4JCWA

Crystal structure of clavibacter michiganensis expansin in complex with cellopentaose
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and D78N mutant Clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 47
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jcwA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4jcwA02
1HD5A 2JNZA 2G6GA 4FG4A 3ENGA 3D30A 3SUMA 3X2NA 4AVRA 5GLYA 4JS7A 2PNWA 2AE0X 2PICA 3M3GA 3X2KA 1L8FA 3CZBA 3X2HA 4JCWA 2BH0A 4JP7A 3X2JA 5GM9A 3X2LA 3X2OA 2KQAA 3X2GA 1WC2A 1BW4A 2HCZX 2PI8A 4FG2A 4JJOA 3FT1A 3SUKA 1WHPA 5GLXA 1OA9A 1N10A 4FERA 3SUJA 1OA7A 1WHOA 2VXQA 4ENGA 1BMWA 4JP6A 2GAEA 3FT9A 3X2IA 3SULA 5H4UA 3X2MA 3X2PA 2G5DA 4ZM7A 1BW3A 2ENGA 4FFTA 4L48A 2PJJA
chains in the Genus database with same CATH superfamily
3HC0B 3A6CL 2EEAA 2RQ8A 1L9NA 1JXDA 1ZSDB 3DVNB 3NJVA 3O2WH 5LHDA 1DFBH 2J6EH 2A6IB 3IJSB 1A3LH 1A5FH 1QAWA 1KOAA 1Z1WA 2WUBH 3L5HA 1ZV2A 2GITA 2NNFA 1PU0A 1ZTMA 3KBFA 3TBSB 4HPHA 3NG5A 4HH9A 1X6NA 4JFXA 4XPTH 2CW0D 4LQFL 1UUNA 3NJFA 4BHUI 2H0EA 4JFDD 2WBJC 3HPJB 5BZWB 1E6JL 3FBQA 3BKYH 2GSMB 2QADC 4J8RB 2FH8A 1HHIB 1P84K 4XRCA 1VIWA 4CMHC 1JF6A 1S7VA 3GBNL 4DP9X 4S0HA 3D30A 3LS4L 4NQCB 4PWKA 1HINL 3GB7A 4G1EA 4U0QB 1LNUA 3IDMB 4OF6A 3QDGB 1LEGA 3U30B 5AFAA 3JV5A 3QJXA 4L4TB 4B5ZA 4H8WH 1F4AA 2V45A 1ZMYA 3HI5L 5DJ8A 3CH1A 5DZPA 1F3RB 3CFDA 3ECWA 2J2ZA 4F57H 2CR0A 5FYJU 4KJQD 4AQOA 1MELA 2HVKB 3FT3A 3DDGA 3HMXH 4MJHA 2HSIA 1CTMA 2H32A 3MLRH 5DQJA 2CRZA 2QQNL 3ZW3A 1M7XA 1P2CB 1C16A 2HP4A 4AYBA 2DDQL 2EIEA 2RBLA 1HK6A 3DETD 3O11B 1QHOA 1SNRA 2F54B 5KTEH 1DBAH 4EOWL 2FJUB 1ZHLA 3O3DA 4OCRH 2A73B 2DMKA 4E9WA 1DBJL 2CAKA 3GMQB 5AD0A 4JB9L 1R3HA 4GKSA 5C7ZA 5IB5A 4G9FB 3QUXA 4QF1A 4PRIE 1BAWA 4HCRA 4P9HH 2QTEA 3ZK0A 3EBHA 4M5ZH 2EIJB 3QR2A 4UF7C 1IAOA 2AEQH 2IGFL 5D1QB 1CD1A 3DSNB 3I9IA 5FDWB 4DN3H 5CEZE 3FZUC 1BAFL 4L1SA 2NY5L 1ID2A 2MH4A 3H7LA 2B4CC 4P5TC 1Y0LB 5DO2D 5BRZA 1E7UA 3RPIB 3WIFA 1MQKH 1QHPA 4O2CB 2NVXA 3IAGC 2G9KA 1UZ8A 4UM8A 3VQ2C 3RP1A 4F33A 3DVGA 4JCMA 4KXZI 2Z7WA 4EE2A 3MLWL 1TETL 1F11B 1T0NA 3VFMB 4EI5B 2YAFA 1WFIA 3G5VA 3QAZB 5CSGA 1Q94B 5F7DB 3WOVA 3WEBA 1EHLL 3WY1A 2E7BA 4H88H 1CICC 4NOHA 1B9KA 1P4BH 3HG5A 3LKQA 3ZDYE 3VGAC 4YQXL 1DE4B 1PNDA 1WHPA 1XVSA 5JW4R 3CU7A 1RP9A 5EEYA 3MUGB 3ASNB 1OP5K 3PGCB 3V2AR 3BWUC 1E2VA 5CD5C 1M71B 4FTDA 9CGTA 2EVFA 4TLUA 2XVLA 4EI0A 1KXQE 2Z7ZA 2ZF9A 3S5ZA 4HPYH 1GOHA 4Z7NB 2CUAA 4OZIF 2FBOJ 5BW7A 4DESA 3M17B 2KL6A 5SWZB 1XEDA 1OK0A 4PGEA 1CUOA 3PLXB 3FO9B 3K4DA 2MFNA 1CFTA 3VWKD 3KWTA 2ADIA 4J3WA 4TQPA 3RJQB 5CINL 3ULVH 2DY2A 2DQTH 3KGTA 1K3ZA 4QMEA 4U1KA 4RH4A 4A7GF 5BUAA 2NR6C 1L0XA 4YHNA 4LRIC 1X44A 1ZTXL 2OR9H 2FGZA 4I0PD 2BS8A 2EXTA 1N4XL 2PTVA 1NANI 5E7FA 3X3GL 5BRZB 5I71C 4XP5H 5LAPA 4AEEA 3TVMA 2VJ0A 3E8UH 3VXMA 3WEXB 3TNMB 5M94B 1IGCL 1FNAA 3WLWC 4RGOL 5CEZD 2CDEB 1PG7W 3F2LA 3VGEA 4AYMC 1N64L 1SVCP 1JPFB 5L4FA 1ZXKA 4DP0X 3ZLQC 4NJ9H 2LTQB 1MN4A 5E2TH 2AFNA 1CGSL 3NT0A 3HCVB 3GTMA 3QQDB 1L9OA 5JW5B 4WUUD 2GYSA 5KYWA 1CFNA 5CZXC 3VVWA 1U8MA 4MA3A 4ELMA 2B1AH 3JYBA 2E2IA 3PGCA 4LMQI 4ETYA 3QXAA 4KJWD 3GS4A 4MNHB 5GS0L 1R75A 2FIRT 3A4EA 5C0BA 4XVOA 5IB2A 1CFQB 3QG6B 1KIRB 4YL9A 1P0SE 3K3QA 1LJMA 1S6NA 3NIFE 3AACA 1WYJA 5FGBC 1AVAA 3PDGA 1FFNA 3MBXL 2HKFH 4WJKB 1HSAB 4YUEL 3TBTA 3Q05A 2AXFB 1KELL 35C8L 4FXTA 5IREA 3PWNB 5LCVA 1K85A 4MA1C 4BH8A 1IC4H 1T5WB 5CKAA 1WBYA 3GSWB 1TZ8A 3ZN6A 1R33A 4FFYH 1FFPB 3G6AB 1H0DB 3RBGA 1NH6A 1Q1JH 3U7WL 1LEKB 3KPRA 3LPGA 1QDNA 3PF2A 4LLDB 1I9JL 3U6RB 5LCVL 5DS8B 4U1LB 1SFOA 5BOZG 3V6OA 1R3LA 2J55A 2VXUH 4GSRA 5IWLA 4AKQA 2P46B 5F3BB 3QXTA 4EO5A 4KDTC 1UD6A 3IFNL 4IW4C 2FLMA 3FB5A 4EIBA 4MNGA 2D9CA 4HSAC 1PDKB 1W80A 5HI5C 2FYVA 1CI5A 4NFDA 2C1PA 2EC8A 2QPFA 1HHKB 2OYLA 1VGKB 2R1WA 1T2JA 3AQXA 2JB6B 3SCMB 2VRAA 4D0CA 3OGCA 4PJCB 3PP3H 4UMGA 1HEZB 1KLFB 3V5DA 4NKIL 2FATL 2X6VA 5EU7C 5EOCJ 4NO5B 2QV4A 2IFGA 1JXKA 4LLVA 1EAPB 1JF5A 2VZOA 3EYUH 3S37X 5IK3B 2V8MA 4JFDA 4NZTH 1QI3A 4TL4A 1I8AA 5HJDA 4BM7A 3QFJB 5CJQH 2OYPA 4NP4H 5DURB 2RB8A 3W0WA 4K94L 5ALCL 4HOMA 3IE4A 4K5LA 1MCSA 5K33A 2VPXA 4Z7OB 3BQUB 4PJAB 4Y7MA 4L1HA 4YHOH 3QJFA 1BW4A 4BKLB 1JZJA 4Z7UF 5L2JB 4GIAA 4Y9BA 4JGNA 4MXVE 1GGIH 2R8SL 4U1MB 2L7UA 3LHAA 4NZRL 4YWGH 4KI5E 3QDJE 5GLXA 4QOKA 2JA7A 5DI8B 5IV2B 1XXDC 3T71A 4Q89A 2F54E 1N0XL 3JWNC 4M00A 2EDJA 2AK1L 2K45A 5EN2A 3U7YH 4ODUA 3ESPA 1AQKH 5DQDH 1RU9L 3GWJA 3NEOA 2ICWJ 2MMXA 5E9DB 5EA0H 4PWHA 3IVKB 3L13A 2GVYA 4X42A 3WFHB 4XPFL 4NM8L 4DK5A 3M1BA 4I2XB 3HRZA 2WM0A 5D1QE 3CSYA 2EDEA 3MXVH 3MREB 3QFJD 1TCMA 5E0QA 5GHWH 3BDYH 1OL0A 2XVBA 5F71A 2ADFL 3DX7B 3HG1A 1JZDC 1JK9A 2VT0A 2ZSVB 2OMBA 2FHFA 2CO7A 3IS1X 1G9EA 3IR5A 2H1PL 3GXTA 4UV4H 4AY0A 1EO7A 3DX6A 3S98A 2V3EA 2BRRL 3DROA 3IMRA 3OC5A 2XN9E 3KBHE 1KBVA 2GKIA 1Z2KA 3WLBB 2FZ3A 4UDTA 5D7JD 1K5NA 2VC2H 1EEYA 1OIOA 1FYHB 4JDVB 5DJ0B 1ZTXH 4MYPA 4CILA 4CW1A 4HV8A 5KZCD 3T1WA 1HE7A 2DWSA 3CWGA 3VXNB 3ARBB 5L2JA 5F6HJ 1JGVH 4MDJA 1YC8A 5D9SA 1UFUA 5KSAC 3LKSA 5EBMB 4QCIA 4ZD3L 4BDVA 1YPZA 2VR6A 4PFEA 