4JCZA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
147
structure length
147
Chain Sequence
HHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 60
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jczA00
2UUIA 5BQIA 4JCZA 4AL1A 2H8AA 2Q7RA 4J7TA 4NTAA 4AL0A 4YL0A 5K0IA 4JRZA 4NTBA 3LEOA 4JC7A 2UUHA 3DWWA 4YK5A 3B29A 5BQHA 4YL1A 4YL3A 3PCVA 2PNOA 4NTFA 4WABA 5BQGA 3HKKA 5HV9A 4BPMA 4J7YA
chains in the Genus database with same CATH superfamily
5L0DA 2A0UA 5A6BD 1V55C 2P61A 2AWCA 4DVYP 3GWLA 3EGDA 4XEKA 3U9MA 4GEHA 2FGYA 4X0RA 3VRCA 5CI8A 4DRJB 3F47A 1O5HA 1M56C 4IWBA 2G62A 3QTHA 4YJWA 5HSWA 2OJED 2HMQA 2YWAA 5A69A 4OD5A 1M6TA 3GEHA 3DAGA 3U5SA 2WL8A 3ZWIA 2R7TA 4N06A 4HFKB 3E9VA 2EPMX 2R7XA 2YL0A 1W2WA 2KW3C 2GA0A 3C8ZA 3NKEA 4MS2A 3DXJF 3JSEO 2CGEA 1V4AA 1YLMA 3O6XA 1LS1A 1YYJA 2EPLX 3PCVA 2I15A 4JURI 4FWVA 3RW0A 3L34A 3IQCA 2VB6A 4CDVA 3TK0A 2P6VA 3HNJA 3FDQA 2AVKA 4MVOA 5AGFA 4BG0A 1RJ9B 4J30B 2UUIA 1UG7A 1HY5A 3KL4A 1YARO 5BQIA 3UGOA 1ZZPA 4WJ0A 1NZEA 2VASA 5BUOA 3S28A 2H8AA 3M4CA 1NG1A 1T5OA 2VCAA 5A6JA 2AWYA 5KYYB 5AC5A 3U9JA 2L81A 2NUTA 3TQOA 2LIGA 2XRHA 1BR2A 4L6RA 3UR3C 3NRHA 2M64A 3T4RA 1MMAA 2QE9A 3M1CB 3Q7GA 4E0IA 1LPEA 1OKKD 1T9KA 1DOVA 2L6HA 4MVMA 1AVOB 3C8GD 1YA9A 4O6YA 1M2VA 5E3CA 3NKDA 3LESA 2HZ8A 2YEVA 1I4ZA 3ZQYA 4EKWA 5T3WA 3HTKC 2Y69C 2XLEA 3GM3A 4JCHA 4FX5A 1RJ9A 2F22A 3FHDA 2ZXOA 3PMRA 1XWJA 3I5QA 3K66A 4Q7CA 2CNWA 2EPOA 3B71A 1SZIA 3UMHA 5DLJA 1PD1A 1YJGA 1ZHWA 2C04A 3KYJA 3VYWA 1MMNA 2R7OA 1HMOA 4WGYA 2J9BA 4CIHA 1YVIA 2XS8A 4EBBA 2G3VA 4YT5A 3F46A 1H7IA 4J32B 5B1AC 4DRHB 3ZG1A 3POVA 2R7UA 1G5ZA 4CX9A 1JR8A 1I4YA 2J9WA 3JT1A 3PDMP 2YVKA 2WZFA 3ZQVA 2LCHA 3IQTA 4I3MA 4E7SA 3AOUA 1E83A 4KNVA 3NYJA 3S0XA 1NU7D 4Q4ZF 4H4KC 2IYLD 4BPMA 4RBNA 4DOZA 1JAFA 2DYSC 1B68A 3N2ZB 4O79A 4IRUA 4RD9A 3RVYA 4BEMJ 1VLSA 2LD6A 2IBFA 1QPUA 3FMSA 1XZQA 2Q4FA 2J46A 3MYIA 1JMWA 4G7HF 3BEHA 4LLCA 3U0CA 1ST6A 4OD4A 4NTAA 3I4UA 4XLPF 2AP3A 2YQYA 5L0GA 3QW1A 4MVSA 3Q6MA 4JIOA 1VLTA 2IXMA 2WZGA 4CBEA 2EPNA 1WN0A 4JE9A 3B29A 3DD7A 3E70C 2LQGA 3DJUB 3BRJA 1TWCA 3U2LA 1E86A 3RQFA 4ZLDA 1A7VA 3G4ZA 3AGUA 4A4AA 4NTFA 4MW8A 3RQEA 1GGQA 4JJGA 3S29A 3U8PA 1D1BA 4CDYA 2MYSA 2Y39A 2Y3GA 5E3AA 5E33A 2L6FA 4C3EA 2LK4A 4C3DA 5JS5A 1PV3A 2DI3A 4JW1A 3RFYA 5AC4A 3T6BA 1T01A 2OQMA 3O55A 4N6HA 3J06A 3C62A 3ASNC 3K1HA 1ZU4A 3RVZA 3S90A 1U0BB 2R02A 1LI7A 2A69F 3AG3C 3EHNA 4W8KA 5DS6A 3ABKC 4PJLA 