4JCZA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
147
structure length
147
Chain Sequence
b'HHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
molecule tags Lyase
source organism Homo sapiens
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
total genus 60
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jczA00
4YK5A 3DWWA 3PCVA 5K0IA 2Q7RA 3B29A 4J7TA 5BQGA 4YL1A 4JCZA 5BQIA 4JRZA 3HKKA 2PNOA 5HV9A 4NTBA 4AL1A 4YL3A 5BQHA 4J7YA 2H8AA 4WABA 3LEOA 4NTAA 4AL0A 2UUHA 2UUIA 4JC7A 4YL0A 4NTFA 4BPMA
chains in the Genus database with same CATH superfamily
2AWCA 1TQGA 3EZHA 2D5RB 3FAJA 3US6A 4N06A 4PACA 3KPHA 1V54C 1LE4A 1NBBA 3TK0A 1OW8A 3C8GD 3ZC4A 2J0WA 3JCUQ 2G3VA 2OG2A 1D1AA 1J8YF 3RH3A 5AC4A 1Z5ZA 3UGOA 1JAFA 3PCVA 1O5HA 4MTFA 3LS1A 4JIOA 4DVZA 3B29A 3C7JA 1ZHWA 2P0NA 1OW6A 2I15A 3OA1A 4LERA 3S90A 2ZXOA 3VM6A 1WASA 1C17M 5L3QA 3HLZA 4PK4A 1CGME 2R05A 3TQOA 2MYSA 2F22A 1YZAA 2EPOA 2W4MA 3V5XA 4WGYA 2ZD9A 3B0VC 4CDYA 4H4KC 1TR2A 2TMVP 1D0ZA 3V5ZA 2DYSC 2J0XA 3X2QC 5A6KA 3T4RA 1PD0A 1RKCA 2QTVA 5E33A 1K04A 2L6GA 2VC9A 2YL3A 5DS5A 5F5HA 2OOCA 1OR3A 2EIKC 4BJTA 4NC3A 1L7CA 1IZMA 4O6NA 4JEBA 4YT2A 5D91A 4BJ1A 2IBFA 3HJCA 1OXBA 2IXNA 4DVYP 4IB4A 4N4WA 3EH2A 1M56C 4AE4B 2HJMA 3M1CB 1EA8A 2AVKA 2HFIA 4JRZA 3VAYA 3KMIA 5BUOA 2KNHA 5L0IA 1QKRA 3QVYA 3ZIBA 4KBLA 4QI2A 4BG0A 3ZSUA 2Y39A 1H9GA 1KNYA 4KC9A 4CJOA 4MVSA 2C03A 3H2UA 1A7EA 2Y3DA 2YKZA 4I44A 4YT5A 5DS6A 2C04A 3AQCA 4MNDA 3NMKA 3SXYA 1Y6DA 2WB7A 4ZLCA 2A68F 3PMRA 5KYXB 1SYQA 1YAUO 1C02A 4U5FE 3H65A 2QLAA 3I5PA 3VRCA 2KJGA 2NUPB 5L3VA 1VTMP 5F5FA 5T3WA 3E70C 4MVZA 2OJED 1A7VA 4K0DA 3TJ5A 4C3EA 1C03A 4JZAA 1KU2A 3U0CA 2ZXPA 4Z9JA 1S7ZA 2WZLA 3U2LA 3V7OA 3S29A 4Z9IA 1T9KA 1I4YA 4J7YA 1NSGB 1JPJA 1SF8A 2Y3HA 1DOVA 1OKKD 4I3MA 3X1OA 4CS9C 3S27A 2Q00A 3RIPA 2YL7A 2QY9A 2YVKA 4Q7CA 4PJLA 5KYWB 2R03A 3GM2A 3U9JA 2J46A 4OINF 4OD5A 4XEKA 2NPUA 4AX2A 4EWCA 3O39A 1HMOA 4G78A 3GEEA 3GEIA 2PP4A 4LDQA 4EBJA 1LIHA 1FNTc 1WN0A 2AWYA 1ZZPA 2HSBA 3HTKC 3N24A 2VCCA 1WATA 2ZPAA 3JRTA 2XXAB 2L81A 3ASOC 4M63A 1R5ID 3R2PA 4FESA 1EKYA 1NFOA 1UG7A 2FGYA 2H7OA 2KYHA 3DAFA 1YLMA 2R25A 3DZAA 1PV3A 4MVQA 5K0IA 3GEHA 3LEVA 2QUPA 4MVUA 1ZW2A 1V74B 2OCCC 1H7IA 3EPVA 4OD4A 4E0HA 2OEXA 1OCOC 5FZTA 3MYIA 2R7SA 3J06A 1ORJA 1XZPA 2W45A 3C8GA 4LLCA 5KYUA 2A1DD 2JD3A 1AUEA 1Z23A 3U3BA 5JS5A 3F47A 5L0DA 3SXKA 3FVYA 3LEOA 1D1BA 5KYUB 1LI5A 1Z3IX 1TWAA 3I5QA 2XM4A 2Q9CA 4AK9A 