4JD7A

Crystal structure of pput_1285, a putative hydroxyproline epimerase from pseudomonas putida f1 (target efi-506500), open form, space group p212121, bound sulfate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
314
structure length
314
Chain Sequence
b'NLYFQSMKQIHVIDSHTGGEPTRLVMKGFPQLHGRSMAEQRDELRELHDRWRRACLLEPRGNDVLVGALYCPPVSADATCGVIFFNNAGYLNMCGHGTIGLVASLQHLGLIAPGVHKIDTPVGQVSATLHEDGAITVANVPSYRYRQHVAVNVPGHGVVHGDIAWGGNWFFLVAEHGQRIELDNREVLTEYTWAMLKALEAQGITGENGAPIDHVELFADDPNADSRNFVMCPGKAYDRSPCGTGTSAKLACLAADGTLAEGQTWVQASITGSQFHGRYERDGERIRPFITGRAHMTADSTLLIDEQDPFAWGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline racemase
molecule tags Isomerase
source organism Pseudomonas putida
publication title Crystal structure of pput_1285, a putative hydroxyproline epimerase from Pseudomonas putida f1 (target EFI-506500), open form, space group P212121, bound sulfate
rcsb
total genus 79
structure length 314
sequence length 314
chains with identical sequence D
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4jd7A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4jd7A01
3FVEA 2GKJA 2Q9HA 4K8LA 1U1VA 4JUUA 2GKEA 5H2GA 1W62A 1SDJA 1XUBA 2AZPA 2OTNA 4K7GB 1QYAA 4J9WA 4Q2HA 4IK0A 1U1XA 4LB0A 3EJXA 4DUNA 5M47A 1T6KA 3EDNA 1U1WA 1QY9A 1BWZA 1W61A 2PVZA 4JD7A 4IJZA 4K7XA 5H2YA 5IWEA 1GQZA 2Q9JA 5HA4A 2PW0A 1TM0A 3EKMA 1S7JA 4JCIA 1U0KA 2H9FA 4Q60A 1YM5A 4JBDA 1XUAA 3G7KA 4J9XA
chains in the Genus database with same CATH superfamily
2GKJA 4K8LA 1WPPA 5H2GA 1W62A 3IGHX 2OTNA 4PY9A 5ANPA 4LB0A 2ZXOA 1U1WA 1W61A 4K7XA 2Q9JA 2PW0A 3EKMA 2QB7A 2HAWA 4JCIA 2H9FA 4Q60A 4RPAA 4J9XA 3FVEA 4GL6A 4OA3A 3W5WA 1XUBA 3WQZA 1QYAA 1U1XA 4DUNA 4LG3A 2ENXA 1BWZA 2IW4A 2PVZA 5H2YA 1GQZA 1TM0A 2ZXPA 1U0KA 1YM5A 4JBDA 2LT2A 2KPTA 3G7KA 3G98A 2Q9HA 1U1VA 3PW9A 4K7GB 4IK0A 2QB8A 3PVHA 5M47A 1T6KA 3ICJA 1WPMA 1QY9A 5IWEA 2YMAA 2EB0A 3DEVA 2MPBA 2QB6A 4JUUA 2GKEA 3PTJA 1K20A 1SDJA 2AZPA 4J9WA 4Q2HA 3EJXA 2KW7A 2ZXRA 3EDNA 4LS9A 4JD7A 4IJZA 2ZVFA 5HA4A 1I74A 1IR6A 1S7JA 1XUAA 1K23A
chains in the Genus database with same CATH topology
2GKJA 4K8LA 1WPPA 5H2GA 1W62A 3IGHX 2OTNA 4PY9A 5ANPA 4LB0A 2ZXOA 1U1WA 1W61A 4K7XA 2Q9JA 2PW0A 3EKMA 2QB7A 2HAWA 4JCIA 2H9FA 4Q60A 4RPAA 4J9XA 3FVEA 4GL6A 4OA3A 3W5WA 1XUBA 3WQZA 1QYAA 1U1XA 4DUNA 4LG3A 2ENXA 1BWZA 2IW4A 2PVZA 5H2YA 1GQZA 1TM0A 2ZXPA 1U0KA 1YM5A 4JBDA 2LT2A 2KPTA 3G7KA 3G98A 2Q9HA 1U1VA 3PW9A 4K7GB 4IK0A 2QB8A 3PVHA 5M47A 1T6KA 3ICJA 1WPMA 1QY9A 5IWEA 2YMAA 