4JCZA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
147
structure length
147
Chain Sequence
b'HHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jczA00
2UUHA 4YK5A 5BQHA 2H8AA 4AL0A 4WABA 4NTAA 4JRZA 4JCZA 4JC7A 2PNOA 5BQGA 5BQIA 3LEOA 3B29A 4YL3A 4YL0A 4YL1A 4J7TA 4BPMA 3PCVA 2Q7RA 4AL1A 4J7YA 3HKKA 3DWWA 5K0IA 5HV9A 4NTFA 4NTBA 2UUIA
chains in the Genus database with same CATH superfamily
1T01A 1ZU5A 3J06A 2LD6A 4MQ9F 1CGNA 2IBFA 3EJNA 4H4KC 4U5CE 3S29A 2FFHA 4YJWA 2J9VA 3ECSA 4W8KA 3SXZA 4AK9A 4BEJA 4C3BA 4HE8D 4NTAA 1FFTC 3KYIA 2P1AA 1AVOB 3FVYA 2X0CA 4YT8A 1YLMA 3M1CB 4JE9A 1OW7A 4MVSA 3EHNA 2P7VA 4XPYA 3POVA 3A11A 3CEXA 2J0XA 2BC5A 2ICWG 3ASNC 1WATA 5B1BC 5L0HA 5E3CA 3K33A 1QZXA 2XL8A 3PDMP 1BR2A 3EFOB 4G7HF 4CS7A 3HLZA 3O39A 3L34A 1BR4A 1YZCA 4I44A 1ZHXA 4FX5A 2B0HA 3DJNB 1MNEA 1PV3A 2IXOA 2LQGA 2L81A 3EPVA 4JEAA 4MVZA 4MTGA 1RJ9B 4R32A 3SYNA 4OIOF 2ZXPA 3GORA 3X2QC 3ZIBA 4XQ1A 2Q00A 4G78A 1H9GA 1ZHWA 1M56C 3WHNA 1T6UA 4MTOA 2Y3GA 5DS6A 3Q7GA 2ZXRA 1GGQA 3LS0A 4JURI 1Z63A 3IPMO 1T5OA 2Y69C 2YWAA 1VB5A 4LERA 4JCZA 3WAQA 1E83A 1MMGA 5KYYA 1C17M 1FMVA 1OCOC 1IW7F 1GQAA 3M15A 3C7JA 1MQVA 1O87A 4ANJA 3NYJA 1ZVZA 2WZLA 3DJUB 4DBQA 2R7VA 1VYIA 4XWJA 3DE8A 2XXAA 2Y3BA 3RH3A 2M4EA 2EPMX 2A0UA 2NUTA 3UMIA 4BJ6A 2HV7A 1TQGA 4H54A 4GQHA 1OR3A 1IZMA 1OKKD 2YLDA 4QI0A 1HE9A 2JD3A 5EK0A 3QW1A 4KBLA 4XEFA 1GM5A 2LIGA 3RKOF 1RKEB 4D4XA 1V55C 2KGOA 3FOOA 2VC9A 3L1MA 2FAPB 4ZLDA 2KC3A 3TJ6A 2HJ3A 3Q7LA 3DAGA 2EPOA 3C63A 5B3IA 1JR8A 2TMVP 1PD1A 1T6QA 1TWAA 2XLMA 5TJ5E 2VCCA 3MYIA 2AWCA 1XWJA 3MBGA 3GANA 2Y3DA 3Q6NA 1Z7Qc 2YZSA 5HSWA 3O10A 4E17A 4EIYA 1OKKA 3EH2A 4XPXA 3UGOA 4Z9JA 1RXQA 3S84A 4CIHA 5JVEA 4U5GA 2L6FA 1HW1A 1D0ZA 2YL0A 4WGYA 1ORJA 3JT1A 1NZEA 3LUTB 3L8JA 3VF0A 1N1CA 4KNWA 2PNOA 4MVOA 3VYWA 3WG7C 2UUIA 3HJCA 4E7ZA 1R5ID 3GEIA 1JOGA 3DAFA 1LS1A 4CS8C 1LM3B 2A0BA 3KKBA 1FFHA 4FAPB 5L0CA 1DOVA 3FHDA 4U9EA 2XLOA 3LS1A 1D1BA 2WZGA 2L9JA 2OCCC 1A7DA 3FXHA 2IXMA 4CX9A 4JRZA 5JSLA 4O6MA 1QPUA 2W4BA 4XLNF 3HTKC 3U0CA 3B0VC 1OW8A 4OIPF 4IAQA 1S05A 1SR2A 4HEAJ 1A41A 3DI5A 3SEOA 4AE4A 1YARO 5L0JA 2Q7RA 2HMZA 3K7DA 3GWNA 2YLIA 4I3MA 1M6TA 2GAQA 3T6BA 2KK1A 3EHMA 5A6BD 2IOQA 1H9TA 5L0GA 1OW6A 4FWVA 3RW0A 4NTFA 2PBEA 4DVYP 1ORYA 1S7ZA 2Z15A 2NPUA 3GWLA 3V5ZA 3RF3A 3RQEA 3PMRA 1Z5ZA 5KYYB 3NMIA 1ZW3A 2HV6A 3JRTA 1YA9A 3ZVRA 5A6JA 2KNHA 5DLJA 1QSPA 2ZPAA 2J45A 5KYNA 3BEHA 2OKUA 2CNWD 