4JDBA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-005
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-005
rcsb
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4jdbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jdbA01
4UTIA 2VEPA 4ADUA 4O4WA 1I2PA 1DVJA 3DKJA 1ICSA 1OFPA 3NL5A 4RXFA 3MP5A 3W2MA 1XDLA 1SQ7A 3H54A 3W7JA 3C2RA 5G1TA 1QPNA 2P10A 3DFTA 1LRTA 2ZRWA 5LNRA 2ABAA 4FHAA 1EUNA 2X1SA 2OT1A 1TB3A 2V5BA 4NJHA 1SZNA 1OFRA 1OVDA 3H53A 2EAWA 2GQ9A 2BWGA 3RNDA 2B7NA 3W7IA 1XBZA 2AAMA 4N9DA 2ATSA 1PL9A 3G1DA 2PE4A 5AYZA 1TPFA 3PY2A 1KLYA 4LV4A 5E0KA 3C61A 3N14A 4A21A 3C8FA 3LOTA 4GE8A 1SSDA 1YDNA 1D3GA 3BLEA 4IMGA 2WO5A 5G2WA 4IXXA 3UPBA 3GXNA 3G3DA 2FJKA 4N4PA 2GQAA 4NT0A 1OYCA 4G1KA 1C29A 3MYOA 5FF0A 1ZY9A 3W7DA 5G2IA 3FFSA 3PS7A 2Y7GA 5DY2A 5CZSA 3C4UA 1EP3A 2DZTA 4MY8A 1C9DA 1Q3NA 1UCWA 2DP3A 4UTWC 2X1UA 5U4NA 1FX6A 3THAA 1D9EA 3GAYA 4DBDA 1YTKA 2QJGA 3A24A 1KV5A 5T26A 3S5YA 4UIOA 1QFEA 3HG4A 3BVJA 1RQHA 5HWMA 1M7OA 1GPWA 3NQVA 3IGXA 4O1CA 1SZFA 1KLZA 3QMSA 2BSLA 3Q37A 5L9FA 2CZEA 3VI2A 4CNNA 4GC4A 4RJEA 1Z44A 5CGQA 5CPNA 1JVNA 3E12A 3MP4A 1JUKA 3DFPA 1DHPA 1SFLA 3ZFHA 2ATMA 2CLEA 5DY3A 2Y89A 2FB2A 4BK9A 3KHJA 1RQEA 5D32A 3IEBA 4R34A 4BWLC 3LTSA 4EOUA 3OBKA 1ZJIA 4NX5A 3W87A 1V5XA 1OFAA 5AHEA 5KINA 3LERA 1EP1A 3P81A 1GVOA 4CNOA 5F2GA 3GX9A 4A2RA 4P61A 4XWUA 3QZEA 3TV8A 1O60A 3HG5A 4HNNA 3TX9A 2GUUA 1W54A 2W6RA 4FNUA 4WOQA 1LBFA 3PB2A 2ZA1A 4MVAA 3LI0A 5A8GA 1HO4A 3ABSA 3LHUA 5AOUA 4WY0F 2R94A 5H2ZA 3M5VA 1Q6LA 4O11A 4FX8A 1WAUA 1YXCA 1GVFA 3PG8A 4CQ8A 1R2TA 3W6YA 2GOUA 1K7XA 4FNSA 3TIMA 3GYEA 1F6KA 2E1DA 3BG9A 2CZ5A 4UR7A 1XKYA 4IUOA 1JCJA 3B0UX 3L0NA 4K39A 3EWBX 4AWSA 5LNSA 3TCEA 3FKKA 2NLIA 1YPFA 5A5WA 4MJZA 4DO6A 1N55A 3DXIA 2CFFA 4LTSA 3RK8A 3RU6A 1VJIA 3L0GA 3HPSA 2QUTA 3N9RA 1GVSA 4TO8A 4O10A 3Q94A 2ZYFA 4PFMA 5AHMA 3T7VA 3L9CA 4JD4A 4HIBA 2C14A 2VKZG 3TR2A 2H8ZA 1XC4A 5K4XA 1SZEA 2RHGA 