2VCBA 4JZAA 4NC3A 1E84A 5K0IA 1A7DA 2JPUA 4JRZA 2HV6A 4NTBA 3JYYA 2J7PD 2R05A 5B1BC 3ZTZA 4EUKB 3H2VA 1LE4A 1E2XA 1Y4CA 4DBRA 5BQHA 2ETSA 2HFIA 4R32A 4G7ZF 1Z23A 1U89A 4P9TA 2OOCA 5DQZA 4IARA 1QSPA 5EK0A 3M79A 1HE1A 3EHMA 3T6JA 4MVRA 3EFOB 2L9JA 3OEOA 3S9OA 3QZCA 5HV9A 4BEJA 5D91A 3ZVRA 5JT4A 2I8BA 4AL1A 3SXMA 1BBHA 4U5CE 3VF0A 1KNYA 2XLVA 4J7TA 1FR0A 3OA1A 4LACB 5KYXA 3O10A 4KNWA 3CZ6A 3FVYA 3AG2C 4KC9A 3MBGA 4YT4A 2W4MA 3R2PA 2PP4A 4YN0B 1KTMA 3KMIA 4YT2A 2PBEA 3LEVA 4OIRF 4XTKA 3ZSUA 2GDCA 2J8WA 3HNIA 4PR9A 4YL3A 1YA7O 3R7CA 5L0HA 2YL1A 1JOGA 2NSGA 1WOLA 5JP7A 3K1IC 1KU2A 4RDAA 1FTSA 1Z5ZA 4PFOA 4D4NA 1VYIA 3HKKA 2J0WA 1VB5A 3JYHA 4P9FA 4XEFA 1K05A 3DM5A 4U9DA 3RH3A 2D4UA 4HEAJ 4JCZA 2XLHA 4GYTA 1GS9A 4MTGA 1ZHTA 2QUPA 2MHRA 3K6BA 3EGXB 5KYWA 1EKYA 3NMKA 2Q9AA 3T6GB 3C63A 4CS9A 4U5BE 2XM4A 3SXYA 5DS4A 1SF8A 2XM0A 3US6A 1YDIA 4AX2A 4GQHA 1Q0DA 2GAQA 2KYHA 3ASOC 1ZYRF 4F4BA 5KYUA 3QMKA 3IQ5A 3L1MA 3X1OA 4E18A 2HS5A 1HW2A 4OIPF 5IY5C 1GM5A 3DMDA 4MTOA 5F28E 2KJGA 4AK9A 2PNOA 1F1MA 1Q0MA 1QLEC 1NFOA 2KQ9A 1D0XA 4AE4A 1BZ4A 4BJTA 4E7ZA 4MNDA 2G3KA 3QVYA 2R7WA 1WASA 4PJMA 4U5GA 1GQAA 3SP1A 3TD7A 4DXWA 1OQCA 5L0FA 2R7VA 1ZW2A 4IAOA 3C8GB 1OCCC 1NSGB 2J45A 3K33A 3MYFA 4I44A 3EPVA 1DOWA 1Z63A 4OIOF 2Q7RA 1NBBA 3VAYA 3MFNA 3RF3A 1VK5A 4NCQA 1ZW3A 4NQFA 3FOPA 3GANA 4BJ1A 4CSAA 4ANJA 3GM1A 2IXOA 2ZXRA 3LEOA 1SMYF 1OR2A 2HMZA 2JX0A 1CGNA 1OXBA 1NU9C 3MLGA 3N0TA 4JC7A 3JRTA 4N4WA 1J8MF 5KYUB 1OCRC 3GM2A 4EWCA 1Q0KA 3EH2A 5COMA 4EBKA 3SNHA 4FESA 1EQ1A 1CGOA 2P0NA 5L0JA 2KSFA 1Y6DA 4PJJA 4MQ9F 4CSAC 1LM3B 1ORJA 1T6IA 2KNHA 2XLMA 3B9QA 1C02A 1YYXA 1A0BA 1CPQA 1Q0GA 4U5EE 3JSZA 2GFHA 1AUEA 3V5ZA 3EG9A 2R7SA 1LI5A 3AG4C 2BC5A 2XL6A 5F5HA 3LLKA 1D1CA 1TFOB 2OJQA 4PFPA 4C7OB 3V5YA 3CAXA 1BR1A 3HLZA 1QQ3A 2X51A 5GPGB 4UDVA 3L8IA 1L7CA 2A6EF 3ECSA 3HNKA 3EH1A 3IEEA 4LDRA 4LDKA 3RQGA 2B0HA 3TOLA 2HV7A 2X0CA 5DS5A 2E87A 3S27A 3FAJA 3HJCA 1YAUO 4MW3A 1TWGA 4Z9HA 3W2VA 4CJGA 4YT8A 2YL7A 5KYXB 1JPNA 3C7JA 3Q6NA 3LS1A 1Z6AA 3ITFA 3TJ5A 1OCOC 3X2QC 3B0PA 2BE5F 1JRAA 2XL8A 3ABLC 3G50A 4Z9JA 1UFBA 3SXZA 1FFTC 2PX0A 4ULWA 4QI0A 4MVQA 2CYDA 2ZD9A 1LKXA 1JPJA 3AQCA 3ZC4A 5B3IA 3RIPA 1WTYA 1RMVA 1K40A 4IGGA 1A7EA 2KK1A 2Y3DA 1T6UA 1M57C 4JEAA 4CIPA 5JVEA 1N1CA 2W9YA 1C03A 3DKAA 2J9VA 4WGZA 2UUHA 2NUPA 3QVZA 3T9OA 2GWWA 1MQVA 4ZLCA 3DE9A 2EINC 3C8GA 3FXHA 4PJNA 3EGXA 1SYQA 2YKZA 4U9EA 4XPXA 5JUAA 5KYWB 1ORSC 1VYKA 1K04A 