2QNLA 2R9RB 1LS1A 2DYRC 3HNIA 3T6BA 1L3PA 2CGEA 2PBEA 4C3DA 4DRHB 3SXZA 2XLWA 4L6RA 3Q6MA 1BR1A 3IHUA 2OKUA 2R7QA 2I8BA 3UMKA 1YJGA 5B1AC 3EHNA 3FOPA 4XPYA 4JTDB 1GM5A 2R7UA 3UMIA 3EGXA 4CS7A 3EFOB 2IXOA 2L6HA 5L0FA 5BQIA 3RFYA 1RMVA 3LESA 4MQ9F 1FR0A 5KYWA 2J9BA 3C63A 2PFDA 4Z9HA 3W2WA 4E0IA 4U5DE 4IRUA 2MWQA 3EGDA 3B0UX 1XWJA 2M4EA 3B71A 2J9UA 2H8AA 4CDVA 2LSEA 1G4WR 4D4NA 1ZHTA 4NTAA 1YDIA 4UDVA 1NZEA 2CDQA 3GWNA 5KYYA 3MFNA 3RQEA 1M2OA 5JT4A 3DI5A 2XS1A 2VH3A 3GORA 2CYDA 2V26A 4KI2A 5JRAA 4BJ5C 1G5ZA 1OCZC 3ECSA 1D1CA 2NUPA 4CS8C 2DGJA 4EHPA 2VCBA 2P61A 2R7TA 2OEVA 2P1AA 3C8GB 2BE5F 3FXHA 2Q7RA 4C7OA 4LDKA 3R7CA 2B0JA 2XLDA 4JJGA 3OWTA 5BQGA 3KYIA 2XL4A 2XLMA 1H6GA 1Z63A 1OXKA 2ASRA 1I5NA 2BL2A 4JE9A 1K40A 1FMVA 2YWAA 4ULVA 2OU6A 2PX3A 3UMHA 1E83A 3M4BA 5BQHA 1A41A 3JYYA 4E7ZA 4YWQA 5FCLA 4XWJA 2J45A 3U2MA 2YLDA 3K6BA 5EK0A 2YEVA 3SNHA 3LUTB 1N1CA 4HFKB 1QSPA 4O7GA 3NMIA 3QMKA 2V3CC 2IXMA 1V55C 4YT4A 4XPWA 5CI9A 3DJUB 2IYLD 1V4AA 3ZDLA 5F28E 2J8WA 3CZ6A 2MHRA 2CCYA 5AC5A 4IARA 3EJNA 1HE9A 2KW3C 3UNGC 2DB4A 2W4BA 3ATPA 3O10A 1MNDA 4WGZA 3JYHA 2XLVA 1VOMA 3DM5A 4U5GA 1DOWA 1OCCC 3U8VA 1O87A 1EI7A 1I4ZA 2YHSA 2ZXWC 1CPQA 2X51A 3QW0A 4G0HA 2A69F 3HKKA 1E2XA 2JX0A 1FMWA 2WVNA 2YZSA 2YRFA 5GPGB 1IW7F 3RQGA 1Q0GA 3EGDB 3GM3A 4IAOA 2YQYA 3I4UA 3KL4A 4J32B 4K1OA 3WG7C 1FAPB 4IGGA 4QDLA 4AL0A 2E87A 3G50A 2H7BA 2L6FA 2R7RA 3L8JA 3U8PA 1JR8A 1QQ3A 3POVA 2EIJC 4DXWA 2R02A 2XM0A 1OCRC 2WZGA 3NG1A 4JJFA 5DS4A 5A69A 3SEOA 3MX3A 2Y3GA 3NMJA 1FFHA 2HJ3A 3HNLA 3EGXB 3B0PA 2XRHA 1JOGA 1OQCA 2J7PD 3DWWA 3EG9B 4JTCB 4W8KA 3W2VA 5AGFA 4RDAA 1NLXA 256BA 2EILC 4GQHA 1APCA 2YL0A 2CNWD 2LIGA 3ABMC 2FAPB 3AGTA 3L1MA 1ST6A 5E3CA 3IQCA 4N6HA 1U89A 3K33A 4ER9A 1U0BB 1T01A 4WABA 1BR4A 3C18A 2HS5A 1Q0FA 4J30B 3U5SA 2HUJA 5DQTA 5B3SC 3PHF2 3NYJA 3V5YA 3PDMP 2HSQA 1ORSC 2XLEA 4YL0A 1BR2A 1EQ1A 1HY5A 3WHNA 2G62A 1YARO 1VYIA 3CSKA 1OW7A 4MVRA 4PJNA 3ZQVA 4G7OF 4JURI 4EBBA 5A6BD 2PX0A 1TWHA 3GODA 2B0HA 2BC5A 4EUKB 1ZW3A 3DMDA 4G7HF 1BBHA 1SZIA 2XXAA 1S05A 2EPKX 4R32A 5EGYA 1ZU4A 2CNWA 1YVIA 3JRMO 3S0XA 1TKNA 3UR3C 2GFHA 2GAQA 3ZQYA 2ETSA 3TOMA 4E17A 3S84A 5COGA 2IOQA 4KNVA 2J9VA 3SP1A 3TULA 2VB6A 4E7SA 4CS9A 2O9XA 1GQAA 4NTBA 4N6CA 1ZU5A 4YJWA 3DE8A 4NQFA 4MW3A 2KQ9A 2GDCA 4CDAA 3M15A 4RD9A 4EIYA 1E85A 3F46A 1ZYRF 3G4XA 4FX5A 2EPLX 3SZRA 2Q3TA 2A0UA 5E3AA 1VLSA 1VMAA 2H7VC 3ZVRA 4CIPA 1T6IA 2HV6A 1LM3B 2EIMC 2YLIA 4GEHA 5COFA 4MVMA 1FFTC 