3DXJF 5A6BA 1NSGB 4IAOA 5A69A 3IQ5A 2XXAB 2AVKA 4B6IA 1Y4CA 2EIMC 1RKCA 1ZU4A 3G4ZA 2NUTB 3GEEA 4BJ5C 4E7SA 1XZQA 4C7OA 2PX0A 1K05A 2QUPA 2KSFA 1D0XA 2Q9BA 5DS5A 3QTHA 3C8GB 1JRAA 1A7VA 3EH1A 3NKEA 4IRUA 2QY9A 4LLCA 2MHRA 2NSFA 1G5ZA 3DZAA 1U6HA 3QZCA 3JYYA 3T6JA 3TULA 4IARA 2DB4A 2MWQA 2XLEA 3VAYA 1HE1A 1FR0A 3US6A 3S90A 3RVZA 3W2VA 3DE9A 1BZ4A 3NKDA 3AG1C 3ABKC 2VB6A 4C3EA 4O6NA 3IQCA 4ULWA 4XEKA 1O3UA 3H2VA 4JKVA 2OOCA 3ZTMA 4YT5A 2W45A 3NRHA 4GEHA 3IQ6A 4JC7A 1RCPA 3HNLA 3T9OA 4XLPF 3ITFA 1D1CA 4IWBA 4QDLA 3O55A 3SZRA 1LE2A 3OWTA 1TKNA 4O6YA 4DRHB 1CPRA 1MMNA 5F5HA 5CI8A 2A68F 4JJGA 3T4RA 3ZQYA 2R03A 2IM8A 4KNVA 4LLEA 4YT2A 2OJED 4OIQF 4OD5A 3RFYA 2CW0F 2DI3A 5D92A 5FZTA 1JAFA 3G50A 5A6KA 5DS4A 1M2OA 3NYLA 1CGME 4CSAA 2NUPB 3PHF2 3F46A 1V74B 1QLEC 1OR2A 4WGZA 1LVKA 3DD7A 2XLWA 2YEVA 5F5FA 4YK5A 2J7PD 4K1OA 2MYSA 2OEVA 5COFA 1CGOA 3ZG1A 2R7SA 3B0PA 2I8BA 4CDAA 1Q0KA 5EHHA 1YZAA 4L6RA 2VH3A 4AE4B 4KC9A 4MVRA 4XTKA 1OCRC 3V5XA 3JRMO 3ABMC 4CS8A 4YWQA 2IYLD 3LEOA 4BEMJ 2WVNA 2A6HF 5CIVA 2E87A 4YL0A 3S9OA 3L8IA 2RD9A 3H2UA 1L7CA 3C18A 3TJ5A 2LCHA 4BPMA 1MMAA 3V7OA 2J7PA 2HKVA 3LLIA 4M63A 4JIOA 1WWPA 5COMA 3AG2C 5JP7A 2IXNA 3U8VA 4UDVA 3KH2A 1WN0A 2BL2A 3JZ0A 2UUHA 2H7BA 3ABLC 1NLXA 4JZAA 1VTMP 4U5EE 3A9CA 4PFOA 3EGDA 2PX3A 3N24A 3N0TA 2GA0A 2X51A 2G3VA 2YL1A 4EBJA 1YYXA 2Y3HA 2B0JA 4C7OB 2AWYA 4N6CA 3W8IA 1LKXA 5DVWA 2R7XA 1MNDA 2IXPA 3K1HA 2ZXWC 1LI5A 2YQYA 3AGUA 2R7QA 3HNKA 1T6IA 3VM6A 5L0FA 4E0HA 5KYUA 3I4UA 2D5RB 3SXMA 1VLTA 2XM4A 2ZXOA 3U2MA 1M2VB 4YN0B 5T1DB 1HMDA 2GDCA 2NSGA 1LIHA 5T3TA 3C8ZA 2LP4A 4WJ0A 1HW2A 4ER9A 2OQMA 2YHSA 4OIRF 2C03A 5JUAA 2EINC 1XZPA 4MS2A 1ORSC 3WODF 3ZQVA 2R7WA 3SP1A 5BQHA 4WABA 4YT4A 3ATPA 5L0DA 3O6XA 4Q7CA 3IQTA 1Q0GA 2JPUA 3U5SA 4MVQA 3ZTZA 3GM1A 3EGXA 1VMAA 4GYTA 1LI7A 3GODA 2V3CC 2WVOA 2ZD9A 3K66A 2R02A 2XL4A 3UGPA 2XS8A 3MLGA 3NG1A 4I1MA 4CSAC 1OQCA 2HS5A 1G4WR 4DXWA 1TWHA 2XLVA 4C3DA 4OINF 3CZ6A 2M64A 1ST6A 1FMWA 3M4CA 2VCBA 3U3BA 3EG9A 4ULVA 2YVKA 1H6GA 2CCYA 3EFOA 1SMYF 2EILC 2GFHA 2Y39A 1QKRA 2J9BA 3JSZA 1OXBA 4X0RA 2AU5A 4CS9C 5AC4A 2P0NA 4CJOA 1A0BA 2XRHA 1OXKA 4PK4A 5B1AC 4P9TA 2O9XA 4NC3A 1QQ3A 3KL4A 4MVMA 3U9JA 1SZIA 4Q5SF 5L0IA 2EPNA 4NCQA 4RDAA 1ZHTA 3K1IC 3SNHA 4N6HA 4PFPA 4N06A 1ZHYA 2XS1A 4O7GA 4YL1A 1U89A 5L3VA 1YAUO 1KTMA 2KQ9A 3IHUA 2J46A 4KI2A 1NBBA 4LACB 5JLIA 2OJQA 2QLAA 3EGDB 1CPQA 4QI2A 1YDIA 2HFIA 1Q0MA 3IEEA 3JYHA 4NTBA 