4PWIA 5E5MA 3EBAA 1SXZA 5DJDB 2E9WA 2Z91B 5FXCH 5AW9B 3MCLH 5D7KD 2XWTA 5FUZH 2JKTM 3MYJB 3HS8A 4KV5F 2L04A 1BM7A 1NDMA 1Z5LB 4K9EC 4NQVA 5HY9B 5D7JB 5I1AB 3B2DC 3AM8A 5DCCA 3LXBA 4S1SL 5D7HA 1KNOA 3PCYA 1PQHA 2VR5A 1U8NA 3EF7A 1CGYA 3VFVA 2IGLA 3DMMB 5C0BD 1CLYH 5JHDD 5L4IA 4XHJD 1OLZA 1DJZA 4GI6A 5J6GB 35C8H 2YAMA 3BPOC 1EZSA 2A4CA 2NX5E 3TOPA 5JHAA 3EOAB 3GTOA 3DX8B 5BZXA 1NAMH 4RAVA 2UY7B 1NC4B 3G6JF 2BS71 1H15A 2EDWA 3ECQA 4HIIB 1TEFA 4H8PA 2EJ1A 4F5CA 5DD6B 2FWSA 3VW3H 1EO8H 1V3MA 2X38A 3I75B 5JIDA 2PP7A 2VSKB 3BUQA 1TYEB 3NSDA 1Q1JL 4HP5A 5T1JA 3MRQA 5GRJL 5IUSA 3UTSD 5C6TH 3NK4A 3WXVH 2P52A 4IU2B 3MO1A 4OCSH 3MFGB 1OQOA 4EJ1C 4TTDC 3VM7A 4U49A 4ZI8A 5D6DC 2DWDB 2DQGL 3GZOA 2VDLB 2Q5BA 1NSNH 1A21A 2C9VA 2OL3A 3HPLA 4MJ4A 1SDDA 4ODHL 4IOSD 4QKXB 5L9DL 4L5FE 3LQZB 1Y18A 4J2QA 5D2LA 4WEBL 4F91B 4MD0A 4ZW3A 1ETB1 3L3KA 3H55A 4NUGL 1KYAA 3P77B 3VRJB 3QXWA 3OJVC 5I30H 4TNWK 2I5YH 5D71H 4DQOH 3TCTA 3VWKA 3IR7A 3D85D 4W9GC 2CJUL 3NACH 4O58H 3MRDA 4BH7B 3BVWA 1FP5A 4LCCC 1P7HL 5C0EA 5FYJD 3C08L 4AW7A 1HH9A 4RGMB 4KODA 4XMPH 5I1JL 2R29A 2HLFC 5BZDA 1JMXA 1UA6H 3CFEB 4YPGA 1I4FA 4JCWA 2D0HA 3U48A 5JOPE 2R56H 5MEOB 1FVEA 1E27B 2G3MA 4PVBA 1JNJA 5I6NA 3TEYA 3ALWA 4NWTL 3VXUD 3WHXA 2ZCHH 4HAFA 4DP8X 4ABUA 2IOIA 2FJHB 4WSJA 2OP4H 3DYOA 5D5MF 4NZFA 5C0NC 3WNMA 2PCXA 4XO4A 4AMKL 5DD6A 3FULA 1Z6JT 1S7UB 3KXFB 4OAWB 2BY0A 2B1HL 3N5AA 3KCPB 4B3VA 4BFBD 2NNAA 2A9NH 3BQVA 4KUZL 2ZXQA 4I89A 3GEFA 5GLYA 2J3SA 2XTSA 4WKZA 4FQXD 3D39A 4IQHA 5KJ7E 2Q7AA 4ZMXA 5GJTH 5CLZA 1MPAL 1N3NA 4NN6C 2WCGA 4Z7UA 2VSCA 3KPLA 3C6SB 5FTLA 5IMMB 3NIDE 2EDHA 4R96B 3L4CA 4QT5A 3GXNA 3EHBB 3BAWA 3RTLA 1KB9J 1OA9A 2WVUA 3DK2A 4PN6A 1WHOA 5FW8A 4GG8A 1VESA 3HPJA 4KTDH 5C09D 3HZMB 2BRQA 3VRJA 3ESMA 5ANHA 2BE5D 4H25A 4WHYG 4YDVA 4YHPB 3CZKA 3MLPA 1Y1UA 4M6OL 2JKJA 2G75A 2ZX5A 4AVKA 1IGYA 3UIZA 4C55A 2FBRA 2XACC 3T04D 4BA8A 1I8LA 3B5GA 1HH9B 2R7ZA 3BPOB 3HZ3A 4BK5C 4BK4A 5EIIA 2VNCA 4I8DA 3SYQA 5ECJE 1CXKA 2BRRH 2C7FA 3ZE2E 2CCVA 3MRPA 1U21A 1U95B 4FI6A 3AMLA 5F7FA 2P26A 3FK3A 3PJSB 2ATPA 4YC2B 4FD0A 3H85A 5CBAB 1VAHA 1AKPA 2YGVA 5ESQA 1CLZL 2Y7SA 1JF1A 4FNTA 1ICTA 1P2CA 3FRPG 2O6EA 1WV7T 1T83A 1TLMA 4N0YL 1Q38A 4I5BA 4C47A 2GJZA 1FNFA 2XTJC 1S7UA 2AK4E 1V7NH 3KXFA 1J11A 3QORC 1XGUB 2FO4B 3GMLA 2ENYA 4AZUA 1IGTB 5AD0B 3NA9H 1JCKA 4ZW8A 1KFAH 5IB5B 4FJ6A 2KQMA 4PYHA 4FMVA 5FHAH 5J57B 1RZ7L 3MA9H 4R97C 2DIBA 3EJYC 1WP6A 2FH6A 5FFOA 1RIVL 2F0CA 2Y5TB 4DN4H 1J9SA 5CEYA 1DVFD 2IPTL 5CLXA 5DQ9B 3I6GA 1IZKA 2IAMB 4N2MA 3PP3K 4WSKA 4MCMA 1FLRH 1D7DA 3BN9C 5FYKL 1MCJA 3DUSB 4RGMC 1FVDB 1RHHB 3C5JA 1S7RB 2PCFB 4YJZL 4ZMOA 1KXTA 1OSZB 5GIRA 5H37A 4NSKA 1XZ0B 1Q94A 5F7DA 3UADA 4WTQA 2ITFA 5GGQH 2EXWD 2BC4B 4FFZL 4FP8L 1O5DT 1FC1A 1NIEA 3BP7A 3FFDA 4APQB 4UBDC 3EIFA 3BEWA 1II4E 2A99A 5I71B 2GAEA 2WLZA 1DVTA 3BVDB 2GY7B 2UXVA 4WWPA 1A7OH 5KN5B 1B2WH 2BERA 2CK2A 1EXHA 5DDHB 3CH8A 3PJSA 1UWXH 4G8GD 3RWCB 1OW0A 2ERJB 5I19H 3QG7H 2VXQL 2BFGA 3FQNB 2BDNL 4BZ2A 4IBLT 2QZ5A 3ETSA 4IOIA 1QBML 3ARDD 4ORGA 3RURA 2W92A 2DM7A 1AZUA 1NFDE 3H53A 1JV5B 3UTQA 3ZGHA 5CCGE 3A24A 3JWDH 2X1PA 4PJBB 4J1UB 4OFIA 2LR4A 5L2KD 3DPDA 4OM0H 1KLUA 4AJYV 4LEXH 4O5LH 4HS6A 1BVLB 5FOJA 2R29H 4X98B 4PW9A 4B7LA 1G5GA 3MBWB 4JRXE 3ZOAA 1UT1A 1REIA 3TT3H 2JIPA 4WY7L 4ZAKD 5EEUA 5DQ9A 5I76A 1ADQL 1ZA3A 1YMHA 1RPQA 1DQMH 1TIUA 4YXHL 3F7YA 3JBG7 2FQGA 2ZAIA 3TZVB 3QORD 5EUOF 1FVCA 5HGGS 2HMIC 4OLYL 1U0QA 2PCPB 2CUHA 3ZTJG 3EH4B 1TZIA 3QDHA 1B0GA 5HDRA 1IAIM 4XI5D 5A2FA 5C08E 1L7IL 4XNDA 2I27N 3BIKA 1J1OH 1A9EB 1TFHA 3PXLA 3CDGA 2ZP0T 3L4YA 5HHME 1RVFL 5C0JB 5G5DA 5I8EA 3IRPX 4Y2OB 2ZYIA 1B9ZA 1N2RB 1NBYA 1LEGB 1DN0A 1JTOA 1NAKH 5E23A 2NT1A 3SBRA 4O9HL 3U9WA 5C0IA 4H8WC 2V33A 1XR9A 4ICXA 5I6KA 1KCUH 4PRNB 2LFEA 2A9CA 2BIPA 3GXIA 1Z32X 4IBTA 5KYNA 4PJDF 1SYSB 2P8LA 3OR6B 1A4AA 1EMTH 4P2AA 5DD5H 1IW7D 3V7MA 5F7LB 4HS8H 2HFFB 1S9XA 3UTZA 3RVTC 1MWAB 3AY4A 5J0BA 2V2TA 1NL0L 4JPWL 4E41E 3UTQB 1EAJA 3APMA 3GK8L 2OCJA 3DRQB 4WFFD 3VX0A 1BHGA 1MPAH 3WL9B 3QUZA 2D3VA 2WZ5A 1BAGA 4G1MB 3SPVA 3MX0B 2V9UA 1N70A 1I3RA 4FABH 1T5WA 4LVEA 4U3XA 4KVCL 4LCWD 2F53A 1P84J 4K7FB 1UTDA 2ZXAA 5DHXB 2AEPH 3O2DA 4YVNA 5IOKA 2OMUA 2W5PA 2JE8A 3NZSA 2WKGA 5F7BA 1S7WA 1YMHB 1EGJL 5LBSL 5FKPA 2UV3A 3APNA 1Z9MA 4ZZFA 1KXVA 4JY5H 3F58H 1O7SA 4ZQKB 2EH8L 2NXZC 2IV9A 2ZG2A 5JHLA 3G5YA 2VR8A 3EOBA 5A3IC 3PAZA 5DS8A 3MJ7B 2X4NB 4R0LC 1C08B 3UAJC 4GAYB 1C12B 4AWJC 2RQEA 5ESVB 1U42A 4DWHA 5FA3A 3RKPA 3FUFA 4Z7WE 5E08L 1E43A 1H6UA 3Q5YA 3FU9A 3N43B 4CC1A 1YY8B 5CLYA 2WGNB 3H6AA 3MLUL 3CQPA 1KJ3H 4PJXB 2NYZA 5MI0B 1M7IA 3MGAA 3HAEG 3CFTA 4ETQA 5JXEC 3K6IA 5I1EH 5TGBA 5KS9A 2X4TB 1TNMA 5AB1A 3SGEH 3QQ9D 1MFAH 4LASH 5GS1C 5C92A 1T3FB 2ZAGA 1XHHA 3PWVB 1M9SA 3FQXA 4FFTA 1B3IA 3NA9L 4I2XE 3QP3A 5LWYL 5IK3A 1F8TL 4LO9A 4JRYD 3ARVA 3IU4H 1GS6X 2VMEA 2ZNXA 3GMMA 3O2VH 2WXMA 3QNXB 4OF0A 3CSGA 3ZL4H 2XV2A 4UTBA 4D0DA 1RCYA 3PHQB 1FRGL 4KNUA 5EPPA 1HE8A 1GJUA 1R3JA 1EX0A 4YDJA 5FYKH 1N18A 1JNNL 3VH8B 3PIQA 4G8IB 1JYVA 5IQOA 4JO2H 1ZVYA 3C60A 