2EINC 3U9MA 3RVYA 3AQBA 3RQFA 3IQ6A 4DBRA 2A6EF 3H2VA 3N0TA 2IM8A 1B68A 3HNKA 4MVOA 2KGOA 4NCQA 1UFBA 5A6JA 3K66A 1WOLA 3ITFA 3NYLA 4J7TA 2Q9AA 3IQ5A 4FWVA 4K7BA 1JMWA 2LFDA 4YL1A 4BEJA 1Y4CA 3SYNA 3K1IA 2XL6A 1Q0DA 3L0IA 3LS0A 2WL8A 1T6QA 3BEHA 3DAGA 4I1MA 1M2VB 4KNWA 3W8IA 2XSEA 4YT8A 1RKEA 5L0CA 4OIOF 1NFNA 5DLJA 4FAPB 4XLPF 1G4US 3IEEA 4O6MA 3AG4C 2CW0F 1LS4A 2UUIA 3JT1A 3RYLA 4DRJB 4XPXA 5TJ5E 1LE2A 3W4YA 1D0YA 4PJMA 4ONSA 2NUTA 5JUAA 3KH2A 5L0JA 2R7OA 2KC3A 3T9OA 5DVWA 1A7DA 2GWWA 3AG2C 2NUTB 3EG9A 4YN0B 1HW2A 2AU5A 1FTSA 2L9JA 1F1MA 4U5CE 4XLNF 5JVEA 1CGOA 2XLOA 2XS8A 4HE8D 4RBNA 4IAQA 1H9TA 4BEMJ 1J8MF 3DM9B 3JSZA 3MBGA 5IY5C 3TJ6A 1W2WA 3T6GB 1K05A 1MMGA 1LI7A 1YYJA 3DKAA 3WAQA 4LACB 2HV7A 3A11A 2X0CA 2KK1A 1OR2A 2EPMX 4D4XA 4CIHA 2HZ8A 3L34A 4C3BA 3B9QA 2UUHA 5CIVA 3LLKA 3LNMB 4LDRA 1VK5A 2ZXRA 1ORYA 3RF3A 4O6YA 5D92A 3FDQA 4U9EA 2D4UA 2WZFA 3GM1A 5JSLA 4P6IC 3QVZA 4IJJA 1T5OA 1R4TA 3LNRA 4AE4A 5DQZA 5B3IA 3AJMA 3G4ZA 5HSWA 4NY3A 1MMNA 1ZHYA 3NYMA 3Q7LA 2RD9A 2ICWG 3FMSA 1NU7D 4JCHA 3FOOA 3Q6NA 3DD7A 4O79A 1NU9C 3RW0A 2FFHA 2M64A 4MTGA 4JCZA 3T6JA 4F4BA 1QZXA 1TFKB 4JEAA 1E86A 3TD7A 1YA7O 5HV9A 2G3KA 2HMQA 1RKEB 1WWPA 1WTYA 3M4CA 4MTOA 1BDJB 4LLEA 4GYTA 1HMDA 1PCXA 3W8HA 3CAXA 1RJ9B 3K7DA 1SR2A 2HKVA 3O55A 4A4AA 3AG3C 2YL1A 4JW1A 4OIQF 2NG1A 3GANA 5CI8A 2WVQA 5KYXA 3LAYA 5B1BC 1TWCA 3K1HA 1JPNA 2IXPA 1JRAA 1VYKA 3JZ0A 4X0RA 4G7ZF 1Z7Qc 3WODF 4PFPA 3JSEO 3ZTMA 3FHDA 4C7OB 4E18A 4A2NB 4CSAC 3SXMA 5COMA 3QTHA 4JKVA 2XLHA 2Q4FA 3AGUA 3EZIA 1Q0MA 1TFOB 3K1IC 4ULWA 1XZQA 5JP7A 1QLEC 3CEXA 3LLIA 4DRIB 2NSFA 3C8ZA 4BJ6C 2NSGA 4ZLDA 1G8XA 2VASA 4HFFB 2LK4A 4YL3A 5A6BA 5A6AA 1HE1A 4MW8A 3GWLA 3L8IA 4W8PA 4B6IA 3IPMO 4XQ1A 4PJJA 1VB5A 3ABKC 2OJQA 1ZHXA 3U3FA 4DBQA 3ZWIA 3JTLO 3RVZA 1HW1A 1M6TA 2Y3BA 2JPUA 5EHHA 1NG1A 4JTAB 1RJ9A 5KYNA 4YK5A 2L7AA 5E2QA 3ASNC 3RKOF 3AOUA 4I1OB 3NDBB 4U5EE 4H54A 1A0BA 4PR9A 1RCPA 3QZCA 2PF4E 4P9FA 1MMAA 2J9WA 4IWBA 4MS2A 2GA0A 1E84A 2QE9A 4U5BE 4CJGA 1QPUA 3VYWA 3UGPA 3NKDA 4AL1A 1YA9A 2A6HF 1VLTA 3E9VA 4CX9A 2R7VA 3ZG1A 1U6HA 3EHMA 3ZTZA 3NRHA 3O6XA 2Y69C 3OEOA 3S28A 3DE9A 2A0BA 1BZ4A 1LPEA 2AP3A 2Q9BA 4JC7A 1LKXA 4PFOA 4HEAJ 4CBEA 2HMZA 1ZVZA 2EPNA 3A9CA 5L0GA 3KKBA 1OKKA 4EKWA 1CGNA 2R7XA 1M57C 1T6UA 5L0HA 3ABLC 3N2ZB 2LCHA 2DI3A 1MMDA 3Q7GA 3DXJF 4OIRF 2LFFA 2P6VA 1GGQA 1MQVA 2YLGA 2J7PA 2LP4A 1YYXA 1KTMA 4XEVA 3NKEA 4OIPF 5T3TA 1MNEA 2WVOA 4ANJA 1Q0KA 3IQTA 1AVOB 