1YA7O 2NG1A 1VLSA 2CNWA 1DOWA 2GWWA 4Z9HA 4DOZA 2Q3TA 2R7OA 1FNTc 1H7IA 3U9MA 4A2NB 3W2WA 4CDVA 4CIPA 2F22A 1UFBA 2XSEA 1VYKA 1QVXA 2BE5F 3FMSA 4AL0A 4JTAB 1YVIA 5KYUB 2W9YA 3ZWIA 3SXKA 5D91A 5E3AA 3NMKA 1U0BB 5BUOA 4NQFA 1AEPA 4N4WA 2R05A 3RQGA 3TQOA 3UNGC 3S28A 1L3PA 2G62A 3JTLO 3UMKA 4JVSA 3LNMB 1F1MA 1C03A 1TWCA 1E2XA 1AUEA 3OEOA 4LDRA 5AGFA 4U5DE 2R25A 3PCVA 2C04A 1I4YA 4U9DA 5EGYA 3AQCA 3GM3A 3HKKA 3DWWA 3LLKA 5K0IA 1D0YA 2KYHA 3B9QA 3FDQA 1W2WA 4IGGA 4DRJB 5E2QA 2L7AA 1O5HA 3H65A 3U3FA 2V26A 4J30B 5B3SC 2VASA 1OCZC 3QMKA 1APCA 3HNJA 2R7UA 2HSQA 3JCUQ 2XLHA 2AP3A 1TWGA 2CYDA 2EIKC 2H8AA 3EGXB 1ZW2A 4RBNA 4JJFA 1FAPB 4G7OF 1V54C 3ZC4A 1UG7A 3F47A 2YL3A 2EPKX 3EZHA 4F4BA 5JT4A 3MFNA 3N2ZB 1TR2A 2XLDA 4JEBA 2KJGA 2R9RB 2EIJC 2HJMA 2XL6A 4XPWA 3R7CA 3EG9B 1Z3IX 3TD7A 1G4US 1K40A 2J0WA 1BR1A 2W4MA 1A7EA 1EI7A 3S27A 4BJ1A 2HZ8A 5KYXA 4I1OB 3LAYA 1E84A 1VK5A 3FOPA 1MMDA 1KU2A 2DGJA 3AG4C 2CDQA 2Q4FA 2WZFA 3JSEO 3RYLA 4J7YA 1NFOA 4U5FE 3FAJA 4Z9IA 4MVUA 3UR3C 2I15A 2J9WA 2YKZA 4PACA 2H7OA 4W8PA 1ZHZA 3B71A 2XM0A 2QTVA 3E9VA 3KMIA 4K7BA 5L3QA 1I5NA 2KW3C 2H7VC 1TFOB 3I5QA 4EUKB 3AQBA 1OCCC 5AC5A 1BDJB 1NG1A 2VCAA 3DMDA 1B68A 3B0UX 1NU7D 3C8GD 2P61A 3TK0A 3QW0A 5CI9A 1BBHA 3EZIA 1HY5A 256BA 4YL3A 3KYJA 4CS9A 4EHPA 2PP4A 2QE9A 2L6GA 2L6HA 3NYMA 3V5YA 3DM9B 1Q0FA 3RVYA 2OG2A 3VRCA 4JCHA 3W8HA 2YL7A 2JX0A 1ZZPA 4LDQA 3UMHA 3AOUA 1WTYA 1JMWA 5JS5A 3K1IA 2D4UA 3MX3A 4D4NA 1Y6DA 2Q9AA 2OU6A 3AJMA 1T9KA 3C8GA 2G3KA 3CSKA 2RSEB 1YYJA 4MNDA 4U5HA 5COGA 4DBRA 3Q6MA 1SF8A 2PFDA 4BJ5A 4IB4A 4PJJA 4E0IA 4EWCA 4RD9A 1JPJA 1HMOA 3GM2A 1RMVA 2J9UA 4OD4A 4P9FA 2HSBA 4DVZA 5IY5C 3M4BA 5BQGA 3S0XA 2LFFA 2WL8A 3CQZA 5F28E 5KYWA 4HFFB 4JW1A 3ZDLA 3B29A 5DQTA 3AGTA 3AG3C 1EQ1A 1J8YF 2ETSA 1JPNA 1Z23A 4J7TA 3FAPB 1LPEA 4CBEA 3MYFA 4HFKB 1TFKB 3CAXA 2WVQA 1V4AA 1G8XA 2J8WA 4XEVA 2A69F 4EBBA 4EBKA 4JTCB 3G4XA 2LSEA 1LS4A 3E70C 4IJJA 1PD0A 1KNYA 5A6AA 1E86A 5JRAA 1YJGA 3TOMA 1K04A 1EA8A 1Q0DA 2A1DD 3ZSUA 3KPHA 2R7RA 2A6EF 2NUPA 3T6GB 4PJLA 1RJ9A 5KYWB 1WOLA 4NY3A 1C02A 3DM5A 4PJNA 3EQLF 2DYSC 3U2LA 4BJ6C 5BQIA 3LEVA 3U8PA 5KYXB 3X1OA 4CDYA 4P6IC 3LNRA 4JTDB 1FTSA 5T3WA 3QVZA 4BG0A 1M57C 2HUJA 3C62A 2QNLA 1WGWA 4AX2A 2EPLX 3ASOC 2LK4A 3BRJA 2YRFA 3NDBB 2WB7A 4ONSA 4U5BE 4BJTA 2R7TA 1EKYA 3GEHA 1R4TA 4Q4ZF 1VOMA 1SYQA 2OEXA 1GS9A 2Q9CA 3L0IA 1J8MF 3LJBA 5DQZA 4DJ9A 2ASRA 2DYRC 3TOLA 4K0DA 1D1AA 3RIPA 4DRIB 4ZLCA 5FCLA 1E85A 4PR9A 3NMJA 4J32B 2YLGA 3OA1A 4MW8A 2CGEA 1ZYRF 2P6VA 4G0HA 4FESA 1RKEA 3QVYA 4EKWA 4A4AA 5E33A 1NU9C 3DKAA 4PJMA 1I4ZA 3LESA 4O79A 1NFNA 4LDKA 3W4YA 4E18A 3M79A 3RQFA 5GPGB 2LFDA 1PCXA 2PF4E 1Z6AA 4AL1A 4CJGA 1WASA 3R2PA 3K6BA 3SXYA 1LE4A 4G7ZF 4MW3A 3I5PA 1M2VA 3HNIA 5HV9A 4MTFA 2FGYA 2HMQA