3ELFA 4DXVA 3TNOA 1JULA 3CEPA 2A0NA 2Z6IA 1TRDA 3CB8A 1TPEA 4IWWA 1TTIA 3AJXA 3EXRA 4C1KA 4NQ1A 3TC7A 3GXTA 3MHFA 3P62A 5CZJA 4O16A 1GG0A 3EX3A 5CPOA 4UR8A 3PBYA 2VFHA 3C52A 1SFJA 3G1HA 4JTUA 3QMTA 3NR0A 5D2WA 3C2EA 3DHFA 3DAQA 3IRDA 3L2IA 3KX6A 4O28A 3F1QA 4JX6A 3IV3A 3FIGA 4Z1AA 2BZNA 4LT9A 3NO5A 1EWDA 1VLWA 3EWUA 4HSNA 1SO4A 4JY9A 1XBYA 5LKYA 3M5ZA 1FDJA 4D2JA 2YR1A 4K38A 2E5BA 1H51A 1GJPA 3DI1A 2FPTA 3PC0A 1QOPA 3LBMA 1ME8A 4LVBA 2NXGA 4O57A 4GUFA 5F4WA 3W83A 3SFKA 1UASA 4FX6M 2C6QA 1FWTA 4O1AA 4OGZA 1G7UA 4HN4A 1FXPA 4HNUA 4IJBA 1W0MA 2AQWA 3M41A 4AH7A 1X7FA 5BOOA 1FY6A 5ABTA 3G8EA 5DXXA 3TW7A 1SO3A 2GVJA 3CTLA 5K9DA 2J9ZA 3KRSA 4UMAA 1OK4A 2G96A 1KW1A 2Z0IA 2A7NA 3NXFA 1WX0A 3MMTA 2VEKA 1KFEA 5K9XA 3STEA 5G5IA 3VE9A 3W7KA 1LROA 4RV8A 3G24A 3S8HA 4XBSA 2CLIA 2QCGA 2OZ0A 3UZ5A 3OHIA 3GKFA 1VPXA 1S5WA 1DQXA 4O19A 4M5PA 1TV5A 3T55A 4LC8A 2VFDA 3L5AA 4Y90A 4RZ6A 2G95A 3M5XA 4NNAA 1RZMA 3O15A 4Y8FA 2A6LA 4OE7A 2YPIA 3A22A 3W85A 4ALDA 3NOEA 1B57A 1E51A 5HULA 3T44A 4LOCA 1M5WA 1I2NA 1O95A 1YTDA 3HG3A 1G4PA 1TYGA 1L6WA 4ZQNA 4LNYA 5DLCA 3CEUA 1X8FA 2Y70A 5D2TA 4Q33A 3LHTA 3VCRA 1TCDA 4M7TA 5HUPA 3S5OA 3TUUA 3Q58A 2QJIA 4RLIA 4UNKA 4HNVA 3P5YA 4RZ4A 4P2VA 3HGSA 3ABQA 3N73A 5CSSA 6ALDA 2ZDRA 4O18A 4A22A 4POCA 4KFPA 1A50A 1VS1A 3A5FA 1MXSA 3HIJA 4CCCA 3HGJA 4WXZA 2E5DA 2W0UA 5DXYA 3T78A 4ZQOA 1HUVA 1Q6RA 4E38A 3PM6A 3TQKA 3S6DA 5HQEA 3KVLA 3QW4B 3YPIA 3GNNA 3SGZA 3FOKA 2B7PA 5CKSA 1C8VA 4WQ6A 5L6UA 1R2RA 4GUHA 3IIOA 4N6EA 3TC6A 3STCA 2PC4A 5EY5A 2X1TA 4YXGA 5AHNA 4DEFA 3TFXA 1FDYA 3QPYA 4NJJA 2FTPA 3LDVA 3LHYA 3QQ1A 1G67A 2Y62A 3QF0A 4NNCA 1G6CA 3HG2A 2AGKA 5DCDA 3L65A 2ZZ3A 1NSJA 5BMWA 2QEZA 4R33A 2VEIA 3G0UA 1AK5A 4QNEA 1KFLA 3NQDA 2Y7FA 3EWWA 3N9SA 2DZPA 4LS0A 5KSWA 3O6DA 2X30A 1O5XA 1PE1A 4MY9A 4Z0JA 3NQ7A 1EX5A 3FS2A 3W1MA 4HSOA 1P5BA 3GLCA 5FF4A 2Y7EA 1TTJA 2KZHA 1J2WA 4O13A 1G4TA 4PA8A 2BXVA 3O06A 2ISVA 4MLRA 3CPRA 