3KYJA 1YZCA 3MLGA 3FAPB 3EQLF 4DOZA 3VF0A 2W9YA 2VCAA 3S9OA 4BPMA 1GS9A 1AEPA 4EBKA 4P9TA 5JLIA 1O3UA 3M79A 3HNJA 4QI0A 2Z15A 1Z6AA 3QW1A 1SMYF 1WGWA 2KSFA 3DJNB 3EH1A 5KYYB 3LJBA 4CSAA 4BJ5A 2RSEB 1M2VA 1PD1A 2R7WA 2XL8A 2P7VA 4CS8A 1LVKA 4BJ6A 3CQZA 2OQMA 3BRJA 4Q5SF 4XEFA 1QVXA 3MYFA 2PNOA 4WJ0A 4U9DA 3EFOA 3C62A 1RXQA 4U5HA 5T1DB 1TWGA 4XTKA 2LD6A 1ZHZA 1CPRA 1D0XA 4JVSA 2LQGA 3TOLA 4Q4ZF 4NTFA 3AG1C 4DJ9A
chains in the Genus database with same CATH topology
4YK5A 3DWWA 3PCVA 5K0IA 2Q7RA 3B29A 4J7TA 5BQGA 4YL1A 4JCZA 5BQIA 4JRZA 3HKKA 2PNOA 5HV9A 4NTBA 4AL1A 4YL3A 5BQHA 4J7YA 2H8AA 4WABA 3LEOA 4NTAA 4AL0A 2UUHA 2UUIA 4JC7A 4YL0A 4NTFA 4BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YK5 A;  3DWW A;  3PCV A;  5K0I A;  2Q7R A;  3B29 A;  4J7T A;  5BQG A;  4YL1 A;  4JCZ A;  5BQI A;  4JRZ A;  3HKK A;  2PNO A;  5HV9 A;  4NTB A;  4AL1 A;  4YL3 A;  5BQH A;  4J7Y A;  2H8A A;  4WAB A;  3LEO A;  4NTA A;  4AL0 A;  2UUH A;  2UUI A;  4JC7 A;  4YL0 A;  4NTF A;  4BPM A; 
#chains in the Genus database with same CATH topology
 2AWC A;  1TQG A;  3EZH A;  2D5R B;  3FAJ A;  3US6 A;  4N06 A;  4PAC A;  3KPH A;  1V54 C;  1LE4 A;  1NBB A;  3TK0 A;  1OW8 A;  3C8G D;  3ZC4 A;  2J0W A;  3JCU Q;  2G3V A;  2OG2 A;  1D1A A;  1J8Y F;  3RH3 A;  5AC4 A;  1Z5Z A;  3UGO A;  1JAF A;  3PCV A;  1O5H A;  4MTF A;  3LS1 A;  4JIO A;  4DVZ A;  3B29 A;  3C7J A;  1ZHW A;  2P0N A;  1OW6 A;  2I15 A;  3OA1 A;  4LER A;  3S90 A;  2ZXO A;  3VM6 A;  1WAS A;  1C17 M;  5L3Q A;  3HLZ A;  4PK4 A;  1CGM E;  2R05 A;  3TQO A;  2MYS A;  2F22 A;  1YZA A;  2EPO A;  2W4M A;  3V5X A;  4WGY A;  2ZD9 A;  3B0V C;  4CDY A;  4H4K C;  1TR2 A;  2TMV P;  1D0Z A;  3V5Z A;  2DYS C;  2J0X A;  3X2Q C;  5A6K A;  3T4R A;  1PD0 A;  1RKC A;  2QTV A;  5E33 A;  1K04 A;  2L6G A;  2VC9 A;  2YL3 A;  5DS5 A;  5F5H A;  2OOC A;  1OR3 A;  2EIK C;  4BJT A;  4NC3 A;  1L7C A;  1IZM A;  4O6N A;  4JEB A;  4YT2 A;  5D91 A;  4BJ1 A;  2IBF A;  3HJC A;  1OXB A;  2IXN A;  4DVY P;  4IB4 A;  4N4W A;  3EH2 A;  1M56 C;  4AE4 B;  2HJM A;  3M1C B;  1EA8 A;  2AVK A;  2HFI A;  4JRZ A;  3VAY A;  3KMI A;  5BUO A;  2KNH A;  5L0I A;  1QKR A;  3QVY A;  3ZIB A;  4KBL A;  4QI2 A;  4BG0 A;  3ZSU A;  2Y39 A;  1H9G A;  1KNY A;  4KC9 A;  4CJO A;  4MVS A;  2C03 A;  3H2U A;  1A7E A;  2Y3D A;  2YKZ A;  4I44 A;  4YT5 A;  5DS6 A;  2C04 A;  3AQC A;  4MND A;  3NMK A;  3SXY A;  1Y6D A;  2WB7 A;  4ZLC A;  2A68 F;  3PMR