2EB0A 3DEVA 2MPBA 2QB6A 4JUUA 2GKEA 3PTJA 1K20A 1SDJA 2AZPA 4J9WA 4Q2HA 3EJXA 2KW7A 2ZXRA 3EDNA 4LS9A 4JD7A 4IJZA 2ZVFA 5HA4A 1I74A 1IR6A 1S7JA 1XUAA 1K23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVE A;  2GKJ A;  2Q9H A;  4K8L A;  1U1V A;  4JUU A;  2GKE A;  5H2G A;  1W62 A;  1SDJ A;  1XUB A;  2AZP A;  2OTN A;  4K7G B;  1QYA A;  4J9W A;  4Q2H A;  4IK0 A;  1U1X A;  4LB0 A;  3EJX A;  4DUN A;  5M47 A;  1T6K A;  3EDN A;  1U1W A;  1QY9 A;  1BWZ A;  1W61 A;  2PVZ A;  4JD7 A;  4IJZ A;  4K7X A;  5H2Y A;  5IWE A;  1GQZ A;  2Q9J A;  5HA4 A;  2PW0 A;  1TM0 A;  3EKM A;  1S7J A;  4JCI A;  1U0K A;  2H9F A;  4Q60 A;  1YM5 A;  4JBD A;  1XUA A;  3G7K A;  4J9X A; 
#chains in the Genus database with same CATH topology
 2GKJ A;  4K8L A;  1WPP A;  5H2G A;  1W62 A;  3IGH X;  2OTN A;  4PY9 A;  5ANP A;  4LB0 A;  2ZXO A;  1U1W A;  1W61 A;  4K7X A;  2Q9J A;  2PW0 A;  3EKM A;  2QB7 A;  2HAW A;  4JCI A;  2H9F A;  4Q60 A;  4RPA A;  4J9X A;  3FVE A;  4GL6 A;  4OA3 A;  3W5W A;  1XUB A;  3WQZ A;  1QYA A;  1U1X A;  4DUN A;  4LG3 A;  2ENX A;  1BWZ A;  2IW4 A;  2PVZ A;  5H2Y A;  1GQZ A;  1TM0 A;  2ZXP A;  1U0K A;  1YM5 A;  4JBD A;  2LT2 A;  2KPT A;  3G7K A;  3G98 A;  2Q9H A;  1U1V A;  3PW9 A;  4K7G B;  4IK0 A;  2QB8 A;  3PVH A;  5M47 A;  1T6K A;  3ICJ A;  1WPM A;  1QY9 A;  5IWE A;  2YMA A;  2EB0 A;  3DEV A;  2MPB A;  2QB6 A;  4JUU A;  2GKE A;  3PTJ A;  1K20 A;  1SDJ A;  2AZP A;  4J9W A;  4Q2H A;  3EJX A;  2KW7 A;  2ZXR A;  3EDN A;  4LS9 A;  4JD7 A;  4IJZ A;  2ZVF A;  5HA4 A;  1I74 A;  1IR6 A;  1S7J A;  1XUA A;  1K23 A; 
#chains in the Genus database with same CATH homology
 2GKJ A;  4K8L A;  1WPP A;  5H2G A;  1W62 A;  3IGH X;  2OTN A;  4PY9 A;  5ANP A;  4LB0 A;  2ZXO A;  1U1W A;  1W61 A;  4K7X A;  2Q9J A;  2PW0 A;  3EKM A;  2QB7 A;  2HAW A;  4JCI A;  2H9F A;  4Q60 A;  4RPA A;  4J9X A;  3FVE A;  4GL6 A;  4OA3 A;  3W5W A;  1XUB A;  3WQZ A;  1QYA A;  1U1X A;  4DUN A;  4LG3 A;  2ENX A;  1BWZ A;  2IW4 A;  2PVZ A;  5H2Y A;  1GQZ A;  1TM0 A;  2ZXP A;  1U0K A;  1YM5 A;  4JBD A;  2LT2 A;  2KPT A;  3G7K A;  3G98 A;  2Q9H A;  1U1V A;  3PW9 A;  4K7G B;  4IK0 A;  2QB8 A;  3PVH A;  5M47 A;  1T6K A;  3ICJ A;  1WPM A;  1QY9 A;  5IWE A;  2YMA A;  2EB0 A;  3DEV A;  2MPB A;  2QB6 A;  4JUU A;  2GKE A;  3PTJ A;  1K20 A;  1SDJ A;  2AZP A;  4J9W A;  4Q2H A;  3EJX A;  2KW7 A;  2ZXR A;  3EDN A;  4LS9 A;  4JD7 A;  4IJZ A;  2ZVF A;  5HA4 A;  1I74 A;  1IR6 A;  1S7J A;  1XUA A;  1K23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...