2VOMA 4J9JA 4LRSA 3LHVA 1JR1A 3FA5A 1IXQA 4BWLA 5K7JA 1K7FA 4IMFA 3PBUA 1SO6A 4AWUA 5IM51 1P0KA 3B06A 3BV4A 3NM1A 1DBTA 1M6JA 1GYLA 3CLMA 2XN0A 3GKAA 3M5YA 4HHPA 1GWJA 1I4NA 4N02A 3M9YA 4JY8A 3CHVA 2JKAA 4LW7A 3IGSA 3JR2A 3QW3A 3TROA 2E77A 3NDOA 2Y6ZA 4BF9A 3PSVA 5LZLA 3B4UA 2Z6JA 3P8IA 3V1PA 2VFEA 1JCNA 3C6CA 3SY5A 2NXHA 3G1XA 3N2MA 2I1OA 1FWWA 3BW3A 1H62A 3F4WA 1Q45A 2V5LA 3QFEA 1YDOA 3HGRA 4RCXA 3CM4A 1O94A 1A53A 3E02A 3SJ3A 7TIMA 5DCBA 3BK0A 3I68A 2ZQ0A 3I7RA 2WPBA 4OV9A 3OEXA 2JK2A 1W5QA 4ML9A 2B7QA 4KWVA 2QDHA 3W75A 4S2BA 4MUZA 1F7BA 4DPQA 5AHIA 2NV1A 4UTHA 1YLVA 4MJMA 1LBMA 1OG0A 3W2NA 1SO5A 1JUBA 5HNRA 2CLOA 4O0KA 3UWWA 4EF8A 4GNJA 1FCVA 3FEMA 4WOZA 1XUUA 3DFSA 2HS6A 3QM3A 4K8EA 3R13A 3RF9A 3NPWA 4CNPA 1TPH1 1KM6A 1ICQA 4LUJA 4BI7A 3R8RA 1OHLA 1ML1A 4X22A 3NZ1A 1VYPX 1WOAA 1Z42A 2QJHA 3LXBA 3RLVA 3QYQA 4O4VA 4ZVJA 4FB7A 5K9CA 4CCEA 3IVTA 3O16A 5LGXA 5TBOA 2QKFA 3MI2A 4IMCA 1JRCA 4GUJA 2EGZA 3P8JA 2ZRVA 4N6FA 3TJXA 2J27A 2TPSA 3KFTA 1I8JA 4YCOA 1AW1A 4L4MA 4UFIA 3MYPA 3RLUA 4I7WA 4IPJA 4ZL1A 5G4EA 3HBLA 3EXTA 3MBFA 1JQVA 4S1FA 3H55A 4MIMA 3JS3A 3STGA 4HPXA 4JDYA 3LBCA 2I14A 3W1PA 3PR2A 5TQLA 5DBUA 4OBTA 2H6RA 4N9EA 3JRKA 1UB3A 1TV8A 1KTBA 3U2OA 3CQ0A 3O05A 3C2VA 3NQEA 1W5NA 3C3NA 3FYOA 3NYZA 1WOBA 3W2LA 4RKAA 4WJEA 3EWYA 2ZZ6A 3FJ6A 4LVDA 2P0OA 3LXAA 2B0MA 1WV2A 1JCLA 2NZLA 3WJWA 1S5TA 3NPUA 4GWEA 4I7UA 3NG3A 2E6DA 1VRDA 5LGZA 3W84A 1M7PA 2VC6A 1T96A 2WJZA 1LLWA 3F03K 4U28A 4LU0A 1F5ZA 1KFCA 4DQWA 5D05A 2A7RA 2ZZ7A 3BW4A 3W22A 1ZAHA 2YYTA 1XUZA 1GZGA 2Q3OA 3VFLA 2ZTJA 1WDWA 5EL1A 5I3GA 1EWEA 2FFCA 3NQ8A 3W7RA 3TDFA 4O0ZA 4X9SA 1OABA 5FF2A 3GDLA 3LRLA 5I3JA 2Y63A 1SZGA 5D38A 4LRTA 3NVTA 3NNTA 1AL7A 4MFEA 4KFNA 3LTPA 5KTLA 1P0NA 1SW0A 1CX9A 3NQCA 1P1XA 2QCHA 2V30A 4JTJA 3MHUA 4KFOA 2A21A 4JTLA 2DZSA 4YL2A 1F2JA 1YPIA 4UXDA 3W3OA 5K2ZA 5E1QA 2XFWA 3DFQA 1G7VA 5AYYA 4N9BA 4TR9A 3TSDA 2GJNA 3BARA 1IXOA 3WFAA 2Q8LA 1OX4A 