A;  5KYX B;  1SYQ A;  1YAU O;  1C02 A;  4U5F E;  3H65 A;  2QLA A;  3I5P A;  3VRC A;  2KJG A;  2NUP B;  5L3V A;  1VTM P;  5F5F A;  5T3W A;  3E70 C;  4MVZ A;  2OJE D;  1A7V A;  4K0D A;  3TJ5 A;  4C3E A;  1C03 A;  4JZA A;  1KU2 A;  3U0C A;  2ZXP A;  4Z9J A;  1S7Z A;  2WZL A;  3U2L A;  3V7O A;  3S29 A;  4Z9I A;  1T9K A;  1I4Y A;  4J7Y A;  1NSG B;  1JPJ A;  1SF8 A;  2Y3H A;  1DOV A;  1OKK D;  4I3M A;  3X1O A;  4CS9 C;  3S27 A;  2Q00 A;  3RIP A;  2YL7 A;  2QY9 A;  2YVK A;  4Q7C A;  4PJL A;  5KYW B;  2R03 A;  3GM2 A;  3U9J A;  2J46 A;  4OIN F;  4OD5 A;  4XEK A;  2NPU A;  4AX2 A;  4EWC A;  3O39 A;  1HMO A;  4G78 A;  3GEE A;  3GEI A;  2PP4 A;  4LDQ A;  4EBJ A;  1LIH A;  1FNT c;  1WN0 A;  2AWY A;  1ZZP A;  2HSB A;  3HTK C;  3N24 A;  2VCC A;  1WAT A;  2ZPA A;  3JRT A;  2XXA B;  2L81 A;  3ASO C;  4M63 A;  1R5I D;  3R2P A;  4FES A;  1EKY A;  1NFO A;  1UG7 A;  2FGY A;  2H7O A;  2KYH A;  3DAF A;  1YLM A;  2R25 A;  3DZA A;  1PV3 A;  4MVQ A;  5K0I A;  3GEH A;  3LEV A;  2QUP A;  4MVU A;  1ZW2 A;  1V74 B;  2OCC C;  1H7I A;  3EPV A;  4OD4 A;  4E0H A;  2OEX A;  1OCO C;  5FZT A;  3MYI A;  2R7S A;  3J06 A;  1ORJ A;  1XZP A;  2W45 A;  3C8G A;  4LLC A;  5KYU A;  2A1D D;  2JD3 A;  1AUE A;  1Z23 A;  3U3B A;  5JS5 A;  3F47 A;  5L0D A;  3SXK A;  3FVY A;  3LEO A;  1D1B A;  5KYU B;  1LI5 A;  1Z3I X;  1TWA A;  3I5Q A;  2XM4 A;  2Q9C A;  4AK9 A;  2QNL A;  2R9R B;  1LS1 A;  2DYR C;  3HNI A;  3T6B A;  1L3P A;  2CGE A;  2PBE A;  4C3D A;  4DRH B;  3SXZ A;  2XLW A;  4L6R A;  3Q6M A;  1BR1 A;  3IHU A;  2OKU A;  2R7Q A;  2I8B A;  3UMK A;  1YJG A;  5B1A C;  3EHN A;  3FOP A;  4XPY A;  4JTD B;  1GM5 A;  2R7U A;  3UMI A;  3EGX A;  4CS7 A;  3EFO B;  2IXO A;  2L6H A;  5L0F A;  5BQI A;  3RFY A;  1RMV A;  3LES A;  4MQ9 F;  1FR0 A;  5KYW A;  2J9B A;  3C63 A;  2PFD A;  4Z9H A;  3W2W A;  4E0I A;  4U5D E;  4IRU A;  2MWQ A;  3EGD A;  3B0U X;  1XWJ A;  2M4E A;  3B71 A;  2J9U A;  2H8A A;  4CDV A;  2LSE A;  1G4W R;  4D4N A;  1ZHT A;  4NTA A;  1YDI A;  4UDV A;  1NZE A;  2CDQ A;  3GWN A;  5KYY A;  3MFN A;  3RQE A;  1M2O A;  5JT4 A;  3DI5 A;  2XS1 A;  2VH3 A;  3GOR A;  2CYD A;  2V26 A;  4KI2 A;  5JRA A;  4BJ5 C;  1G5Z A;  1OCZ C;  3ECS A;  1D1C A;  2NUP A;  4CS8 C;  2DGJ A;  4EHP A;  2VCB A;  2P61 A;  2R7T A;  2OEV A;  2P1A A;  3C8G B;  2BE5 F;  3FXH A;  2Q7R A;  4C7O A;  4LDK A;  3R7C A;  2B0J A;  2XLD A;  4JJG A;  3OWT A;  5BQG A;  3KYI A;  2XL4 A;  2XLM