chains in the Genus database with same CATH topology
2UUHA 4YK5A 5BQHA 2H8AA 4AL0A 4WABA 4NTAA 4JRZA 4JCZA 4JC7A 2PNOA 5BQGA 5BQIA 3LEOA 3B29A 4YL3A 4YL0A 4YL1A 4J7TA 4BPMA 3PCVA 2Q7RA 4AL1A 4J7YA 3HKKA 3DWWA 5K0IA 5HV9A 4NTFA 4NTBA 2UUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUH A;  4YK5 A;  5BQH A;  2H8A A;  4AL0 A;  4WAB A;  4NTA A;  4JRZ A;  4JCZ A;  4JC7 A;  2PNO A;  5BQG A;  5BQI A;  3LEO A;  3B29 A;  4YL3 A;  4YL0 A;  4YL1 A;  4J7T A;  4BPM A;  3PCV A;  2Q7R A;  4AL1 A;  4J7Y A;  3HKK A;  3DWW A;  5K0I A;  5HV9 A;  4NTF A;  4NTB A;  2UUI A; 
#chains in the Genus database with same CATH topology
 1T01 A;  1ZU5 A;  3J06 A;  2LD6 A;  4MQ9 F;  1CGN A;  2IBF A;  3EJN A;  4H4K C;  4U5C E;  3S29 A;  2FFH A;  4YJW A;  2J9V A;  3ECS A;  4W8K A;  3SXZ A;  4AK9 A;  4BEJ A;  4C3B A;  4HE8 D;  4NTA A;  1FFT C;  3KYI A;  2P1A A;  1AVO B;  3FVY A;  2X0C A;  4YT8 A;  1YLM A;  3M1C B;  4JE9 A;  1OW7 A;  4MVS A;  3EHN A;  2P7V A;  4XPY A;  3POV A;  3A11 A;  3CEX A;  2J0X A;  2BC5 A;  2ICW G;  3ASN C;  1WAT A;  5B1B C;  5L0H A;  5E3C A;  3K33 A;  1QZX A;  2XL8 A;  3PDM P;  1BR2 A;  3EFO B;  4G7H F;  4CS7 A;  3HLZ A;  3O39 A;  3L34 A;  1BR4 A;  1YZC A;  4I44 A;  1ZHX A;  4FX5 A;  2B0H A;  3DJN B;  1MNE A;  1PV3 A;  2IXO A;  2LQG A;  2L81 A;  3EPV A;  4JEA A;  4MVZ A;  4MTG A;  1RJ9 B;  4R32 A;  3SYN A;  4OIO F;  2ZXP A;  3GOR A;  3X2Q C;  3ZIB A;  4XQ1 A;  2Q00 A;  4G78 A;  1H9G A;  1ZHW A;  1M56 C;  3WHN A;  1T6U A;  4MTO A;  2Y3G A;  5DS6 A;  3Q7G A;  2ZXR A;  1GGQ A;  3LS0 A;  4JUR I;  1Z63 A;  3IPM O;  1T5O A;  2Y69 C;  2YWA A;  1VB5 A;  4LER A;  4JCZ A;  3WAQ A;  1E83 A;  1MMG A;  5KYY A;  1C17 M;  1FMV A;  1OCO C;  1IW7 F;  1GQA A;  3M15 A;  3C7J A;  1MQV A;  1O87 A;  4ANJ A;  3NYJ A;  1ZVZ A;  2WZL A;  3DJU B;  4DBQ A;  2R7V A;  1VYI A;  4XWJ A;  3DE8 A;  2XXA A;  2Y3B A;  3RH3 A;  2M4E A;  2EPM X;  2A0U A;  2NUT A;  3UMI A;  4BJ6 A;  2HV7 A;  1TQG A;  4H54 A;  4GQH A;  1OR3 A;  1IZM A;  1OKK D;  2YLD A;  4QI0 A;  1HE9 A;  2JD3 A;  5EK0 A;  3QW1 A;  4KBL A;  4XEF A;  1GM5 A;  