2JD3A 1D0ZA 2Q9BA 1BR4A 1WATA 2IXNA 2NPUA 4JVSA 5JSLA 5BQGA 3K7DA 5TJ5E 1D0YA 4CS7A 2C03A 3EFOA 1R5ID 2ASRA 3L0IA 4XQ1A 2Y3HA 3WHNA 2XXAB 1TWAA 2EIJC 2PF4E 4DVZA 2QLAA 2CNWD 5T1DB 2QY9A 4XEVA 1YZAA 4JKVA 2XL4A 1MNDA 2RD9A 4G7OF 3LNRA 1WGWA 1OKKA 4QDLA 2Q00A 3GODA 1YZCA 2FFHA 2P7VA 2OG2A 1G4US 2LP4A 2YHSA 5A6BA 4IAQA 3W2WA 4BJ5C 2YL3A 3HNLA 2O9XA 2R9RB 4Q5SF 5DVWA 3IHUA 2ICWG 2R7QA 1CPRA 2R25A 3I5PA 4M63A 1O3UA 2OCCC 5COFA 4JTCB 5T3TA 3SEOA 5L0CA 2L7AA 4XLNF 4MTFA 2HJMA 2VC9A 4CS9C 3CEXA 2XXAA 1RCPA 2H7OA 1S7ZA 3DZAA 3QW0A 1XZPA 1LIHA 3CSKA 2J0XA 3EGDB 1LVKA 1C17M 2ZXPA 2A1DD 4JTDB 3U2MA 3LJBA 1FNTc 4MVZA 1L3PA 2XSEA 3FOOA 1H9TA 2XLDA 1J8YF 4W8PA 2P1AA 5KYNA 1LE2A 3CQZA 1LS4A 3M15A 1RKEB 2WVOA 4K7BA 3H2UA 3K1IA 4PK4A 5JLIA 3LS0A 3GEIA 5CI9A 1VTMP 5A6AA 2YLGA 1FAPB 1I5NA 2HKVA 4NY3A 4U5DE 3Q7LA 4D4XA 1IZMA 3W8HA 1HE9A 4XWJA 2Y3BA 1MMDA 1H6GA 1ZHYA 3B0UX 2R7RA 4ULVA 2CCYA 1G4WR 1FMVA 3AJMA 1ZU5A 4K1OA 4O6NA 3FAPB 4C7OA 3DJNB 4KI2A 2B0JA 4AE4B 3TJ6A 3EJNA 2OU6A 1NFNA 2NUPB 4DBQA 1CGME 3N24A 3NYMA 1FFHA 3WODF 1MNEA 3NMIA 4Z9IA 4I1MA 2A68F 4U5HA 4MVUA 1OR3A 5EGYA 4YL0A 1U6HA 3SXKA 2NUTB 2H7VC 3WAQA 2VH3A 1RKEA 2WZLA 2J7PA 3EZHA 3O39A 2W4BA 1HMDA 3VM6A 3DWWA 4PACA 4C3BA 4I1OB 2EIMC 4K0DA 1PCXA 2YLDA 1ZVZA 1FMWA 3TULA 2LFFA 1M2VB 1IW7F 1G8XA 2IM8A 4P6IC 2EILC 2H7BA 2HSQA 3GWNA 3LNMB 3L8JA 5L0IA 3KKBA 1R4TA 2V3CC 1WWPA 2AU5A 3AGTA 3ZDLA 3GORA 1OW7A 2DYRC 2QNLA 1OW6A 3A11A 4JTAB 4E17A 2XLWA 3DE8A 3DM9B 3JZ0A 2A6HF 2FAPB 5D92A 3V7OA 4H54A 1E85A 4EHPA 2YRFA 5L3QA 1Z3IX 2RSEB 2DB4A 3EG9B 3G4XA 3PHF2 1V74B 1PD0A 2L6GA 3MX3A 3S84A 4IJJA 5F5FA 1M2OA 2QTVA 1Q0FA 2Z15A 3ATPA 4AL0A 1BDJB 2IXPA 3KH2A 1ZHXA 1O87A 2BL2A 2DGJA 4XPWA 3LLIA 3DI5A 3NYLA 4E0HA 2KGOA 1A41A 4KBLA 4YK5A 3OWTA 5EHHA 1TR2A 2Q9CA 4G78A 2PFDA 4U5FE 4YL1A 3IQ6A 1OW8A 3SZRA 3UMIA 4EBJA 2OKUA 4ONSA 3IPMO 3LAYA 1AEPA 2V26A 5KYYA 4CS8A 4WABA 2Q3TA 2WB7A 5B3SC 1ZHZA 2HSBA 4IB4A 5L3VA 3LUTB 3UMKA 4J7YA 3U3BA 1OCZC 1T6QA 256BA 4LDQA 4CDAA 4EIYA 1TQGA 2NSFA 4G0HA 3RYLA 3NDBB 1OXKA 4OINF 2HUJA 3JRMO 2LFDA 4FAPB 3UGPA 2WVNA 4OIQF 4BJ6A 1HW1A 1ORYA 5JRAA 2KC3A 4CS8C 3H65A 5COGA 4QI2A 1EA8A 4DRIB 2A0BA 1S05A 2ZXWC 3DAFA 4LLEA 4XPYA 1APCA 1QZXA 3TOMA 3UNGC 3ZTMA 5A6KA 2W45A 1MMGA 4O6MA 3ZIBA 1TWHA 1VOMA 2XS1A 3EQLF 4BJ5A 2OEVA 3A9CA 4DJ9A 1Z7Qc 1V54C 3ABMC 2EPKX 3KYIA 2LSEA 4JEBA 2NG1A 3AQBA 4A2NB 1TKNA 2EIKC 4ER9A 2MWQA 1EI7A 2YZSA 5DQTA 1SR2A 3AG1C 2TMVP 3RKOF 3B0VC 3JCUQ 2CW0F 5FCLA 3KPHA 3M4BA 4O7GA 3V5XA 4N6CA 3WG7C 4JJFA 4B6IA 3SYNA 2IOQA 3W4YA 1VMAA 2OEXA 2M4EA 1RKCA 2R03A 2VCCA 2ZPAA 3EZIA 3NMJA 5E2QA 2YLIA 3GEEA 2XLOA 4HE8D 2WVQA 3JTLO 3U3FA 1TFKB 3U8VA 4CJOA 2PX3A 1RXQA 2CDQA 4YWQA 1H9GA 2D5RB 4LERA 2J9UA 2HJ3A 4HFFB 5FZTA 5CIVA 1QVXA 4BJ6C 1NLXA 3NG1A 3W8IA 1QKRA 1D1AA 3C18A