4LDEB 5LGJA 4XMKH 1PW3A 1W0YT 3WFBL 4MAUH 4PJBE 1VCBC 1BVNP 3IETA 3SZKC 3QWOA 1RJYA 1FF5A 5K1NA 5GGTA 3VDBA 3B1TA 2W0KA 4IMKC 1AGCB 3K2IA 2CDEA 4TTGA 4J3UA 3LS5H 2BY3A 1FNGB 2ICEA 2OMNA 4CC4C 3K6NA 2UZYB 1T0MA 4K07A 1OP3K 3V4VL 3ZPDA 4LSDA 1X9QA 2DICA 3DUUA 4BD4A 4GBXC 2JKSA 3CCHA 1CG9B 2B14A 2VDLL 3G5ZA 3Q3GA 5A2CA 1QUNA 5DJAB 1YLBB 4ZFFA 3MLZH 3FU6A 4EQ2A 4YHYB 4YXKL 3WIIH 1WZMA 4F93B 1DO6A 5BNXD 1JK9B 2P80D 4HGKC 3BZEB 5EH1A 3T0EC 2XFGB 2YJLA 1MHHB 5CWSB 1R3HB 1IGJB 2IANA 4G7QB 5ID0A 4QRAA 4OLZL 3NUKA 4HWNA 3B9DA 4P9HL 1TJMA 5KW9H 4NB7A 5T5ID 3T09A 1WFJA 2MRYA 3O6LH 3HG3A 1D5ZB 3P4MA 4GRLA 2D7QA 2FR4A 2G5BA 1OTUC 1LD9A 1CZ4A 4M3KB 5T8IA 1AIFA 1ZTXE 5KVFH 4K15A 3FFCE 4BZ1H 4KDLA 2QHLA 4PRHD 3AREA 4XBGB 1MFMA 4ZS6C 1FSKC 1KPVB 2QSCL 2L7JA 3F62A 3BESR 1PKQB 3AAZB 4BXSV 2X4PA 1NCWH 3BVNA 2ZCKH 2ZXEB 1CU4H 1JUFB 3E2HC 2AE0X 4W6XB 1T80A 3U6RA 1LP9A 2EEFA 4ZFQA 4LCWA 3D0LA 3HBZA 4EZLA 3GSOB 5B8CA 3DOIA 1HXKA 3X3FL 3NAAH 3G3LA 1NLBH 1WE5A 2B8OT 3DTXA 3NIFB 4NJAL 2K9UA 5KJRH 1CG9A 3SYPA 1MQ8A 3EGXA 2C8NA 2JELH 4NOFA 2E47A 4K2UL 2PPFA 1HFUA 1M3JA 4GH7B 3BKML 3GMNB 4MA7H 5KSBB 2R27A 4PGEB 5T1DL 2HJFB 1CT8B 5IY5B 3DA0A 4A2FA 3V5DB 5D55A 3NGBB 3BVTA 3H54A 4QRPA 4UM9D 4IRSD 5CINH 2FQDA 3HU2A 3DX8A 5JOPD 1F3JA 3SE3A 2EVJA 1J0KA 2OMXB 3T4AB 2RAMA 1D5BA 3EGSA 4N87A 4E9RA 2Z8WC 3AT0A 3L1GA 4LSQH 1DLHA 2V7HA 4XVSH 3NCJL 1WT5A 5CEXA 2VZ1A 1CIDA 3DARA 1TYJA 5K1JA 2FWUA 3P02A 4O00A 3IJYA 4P5KA 3G5XB 3L3IB 3O5AA 4NQCE 2LABA 4TV3A 4U1HB 1N64H 4X6BA 5AAMC 2IAMD 4HWBH 2XLLA 4UT7L 3U6XS 1EJOL 2ESVE 1BWWA 3KXFD 5EULV 5D2LB 3CC5A 5EN2B 5CZVL 4MD4A 3UABA 4I3SL 4X4MA 2VXQA 4JNXA 1A7PL 1GW0A 5DUML 1HXYB 1ZVNA 2QLVB 3VTTA 4J23A 1PQFA 3HHMA 4F9LA 1PZ2A 2V2WA 4LOFA 1JPSH 3NFSH 4WI0A 4LE8A 3D69B 3U79A 3FTYA 1MNUL 4WDIA 5K9KA 1AGBA 4DUWA 1OLLA 4ZMQA 3KL5A 3OZLA 3CFKA 2H41A 2ZKMX 4QHNA 1NUGA 2VXSH 3WMSA 4YMPA 5C9JA 1A6ZA 2VZTA 3NDYE 2PWGA 2XYCA 3UZEC 1HN1A 3MVSA 1H5BC 2VMJA 5BV7B 1CGWA 4HALA 5HGBA 3UP1A 4I85A 1DEEB 5KYUB 3DROB 3HE6C 5E2TL 2FJHA 1AJ7H 3NQIA 2VPZA 3QHFH 2R2EA 3QPKA 3QIWC 4O02L 1OAQL 3BPLC 3PJNA 4G6AD 1SYVB 3SPJA 3B56A 2Q6WA 3L95B 4UNIA 2K8QA 3FZUD 2F68X 2FO8A 3RG1C 3C5XA 2FEEI 2XKNA 2VLRA 3CE1A 5EO1B 3T3PE 4CJ1A 3KPLB 1Q0YH 3ZMNA 4QCIB 1F6FB 3L48A 5KSVA 4M5SA 5DD3H 4BFFA 4GI8A 3GMPA 4FAAB 1A1MB 4GG8B 1A14L 5AVYB 2ENSA 3B9VA 3EYVB 3X14B 2MCAA 5I15L 1T22B 4F7PA 2ITDB 3B2UD 3CQFA 3A6BL 5IFAL 5DK0A 2ADJB 4NDMA 3Q2VA 2YD1A 2IBGA 3Q2LA 4RWYL 1TT6A 2OMYB 3FNKA 3WO4C 1XF1A 1MHPH 5TDOB 4LLUB 2OX5A 2BIHA 3EAKA 3RNQA 3X2OA 1KLFA 5SWZE 4QJ3B 4U0RC 3WBDA 4NRXB 3U46B 5CM1A 4M9OA 1VJSA 4DVBB 5EOTB 4E9XA 3LZQA 5DMYA 5GLFA 4P04A 3RFRA 5DUPL 2BS9A 5DLMH 1HJCA 4W4NA 5B6CA 4LP4A 1JRHI 4LLWB 3ZMRA 3O6LL 5I74B 4BK5A 4Q97A 5C7XL 2EIBA 2YPVH 2GTZA 4UT6L 5FOBA 3EO1A 3UTPE 5D1ZB 1UA7A 4PBWD 3EFOA 4QRRE 4N85A 2CO6A 2RJMA 3BRDA 2UXGA 4NX0A 4PY8J 5CZKA 4HKBB 4R5TA 1WWCA 1YNKL 3KWWA 2X3BA 4KBPA 2KLRA 4OZGE 5ICXB 4ODSH 3VG0L 2FO4A 3GMLB 4UTAH 3UG3A 3SD2A 4L9DA 5A40E 1VGEH 4LL4A 4I0PC 1R27A 3BUYA 3RY4A 4YX2H 5EO1A 4AI7A 5HHPB 2LFGA 4JPIB 1J8RA 3P4OB 3BPCA 5I8KH 2H2PC 5D4IA 2EDYA 2G4EA 4HGMA 3FF7A 1QFHA 2H6OA 3FYEB 3LQZA 1NGZB 3VU2A 5CCKH 4GAJL 3LOWA 3IDJA 3TJHC 1HU8A 3X2JA 5E03A 4E5XG 2VITB 3MZGB 2VLLB 5I18H 5IROD 1PBYA 1UA3A 3AG1B 1L0PA 4MHHG 2XQ0A 3MC0A 3GFUA 4FQHA 3WS3B 1BM3L 2CG9X 4K3JH 2LHAA 3GKZA 3SDAB 2IALB 4G8FA 3DNKA 1J86A 1ZT1B 2JSFA 4U05A 2E76C 2XXFA 4ZDHB 5EEVA 2D2CC 5BXFB 4Y1TA 1IC7H 1KJMA 2YLHA 4L4VD 3UO1L 4FQIL 1N8OE 3N85H 3BKYL 3GJFA 1Z66A 1ZHNA 3T6VA 2ITEA 4LSQL 3KH3A 4N9GA 4F7EA 1QSEB 1JHKH 1RSYA 1TXKA 3RNKB 4S1QH 3S8GB 3GHEL 1F4WL 1NZRA 3EO0B 1EJ8A 2G2RB 1RZJL 5DHYB 4N8VG 2ZOLB 3F04A 5AKRA 1U3HD 1TU2B 3MA7B 2MCPH 3IYLW 4MQ7A 1PFOA 2X4RA 3ASOB 3QEQA 3FU8A 1KLUB 4DP1X 3HMWH 1N19A 2YD8A 1L0YA 4P07A 1M6OA 3TPKA 2GJRA 3EF4A 4FQPA 2XWTB 3IWVA 2G2NA 4MMZB 5FUZL 3SBWA 3DIDA 4W9HC 1JI2A 3UG4A 4Z7OF 5IHBA 4XXWA 2A83A 1MFDH 3LZFL 3N42F 4ZFZB 4LCCB 3OAYH 3B9EA 2FWOB 5EFIA 4YSAA 4FJZA 3QUML 4I9WD 1KIQA 1UOWA 2OMWB 3MOBL 3FFOA 3GGWA 3GSVB 3WE6A 4AG4H 4P46D 4NQED 4D9RE 4D8PB 1QVOB 1L0QA 1M05A 4KKBC 5C0JA 2ZOWA 1KN2L 2H2SC 4PJ9A 4G8FB 4JFHD 1N2RA 1NBYB 4RAVB 4KROC 1S3KH 1HEHC 1ZLDA 3LNGA 1F90L 4FXGA 5LAXA 4DP5X 1JZ8A 1FN4B 5IMKA 3I02A 4K7PL 4X6CB 2LU4A 4X5WB 3MLWH 3U36B 1J12A 4HA1A 2CBOA 2CKNA 1YJDC 3MROA 4F37K 1RZQA 1R19A 5K9OA 4IBYA 1EANA 1EQWA 3KNBB 4PJ7F 5AW4B 3BAIA 1JV2A 1XTMA 2FTAA 5I1CL 2OCCB 1IJNA 5A2KH 1G0DA 3EYQD 1M1SA 1KV3A 4YAQA 3MUJA 3RB7A 4EDXA 4NQSA 4G1MA 2BVTA 2J71A 4S1RH 4XN9A 3N04A 5J11C 2VN3A 3S6CA 1J1PL 1LWHA 1XF3A 4YH6A 1XCTB 3QUKA 1PX3A 3L3KB 3QRGL 3DVNA 3GTKA 1EUTA 4BZ2L 2OMTB 1BIIB 3D18A 1SN0A 3K71A 4RRPA 3WENA 5DR5H 3FTZA 4PJFB 3QJZA 1RJLA 1H8SA 2FT8A 3DV4B 4LL1A 3DGDA 2XFXB 4MD5A 1ZHKA 4PJIA 3RVWC 3VW3L 5EU6E 1I7ZB 5DEGA 5KBDA 3CNKA 5AENA 5KVDL 4ZXBA 1XMEB 1RUAL 2XX0A 2OJEB 3C08H 4FQXA 2XVKA 3AU1A 1GS8A 4KX9A 4YE4H 3VXSE 2CUIA 3ORJA 4B27A 3O9WB 3B2VL 2R56L 5HD8D 4OCYL 2PYFB 3BAXA 3RU8L 1WC2A 4M6ML 3IJEA 4ZT1A 3U2JA 5MEPA 