A;  1H6G A;  1Z63 A;  1OXK A;  2ASR A;  1I5N A;  2BL2 A;  4JE9 A;  1K40 A;  1FMV A;  2YWA A;  4ULV A;  2OU6 A;  2PX3 A;  3UMH A;  1E83 A;  3M4B A;  5BQH A;  1A41 A;  3JYY A;  4E7Z A;  4YWQ A;  5FCL A;  4XWJ A;  2J45 A;  3U2M A;  2YLD A;  3K6B A;  5EK0 A;  2YEV A;  3SNH A;  3LUT B;  1N1C A;  4HFK B;  1QSP A;  4O7G A;  3NMI A;  3QMK A;  2V3C C;  2IXM A;  1V55 C;  4YT4 A;  4XPW A;  5CI9 A;  3DJU B;  2IYL D;  1V4A A;  3ZDL A;  5F28 E;  2J8W A;  3CZ6 A;  2MHR A;  2CCY A;  5AC5 A;  4IAR A;  3EJN A;  1HE9 A;  2KW3 C;  3UNG C;  2DB4 A;  2W4B A;  3ATP A;  3O10 A;  1MND A;  4WGZ A;  3JYH A;  2XLV A;  1VOM A;  3DM5 A;  4U5G A;  1DOW A;  1OCC C;  3U8V A;  1O87 A;  1EI7 A;  1I4Z A;  2YHS A;  2ZXW C;  1CPQ A;  2X51 A;  3QW0 A;  4G0H A;  2A69 F;  3HKK A;  1E2X A;  2JX0 A;  1FMW A;  2WVN A;  2YZS A;  2YRF A;  5GPG B;  1IW7 F;  3RQG A;  1Q0G A;  3EGD B;  3GM3 A;  4IAO A;  2YQY A;  3I4U A;  3KL4 A;  4J32 B;  4K1O A;  3WG7 C;  1FAP B;  4IGG A;  4QDL A;  4AL0 A;  2E87 A;  3G50 A;  2H7B A;  2L6F A;  2R7R A;  3L8J A;  3U8P A;  1JR8 A;  1QQ3 A;  3POV A;  2EIJ C;  4DXW A;  2R02 A;  2XM0 A;  1OCR C;  2WZG A;  3NG1 A;  4JJF A;  5DS4 A;  5A69 A;  3SEO A;  3MX3 A;  2Y3G A;  3NMJ A;  1FFH A;  2HJ3 A;  3HNL A;  3EGX B;  3B0P A;  2XRH A;  1JOG A;  1OQC A;  2J7P D;  3DWW A;  3EG9 B;  4JTC B;  4W8K A;  3W2V A;  5AGF A;  4RDA A;  1NLX A;  256B A;  2EIL C;  4GQH A;  1APC A;  2YL0 A;  2CNW D;  2LIG A;  3ABM C;  2FAP B;  3AGT A;  3L1M A;  1ST6 A;  5E3C A;  3IQC A;  4N6H A;  1U89 A;  3K33 A;  4ER9 A;  1U0B B;  1T01 A;  4WAB A;  1BR4 A;  3C18 A;  2HS5 A;  1Q0F A;  4J30 B;  3U5S A;  2HUJ A;  5DQT A;  5B3S C;  3PHF 2;  3NYJ A;  3V5Y A;  3PDM P;  2HSQ A;  1ORS C;  2XLE A;  4YL0 A;  1BR2 A;  1EQ1 A;  1HY5 A;  3WHN A;  2G62 A;  1YAR O;  1VYI A;  3CSK A;  1OW7 A;  4MVR A;  4PJN A;  3ZQV A;  4G7O F;  4JUR I;  4EBB A;  5A6B D;  2PX0 A;  1TWH A;  3GOD A;  2B0H A;  2BC5 A;  4EUK B;  1ZW3 A;  3DMD A;  4G7H F;  1BBH A;  1SZI A;  2XXA A;  1S05 A;  2EPK X;  4R32 A;  5EGY A;  1ZU4 A;  2CNW A;  1YVI A;  3JRM O;  3S0X A;  1TKN A;  3UR3 C;  2GFH A;  2GAQ A;  3ZQY A;  2ETS A;  3TOM A;  4E17 A;  3S84 A;  5COG A;  2IOQ A;  4KNV A;  2J9V A;  3SP1 A;  3TUL A;  2VB6 A;  4E7S A;  4CS9 A;  2O9X A;  1GQA A;  4NTB A;  4N6C A;  1ZU5 A;  4YJW A;  3DE8 A;  4NQF A;  4MW3 A;  2KQ9 A;  2GDC A;  4CDA A;  3M15 A;  4RD9 A;  4EIY A;  1E85 A;  3F46 A;  1ZYR F;  3G4X A;  4FX5 A;  