CSBA 3HC3H 3LZNA 4CKQA 1LO2H 4DKFL 3JZYA 3T8XA 2D03H 3DO3A 2ZPKL 4XMKH 3RA7H 1QSZA 3BCFA 3V9CA 2V3VA 2RTTA 2JB5H 3P3SA 2JKIS 1IKOP 5IBLD 2YWZA 3HE6A 4XVTH 4XBEH 5EO1A 1DTUA 3GIZH 3TL5A 2F1BA 3QNZA 1IAIH 2K78A 2Y6SC 5ESAB 4PJIA 1JF6A 1A1MA 1XX9C 3ABZA 4D9RE 3ENGA 5CBAB 4KNQA 4AVRA 3WFEL 4F24A 1L3WA 3Q6GL 2WQWA 1WZ1L 5T1MB 3KHOA 4NM8H 4KI1A 1WD8A 2CK2A 5TD4A 2CMRL 4MXQD 3E6FA 3Q2VA 3FCTA 3CU1A 2OI9B 4NUJA 3HS0B 4GKZB 3L3IB 5D7JA 3FUIA 3P1VA 3S5YA 1MXDA 3UJJH 5KN5B 1JWUA 4NRXB 4KFMA 1BZOA 2ZX6A 3PHQB 2CR6A 1HSBB 4YHPA 2DICA 2Y06H 3LEYL 5B38G 3VXSA 1N3NB 1T22B 3HE7C 1X5YA 3FSWA 5FOBA 3EBIA 1IGYA 3DYMA 4U6HA 4E9TA 2BOCB 3OKOA 5MEND 4X6CA 3K5RA 1KY7A 2V2XA 5C7XH 4UUJA 5KYUB 3IFOB 5IW1B 1MW0A 2R1YB 2WD0A 3LNDA 3HCVB 1SUHA 2C9XA 3PUCA 2YAMA 4LSVH 3SYQA 5D9SA 2A6DA 4YSUA 1PT1A 5ETUA 1WLHA 5C0JA 5J89A 2IDQA 3TNNB 4F9LC 4PRIE 3LN5B 1EXUA 1TJHL 1HT6A 2G4GA 4MRBA 4FA6A 3MRIB 1WS7A 4U1SB 1I8LA 2CRYA 1GPOH 1NTDA 2MPVA 3P0VH 4EN3A 5C0BA 1U0QA 2Q20A 4J3VA 3AWFA 1UHEA 4MS6A 3LX9A 1UWEL 4XVJL 1KF9B 3CCHB 4I5BA 5D71L 5DMKA 4H25B 2AAAA 4BCZA 1AHWA 3WMPA 1FE8H 5SWZE 2RA1A 3N50A 3L3DA 3GSNA 4HKJB 2VUOA 3UPCA 1WA1X 2WAHA 3A67H 1F8TH 3L3OC 1B3JA 4G8GE 2LE9A 4X4XB 4AL8L 2GEQA 1XF3B 5C2BL 3WIAA 2A9DA 3CQPA 4JANB 5HPMA 2V45A 2EKSA 2GIYA 1DUYA 5GRXG 4ZTOH 2VLJE 3F8UB 3QQXA 4ZMPA 2X1PA 4M8RA 4ANUA 4DZBB 4G5ZH 4HJGB 2N0MA 3S8WA 4Z77B 2OXGB 4P3CL 2XRAH 4ANKA 2FYYB 2R4SL 4HJ0C 4Z7IA 1S9XA 4CC0A 5AD0B 4P2RA 1VGEH 1N67A 3O2VL 4GI9A 1OSYA 1RMFH 5HBBA 4HSQA 2VDMB 2HFFA 4JM4H 3TBSB 1IFHL 3ROOB 5DJ2A 1Y5IA 2FHFA 3EGDB 4LHUG 4FQCL 4M7KL 1WSST 3BSZL 5J9PA 5HI3D 3QXVA 3MRDB 3EF4A 2WSKA 5DU7A 5FCUH 2PMZA 4PLNC 2B39A 1HL4A 2AAVA 1XFPA 1OP5H 3VFNA 3EF7A 4ZMTA 3MLZH 1T0MB