1FNEB 1DQVA 1KJ2L 1T83C 3BGMB 4PJXF 3RGVC 1MZZA 3CZNA 2EO9A 2HVKA 2XTJB 2XU9A 3FT3B 2X4TA 3D05A 4L4JA 4WUKL 4GQZA 4J3TA 4FYTA 5FB8A 4QRUB 1ZLUH 2XV6B 3O4OC 3ZHFA 5T3ZE 2B1HH 3V79C 3OZKA 4GW5A 2JQZA 2UWEE 2PR4H 2Y7QB 2NY6D 3OGOE 5EIVA 4AENA 5I1JH 1AS7A 3KPRD 5LNDA 4JO3H 1BA9A 3ZZLA 4YSRA 2O61B 3ZT5A 2VB5A 1N7MH 4EN3C 3PUCA 1A1OA 4MMXA 5IF0A 2YXFA 4GKSB 2AQ3A 4LOUD 5IIEB 3H6JA 3GC3A 5D1XD 4NKDA 3TS8A 4ELDA 3N9GH 1B4JL 1ZK5A 3DVFA 5AOMA 1KB9K 4JFQB 1Y0LA 3V0HA 3WU1A 4NXSA 3OMNB 1WAAF 3MPCA 5DEGB 1GYCA 3SJVD 1QTPA 3S97C 2F08A 1KCSL 1F2XK 2QMJA 2Q8BL 5HYSB 2TSAA 2WB7A 1MI5A 3NSJA 2GCYB 3CDYA 3BC9A 2UVFA 3CDGB 5GZOD 2A9AA 3FT1A 3K1DA 3F7PC 2BVUA 3IGFA 4TNWF 3FCGA 1F6AB 2IXQA 2IH1B 4AQAB 3QI9D 3G5ZB 1A6VL 2BLFA 4XODA 1TYRA 4AQ1C 1BMWA 1MEXL 2Y2WA 1JHKL 3BX7C 1IGIL 5CILH 2LTQC 3BKJH 4S1QL 3VGGA 3CVBA 4Z7WB 2WAHA 2GSIA 1R6VA 4X6DE 2O93L 4CRZA 5CIPA 3DX2A 4OGZA 3RVXD 2QKSA 4G8GE 3MRGB 3B34A 4NUPA 3BW9A 2IH9A 1DVZA 4ZNEE 1MCCA 4M3HA 1ZOXA 4NRZA 1KTLB 2YMOA 3CJJA 3EADA 5DD1H 3SKOB 4R97B 1NMBL 1AYRA 2BOBB 4WI6A 3CZLA 3O9WD 4D9RD 1HXMB 5LNEA 2C3XA 2IPTH 2EUZA 1JERA 3T77A 1PZDA 2V6HA 2Y3AA 3NRFA 4FZEL 2NSXA 4N2BA 4XAWL 2W9DL 2A6HD 4YL4A 3TJEH 1JYXA 4YS4A 4JKPH 3TTSA 5C09A 4JHVA 1JXFA 2D7TL 4J8RA 2PCFA 2WO3B 4CA4A 1Q9LA 2OMZA 2VH5L 4IOFD 3R19A 1S7VB 2E9GA 4AIXA 1CL7I 1I3UA 2ATKB 3L4UA 4NZTL 2VKWA 4NPJA 5GGQL 1KCVH 1CYGA 4U4IA 4APQC 4L8SB 4L0PB 1C7TA 1L7TL 3IFOB 2UUDH 3DTUB 3A6CH 1FAIL 3O0LA 5KN5A 2F1BA 4NKMA 5DWPA 2NOYA 1N5AA 4MKMA 2HXAA 1X3DA 2HWZH 3K72B 3ISRA 1EDHA 5IBUB 3RIAF 5CLTA 1IEHA 5HHOE 4NHCH 1FWXA 1CFNB 4RQQB 4WUUA 2ZUTA 4CDHA 1IEBA 4DKDC 1QSFB 3K71B 3EJTA 4XPGH 4XN1A 3QXAB 4MNHA 4OGYH 4JY6B 4WFHD 3KWUA 4J1UA 1K6QH 2CD0A 4WI9A 3E0GA 1PTZA 5I1KL 1WZKA 1BVLA 4JFUA 4Y9FA 4OM0L 2EE9A 2YR3A 5IVNA 5JDSA 3P2BA 3BSZA 5FF6B 3S88L 1TDQA 2O5ZL 2KLSA 3VFUA 4U2YA 3TEXA 2DWXA 2QL1A 1CD1B 2CHDA 3AXIA 3DSNA 4W9KC 4MB1A 1SJHA 2PF6A 1R0AL 2B2XL 3FB8B 2X9YA 3ZTEA 4MS8C 3O3UN 4AIZA 1TCRB 4JN1L 3EO9H 3TTYA 4MS8D 5EOCH 5JR1H 4M7LL 2BZ7A 5F7WC 3MRIB 3NCYP 4LLMB 3VJ6A 2IH3B 3HE6B 3HS9A 1U4FA 4N68A 1IQDB 3CN1A 3GJFH 3GSQB 3K8KA 4IOSA 5C0GB 4Z76A 2OXGB 3SGJC 3BLKA 2VM4A 4RZKA 5AL8A 3NJHA 1RVFH 2VC2L 2ZIDA 4MD4B 4Q9RH 4PJHB 1RKRA 4NQDD 4M6MH 4XMWA 3GD1C 4Z5RB 1NBZA 2Z31D 1N5AB 2AABL 2VDNH 5JORA 1RZGA 3H3KA 3S4SA 3K2KA 5KANI 1NCAL 1DDHB 4HIXL 2EIKB 2VE6B 2Z92B 2A5UA 5CMAB 3GJEA 2JWYA 1THCA 2GJ6E 3RI5K 1X7QA 1BFSA 3QIUC 4DGYH 4Y1AA 1UXWB 5JO5B 2JB6A 4TLTA 3SCMA 1JVKA 4JM2C 1RZJC 1EEZB 4HBQA 1TQBB 3B5TA 4BGDA 1UFGA 3DMRA 5AOLA 4D0BB 5C9JB 1T04A 2DJSA 1MHHA 2RTTA 1L9QA 2DJUA 1F0LA 4MJ2A 3ZO0A 3TU6A 3P4NA 2KZBA 4W9DC 5HVGB 4HEME 4YHLL 4P23C 1WWWX 4IRJB 1Z5YD 4HX1A 3TBBA 4CSSA 5D7JC 3F7VB 2WXFA 2AEPL 2EYTB 3ARGD 3CLFH 1GOFA 3WDHA 4RETB 4KK9C 1JL8A 2FJGB 2D31B 4OFQA 5AL0A 5FKAA 5DRXB 1FBIL 1TKWA 4NIYE 2KPNA 4HIEB 3VI3A 2CDFA 4Y19D 4YLCA 3LHPH 1XGYH 1SIWA 5TE6L 3LTVA 2Q86B 3LZRA 2AQQA 4B9FA 5C0RL 3ZKXB 3VXME 5C8JA 2D9QB 4KPHH 5LB1A 5C3IA 2A6JB 5AWNL 4AQ8C 4GRWB 5FW6A 5TF1L 4ZOCA 3CFMA 4AT6B 4QXUH 2P5ED 3AG2B 2IG2L 3KG5A 2WQUA 2GJJA 4IDJL 5AKTA 5DMIL 2Q87A 4NYLB 5JIIA 2GEQA 3FTGB 3R18A 3BCFA 5HGDB 1WA1X 4OCNC 3EYSH 3A0OA 1L9RA 1KJ3L 2BZDA 1RFDH 5I23A 1BEYL 5KS9B 5IOPB 3RWHB 1FNSL 5E6ZA 1AZBA 4UB0H 1OGYA 1YA5A 5HDBE 1KIRA 2F5BL 2VYRE 2XZAH 4F8OA 4CBPA 1OTSD 4JY5L 4FDWA 1Q0XL 3TT1L 5BVPH 5ICZB 1EJFA 1MXDA 3D2UB 5DEFA 2ZSVA 4K0OA 2C9AA 1UUSA 2HFGH 4P2OD 4JM4H 3VWKC 2I7SA 3P4NB 4HSQA 5C0CE 4XMUA 1FRGH 2YBGA 3MJ9A 2F58L 3ZRCC 2CJUH 4OJEH 2J21A 4AYGA 4F27A 1DUYB 1IBGL 5C70A 3O41A 4TVPE 3WNJA 3T1FB 4MJIA 2RHEA 1JNNH 1XL4A 4OCWL 2XXCB 3MV7B 1EEYB 3HI1A 4C58B 5L4MA 3RTQA 2FQFA 3IR6A 4BUGA 3IFPB 1T4KB 3WE1A 2AANA 1NIDA 1MCBA 1FZJB 2E9IA 1GSMA 5E6IC 2H26B 3L3IA 1IILE 1MUJA 3VFRB 3BPCB 4JO1L 1EHAA 2GI0A 4M7KH 4K23H 4GAGH 2FB4H 3TH3T 4GSQA 3A4DA 1MH5B 1YEEH 4WJ5B 1I8MA 3ET9F 3C6LD 1KELH 2QPSA 5DD0L 4YHKL 2KQAA 2IAND 3K6FA 2YK1H 2OQJA 1ASOA 2DYRB 4Q6IC 3SODB 1NMAH 1IU1A 4M8QA 1OEZW 2P44B 3OPUA 3QQ4B 1FG2B 5JQ6L 1KB3A 1PT1A 4HCGA 5DRWA 1TMOA 1K6QL 4A6YL 2OPCA 2D7OA 4X9FA 2GUOA 5DMGC 2KPWA 3PV6A 4I48B 1JJUA 4X9HA 4J3OG 3FO2B 2RH0A 5E4EB 2XIDA 2DH2A 2QADB 4Y5XC 4QLWA 1U2HA 4JHAL 2VLJA 4E68A 1AG6A 1S46A 3HAEA 4RVBA 3WJJC 3X11A 2QVKA 4YBQC 2NNRA 5IP4A 3S3DB 4LNRB 1HZLA 3O4LA 4KUCF 2X6CA 4E5XA 2RIKA 1CFMA 1KYUA 2CPUA 2NDGA 4KTGA 3BH8B 3FQYA 5F6HI 3ECUA 5HYSG 2RACA 3RWDA 1FE8H 4U6VH 4IU2A 1SFDA 3QC8A 2CHZA 3OG4B 2GB2A 4DJMA 4MLSA 5EZOL 5B8CB 2BIIA 1KB5L 2PTUA 2EUXA 4G8EA 4TTDD 3GMRB 2F54D 1NCBH 1VADA 2QQQA 4EIGB 3OMZA 1BFOB 4X5PA 1YRKA 5EBGA 5KW9L 4MXWH 4F9LC 4PV9B 3LNIA 1RZKC 1UD8A 2NY6B 3MHZA 4K94H 5JW3H 3QCVL 5HYJD 5SX4H 4ZMNA 4UM9A 4PJ8A 2N0KA 1WAAE 3PREA 2HPTA 3PWPD 4XTRC 3VWKB 1JAEA 2X87A 1MJUH 4N8VA 1G4MA 2EKSB 1XZWA 5E6ID 2OX5B 3LXUX 1RERA 4GAAA 3VAEA 4F8LA 1ACYL 4FYRA 2A9BA 2V3DA 1JZIA 5EOTA 3TM7B 1S2EA 3GKWL 4M4RA 3V0WL 4YE0A 5JHMA 5IB4B 1UD3A 4PJ5A 4ZPTB 4ZMAT 1BQLH 1A3LL 1RY7B 4BFNA 1TVBA 1UJ3A 1A0QH 2XJKA 1HIML 5IJVA 3HAEB 5LBVA 4J6IA 4NO0B 1L3WA 