2EPL X;  3SZR A;  2Q3T A;  2A0U A;  5E3A A;  1VLS A;  1VMA A;  2H7V C;  3ZVR A;  4CIP A;  1T6I A;  2HV6 A;  1LM3 B;  2EIM C;  2YLI A;  4GEH A;  5COF A;  4MVM A;  1FFT C;  2EIN C;  3U9M A;  3RVY A;  3AQB A;  3RQF A;  3IQ6 A;  4DBR A;  2A6E F;  3H2V A;  3N0T A;  2IM8 A;  1B68 A;  3HNK A;  4MVO A;  2KGO A;  4NCQ A;  1UFB A;  5A6J A;  3K66 A;  1WOL A;  3ITF A;  3NYL A;  4J7T A;  2Q9A A;  3IQ5 A;  4FWV A;  4K7B A;  1JMW A;  2LFD A;  4YL1 A;  4BEJ A;  1Y4C A;  3SYN A;  3K1I A;  2XL6 A;  1Q0D A;  3L0I A;  3LS0 A;  2WL8 A;  1T6Q A;  3BEH A;  3DAG A;  4I1M A;  1M2V B;  4KNW A;  3W8I A;  2XSE A;  4YT8 A;  1RKE A;  5L0C A;  4OIO F;  1NFN A;  5DLJ A;  4FAP B;  4XLP F;  1G4U S;  3IEE A;  4O6M A;  3AG4 C;  2CW0 F;  1LS4 A;  2UUI A;  3JT1 A;  3RYL A;  4DRJ B;  4XPX A;  5TJ5 E;  1LE2 A;  3W4Y A;  1D0Y A;  4PJM A;  4ONS A;  2NUT A;  5JUA A;  3KH2 A;  5L0J A;  2R7O A;  2KC3 A;  3T9O A;  5DVW A;  1A7D A;  2GWW A;  3AG2 C;  2NUT B;  3EG9 A;  4YN0 B;  1HW2 A;  2AU5 A;  1FTS A;  2L9J A;  1F1M A;  4U5C E;  4XLN F;  5JVE A;  1CGO A;  2XLO A;  2XS8 A;  4HE8 D;  4RBN A;  4IAQ A;  1H9T A;  4BEM J;  1J8M F;  3DM9 B;  3JSZ A;  3MBG A;  5IY5 C;  3TJ6 A;  1W2W A;  3T6G B;  1K05 A;  1MMG A;  1LI7 A;  1YYJ A;  3DKA A;  3WAQ A;  4LAC B;  2HV7 A;  3A11 A;  2X0C A;  2KK1 A;  1OR2 A;  2EPM X;  4D4X A;  4CIH A;  2HZ8 A;  3L34 A;  4C3B A;  3B9Q A;  2UUH A;  5CIV A;  3LLK A;  3LNM B;  4LDR A;  1VK5 A;  2ZXR A;  1ORY A;  3RF3 A;  4O6Y A;  5D92 A;  3FDQ A;  4U9E A;  2D4U A;  2WZF A;  3GM1 A;  5JSL A;  4P6I C;  3QVZ A;  4IJJ A;  1T5O A;  1R4T A;  3LNR A;  4AE4 A;  5DQZ A;  5B3I A;  3AJM A;  3G4Z A;  5HSW A;  4NY3 A;  1MMN A;  1ZHY A;  3NYM A;  3Q7L A;  2RD9 A;  2ICW G;  3FMS A;  1NU7 D;  4JCH A;  3FOO A;  3Q6N A;  3DD7 A;  4O79 A;  1NU9 C;  3RW0 A;  2FFH A;  2M64 A;  4MTG A;  4JCZ A;  3T6J A;  4F4B A;  1QZX A;  1TFK B;  4JEA A;  1E86 A;  3TD7 A;  1YA7 O;  5HV9 A;  2G3K A;  2HMQ A;  1RKE B;  1WWP A;  1WTY A;  3M4C A;  4MTO A;  1BDJ B;  4LLE A;  4GYT A;  1HMD A;  1PCX A;  3W8H A;  3CAX A;  1RJ9 B;  3K7D A;  1SR2 A;  2HKV A;  3O55 A;  4A4A A;  3AG3 C;  2YL1 A;  4JW1 A;  4OIQ F;  2NG1 A;  3GAN A;  5CI8 A;  2WVQ A;  5KYX A;  3LAY A;  5B1B C;  1TWC A;  3K1H A;  1JPN A;  2IXP A;  1JRA A;  1VYK A;  3JZ0 A;  4X0R A;  4G7Z F;  1Z7Q c;  3WOD F;  4PFP A;  3JSE O;  3ZTM A;  3FHD A;  4C7O B;  4E18 A;  4A2N B;  4CSA C;  3SXM A;  5COM A;  3QTH A;  4JKV A;  