2LIG A;  3RKO F;  1RKE B;  4D4X A;  1V55 C;  2KGO A;  3FOO A;  2VC9 A;  3L1M A;  2FAP B;  4ZLD A;  2KC3 A;  3TJ6 A;  2HJ3 A;  3Q7L A;  3DAG A;  2EPO A;  3C63 A;  5B3I A;  1JR8 A;  2TMV P;  1PD1 A;  1T6Q A;  1TWA A;  2XLM A;  5TJ5 E;  2VCC A;  3MYI A;  2AWC A;  1XWJ A;  3MBG A;  3GAN A;  2Y3D A;  3Q6N A;  1Z7Q c;  2YZS A;  5HSW A;  3O10 A;  4E17 A;  4EIY A;  1OKK A;  3EH2 A;  4XPX A;  3UGO A;  4Z9J A;  1RXQ A;  3S84 A;  4CIH A;  5JVE A;  4U5G A;  2L6F A;  1HW1 A;  1D0Z A;  2YL0 A;  4WGY A;  1ORJ A;  3JT1 A;  1NZE A;  3LUT B;  3L8J A;  3VF0 A;  1N1C A;  4KNW A;  2PNO A;  4MVO A;  3VYW A;  3WG7 C;  2UUI A;  3HJC A;  4E7Z A;  1R5I D;  3GEI A;  1JOG A;  3DAF A;  1LS1 A;  4CS8 C;  1LM3 B;  2A0B A;  3KKB A;  1FFH A;  4FAP B;  5L0C A;  1DOV A;  3FHD A;  4U9E A;  2XLO A;  3LS1 A;  1D1B A;  2WZG A;  2L9J A;  2OCC C;  1A7D A;  3FXH A;  2IXM A;  4CX9 A;  4JRZ A;  5JSL A;  4O6M A;  1QPU A;  2W4B A;  4XLN F;  3HTK C;  3U0C A;  3B0V C;  1OW8 A;  4OIP F;  4IAQ A;  1S05 A;  1SR2 A;  4HEA J;  1A41 A;  3DI5 A;  3SEO A;  4AE4 A;  1YAR O;  5L0J A;  2Q7R A;  2HMZ A;  3K7D A;  3GWN A;  2YLI A;  4I3M A;  1M6T A;  2GAQ A;  3T6B A;  2KK1 A;  3EHM A;  5A6B D;  2IOQ A;  1H9T A;  5L0G A;  1OW6 A;  4FWV A;  3RW0 A;  4NTF A;  2PBE A;  4DVY P;  1ORY A;  1S7Z A;  2Z15 A;  2NPU A;  3GWL A;  3V5Z A;  3RF3 A;  3RQE A;  3PMR A;  1Z5Z A;  5KYY B;  3NMI A;  1ZW3 A;  2HV6 A;  3JRT A;  1YA9 A;  3ZVR A;  5A6J A;  2KNH A;  5DLJ A;  1QSP A;  2ZPA A;  2J45 A;  5KYN A;  3BEH A;  2OKU A;  2CNW D;  3DXJ F;  5A6B A;  1NSG B;  4IAO A;  5A69 A;  3IQ5 A;  2XXA B;  2AVK A;  4B6I A;  1Y4C A;  2EIM C;  1RKC A;  1ZU4 A;  3G4Z A;  2NUT B;  3GEE A;  4BJ5 C;  4E7S A;  1XZQ A;  4C7O A;  2PX0 A;  1K05 A;  2QUP A;  2KSF A;  1D0X A;  2Q9B A;  5DS5 A;  3QTH A;  3C8G B;  1JRA A;  1A7V A;  3EH1 A;  3NKE A;  4IRU A;  2QY9 A;  4LLC A;  2MHR A;  2NSF A;  1G5Z A;  3DZA A;  1U6H A;  3QZC A;  3JYY A;  3T6J A;  3TUL A;  4IAR A;  2DB4 A;  2MWQ A;  2XLE A;  3VAY A;  1HE1 A;  1FR0 A;  3US6 A;  3S90 A;  3RVZ A;  3W2V A;  3DE9 A;  1BZ4 A;  3NKD A;  3AG1 C;  3ABK C;  2VB6 A;  4C3E A;  4O6N A;  3IQC A;  4ULW A;  4XEK A;  1O3U A;  3H2V A;  4JKV A;  2OOC A;  3ZTM A;  4YT5 A;  2W45 A;  3NRH A;  4GEH A;  3IQ6 A;  4JC7 A;  1RCP A;  3HNL A;  3T9O A;  4XLP F;  3ITF A;  1D1C A;  4IWB A;  4QDL A;  3O55 A;  3SZR A;  1LE2 A;  3OWT A;  1TKN A;  4O6Y A;  4DRH B;  1CPR A;  