2B3RA 3KNBA 4NZDA 3KYMB 4FFZH 4ONFL 3OJDB 1X7SA 3QDME 3BH9A 3GXPA 3CVDA 3BFQG 1CN4A 5C0AD 3RGHA 3U30C 1NEPA 4WCYH 1INDL 4TULL 3DYMA 5EORH 1B0WA 1IAII 1R5WB 2F19H 2IBZX 4HK0B 4JVPA 3TCLB 3AG4B 3HI5H 2YS4A 3S3SA 1A7RH 2V17H 4L37A 3ZBMA 1XCTA 4OLUH 3ARXA 3NPZB 2HCZX 1IFHL 2CKBA 4UOQA 5HHPA 1MIEH 2UY6B 1EAOA 3HE7D 4URKA 4G8AC 1KIUB 4LCUA 4F8NA 3M1OA 1A66A 1KPUB 4YDZA 1QRNB 2D0FA 5L8JB 1KTBA 1ZHKB 1FJ1A 3HE6D 2BX5A 3BUBA 4H7VA 5EUOE 4EOWH 1KZQA 2VR7A 3P40A 3PGDB 2CXGA 2R2HA 3QZWG 3UZVA 4GSUA 1GYUA 4G9DB 3L3HB 1NCCL 1F45A 2KZKA 1IGYB 3ZDXF 3GYRA 1H19A 3VMPA 4J27A 1Q9WA 3ZE1F 2OULB 3MLVH 1ZE3H 1RPKA 2V9TA 1YN6B 2NQCA 2QMKA 5ALBH 4F57L 3CSFA 1M42A 3GJFK 5FYJH 1DUZB 3K2UH 4OZHE 1ZSHA 3GRGA 4ZDHA 4Y8AA 2E7DA 1E4KA 2NXZB 1JZ3A 3WS6A 1U92A 4PJ5B 5J06A 1EHNA 1I9RL 2AV1B 4FJYA 3P9LA 1GGYA 4LZKA 5IROC 4WF7A 3C5ZC 1OZUA 1JF1B 1DBAL 1FNLA 1S9VA 1XV8A 2G4GA 2XY2A 3MODL 5HGAB 3I50L 2Y7QA 2HT4C 4KK8C 1FGVL 3QPXL 1T1XA 1T7VA 2C1OA 5IB3A 4ACPA 4Z23A 2EH7L 2VM3A 5BUPA 5GGSB 5BS0E 2HKAA 3GSXB 3LZLA 3JWNH 1NCTA 5ANMB 4ZBJA 3HVDA 4O9HH 4I13B 5K9QG 2WC7A 3NPSB 2AEQL 1PG7H 2IGFH 3GSRB 4ICWA 3UAAA 3CHQA 5E51A 4PJGA 1MHEA 3PRZA 4H88L 4TNGA 1KTJA 2Y07L 4NDMB 15C8L 1I82A 4N5UA 1NOAA 3QEGL 4BK8A 2X2UA 2G60H 5IBTL 2YARA 2NR6A 1CWVA 5BQDA 3MGTA 4P5TB 4MWFB 4LQ1A 2EVIA 4ECNA 4FABL 1DANU 3KJ4C 3MRRB 4EPSA 3N1PC 5EU4B 5DUPH 3MLSH 2CO4A 4DPBX 5FYJE 1O6SB 3NH7L 3EKCA 1F6AA 5GRZA 5KAQG 2FYYA 4FMFA 2OR9L 3VWJB 3LCYA 1MW2A 4E9SA 1FL6A 2WINA 4HZLB 3TJPA 3SDCA 5EBLB 4AVJA 1WO2A 2J25A 3RGVD 2QT6A 3D3VE 2QDVA 5E00B 3IXTA 3ABMB 4EBQH 2EXYC 1UADC 2EDMA 2BXYA 2J1YA 3QWNA 1DR9A 3FU0A 2BSCA 4KV5E 3UAJA 4LCVA 1TWCA 1P1ZA 1G7LA 3DMMD 1IGML 4KNSA 3PXHA 2CALA 4XAKE 3JWNE 3P4OA 4B9KC 3ZQXA 1U3JA 5E08H 3L9YA 4UOW0 4GO8A 3BWAA 1G9MC 1JFQH 1XGRB 3C60D 3NP4A 3GSRA 3PG2A 4P2QA 3IDJB 5I1HH 3CZGA 4F2MB 3CFJB 4UILH 3FOMB 2YUWA 2D2OA 4YDVB 4YHPA 3VYOA 4JFXB 3ZTJH 2H45A 2VQ1B 4RX4A 5C08B 1PL3A 2X42A 4NS0A 2XZCH 1G1KA 4GT0A 5GISL 2YA2A 3MBED 1G1OA 2FQEA 4H5SA 2WNGA 4HS3B 1KJ2B 1T6VN 1U8OA 5AAPA 3SDAA 3IMBA 5L8KB 1ACYH 1GMEA 4BQCA 2E7CA 3DXAE 4ZTPL 5IT2L 3ZL1A 5EU4A 5IVXE 3QCTH 3VUAA 5DSCB 2AQ2A 2WJ7A 2XRAH 4YGVA 2OXHA 1MKFA 2N59A 3OR7A 3KPMA 1XTLA 1Y4ZA 3SYAA 2QVMA 4EKXA 2XX1A 1HIMH 5D96B 5LXGL 1JE6A 1HL4A 2W65B 4CUCA 1F4WH 3SGKA 4IMKA 5I75B 3BOVA 3HMXA 3W9DA 3LH2H 3HI6H 2BMKA 3L5WA 4HUMB 1A7QL 4X7SL 1TTUA 2AKRA 1WVZA 3NQKA 1BECA 1T2QL 4MBRA 3ROOA 2G3ZA 3S7GA 1RK0A 1AZNA 4TQEH 1MIML 1IMHC 4J7RA 4XCCH 2JKIS 4BJLA 1SUJA 5FK9A 4HFUH 1IVLA 4ZOBA 3SUMA 2X6MA 3TWCL 4BQBA 5J6HB 4GA6A 1IC7L 4BGLA 4FQIH 2ADGB 2AQRA 1MFDL 3LZFH 2YKKA 5ETUA 2VLKB 4F20A 4YDNA 1U8HA 3QE5A 4FZ8L 3WKPA 5B39A 3D0VA 4WWOA 1SLWA 4A6YA 1LE9B 4DPRA 1S7RA 2FX9H 2VQ1A 3DI3B 4X6FB 2LVEA 4QIRA 1MREL 3IJ9A 5AKVA 1NCCH 1XZ0A 5AYUH 5TE4L 3KZ8A 3AU0A 2NLJA 3TPUB 1QVOA 4Y4KD 5E2UL 1OB1A 2NZ1A 2VCOA 3QS2A 1NC2B 2OM5A 4YXLH 1KFAL 2YHGA 3CX5J 4OD2A 1T89A 2BOLA 5LAXB 3RVVC 3FTWA 3ZSSA 3GIVA 1U8JA 2R9HC 5ES4B 4X6CA 4NO3A 4DUVA 3T0VA 3OLEA 1RUQL 1WC7B 5I16A 4J28A 5GSVB 1U8PA 4NP4L 2XTJE 3N06B 4HJIA 4HU8A 2XWBA 4DTGL 3QUMH 4EI5D 5K93A 5I73C 3RVWD 5ERWB 1HL5A 3EJUA 1HYSD 1UB6B 5GGUA 1T04B 3WKYA 5AW1B 4HFWA 1XF3B 1NEZG 2AJUL 3UC0L 2A77L 1NCDH 4N3TA 4WVRA 1WFUA 3CHPA 3CG8A 2LU3A 1RURL 3GI8H 4XP1H 2F8OA 4M48L 5DQDL 1N6UA 4WK4B 3DV6B 5B1JC 2EICA 3JUZA 4Z77A 4AGNA 1M1XB 2DQDL 5HI3D 4YWGL 3GSNA 2QTVA 4H8UA 5BRZE 1OB0A 5FUOH 3WFEL 2HTLC 2WXKA 5F88B 4N8UA 5C2BL 1D7BA 1J8SA 1BVZA 1KQGA 3IJ7A 3WN5B 3K2MC 4WU5B 1QOKA 4HUKB 4PLKC 3QHZH 1RJYB 5LN4A 3U7YL 4KZEL 2V5MA 3ULVF 2YIHA 4FCHA 1I7UB 2EO1A 2CK0H 4JGUA 2PICA 3B8YA 3BIAX 3LKQB 4RBPK 3SOBL 1WQVT 1CICB 1I8KA 5AUMB 2FT6A 1D6VL 2PUQT 4N2LA 3WI9A 3E6FB 5MHSD 1NFIA 2A2QT 5HJ3A 3H2QA 1LHZA 3MUGA 3FU3A 5LN8A 4IGBD 1H3PH 3TT3L 3RGVB 3HB3D 3FRPB 4D2NA 5I16B 2QQLH 3L3DA 1H9DA 3ZZ1A 2HFFA 1VACA 3R1GL 4Z7VE 5DZAA 1YEIL 2A4EA 2X2JA 2Y06H 3FO1A 1WD9A 2FL5A 2I32A 3GBMH 3UPRA 1UB6A 1TPXC 3MCLL 5DUMH 1N7ML 1R24A 2AJZA 4RMWA 3X12B 4QTFA 3PDOA 1G7HB 2BVPA 3IDIB 1YJDL 4R84A 2EDNA 1JWUA 3RGBA 3FTVA 4KQ3L 4LRNH 1OGAA 4U3HA 3P0VL 4ABVA 5I1IH 3U0TB 4YIQB 5TF0A 2D0GA 2K4WA 1NGPL 1KCUL 3OWRA 1BD2A 5IVXB 3K6DA 1UHVA 5SWQA 3TBWB 4DP7X 5FFLA 1Z9SB 2EP6A 3IGAB 4DW2L 1H6FA 1YEHH 2VXSL 4UV7L 1U8QA 4TVSa 4IMLB 4K8RL 3P69A 3X1BA 1B6DA 1BSIA 4G5ZL 3JVGC 5ENWA 1JRHH 1W0VB 2XZZA 3PGFH 4K3EL 1S7SB 4JN2B 2CBPA 1QLRA 4Z76B 1UKTA 5ECGA 3R8QA 3HLAB 2ZYHA 3OB0H 1ACZA 4J5VA 4UBDD 1ZV9A 5JW5A 2OTWA 4LNVA 4KKZA 3VFOB 1CFBA 1J0IA 5HDBF 2P24B 1QR1A 4P59H 3I3DA 5DUJA 5JMOC 5EMYA 4XN4A 3SCMD 3V95A 5EEWA 3HOGA 3LZNA 5F70A 3DO7B 1R3IL 2VZUA 4QXGL 4LL9A 2WBKA 2NTFA 1KDJA 3ZKND 3PWJA 3F58L 4Y16C 2Y36L 1P53A 1T2QH 1UXWA 2D3JA 2BK8A 4PU2A 1HSAA 1PAZA 4XVUD 4E2OA 5ITFA 1HKFA 2QVFB 4PR5B 3ZGIA 4WW2A 4YO0A 5FM5M 5HHMD 1VPOL 2DV6A 3DKHA 4BA0A 4DEPB 3RFZA 2YSSB 3BSHA 3WTUA 4MZ3A 4KTEL 2ZX7A 3WFDH 4G8IA 3M8OL 4Y2DC 1KUMA 2Z6FA 4HC1H 4R7LA 4ZW7A 4FQCL 1QSZA 2X2YA 4OCSL 2CDFB 1JWSA 2X88A 3AXHA 1BZDA 1YCSA 2JB5L 4I77H 4U6XA 5J12B 4KDVA 3RI5F 4L8SA 