chains in the Genus database with same CATH topology
2UUIA 5BQIA 4JCZA 4AL1A 2H8AA 2Q7RA 4J7TA 4NTAA 4AL0A 4YL0A 5K0IA 4JRZA 4NTBA 3LEOA 4JC7A 2UUHA 3DWWA 4YK5A 3B29A 5BQHA 4YL1A 4YL3A 3PCVA 2PNOA 4NTFA 4WABA 5BQGA 3HKKA 5HV9A 4BPMA 4J7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUI A;  5BQI A;  4JCZ A;  4AL1 A;  2H8A A;  2Q7R A;  4J7T A;  4NTA A;  4AL0 A;  4YL0 A;  5K0I A;  4JRZ A;  4NTB A;  3LEO A;  4JC7 A;  2UUH A;  3DWW A;  4YK5 A;  3B29 A;  5BQH A;  4YL1 A;  4YL3 A;  3PCV A;  2PNO A;  4NTF A;  4WAB A;  5BQG A;  3HKK A;  5HV9 A;  4BPM A;  4J7Y A; 
#chains in the Genus database with same CATH topology
 5L0D A;  2A0U A;  5A6B D;  1V55 C;  2P61 A;  2AWC A;  4DVY P;  3GWL A;  3EGD A;  4XEK A;  3U9M A;  4GEH A;  2FGY A;  4X0R A;  3VRC A;  5CI8 A;  4DRJ B;  3F47 A;  1O5H A;  1M56 C;  4IWB A;  2G62 A;  3QTH A;  4YJW A;  5HSW A;  2OJE D;  2HMQ A;  2YWA A;  5A69 A;  4OD5 A;  1M6T A;  3GEH A;  3DAG A;  3U5S A;  2WL8 A;  3ZWI A;  2R7T A;  4N06 A;  4HFK B;  3E9V A;  2EPM X;  2R7X A;  2YL0 A;  1W2W A;  2KW3 C;  2GA0 A;  3C8Z A;  3NKE A;  4MS2 A;  3DXJ F;  3JSE O;  2CGE A;  1V4A A;  1YLM A;  3O6X A;  1LS1 A;  1YYJ A;  2EPL X;  3PCV A;  2I15 A;  4JUR I;  4FWV A;  3RW0 A;  3L34 A;  3IQC A;  2VB6 A;  4CDV A;  3TK0 A;  2P6V A;  3HNJ A;  3FDQ A;  2AVK A;  4MVO A;  5AGF A;  4BG0 A;  1RJ9 B;  4J30 B;  2UUI A;  1UG7 A;  1HY5 A;  3KL4 A;  1YAR O;  5BQI A;  3UGO A;  1ZZP A;  4WJ0 A;  1NZE A;  2VAS A;  5BUO A;  3S28 A;  2H8A A;  3M4C A;  1NG1 A;  1T5O A;  2VCA A;  5A6J A;  2AWY A;  5KYY B;  5AC5 A;  3U9J A;  2L81 A;  2NUT A;  3TQO A;  2LIG A;  2XRH A;  1BR2 A;  4L6R A;  3UR3 C;  3NRH A;  2M64 A;  3T4R A;  1MMA A;  2QE9 A;  3M1C B;  3Q7G A;  4E0I A;  1LPE A;  1OKK D;  1T9K A;  1DOV A;  2L6H A;  4MVM A;  1AVO B;  3C8G D;  1YA9 A;  4O6Y A;  1M2V A;  5E3C A;  3NKD A;  3LES A;  2HZ8 A;  2YEV A;  1I4Z A;  3ZQY A;  4EKW A;  5T3W A;  3HTK C;  2Y69 C;  2XLE A;  3GM3 A;  4JCH A;  4FX5 A;  1RJ9 A;  2F22 A;  3FHD A;  2ZXO A;  3PMR A;  1XWJ A;  3I5Q A;  3K66 A;  4Q7C A;  2CNW A;  