1MMN A;  5F5H A;  5CI8 A;  2A68 F;  4JJG A;  3T4R A;  3ZQY A;  2R03 A;  2IM8 A;  4KNV A;  4LLE A;  4YT2 A;  2OJE D;  4OIQ F;  4OD5 A;  3RFY A;  2CW0 F;  2DI3 A;  5D92 A;  5FZT A;  1JAF A;  3G50 A;  5A6K A;  5DS4 A;  1M2O A;  3NYL A;  1CGM E;  4CSA A;  2NUP B;  3PHF 2;  3F46 A;  1V74 B;  1QLE C;  1OR2 A;  4WGZ A;  1LVK A;  3DD7 A;  2XLW A;  2YEV A;  5F5F A;  4YK5 A;  2J7P D;  4K1O A;  2MYS A;  2OEV A;  5COF A;  1CGO A;  3ZG1 A;  2R7S A;  3B0P A;  2I8B A;  4CDA A;  1Q0K A;  5EHH A;  1YZA A;  4L6R A;  2VH3 A;  4AE4 B;  4KC9 A;  4MVR A;  4XTK A;  1OCR C;  3V5X A;  3JRM O;  3ABM C;  4CS8 A;  4YWQ A;  2IYL D;  3LEO A;  4BEM J;  2WVN A;  2A6H F;  5CIV A;  2E87 A;  4YL0 A;  3S9O A;  3L8I A;  2RD9 A;  3H2U A;  1L7C A;  3C18 A;  3TJ5 A;  2LCH A;  4BPM A;  1MMA A;  3V7O A;  2J7P A;  2HKV A;  3LLI A;  4M63 A;  4JIO A;  1WWP A;  5COM A;  3AG2 C;  5JP7 A;  2IXN A;  3U8V A;  4UDV A;  3KH2 A;  1WN0 A;  2BL2 A;  3JZ0 A;  2UUH A;  2H7B A;  3ABL C;  1NLX A;  4JZA A;  1VTM P;  4U5E E;  3A9C A;  4PFO A;  3EGD A;  2PX3 A;  3N24 A;  3N0T A;  2GA0 A;  2X51 A;  2G3V A;  2YL1 A;  4EBJ A;  1YYX A;  2Y3H A;  2B0J A;  4C7O B;  2AWY A;  4N6C A;  3W8I A;  1LKX A;  5DVW A;  2R7X A;  1MND A;  2IXP A;  3K1H A;  2ZXW C;  1LI5 A;  2YQY A;  3AGU A;  2R7Q A;  3HNK A;  1T6I A;  3VM6 A;  5L0F A;  4E0H A;  5KYU A;  3I4U A;  2D5R B;  3SXM A;  1VLT A;  2XM4 A;  2ZXO A;  3U2M A;  1M2V B;  4YN0 B;  5T1D B;  1HMD A;  2GDC A;  2NSG A;  1LIH A;  5T3T A;  3C8Z A;  2LP4 A;  4WJ0 A;  1HW2 A;  4ER9 A;  2OQM A;  2YHS A;  4OIR F;  2C03 A;  5JUA A;  2EIN C;  1XZP A;  4MS2 A;  1ORS C;  3WOD F;  3ZQV A;  2R7W A;  3SP1 A;  5BQH A;  4WAB A;  4YT4 A;  3ATP A;  5L0D A;  3O6X A;  4Q7C A;  3IQT A;  1Q0G A;  2JPU A;  3U5S A;  4MVQ A;  3ZTZ A;  3GM1 A;  3EGX A;  1VMA A;  4GYT A;  1LI7 A;  3GOD A;  2V3C C;  2WVO A;  2ZD9 A;  3K66 A;  2R02 A;  2XL4 A;  3UGP A;  2XS8 A;  3MLG A;  3NG1 A;  4I1M A;  4CSA C;  1OQC A;  2HS5 A;  1G4W R;  4DXW A;  1TWH A;  2XLV A;  4C3D A;  4OIN F;  3CZ6 A;  2M64 A;  1ST6 A;  1FMW A;  3M4C A;  2VCB A;  3U3B A;  3EG9 A;  4ULV A;  2YVK A;  1H6G A;  2CCY A;  3EFO A;  1SMY F;  2EIL C;  2GFH A;  2Y39 A;  1QKR A;  2J9B A;  3JSZ A;  1OXB A;  4X0R A;  2AU5 A;  4CS9 C;  5AC4 A;  2P0N A;  4CJO A;  1A0B A;  2XRH A;  1OXK A;  4PK4 A;  5B1A C;  4P9T A;  2O9X A;  4NC3 A;  1QQ3 A;  3KL4 A;  4MVM A;  3U9J A;  1SZI A;  4Q5S F;  5L0I A;  