4WEUD 2VM9A 5F1NB 4NQQA 3ZUNC 2WMPA 3NEEA 2YPKA 4HCFA 2HTKD 4P3WA 4WEBH 4E41D 3N2JA 3N44F 1WGVA 4MASA 2KERA 3FQ4A 3CAFA 2WWMC 2O5JD 2AZUA 1T7YA 4G72B 3KYKH 5F96L 4ZFFB 5DK2A 2A74A 3JV0A 4GT7A 5FHBL 5FO8A 2BP3A 1HXYA 4QNPE 5I0YA 3HRZB 3GLEA 3O6FB 1QD0A 3QIUA 4WV1B 4X4XA 5IOPA 2KKQA 3DK0A 3SCMC 4JGJA 1MCKA 2EKJA 4GYBA 4MAUL 3D69A 3D25B 3WMQA 3D2UD 3BLPX 5C71A 1WWAX 5H4YA 1AGBB 2CJTA 3IDYB 2AF2A 3ARFC 4HHAB 3PWUA 2MNWA 2AJUH 3WHE1 1L9PA 4PV8A 2A77H 2BHUA 2YD2A 5ITFB 5HJBA 1A4KB 4P48A 2ICWI 4Q8BA 1FZOA 3U4AA 4FQLL 2WQ8A 1XGQB 5LNGA 2KZ1B 2CM6A 4WEMB 2FZ3B 4A04A 5AZUA 4PJ8D 1ZT4A 2QGEA 3OKEA 4MB5A 5EWIH 3AREB 4LPUA 3H9ZA 1MG3C 4KUZH 1LO3H 4XVTH 3DO4A 5ELIA 1EHXA 5GM9A 2DMHA 4R0LA 4AQ1A 2ATAA 2NT0A 2BNUB 4OZIB 1WA0X 4U6XB 3QQ3A 3C6EA 1I50A 1IM3B 5E94B 4P2RD 2BNQD 2VDQH 3UTSA 1X4YA 1XCQA 1WH0A 2BIQA 3EG9B 3LKSB 4XO5A 1CR5A 5AAMA 5ACMA 4AYFA 5BO0D 4QRQA 1D6VH 1CI3M 1OGTA 3GTVA 3C6LB 2ZNWA 1MRFL 1VFBA 4I7ZC 3RIKA 1CR9H 3T65B 4NUJA 4PY7A 1AD9A 5KYYB 2OTUB 2V5YA 1MZYA 1OK8A 3KPSD 5D2NC 2PPEA 5D1XB 5DYOA 1AIZA 4F24A 2I07B 4XTRD 1HHGB 2E27H 3VFWB 1G4RA 4E9YA 4POUB 3MNWA 3WTWA 2Y06L 1YNJD 4WV1A 4BZ1L 1PS3A 1KTDA 4TNVF 5LQBH 3QZNA 1C8QA 3LIUA 2ZPKL 1UC6A 4JFYB 2ZCKL 2WW8A 2ENPA 3TBYB 4JUTA 4JP6A 5CD5D 2VLJD 3EJSA 4LCIL 3X2PA 5BVJA 3WLBA 2H9GA 2ZUYA 1PZCA 4OZFB 4UDTB 4UZGA 2EYTA 4AE1A 3UBHA 1U8CB 4GXUM 3UZEA 3X2NA 1ASQA 2QGDA 3DHPA 3KYAA 1YHPA 3BZ4B 3VA6A 4Q0XL 1NWPA 1FFTB 3L5XL 4A39A 5KJRL 2O6FA 2PO6D 4OZIE 5J12C 2YGQA 3PL6A 4IKJA 4XPTL 3SJVA 1ZT4B 3OKEB 4GI9A 3Q8EA 2R69H 1AXSA 1UKQA 5E6IB 1YUHA 1ID5I 5CSBA 5GSRA 4ZAKB 4FX5A 3O4OB 5BS0B 1E2ZA 1L9TA 5ADPL 3UJIL 3HA0A 1BF2A 5HGHB 3SPGA 1NGXB 2XSKA 3C8DA 4IDJH 4XB8A 1HHJA 4WFGD 5DMIH 4GKNB 1OANA 5EB9A 3ULAB 4BRVA 2PETA 4D9QD 3U0PA 5F3HA 4O51B 4ILDA 2J6EL 2R15A 3DX9B 5KYYA 4PS4H 3TV3H 2I9TA 3T9WA 1E9QA 3E3QE 3SY0A 3VGFA 3MRLB 3OD3A 3B83A 5D7LD 4ODWA 3LS4H 4YSDA 4HC1A 3AQDA 4NT6A 1MRDL 4HIHB 1OV8A 2BWIA 3D2TA 1JSYA 3PABB 4AZ8B 5DC2A 4YSQA 2PYEE 2EABA 4LHUD 1A7OL 4HWBL 4UT7H 1MNNA 1UGKA 2XICA 2DL2A 3JWDL 3GBNH 1H8LA 1ZT7B 4Z7VB 4HJUA 1DJHA 1OE3A 4B60A 5D72H 5CJ5A 4CSTA 1SN2A 1KJMB 3LV3B 1QBLH 4HIJA 4JFEB 4HJEA 1SYVA 2OR8A 1TENA 3MCG1 1PPYA 1OQXA 2NXYB 4WY7H 4YSPA 1IB5A 5IQ9A 3II1A 1UVQB 2PW2B 2VRQA 4M7ZB 2XZAL 1BMZA 1KGXA 3P73A 4MCYB 3LH8A 1CE6B 3RX7A 5DEZA 3SKNA 1UCBL 5MI0C 1KCLA 2Z0BA 2HA1A 2R0ZH 4JY4B 4A2LA 2FHBA 1KV7A 5A7EA 3M45A 2Y2TA 3VACA 1HHHB 3QYCA 1MQKL 2ITDA 3SO5A 4OUUB 3K80A 1F1AA 4KITB 1EFXB 3C2AL 3NFPB 5MEQA 2P5WA 4QHUA 4JFSA 2KDYA 1MCOH 2VDKH 3O6FC 1DVFA 3MU3A 3RX9A 3ZTNL 1CXHA 5GJSH 3OSKA 4ZFZA 5EO0A 2AW2A 5C0FA 5I19L 1L7IH 5I8CA 4NENB 1C1EH 5FYLL 4MNQB 5TPWH 1A02N 2NAPA 3T0WA 4DVBA 4XBMA 3UZQA 4FN0A 5ISZD 1KTRL 3WO3B 3A6OA 5CBEA 3T2OA 5DA4A 4OGAC 3O4LD 4KAQH 1TTAA 3HNVH 2D03L 3CSPA 4Y4HD 1S78C 2JJTC 1O6TA 1FGNH 2VLJB 4M56A 4CMHB 1T66D 2DJMA 1OE1A 4HJ1A 4ZQTA 4H26B 1A9BA 2BXZA 1CDBA 1W0WA 2FHCA 3GEWB 2ATPB 4BKSC 1IARB 3H0TB 1CLOH 1TSHA 43CAB 2IBZY 4JRWA 4HUVB 4JFEA 3O0RL 4RGND 2Q8BH 3W3BA 1ED3B 2VDQB 4N0UA 5DJXA 4PG9A 3GK8H 4KRMB 1IC1A 5DHMC 3W38A 1AQDA 1UVQA 3OKMA 4UT9L 3QARA 4RBPH 3E9TA 4XP5L 1K8DB 4XMXA 3X1GA 1UZ6E 4LGSB 4CN4A 1E9OA 3RDJA 4Z7UB 4H2AA 2XUWA 4FS0A 4HWUA 4NN6B 1CK0H 2DEWX 5ANMA 1RIUH 3CFDB 2B4CL 2JI3A 2UX7A 3KDPB 4PJGB 5B22A 5CP7A 2Y5TA 3RB5A 1FL3B 3NJIA 1OWRM 5F7AA 2D7MA 1HZKA 3AITA 4CADA 3KJ6L 1KENH 2YRPA 4O4YL 4OVUA 2ICWA 1I7ZA 3DXAB 4KH9A 1JWMA 5E2WL 1AQHA 2QKIB 3LB6C 4DKFH 1BLNA 1KLGA 4G9FA 1MW3A 1P4LA 5CSZA 2QHRH 5E9DE 2W1NA 3TFKC 4JX0A 3NIDF 3WJMB 2P8PA 3TFKD 4NFCA 1MJ8H 4Z1PA 1QFUH 4OLEA 3WS6C 1JGIA 5DS1A 2DL9A 3WMPA 4N9GB 4HD5A 4FULA 4OV6F 3VFPB 5CBAA 3QXDA 2GEEA 4K9EL 3SKJH 4U7KA 1ECYA 2J2ZB 2J57A 2G30A 43CAA 4UQ3B 1CDJA 2YLKA 5JXED 4L8SC 2O6CA 1A3QA 1MLCA 4FYSA 1AHWB 3C09C 4OSUL 4Z7OE 4H40A 3ARYA 3PHOA 1MJUL 3S36X 3OJMB 1QEWA 2FDBP 3NCXA 3W39B 2HT3C 1MVUB 4JM2B 3VXMD 5TK4A 1ZLVK 3LNFA 5CEYB 6TAAA 4X98A 5DJCA 4NO2A 4JRXB 5IHZB 3FB6A 3IMSA 1M1XA 4NN7C 5EOQL 5CP7B 4POZC 2HTLD 1AGEA 2XWEA 2GUYA 2WWOA 2WD0A 4D7PA 1INQB 4JMNA 4XCFH 5HYJA 1VKXA 5A16A 2WP3O 2Z64C 3FFCB 3QEHA 4F58H 4YXKH 2PNWA 3FO9A 1EZVY 4MHHI 4ATTA 2APTA 3CQQA 4GUOA 3BP7B 3FFDB 1YQVL 4G2AA 3V4VH 2DLTA 3LKPA 4PREB 4KMQA 4WGVB 3CU1A 3CH1B 1MIEL 5BCAA 1MRCL 5C0DB 2JIOA 3FB7A 5DVNA 2J20A 2X53A 3KR3H 3WD5H 4GA5A 3FDWA 2AJVL 3HNSH 4WFED 4JO4H 3FOLA 1PGRB 4XVJL 1UOLA 3F6IA 1Y1VA 1NCWL 1OP9A 5LG6A 1TTFA 2CA3A 4R4FL 1O0VA 3FUMA 3I50H 4K5MA 1S4IA 3O11A 4Y2LA 1ZGLM 1FGVH 3ATBA 1WFOA 3QPXH 4UQ9A 3E6HA 1NCHA 4WSGA 1YO4A 2K78A 3LJ3A 3T08A 1NFDA 3RLSA 4TSBH 5H94A 5F0JB 2YC1A 4ZXBD 3W9EB 1TJGL 1KN2H 2W60A 1XD0A 2FATH 3N0PB 1RUMH 4YIQA 5FC9A 4XC1H 4N0FB 5FO7B 1UURA 4JRXA 4M5TA 5J3HD 1I9RH 2VPWA 1JNLL 3D8MA 1JK8A 2ZSWB 4FQQB 5DHVA 3VD5A 5HVWA 2X2IA 2O72A 4Z7QB 3QEUA 3JV6A 3GUTA 1T20B 3X2LA 5LXVA 4DEPC 4HHGA 3KHOA 2RA1A 5EF2A 1S7SA 4CU6A 3ZVVA 2DQCH 4G80B 4TPRH 2NY0D 4GW1B 2Y24A 1ITBB 1CZ5A 3FMGH 1LGVA 2R8SH 1OSEA 3LEXA 1TZOA 4J6RL 4ZSOE 5IHUH 4OD2B 1IAIL 4XPBL 3CFNA 2J6WA 4A37A 4XNYH 