2EPO A;  3B71 A;  1SZI A;  3UMH A;  5DLJ A;  1PD1 A;  1YJG A;  1ZHW A;  2C04 A;  3KYJ A;  3VYW A;  1MMN A;  2R7O A;  1HMO A;  4WGY A;  2J9B A;  4CIH A;  1YVI A;  2XS8 A;  4EBB A;  2G3V A;  4YT5 A;  3F46 A;  1H7I A;  4J32 B;  5B1A C;  4DRH B;  3ZG1 A;  3POV A;  2R7U A;  1G5Z A;  4CX9 A;  1JR8 A;  1I4Y A;  2J9W A;  3JT1 A;  3PDM P;  2YVK A;  2WZF A;  3ZQV A;  2LCH A;  3IQT A;  4I3M A;  4E7S A;  3AOU A;  1E83 A;  4KNV A;  3NYJ A;  3S0X A;  1NU7 D;  4Q4Z F;  4H4K C;  2IYL D;  4BPM A;  4RBN A;  4DOZ A;  1JAF A;  2DYS C;  1B68 A;  3N2Z B;  4O79 A;  4IRU A;  4RD9 A;  3RVY A;  4BEM J;  1VLS A;  2LD6 A;  2IBF A;  1QPU A;  3FMS A;  1XZQ A;  2Q4F A;  2J46 A;  3MYI A;  1JMW A;  4G7H F;  3BEH A;  4LLC A;  3U0C A;  1ST6 A;  4OD4 A;  4NTA A;  3I4U A;  4XLP F;  2AP3 A;  2YQY A;  5L0G A;  3QW1 A;  4MVS A;  3Q6M A;  4JIO A;  1VLT A;  2IXM A;  2WZG A;  4CBE A;  2EPN A;  1WN0 A;  4JE9 A;  3B29 A;  3DD7 A;  3E70 C;  2LQG A;  3DJU B;  3BRJ A;  1TWC A;  3U2L A;  1E86 A;  3RQF A;  4ZLD A;  1A7V A;  3G4Z A;  3AGU A;  4A4A A;  4NTF A;  4MW8 A;  3RQE A;  1GGQ A;  4JJG A;  3S29 A;  3U8P A;  1D1B A;  4CDY A;  2MYS A;  2Y39 A;  2Y3G A;  5E3A A;  5E33 A;  2L6F A;  4C3E A;  2LK4 A;  4C3D A;  5JS5 A;  1PV3 A;  2DI3 A;  4JW1 A;  3RFY A;  5AC4 A;  3T6B A;  1T01 A;  2OQM A;  3O55 A;  4N6H A;  3J06 A;  3C62 A;  3ASN C;  3K1H A;  1ZU4 A;  3RVZ A;  3S90 A;  1U0B B;  2R02 A;  1LI7 A;  2A69 F;  3AG3 C;  3EHN A;  4W8K A;  5DS6 A;  3ABK C;  4PJL A;  2VCB A;  4JZA A;  4NC3 A;  1E84 A;  5K0I A;  1A7D A;  2JPU A;  4JRZ A;  2HV6 A;  4NTB A;  3JYY A;  2J7P D;  2R05 A;  5B1B C;  3ZTZ A;  4EUK B;  3H2V A;  1LE4 A;  1E2X A;  1Y4C A;  4DBR A;  5BQH A;  2ETS A;  2HFI A;  4R32 A;  4G7Z F;  1Z23 A;  1U89 A;  4P9T A;  2OOC A;  5DQZ A;  4IAR A;  1QSP A;  5EK0 A;  3M79 A;  1HE1 A;  3EHM A;  3T6J A;  4MVR A;  3EFO B;  2L9J A;  3OEO A;  3S9O A;  3QZC A;  5HV9 A;  4BEJ A;  5D91 A;  3ZVR A;  5JT4 A;  2I8B A;  4AL1 A;  3SXM A;  1BBH A;  4U5C E;  3VF0 A;  1KNY A;  2XLV A;  4J7T A;  1FR0 A;  3OA1 A;  4LAC B;  5KYX A;  3O10 A;  4KNW A;  3CZ6 A;  3FVY A;  3AG2 C;  4KC9 A;  3MBG A;  4YT4 A;  2W4M A;  3R2P A;  2PP4 A;  4YN0 B;  1KTM A;  3KMI A;  4YT2 A;  2PBE A;  3LEV A;  4OIR F;  4XTK A;  3ZSU A;  2GDC A;  2J8W A;  3HNI A;  4PR9 A;  4YL3 A;  1YA7 O;  3R7C A;  5L0H A;  2YL1 A;  1JOG A;  2NSG A;  1WOL A;  5JP7 A;  3K1I C;  1KU2 A;  4RDA A;  1FTS A;  1Z5Z