2EPN A;  4NCQ A;  4RDA A;  1ZHT A;  3K1I C;  3SNH A;  4N6H A;  4PFP A;  4N06 A;  1ZHY A;  2XS1 A;  4O7G A;  4YL1 A;  1U89 A;  5L3V A;  1YAU O;  1KTM A;  2KQ9 A;  3IHU A;  2J46 A;  4KI2 A;  1NBB A;  4LAC B;  5JLI A;  2OJQ A;  2QLA A;  3EGD B;  1CPQ A;  4QI2 A;  1YDI A;  2HFI A;  1Q0M A;  3IEE A;  3JYH A;  4NTB A;  1YA7 O;  2NG1 A;  1VLS A;  2CNW A;  1DOW A;  2GWW A;  4Z9H A;  4DOZ A;  2Q3T A;  2R7O A;  1FNT c;  1H7I A;  3U9M A;  4A2N B;  3W2W A;  4CDV A;  4CIP A;  2F22 A;  1UFB A;  2XSE A;  1VYK A;  1QVX A;  2BE5 F;  3FMS A;  4AL0 A;  4JTA B;  1YVI A;  5KYU B;  2W9Y A;  3ZWI A;  3SXK A;  5D91 A;  5E3A A;  3NMK A;  1U0B B;  5BUO A;  4NQF A;  1AEP A;  4N4W A;  2R05 A;  3RQG A;  3TQO A;  3UNG C;  3S28 A;  1L3P A;  2G62 A;  3JTL O;  3UMK A;  4JVS A;  3LNM B;  1F1M A;  1C03 A;  1TWC A;  1E2X A;  1AUE A;  3OEO A;  4LDR A;  5AGF A;  4U5D E;  2R25 A;  3PCV A;  2C04 A;  1I4Y A;  4U9D A;  5EGY A;  3AQC A;  3GM3 A;  3HKK A;  3DWW A;  3LLK A;  5K0I A;  1D0Y A;  2KYH A;  3B9Q A;  3FDQ A;  1W2W A;  4IGG A;  4DRJ B;  5E2Q A;  2L7A A;  1O5H A;  3H65 A;  3U3F A;  2V26 A;  4J30 B;  5B3S C;  2VAS A;  1OCZ C;  3QMK A;  1APC A;  3HNJ A;  2R7U A;  2HSQ A;  3JCU Q;  2XLH A;  2AP3 A;  1TWG A;  2CYD A;  2EIK C;  2H8A A;  3EGX B;  1ZW2 A;  4RBN A;  4JJF A;  1FAP B;  4G7O F;  1V54 C;  3ZC4 A;  1UG7 A;  3F47 A;  2YL3 A;  2EPK X;  3EZH A;  4F4B A;  5JT4 A;  3MFN A;  3N2Z B;  1TR2 A;  2XLD A;  4JEB A;  2KJG A;  2R9R B;  2EIJ C;  2HJM A;  2XL6 A;  4XPW A;  3R7C A;  3EG9 B;  1Z3I X;  3TD7 A;  1G4U S;  1K40 A;  2J0W A;  1BR1 A;  2W4M A;  1A7E A;  1EI7 A;  3S27 A;  4BJ1 A;  2HZ8 A;  5KYX A;  4I1O B;  3LAY A;  1E84 A;  1VK5 A;  3FOP A;  1MMD A;  1KU2 A;  2DGJ A;  3AG4 C;  2CDQ A;  2Q4F A;  2WZF A;  3JSE O;  3RYL A;  4J7Y A;  1NFO A;  4U5F E;  3FAJ A;  4Z9I A;  4MVU A;  3UR3 C;  2I15 A;  2J9W A;  2YKZ A;  4PAC A;  2H7O A;  4W8P A;  1ZHZ A;  3B71 A;  2XM0 A;  2QTV A;  3E9V A;  3KMI A;  4K7B A;  5L3Q A;  1I5N A;  2KW3 C;  2H7V C;  1TFO B;  3I5Q A;  4EUK B;  3AQB A;  1OCC C;  5AC5 A;  1BDJ B;  1NG1 A;  2VCA A;  3DMD A;  1B68 A;  3B0U X;  1NU7 D;  3C8G D;  2P61 A;  3TK0 A;  3QW0 A;  5CI9 A;  1BBH A;  3EZI A;  1HY5 A;  256B A;  4YL3 A;  3KYJ A;  4CS9 A;  4EHP A;  2PP4 A;  2QE9 A;  2L6G A;  2L6H A;  3NYM A;  3V5Y A;  3DM9 B;  1Q0F A;  3RVY A;  2OG2 A;  3VRC A;  4JCH A;  3W8H A;  2YL7 A;  2JX0 A;  1ZZP A;  4LDQ A;  3UMH