1A8ZA 1EPFA 1IL1B 2GFBB 4ZX3A 4N28A 4KC3B 2BJML 2E6PA 2WNKA 3BGFC 4XPAH 3ZKXC 4MJID 4KPHL 5IBTH 3WFZA 2IQ9L 3L7FB 4LHUB 1QSFA 1J5OH 5F9JA 1GZHC 4UV4L 4U1LA 3MXVL 2PN5A 1ROCA 1C5CL 3MDJA 2EC9U 4Q6IB 4UIKL 1FPTL 5C6PB 2HKHL 1GL4B 2L7QA 5GZNA 2LLGA 2J1ZA 3OZ9H 1NINA 1RFDL 3QQNA 4HHWA 4EUPH 4ZFOB 2GC4C 1JXGA 5CZRA 5G55A 2NY2C 3E7JA 2NY0B 3NCJH 4NKDB 4M1GL 2K3TA 4XNAA 1CDYA 1HILB 2HVJA 3NGBC 1U8IB 1SJHB 4LF3B 5FO7A 5ICYB 3BPNB 1MI5D 3K0WA 5HD8C 2A9ML 2P5WD 3DV6A 4YVUA 3FB8A 1JK8B 3D7PA 4LBEA 4EBQL 3S2AA 3J07A 2DEXX 1BZ9B 1I8IA 4OBRA 4OY9A 2Y5QA 4HJJL 4FXGC 2X6AA 2ESVD 3KXFE 1AJ7L 4PMEA 5FA3B 2PO6B 4QWWD 3DGGA 4ZOEA 4QUOA 5F89B 3H3PH 3HCVA 1YEGL 2XRAL 3KPMB 3KPNB 3QQDA 4PD4J 4QO1B 3QXUA 3WNNA 3NFSL 2XA8H 4I3RL 3ZKMD 3SDXF 2WZAA 4Z7WA 1ORSA 4PJAA 4Y19A 1BOGA 5I2IA 3KYNA 3FU5A 5DJYA 4MXVF 2IOMA 1XAKA 5C0BB 3QZWB 2NVYA 4OT1L 4UQ2B 2UVEA 3MJ6A 3D25A 3MRGA 1JZ7A 2YD6A 3BUIA 2A74C 3FQXB 1SOKA 1OCRB 1A3ZA 5DMKA 4LDLB 4FG6D 3A47A 4NZUH 2NY1D 2CJ3A 3TYGH 4FG6C 2C26A 3BGAA 3IKCA 4N4YB 3TURA 1ORQA 4IJ3C 5CWSA 1OY3B 4TSAL 3WFHA 3NA4A 3TFBA 3PHQA 2H4EA 4K5OA 4TS6A 2YGNA 1KYOJ 4TQ8A 2XN1A 5LLIC 3WO4B 1XD1A 4EVNA 1BVKA 1A3RL 5DD3L 5EOQH 5B39B 3C2SA 3FUDA 1DEDA 2EECA 5C09B 3V6ZA 1J9RA 3VGDA 1LE9A 2PWFA 1GC1C 3SYCA 1EEQA 1RQ5A 3VWJD 5AOIA 5FKAB 2APVA 4HJ0C 4B95C 2PI8A 5IGXH 5AAWC 5T5NG 1QLFA 2ROYA 1EO8L 1BZ9A 5EDSA 3NACL 1AGCA 4O58L 5L9DH 3K6SB 1YQVH 4U1MA 1RH8A 4OKVA 3QFDB 1JUFA 1T0OA 1U3HB 4HDIA 3KL3A 3LIZA 3HLAA 4X6DB 2Y7LA 2PXYD 5KVEL 1I75A 3F7QA 4FL4B 4XNUH 4MCNA 1IEBB 3BI9X 1CDCA 2GT9A 1BOGB 2WV3A 4LFHG 4BWTA 1T1YA 1ES0A 1YYLH 2YEZB 2Z7YA 3HBPA 4JY6A 3WHE0 1CVSC 1GY2A 5GGVY 3EGXB 1V54B 5J6SA 1UWEL 4JEGB 3WXWH 2G5DA 4FE9A 3CN4A 1UT2A 2BSEA 1NC4D 2XCMC 1KN4L 2DWYA 1I1YA 1NCBL 2OKMA 4KKAC 2FJFB 3V55A 2HLAA 4P5RA 3F01A 3UEZA 5BVJB 3OAUL 5AOZA 4GAJH 5AZEH 3RY6C 1PQEA 2YRLA 4BE5A 1L8FA 3ARPA 5JYMA 3UBGA 2YN5A 3D5OF 4XVUC 3OAZH 4L3ED 1KYDA 2VERA 5FO9B 1LLAA 4QYOB 1NWOA 1Q9KA 2QPEB 7CGTA 5F0MB 4JANB 4LDOB 4UYQA 1T5KA 2R23B 4TXVB 3S0PA 4JKNA 3JVFC 3NMEA 2H0JA 3VXRD 2XZQH 4HVBA 4OI9A 3DSFH 5E9AA 2BSTA 2HFTA 5F9WB 2RALA 1CICA 1I8KB 3IJHA 2BOCB 4JR9H 1GJWA 1NFIB 3IF1B 4J6RH 4JPSA 5IHUL 1IAIH 1U91B 3MKGA 4JMXA 1N67A 3HUJB 1MH5A 4ONFH 6PAZA 1HS6A 4XMLL 3P2DA 2PXYC 3QO1B 1I3QA 1GH7A 1ERNA 2WN2A 1X7QB 4ENGA 3AABA 3AS2A 5F8RC 3WKMH 3NPSC 4Y1AB 3D3VD 2VMCA 3QQ4A 4K3JL 3U7WH 1TG8A 2A6KA 1KEGH 5K9KB 1R24B 3GT6A 4OCXH 1W72H 3ISYA 1BCIA 2E5EA 1JWUB 3IMWA 3CSBA 1OM9A 4ZUTA 4N2NA 4JZOA 3F5WA 3PAYA 3Q43A 1HAWA 4HEMA 2X7LB 4TUUA 4ADIA 4PPTA 1CXEA 4OB5L 2D31A 3LMJH 4U2ZA 1DEEA 2BNRB 4X50A 4HIXH 4HIIA 2A0LC 1F13A 1YEHL 2ICCA 2V7NB 5JHLH 3R1GH 5B3JF 1XGPB 4MDJB 5D9SB 3VSUA 4Z3JA 3RZCD 2R23A 2CU9A 2WVTA 1NIBA 4HLJA 3Q5TA 4K3EH 4UZUA 1ZEAL 4P4KB 4NM4H 5MEOA 2YKLH 3CC5B 1TTBA 5IZ7A 2W59A 4J3OD 1QWUA 4AYFB 8PAZA 5T5MD 4JDTL 5KSAD 3EYFB 3N1QC 1FIEA 3QUZD 4G8EB 2GJ6B 1WGOA 2J43A 3SKMB 1AD9B 2ED6A 3MRBB 3EYVA 3X14A 4WO4D 4ZS7H 3ES6B 5F2FA 4R2GD 4JFTA 3U9UA 3WKQA 4OT1H 3DLQR 2KT6A 1WCBB 4JAMB 2IPKA 2VWEC 4JZNA 4WU7B 5I24A 2NXYD 3HTLX 3K6OA 2OI9B 4HPOH 4PGJA 2VJXA 3FT2A 1J1PH 2Y6TE 1SMYD 2WBJA 5CBEB 3O6KL 3MJWA 2NXZD 4PR5A 5CUSH 5D7SH 2HAZA 3N40F 1T1WA 3KPRE 4UU9B 5HGBB 4Z78B 2PTTA 5F7YC 1E6OH 1R3KB 1A2YA 4HJGB 4O02B 4WKXA 5C0CA 2AV7A 4H44C 4Z3HA 2FSEB 3H9SE 3ARGC 5EO9B 2Y7OA 4PCTA 1YNLH 2J8UE 1U8LA 3FN9A 3WHXB 4IBQA 3O8XB 5LBGA 1TVBB 1UJ3B 5J9PB 3VQ1C 4NO0A 3LN4B 3MRQB 4FXLA 3NZHL 5J13C 1DQML 1FZJA 1G9NH 4IK7A 2WNXA 1G87A 2Q2LA 2QQNH 3FH5A 3QJTB 4OCYH 1NMCC 1URZA 4ZAKA 4G82A 3IXAA 2V9QA 1D5XA 4D94A 5KSVB 3QNZB 1KF9B 1S7TB 1E30A 3X1NA 4GXFA 5KTEL 4PRHA 4IDLA 5TDNB 3D51A 4L5FH 4PJEA 3AG3B 3VXPB 1HNGA 2XQYA 3CXHK 1QBAA 4KROD 1G7QA 4IJTA 1KPUA 2MIZA 2JV6A 5CJOH 1OSYA 4OFPA 3MRBA 1ETJA 2JJVA 2JQAA 3MRDB 4HAKA 5DRWB 4L9LC 3ES6A 1VC3B 4YDKL 4BH7A 4PJ8C 4DN3L 4JAMA 1G7JA 1E4HA 2B9AA 2WP3T 4NIKB 4PWGA 1QPKA 1AOHA 4FNPA 1EMTL 1LDPL 5EU7E 3GTPA 3GRBA 3EH1A 1IC5L 5F7EL 3WS3A 4C83B 1OF0A 1JFHA 4XO9A 4PVNA 1ZLEA 5JPNB 3OL2A 3LQMA 2DN7A 4P2OC 2H8PA 2Y1VA 2HT2C 3QDJB 4R4ND 1QTSA 2YQBA 3B1UA 3WIHL 4H20H 2O6DA 5BZWA 5D1ZA 5C0CB 1UJTA 3EFDH 3KYKL 2IV8A 5HVFB 4PJGF 3T8XA 3C8KA 3VWJC 4CKVX 1U8LB 3HG2A 1TQWA 3FN0H 3UXFA 2YQ2A 3Q9QA 1BEXA 2CHNA 2BVYA 3IMTA 3BH8A 3GTGA 4KRLB 4Y4KB 2NW3A 2Y7MA 3KPOA 3SDAD 3CN3A 4L0YA 1UACH 4MZIA 1SEQH 3H2WA 4JPIA 5FO2A 4ENZA 5BJTB 2HT4D 1Q0EA 3U7AA 3UTOA 1IGIH 1UXMA 5CILL 3MV7E 4NBXB 5DDHA 2JIQA 3HUJF 3VD4A 1VFMA 2AQNA 4LKXB 1AFVL 1HHHA 3UBXA 3BO8B 1A7QH 5BOPA 2ESVB 2C3VB 3RPKA 5GGRY 1FLTX 4N8VB 1GZPB 4WRLA 1BBDL 3RZCA 1KCSH 4G43A 1LO3L 5T5NF 3MV9A 3CVHL 5C6TL 1W6WA 2Q7NA 1L9SA 2V5SA 2XXMB 1X9UA 4IRJD 4M5YH 2H1XA 3AWGA 1SHSA 2AXWA 2YXWA 2L8AA 2ZP8A 1G43A 3MGTB 4ELME 2IALA 1J5DA 2R1YA 3GS0A 4PIBA 2VDQL 2CE6A 1N0LB 4QJ5B 3MBWA 2OW6A 4NQCA 1T1ZB 2JH2A 2DMBA 2JKWA 1MEXH 5PCYA 2OMVB 3S37H 1IKFL 3FB7B 3B9KC 3H4HA 1MRFH 1VSCA 2Q3XA 3FSVA 2Q76B 2EE6A 2VJ8A 5HDLA 5A1AA 4DQOL 1S8DB 2ZKHL 3QIWB 4WNSA 3OAZK 4X4ME 4GBXD 3A67H 4XBEH 5DFVD 4BFGA 4DGVL 2XG4A 