A;  4PFO A;  4D4N A;  1VYI A;  3HKK A;  2J0W A;  1VB5 A;  3JYH A;  4P9F A;  4XEF A;  1K05 A;  3DM5 A;  4U9D A;  3RH3 A;  2D4U A;  4HEA J;  4JCZ A;  2XLH A;  4GYT A;  1GS9 A;  4MTG A;  1ZHT A;  2QUP A;  2MHR A;  3K6B A;  3EGX B;  5KYW A;  1EKY A;  3NMK A;  2Q9A A;  3T6G B;  3C63 A;  4CS9 A;  4U5B E;  2XM4 A;  3SXY A;  5DS4 A;  1SF8 A;  2XM0 A;  3US6 A;  1YDI A;  4AX2 A;  4GQH A;  1Q0D A;  2GAQ A;  2KYH A;  3ASO C;  1ZYR F;  4F4B A;  5KYU A;  3QMK A;  3IQ5 A;  3L1M A;  3X1O A;  4E18 A;  2HS5 A;  1HW2 A;  4OIP F;  5IY5 C;  1GM5 A;  3DMD A;  4MTO A;  5F28 E;  2KJG A;  4AK9 A;  2PNO A;  1F1M A;  1Q0M A;  1QLE C;  1NFO A;  2KQ9 A;  1D0X A;  4AE4 A;  1BZ4 A;  4BJT A;  4E7Z A;  4MND A;  2G3K A;  3QVY A;  2R7W A;  1WAS A;  4PJM A;  4U5G A;  1GQA A;  3SP1 A;  3TD7 A;  4DXW A;  1OQC A;  5L0F A;  2R7V A;  1ZW2 A;  4IAO A;  3C8G B;  1OCC C;  1NSG B;  2J45 A;  3K33 A;  3MYF A;  4I44 A;  3EPV A;  1DOW A;  1Z63 A;  4OIO F;  2Q7R A;  1NBB A;  3VAY A;  3MFN A;  3RF3 A;  1VK5 A;  4NCQ A;  1ZW3 A;  4NQF A;  3FOP A;  3GAN A;  4BJ1 A;  4CSA A;  4ANJ A;  3GM1 A;  2IXO A;  2ZXR A;  3LEO A;  1SMY F;  1OR2 A;  2HMZ A;  2JX0 A;  1CGN A;  1OXB A;  1NU9 C;  3MLG A;  3N0T A;  4JC7 A;  3JRT A;  4N4W A;  1J8M F;  5KYU B;  1OCR C;  3GM2 A;  4EWC A;  1Q0K A;  3EH2 A;  5COM A;  4EBK A;  3SNH A;  4FES A;  1EQ1 A;  1CGO A;  2P0N A;  5L0J A;  2KSF A;  1Y6D A;  4PJJ A;  4MQ9 F;  4CSA C;  1LM3 B;  1ORJ A;  1T6I A;  2KNH A;  2XLM A;  3B9Q A;  1C02 A;  1YYX A;  1A0B A;  1CPQ A;  1Q0G A;  4U5E E;  3JSZ A;  2GFH A;  1AUE A;  3V5Z A;  3EG9 A;  2R7S A;  1LI5 A;  3AG4 C;  2BC5 A;  2XL6 A;  5F5H A;  3LLK A;  1D1C A;  1TFO B;  2OJQ A;  4PFP A;  4C7O B;  3V5Y A;  3CAX A;  1BR1 A;  3HLZ A;  1QQ3 A;  2X51 A;  5GPG B;  4UDV A;  3L8I A;  1L7C A;  2A6E F;  3ECS A;  3HNK A;  3EH1 A;  3IEE A;  4LDR A;  4LDK A;  3RQG A;  2B0H A;  3TOL A;  2HV7 A;  2X0C A;  5DS5 A;  2E87 A;  3S27 A;  3FAJ A;  3HJC A;  1YAU O;  4MW3 A;  1TWG A;  4Z9H A;  3W2V A;  4CJG A;  4YT8 A;  2YL7 A;  5KYX B;  1JPN A;  3C7J A;  3Q6N A;  3LS1 A;  1Z6A A;  3ITF A;  3TJ5 A;  1OCO C;  3X2Q C;  3B0P A;  2BE5 F;  1JRA A;  2XL8 A;  3ABL C;  3G50 A;  4Z9J A;  1UFB A;  3SXZ A;  1FFT C;  2PX0 A;  4ULW A;  4QI0 A;  4MVQ A;  2CYD A;  2ZD9 A;  1LKX A;  1JPJ A;  3AQC A;  3ZC4 A;  5B3I A;  3RIP A;  1WTY A;  1RMV A;  1K40 A;  4IGG A;  1A7E A;  2KK1 A;  2Y3D A;  1T6U A;  1M57 C;  4JEA A;  4CIP