A;  3AOU A;  1WTY A;  1JMW A;  5JS5 A;  3K1I A;  2D4U A;  3MX3 A;  4D4N A;  1Y6D A;  2Q9A A;  2OU6 A;  3AJM A;  1T9K A;  3C8G A;  2G3K A;  3CSK A;  2RSE B;  1YYJ A;  4MND A;  4U5H A;  5COG A;  4DBR A;  3Q6M A;  1SF8 A;  2PFD A;  4BJ5 A;  4IB4 A;  4PJJ A;  4E0I A;  4EWC A;  4RD9 A;  1JPJ A;  1HMO A;  3GM2 A;  1RMV A;  2J9U A;  4OD4 A;  4P9F A;  2HSB A;  4DVZ A;  5IY5 C;  3M4B A;  5BQG A;  3S0X A;  2LFF A;  2WL8 A;  3CQZ A;  5F28 E;  5KYW A;  4HFF B;  4JW1 A;  3ZDL A;  3B29 A;  5DQT A;  3AGT A;  3AG3 C;  1EQ1 A;  1J8Y F;  2ETS A;  1JPN A;  1Z23 A;  4J7T A;  3FAP B;  1LPE A;  4CBE A;  3MYF A;  4HFK B;  1TFK B;  3CAX A;  2WVQ A;  1V4A A;  1G8X A;  2J8W A;  4XEV A;  2A69 F;  4EBB A;  4EBK A;  4JTC B;  3G4X A;  2LSE A;  1LS4 A;  3E70 C;  4IJJ A;  1PD0 A;  1KNY A;  5A6A A;  1E86 A;  5JRA A;  1YJG A;  3TOM A;  1K04 A;  1EA8 A;  1Q0D A;  2A1D D;  3ZSU A;  3KPH A;  2R7R A;  2A6E F;  2NUP A;  3T6G B;  4PJL A;  1RJ9 A;  5KYW B;  1WOL A;  4NY3 A;  1C02 A;  3DM5 A;  4PJN A;  3EQL F;  2DYS C;  3U2L A;  4BJ6 C;  5BQI A;  3LEV A;  3U8P A;  5KYX B;  3X1O A;  4CDY A;  4P6I C;  3LNR A;  4JTD B;  1FTS A;  5T3W A;  3QVZ A;  4BG0 A;  1M57 C;  2HUJ A;  3C62 A;  2QNL A;  1WGW A;  4AX2 A;  2EPL X;  3ASO C;  2LK4 A;  3BRJ A;  2YRF A;  3NDB B;  2WB7 A;  4ONS A;  4U5B E;  4BJT A;  2R7T A;  1EKY A;  3GEH A;  1R4T A;  4Q4Z F;  1VOM A;  1SYQ A;  2OEX A;  1GS9 A;  2Q9C A;  3L0I A;  1J8M F;  3LJB A;  5DQZ A;  4DJ9 A;  2ASR A;  2DYR C;  3TOL A;  4K0D A;  1D1A A;  3RIP A;  4DRI B;  4ZLC A;  5FCL A;  1E85 A;  4PR9 A;  3NMJ A;  4J32 B;  2YLG A;  3OA1 A;  4MW8 A;  2CGE A;  1ZYR F;  2P6V A;  4G0H A;  4FES A;  1RKE A;  3QVY A;  4EKW A;  4A4A A;  5E33 A;  1NU9 C;  3DKA A;  4PJM A;  1I4Z A;  3LES A;  4O79 A;  1NFN A;  4LDK A;  3W4Y A;  4E18 A;  3M79 A;  3RQF A;  5GPG B;  2LFD A;  1PCX A;  2PF4 E;  1Z6A A;  4AL1 A;  4CJG A;  1WAS A;  3R2P A;  3K6B A;  3SXY A;  1LE4 A;  4G7Z F;  4MW3 A;  3I5P A;  1M2V A;  3HNI A;  5HV9 A;  4MTF A;  2FGY A;  2HMQ A; 
#chains in the Genus database with same CATH homology
 2UUH A;  4YK5 A;  5BQH A;  2H8A A;  4AL0 A;  4WAB A;  4NTA A;  4JRZ A;  4JCZ A;  4JC7 A;  2PNO A;  5BQG A;  5BQI A;  3LEO A;  3B29 A;  4YL3 A;  4YL0 A;  4YL1 A;  4J7T A;  4BPM A;  3PCV A;  2Q7R A;  4AL1 A;  4J7Y A;  3HKK A;  3DWW A;  5K0I A;  5HV9 A;  4NTF A;  4NTB A;  2UUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...