1RUKL 2APSA 5E00A 1GKOA 4QY8A 5E2UH 1F11A 1TJHH 5E6IA 3BP4A 4DGIH 1WITA 4E0RB 3LIZH 2N7SA 3W11C 5DZNA 2PPAA 1XF4A 4XMKL 3WY4A 3BD4A 4Y0GA 1KYFA 1K2DB 1H8OA 4MSWA 1OAKL 2AJ3B 5K9JL 4A2HA 1ZHLB 4NQSB 3CV5A 1HHJB 4C8XA 4P3CH 4BV1A 4Z3EA 4G7YH 2O5YL 4UIMB 2P7TA 4UAHA 5J3HC 1I1FB 4KFMA 1FJ1B 3FT4A 2EDLA 3SKUD 4QRTA 4Y4FB 1A0QL 1SF3A 3VXRB 3IB4A 3NSYA 1USZA 4AEIL 3FO0H 4MD5B 4Z7QE 4H1LA 4JFPB 4U1IB 4F7TA 4JZJA 1N6VA 3S88H 1I7RB 1GJIA 2ZWYA 4C56A 5FS5A 4JO2L 1SQ2N 1TZIB 2Q0ZX 1DBKL 1I3RB 2XOTA 2R0KL 2HWZL 2WIMA 2Z9TA 2P8PB 2I24N 2EC9T 3GZPA 1C7SA 1X5JA 1CGXA 3QWQB 2KBGA 3N1MC 4ZX5A 1WIUA 2HJKA 3WNLA 1DVYA 1HOCB 1N59B 2LE9A 4HK3N 5TE7H 1NFKA 1S8DA 1ADQA 2APWA 5C07B 1ETZA 1T1XB 1JV5A 5B1BB 5JUEH 2ORBL 1CGVA 4HIPA 4X8JB 1UG9A 2J73A 2NZIA 2YU9A 1BZQK 4YHZH 4XX1E 4DMRA 4OZ4A 5SWZA 3VD9A 1BV8A 4TUKL 4WGKA 5A6IA 2B2XH 1TWFA 2QLYA 1LEIB 1E2WA 3X2KA 2DRUA 5F7NC 1MVYA 3M3GA 1N8ZB 2IVFC 4UQEA 3V8OA 1LMKA 5FCUL 1QO3B 3DX0A 4P23A 3A5VA 1T03H 4FQJL 4LVNC 5SWSD 2D7NA 5A2LH 4NQDB 4ADJA 3X3FH 2V2XA 3TZVA 4IJ3B 1A6AB 1WAPA 3QUYA 3MRHB 1DL7L 1OAXH 3UOAB 3T0EA 1HAUA 3VXRA 1XSIA 4I18B 1S7WB 2AS5M 2EIZA 2YRBA 4YR6B 2HJLA 4QTHA 1IC5H 5F7EH 5TH2A 2FECI 2EH7H 2G2PA 3EBIA 3P0VH 5FHAL 3VI4A 2PYFA 3MA9L 3FBKA 4HXAH 4FLSA 5ABZA 1FDOA 2ARJA 1XBRA 4PLJC 4HU2A 3APDA 1UHDA 5J1AA 4M1DH 4B9IA 4PLJD 1U8JB 4ZODA 2XI9A 1MFEL 3DX1A 4KHXL 2CLZA 1SYSA 2P8LB 3OR6A 3HZVB 1AHWC 1RU9H 3C09B 4LU5L 3TN0A 1PYWB 2XN9A 4IHOA 4Y4HB 5GJSL 1ZJBA 2FD6L 2ZYSA 4IRSA 3DHUA 1AMYA 4Q7DA 2ITCA 3S5YA 5CIPB 3HG0A 3BAEH 3S34L 2DM3A 1S7XB 4HG4J 3BFWA 3BDYL 2UZYA 4IEFB 4UDUB 1ORQB 3QG6A 3ZE0E 5HXMA 5FGSA 1L5GA 4XN8A 3PQYE 3Q3GB 1BQUA 1FFNB 4KI1A 3VXOB 1K4DA 2CLRB 2DQ6A 4MB4A 1FBIH 5EEXA 5DHEA 3HE7C 3FFCD 1FUNA 3ASWA 4KJPD 3BIBX 2YSTA 1A4CA 2JF1A 1EO5A 2HN7B 1X9LA 5H37G 4YZFE 2NR6D 4N2DA 4PJFF 5TF1H 4CN1A 1F41A 3IETB 4P9ML 1PT0A 4FC3E 4LAJH 4B41A 3W37A 2FBJH 4X0KA 4TNVK 4HDIB 2J5LC 3QDMB 1E5AA 4GIPD 3P4MB 4HWZA 3V6FA 3GIZH 3QXDB 3V6BR 1I1AC 1YECH 3OR7B 4PGBB 3CTTA 4MJ6A 4CSPA 1KGUA 1F1DA 4B9PA 4L3EA 1ADQH 4I77L 4M1CC 3IT8D 4HEPA 5CZVH 4ZJ9A 3TA3D 2CLZB 5FTJA 1TUPA 2QPDB 1RD6A 4X8XA 1AGDA 3DIVA 3IGKA 2DYPA 2GAZA 4IHOB 1ONQA 4DZBB 5D1XC 3B2UC 3M88A 3IGLA 2IGTA 4X6EA 4KQ4L 1M2OA 2HFGL 4QDGA 4RSVA 1KTLA 2G0KA 3D0LB 4CVWA 5T3XE 1FCGA 1XIWC 4G6FB 3VXTA 4CJ0A 4N5EC 5C0CD 5EN3A 1R5VB 1J9QA 1TQSA 2AJZB 4AGQA 3DGCR 3ULVC 4IGBC 3OWEA 4YK4C 4EEEA 1YEEL 3VH8A 4A6YB 3ZHKA 2R4RH 4KO8A 2W0LA 1VZHA 1OARL 4X6FA 3GS7A 4GMSH 2AQ1A 4QHMB 2Y2YA 3CD4A 12E8H 3TIWA 2GC7C 5FFGA 4LSRL 5JLZA 1IBHA 4KXBA 4LT7A 4O02H 5A6MA 1MHPL 2LAGB 1I8IB 1XAUA 5FUCC 3PV7A 2JCWA 2MSPA 4ES8A 3CZUB 3M07A 3W0WD 4A6YH 5HP5A 1F3JB 3PJLA 1ZRUA 4GFTB 4C56D 1PZSA 4AXWB 4PYGA 1G5AA 5D1ZC 2PYED 3N55A 1H3TA 1PF3A 4OV5B 2ZUXA 4WWKD 4LGRB 4XVTL 5JA9A 1JP5A 1PD6A 4RWYH 3EJYD 5IJBC 4JFFA 3KPSE 4M7LT 3ARBC 3OKLB 3TNNA 5GZND 3EZ8A 3UL4A 5CGYD 1JGDB 3ZYIA 4XN2A 4AQEB 5I15H 2IJ0C 4ALAH 5SWSE 3MREA 4X6BB 1NFDB 5GGUB 3S4SG 3QGVA 4NNPH 5EU6A 2X0WA 5ID0B 5H94B 4Y5VB 3VXSD 1AW8B 1CD0A 4LMQE 4TUKH 4ATWA 4LIQH 4JKMA 4Z95L 3DX6B 1HQRA 4MDRA 1J0JA 2DQTL 4TVUA 3SULA 1LD9B 1KB5H 5D5MB 5HHVH 1CYWA 4HX1B 5F44A 2A4ZA 2NY4B 1TCRA 4LP5A 3JZYA 1ZGLA 1PYQA 3VD7A 5F88A 2EDDA 2ZOOA 4DAGL 1T20A 4OF7A 1AI1H 4LASL 2FX8H 4MQSB 2X4PB 1E61A 4G80A 4MAYD 1JWSB 4RGOH 4XOCA 1CLCA 2J1XA 1JN6B 1J18A 2NYYD 4PGZA 43C9B 5C8JB 5LUMA 3GSNH 4MNQE 3HUJE 1WBZA 5KAQF 3MJ9H 3MRCB 4HXAL 4YUEH 4OIIH 5IEKA 3UC0H 1AQ8A 4UOJA 1JGUL 3HZYB 4PVLA 1WUZA 4OQTA 2DM2A 3OF6D 1P5VB 2MQCA 1C5BL 2J8HA 2WWKO 1O7DC 3BGFB 4KI5C 4KXCA 4WWKC 4AK1A 1VZGA 1KBGL 1JNLH 4JHBA 3AS3A 5DK2B 4JFFB 4N86A 2Y1ZA 5EG6C 2RFXB 4CMMA 1B4TA 2VLRB 3LDBB 3QIUB 5FUOL 3VD0A 5JO5A 3MRJA 3S8FB 4PI2A 5DYGA 1BJMA 4YZWA 1TQBC 4Y1AE 3BWZA 2NX5D 3QAQA 3QHZL 5B7FA 1T1WB 4UU9A 1JVLA 4Z78A 3GTLA 1A1MA 3RYMA 2HLAB 4HQQH 3V7AE 1Q72L 4HJGA 5B21A 4HKZA 4ANVA 3L9BA 2G5UA 1Y6KR 3F7VA 3RA7H 4BQ9A 3IRZA 1B0RB 4JVUA 4MA1B 2XC8A 1W16A 3QK0A 4XNYL 5J6GA 2YAOA 2ALWA 4WWID 3O8XA 2JMRA 3RFZC 1JPGA 3G6DH 5CEXB 3IGAA 1HZHL 1TWHA 5HI3C 4A2DA 1UKSA 1R5IA 2YAEA 4QHKI 1OVZA 1AZZC 3G5XA 2SODB 2P9RA 3HIZA 1A7RL 2V17L 4S1DC 2BVOB 3D85A 5D7IB 3ZIMA 4LVHC 5J1TC 1IE4A 3IRCA 5JIHA 3IKKA 4DCQB 3DOHA 1JCVA 1E50A 1PZAA 1JN6A 5DMJB 3MGOA 3V4PA 3M86A 3OZ9L 4XE5B 3QORB 3IDGB 3C9NA 4NYLA 1A6UL 1EZUA 4B9ZA 2EUVA 1YEGH 3UGEA 1ZS8A 1SY6L 1E3XA 2OL3B 3SQRA 3VD2A 1O9ZA 1ORSB 1ZS2A 4MX7A 4KQ3H 4Y19B 3HZYA 5JDJA 1NICA 3EFOB 2VL5B 4AL8C 3Q06A 1WFTA 3H1ZA 4BZYA 5E4AA 3AUVA 5KSAA 4Y9EA 4XC3H 2VLMD 4ISVB 4KI5D 4X5XA 3QDGE 1CTOA 5AVTB 3VFWA 5ICZA 2FE0A 4KQ4H 1LK3L 1NIFA 5DEFB 3FW6A 4P05A 1JGLL 3NSFA 4HJJH 1NGQH 5LDUA 4KK6D 2YFNA 4KRPC 2GUOB 1AC0A 1F1GA 3ZDXB 1SBSL 4OTXL 1D9KD 5DO8A 3JZ7A 2BVQB 3DX4A 4AG4L 3ZO9A 4K7PH 1I4FB 4L8BA 4LSVL 3MUY1 1AANA 3UGUA 3RHWK 1MFUA 3EGDA 2Z93A 2DQEH 4M43H 5E1AB 5JXAH 1E27A 1PG7L 1UM4L 3QO0B 2X7LA 2XY1A 3AROA 4PTTA 3MODH 5ALCH 3C8KB 5KVGH 4WAFA 1Q90A 5AW2B 1Y1DA 5DC9B 2OZNA 1H5NA 1ZWIB 3V4VB 5ISZB 2QVTA 3EFFB 5ITBL 3KPTA 1AP2A 3STLB 4LSRH