A;  5JVE A;  1N1C A;  2W9Y A;  1C03 A;  3DKA A;  2J9V A;  4WGZ A;  2UUH A;  2NUP A;  3QVZ A;  3T9O A;  2GWW A;  1MQV A;  4ZLC A;  3DE9 A;  2EIN C;  3C8G A;  3FXH A;  4PJN A;  3EGX A;  1SYQ A;  2YKZ A;  4U9E A;  4XPX A;  5JUA A;  5KYW B;  1ORS C;  1VYK A;  1K04 A;  2JD3 A;  1D0Z A;  2Q9B A;  1BR4 A;  1WAT A;  2IXN A;  2NPU A;  4JVS A;  5JSL A;  5BQG A;  3K7D A;  5TJ5 E;  1D0Y A;  4CS7 A;  2C03 A;  3EFO A;  1R5I D;  2ASR A;  3L0I A;  4XQ1 A;  2Y3H A;  3WHN A;  2XXA B;  1TWA A;  2EIJ C;  2PF4 E;  4DVZ A;  2QLA A;  2CNW D;  5T1D B;  2QY9 A;  4XEV A;  1YZA A;  4JKV A;  2XL4 A;  1MND A;  2RD9 A;  4G7O F;  3LNR A;  1WGW A;  1OKK A;  4QDL A;  2Q00 A;  3GOD A;  1YZC A;  2FFH A;  2P7V A;  2OG2 A;  1G4U S;  2LP4 A;  2YHS A;  5A6B A;  4IAQ A;  3W2W A;  4BJ5 C;  2YL3 A;  3HNL A;  2O9X A;  2R9R B;  4Q5S F;  5DVW A;  3IHU A;  2ICW G;  2R7Q A;  1CPR A;  2R25 A;  3I5P A;  4M63 A;  1O3U A;  2OCC C;  5COF A;  4JTC B;  5T3T A;  3SEO A;  5L0C A;  2L7A A;  4XLN F;  4MTF A;  2HJM A;  2VC9 A;  4CS9 C;  3CEX A;  2XXA A;  1RCP A;  2H7O A;  1S7Z A;  3DZA A;  3QW0 A;  1XZP A;  1LIH A;  3CSK A;  2J0X A;  3EGD B;  1LVK A;  1C17 M;  2ZXP A;  2A1D D;  4JTD B;  3U2M A;  3LJB A;  1FNT c;  4MVZ A;  1L3P A;  2XSE A;  3FOO A;  1H9T A;  2XLD A;  1J8Y F;  4W8P A;  2P1A A;  5KYN A;  1LE2 A;  3CQZ A;  1LS4 A;  3M15 A;  1RKE B;  2WVO A;  4K7B A;  3H2U A;  3K1I A;  4PK4 A;  5JLI A;  3LS0 A;  3GEI A;  5CI9 A;  1VTM P;  5A6A A;  2YLG A;  1FAP B;  1I5N A;  2HKV A;  4NY3 A;  4U5D E;  3Q7L A;  4D4X A;  1IZM A;  3W8H A;  1HE9 A;  4XWJ A;  2Y3B A;  1MMD A;  1H6G A;  1ZHY A;  3B0U X;  2R7R A;  4ULV A;  2CCY A;  1G4W R;  1FMV A;  3AJM A;  1ZU5 A;  4K1O A;  4O6N A;  3FAP B;  4C7O A;  3DJN B;  4KI2 A;  2B0J A;  4AE4 B;  3TJ6 A;  3EJN A;  2OU6 A;  1NFN A;  2NUP B;  4DBQ A;  1CGM E;  3N24 A;  3NYM A;  1FFH A;  3WOD F;  1MNE A;  3NMI A;  4Z9I A;  4I1M A;  2A68 F;  4U5H A;  4MVU A;  1OR3 A;  5EGY A;  4YL0 A;  1U6H A;  3SXK A;  2NUT B;  2H7V C;  3WAQ A;  2VH3 A;  1RKE A;  2WZL A;  2J7P A;  3EZH A;  3O39 A;  2W4B A;  1HMD A;  3VM6 A;  3DWW A;  4PAC A;  4C3B A;  4I1O B;  2EIM C;  4K0D A;  1PCX A;  2YLD A;  1ZVZ A;  1FMW A;  3TUL A;  2LFF A;  1M2V B;  1IW7 F;  1G8X A;  2IM8 A;  4P6I C;  2EIL C;  2H7B A;  2HSQ A;  3GWN A;  3LNM B;  3L8J A;  5L0I A;  3KKB A;  1R4T A;  2V3C C;  1WWP A;  2AU5 A;  3AGT A;  3ZDL A;  3GOR A;  1OW7 A;  2DYR C;  2QNL A;  