2XLH A;  2Q4F A;  3AGU A;  3EZI A;  1Q0M A;  1TFO B;  3K1I C;  4ULW A;  1XZQ A;  5JP7 A;  1QLE C;  3CEX A;  3LLI A;  4DRI B;  2NSF A;  3C8Z A;  4BJ6 C;  2NSG A;  4ZLD A;  1G8X A;  2VAS A;  4HFF B;  2LK4 A;  4YL3 A;  5A6B A;  5A6A A;  1HE1 A;  4MW8 A;  3GWL A;  3L8I A;  4W8P A;  4B6I A;  3IPM O;  4XQ1 A;  4PJJ A;  1VB5 A;  3ABK C;  2OJQ A;  1ZHX A;  3U3F A;  4DBQ A;  3ZWI A;  3JTL O;  3RVZ A;  1HW1 A;  1M6T A;  2Y3B A;  2JPU A;  5EHH A;  1NG1 A;  4JTA B;  1RJ9 A;  5KYN A;  4YK5 A;  2L7A A;  5E2Q A;  3ASN C;  3RKO F;  3AOU A;  4I1O B;  3NDB B;  4U5E E;  4H54 A;  1A0B A;  4PR9 A;  1RCP A;  3QZC A;  2PF4 E;  4P9F A;  1MMA A;  2J9W A;  4IWB A;  4MS2 A;  2GA0 A;  1E84 A;  2QE9 A;  4U5B E;  4CJG A;  1QPU A;  3VYW A;  3UGP A;  3NKD A;  4AL1 A;  1YA9 A;  2A6H F;  1VLT A;  3E9V A;  4CX9 A;  2R7V A;  3ZG1 A;  1U6H A;  3EHM A;  3ZTZ A;  3NRH A;  3O6X A;  2Y69 C;  3OEO A;  3S28 A;  3DE9 A;  2A0B A;  1BZ4 A;  1LPE A;  2AP3 A;  2Q9B A;  4JC7 A;  1LKX A;  4PFO A;  4HEA J;  4CBE A;  2HMZ A;  1ZVZ A;  2EPN A;  3A9C A;  5L0G A;  3KKB A;  1OKK A;  4EKW A;  1CGN A;  2R7X A;  1M57 C;  1T6U A;  5L0H A;  3ABL C;  3N2Z B;  2LCH A;  2DI3 A;  1MMD A;  3Q7G A;  3DXJ F;  4OIR F;  2LFF A;  2P6V A;  1GGQ A;  1MQV A;  2YLG A;  2J7P A;  2LP4 A;  1YYX A;  1KTM A;  4XEV A;  3NKE A;  4OIP F;  5T3T A;  1MNE A;  2WVO A;  4ANJ A;  1Q0K A;  3IQT A;  1AVO B;  3KYJ A;  1YZC A;  3MLG A;  3FAP B;  3EQL F;  4DOZ A;  3VF0 A;  2W9Y A;  2VCA A;  3S9O A;  4BPM A;  1GS9 A;  1AEP A;  4EBK A;  4P9T A;  5JLI A;  1O3U A;  3M79 A;  3HNJ A;  4QI0 A;  2Z15 A;  1Z6A A;  3QW1 A;  1SMY F;  1WGW A;  2KSF A;  3DJN B;  3EH1 A;  5KYY B;  3LJB A;  4CSA A;  4BJ5 A;  2RSE B;  1M2V A;  1PD1 A;  2R7W A;  2XL8 A;  2P7V A;  4CS8 A;  1LVK A;  4BJ6 A;  3CQZ A;  2OQM A;  3BRJ A;  4Q5S F;  4XEF A;  1QVX A;  3MYF A;  2PNO A;  4WJ0 A;  4U9D A;  3EFO A;  3C62 A;  1RXQ A;  4U5H A;  5T1D B;  1TWG A;  4XTK A;  2LD6 A;  1ZHZ A;  1CPR A;  1D0X A;  4JVS A;  2LQG A;  3TOL A;  4Q4Z F;  4NTF A;  3AG1 C;  4DJ9 A; 
#chains in the Genus database with same CATH homology
 4YK5 A;  3DWW A;  3PCV A;  5K0I A;  2Q7R A;  3B29 A;  4J7T A;  5BQG A;  4YL1 A;  4JCZ A;  5BQI A;  4JRZ A;  3HKK A;  2PNO A;  5HV9 A;  4NTB A;  4AL1 A;  4YL3 A;  5BQH A;  4J7Y A;  2H8A A;  4WAB A;  3LEO A;  4NTA A;  4AL0 A;  2UUH A;  2UUI A;  4JC7 A;  4YL0 A;  4NTF A;  4BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...