1OW6 A;  3A11 A;  4JTA B;  4E17 A;  2XLW A;  3DE8 A;  3DM9 B;  3JZ0 A;  2A6H F;  2FAP B;  5D92 A;  3V7O A;  4H54 A;  1E85 A;  4EHP A;  2YRF A;  5L3Q A;  1Z3I X;  2RSE B;  2DB4 A;  3EG9 B;  3G4X A;  3PHF 2;  1V74 B;  1PD0 A;  2L6G A;  3MX3 A;  3S84 A;  4IJJ A;  5F5F A;  1M2O A;  2QTV A;  1Q0F A;  2Z15 A;  3ATP A;  4AL0 A;  1BDJ B;  2IXP A;  3KH2 A;  1ZHX A;  1O87 A;  2BL2 A;  2DGJ A;  4XPW A;  3LLI A;  3DI5 A;  3NYL A;  4E0H A;  2KGO A;  1A41 A;  4KBL A;  4YK5 A;  3OWT A;  5EHH A;  1TR2 A;  2Q9C A;  4G78 A;  2PFD A;  4U5F E;  4YL1 A;  3IQ6 A;  1OW8 A;  3SZR A;  3UMI A;  4EBJ A;  2OKU A;  4ONS A;  3IPM O;  3LAY A;  1AEP A;  2V26 A;  5KYY A;  4CS8 A;  4WAB A;  2Q3T A;  2WB7 A;  5B3S C;  1ZHZ A;  2HSB A;  4IB4 A;  5L3V A;  3LUT B;  3UMK A;  4J7Y A;  3U3B A;  1OCZ C;  1T6Q A;  256B A;  4LDQ A;  4CDA A;  4EIY A;  1TQG A;  2NSF A;  4G0H A;  3RYL A;  3NDB B;  1OXK A;  4OIN F;  2HUJ A;  3JRM O;  2LFD A;  4FAP B;  3UGP A;  2WVN A;  4OIQ F;  4BJ6 A;  1HW1 A;  1ORY A;  5JRA A;  2KC3 A;  4CS8 C;  3H65 A;  5COG A;  4QI2 A;  1EA8 A;  4DRI B;  2A0B A;  1S05 A;  2ZXW C;  3DAF A;  4LLE A;  4XPY A;  1APC A;  1QZX A;  3TOM A;  3UNG C;  3ZTM A;  5A6K A;  2W45 A;  1MMG A;  4O6M A;  3ZIB A;  1TWH A;  1VOM A;  2XS1 A;  3EQL F;  4BJ5 A;  2OEV A;  3A9C A;  4DJ9 A;  1Z7Q c;  1V54 C;  3ABM C;  2EPK X;  3KYI A;  2LSE A;  4JEB A;  2NG1 A;  3AQB A;  4A2N B;  1TKN A;  2EIK C;  4ER9 A;  2MWQ A;  1EI7 A;  2YZS A;  5DQT A;  1SR2 A;  3AG1 C;  2TMV P;  3RKO F;  3B0V C;  3JCU Q;  2CW0 F;  5FCL A;  3KPH A;  3M4B A;  4O7G A;  3V5X A;  4N6C A;  3WG7 C;  4JJF A;  4B6I A;  3SYN A;  2IOQ A;  3W4Y A;  1VMA A;  2OEX A;  2M4E A;  1RKC A;  2R03 A;  2VCC A;  2ZPA A;  3EZI A;  3NMJ A;  5E2Q A;  2YLI A;  3GEE A;  2XLO A;  4HE8 D;  2WVQ A;  3JTL O;  3U3F A;  1TFK B;  3U8V A;  4CJO A;  2PX3 A;  1RXQ A;  2CDQ A;  4YWQ A;  1H9G A;  2D5R B;  4LER A;  2J9U A;  2HJ3 A;  4HFF B;  5FZT A;  5CIV A;  1QVX A;  4BJ6 C;  1NLX A;  3NG1 A;  3W8I A;  1QKR A;  1D1A A;  3C18 A; 
#chains in the Genus database with same CATH homology
 2UUI A;  5BQI A;  4JCZ A;  4AL1 A;  2H8A A;  2Q7R A;  4J7T A;  4NTA A;  4AL0 A;  4YL0 A;  5K0I A;  4JRZ A;  4NTB A;  3LEO A;  4JC7 A;  2UUH A;  3DWW A;  4YK5 A;  3B29 A;  5BQH A;  4YL1 A;  4YL3 A;  3PCV A;  2PNO A;  4NTF A;  4WAB A;  5BQG A;  3HKK A;  5HV9 A;  4BPM A;  4J7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...