3BW2A 3IVUA 5HWJA 1LRNA 4MLJA 4IQLA 3W9ZA 1Z48A 1VR6A 2QUUA 3CWOX 4Z1CA 3DU0A 4M6PA 1IIGA 1KM1A 2JBMA 1H60A 4UTLA 2F7FA 3KRUA 3FKRA 3BG3A 1H7WA 1TTPA 3LCGA 2ZRYA 3G1YA 2FIQA 3NQ6A 5D37A 5AHLA 2EPHA 2ISWA 2PRMA 2QAPA 2J24A 1F74A 1TQJA 1LYXA 5BRBA 3C56A 1B3OA 2ZRZA 4JTIA 3S1WA 1R47A 1VZWA 3MO7A 1FUYA 3AO0A 4ZQCA 1VHCA 3QSTA 3NPXA 3LCIA 4TX9A 1W5PA 3W7MA 4PTNA 5HWNA 5F4XA 1H7RA 4Y9AA 2F84A 1LTDA 1SR9A 2BLEA 3MP3A 1TJPA 4FNRA 3PG9A 1W5OA 1V7YA 1QNVA 4R53A 2ZZ2A 4UFKA 1LZOA 5DBTA 1FQ0A 2YFNA 3PSWA 3OVRA 4NUWA 2YX0A 4Y96A 4FIQA 3K30A 2OMAA 4H6KA 4YCPA 1JQXA 3TH6A 1XBXA 5CPMA 2YDAA 3NQ2A 4JN6A 3O07A 3HF3A 4ADTA 4PL1A 3NM3A 4O17A 1TIMA 3EB2A 1MEWA 3L66A 3QC3A 3TK7A 1MEHA 3G1VA 4LVAA 2VEMA 3LLDA 2QR6A 4XKYA 1BTMA 3G3MA 3M1ZA 2NUYA 5CZTA 4M6VA 1GG1A 3W7EA 4M19A 3T40A 3L67A 1XBVA 4JICA 3B05A 1N7KA 3UWUA 1F73A 1KFBA 2HMCA 4QSHA 1KA9F 4IMDA 3ABOA 3EKZA 2JGQA 1EP2A 1EIXA 1WQ5A 1L6SA 3E49A 3KOFA 3TMLA 4DPPA 3PUOA 5AFDA 2A1YA 3IIPA 4QNWA 5FESA 3W70A 2C16A 5HUOA 4UTMA 1A5SA 3BO9A 4MZYA 2YGYA 2X2GA 2E09A 1GQNA 2YYUA 3W7PA 3LI1A 4YLWA 3MI6A 3G22A 5CZ0A 3TFCA 1PS9A 3INPA 2NWRA 4UFJA 2ZRXA 4OWGA 3W72A 3CU2A 3UWVA 2ZTKA 1YTEA 1RD5A 4E2BA 3GNDA 2E5CA 4HPJA 2NWSA 1PHQA 1RPXA 3W2KA 1UUOA 4WY0A 2Q8ZA 1UUMA 3L5MA 2QCNA 3HO8A 3DFNA 3S5ZA 3N3MA 1QPQA 3LM7A 1FCQA 1VGAA 4GFSA 3NGJA 1J4EA 2H3DA 5EBUA 1ONRA 3GDKA 2YFOA 3ZWTA 5BMXA 2WQPA 2J9XA 3SGUA 2BX7A 1W3NA 2A85A 4PODA 3PVFA 3EEGA 4JYEA 3LX9A 4JYFA 4UTUA 4LVFA 1D3HA 2RH9A 5FEZA 5C54A 1H7NA 1L6YA 2V9DA 3ANYA 3GDTA 2OT0A 3O63A 2PRHA 4YMZA 4EIVA 2OX1A 1XL9A 2EHHA 5CG7A 8TIMA 4NJKA 1TMHA 3UWYA 1ZHAA 3BLIA 3WJSA 3USBA 4QM1A 4UUIA 3HGOA 3FLUA 5C2XA 5LSMA 3DZ1A 3PUEA 3W07A 3PF3A 5FEXA 3HB9A 4JS3A 3L68A 3M47A 4CQ9A 2WSRA 3BLFA 1LOQA 3I6RA 1TPC1 5HR7A 3GVGA 2FQIA 1BKSA 3P7YA 4A3UA 1FBAA 4N2YA 1P4CA 1OFBA 1FXQA 5KZMA 4K8HA 1DORA 4ZQMA 3FYPA 1KM4A 3SZ8A 3CIXA 1K8ZA 3MUXA 3SR7A 1ZFJA 4Z1DA 5D30A 2CZFA 1IF2A 2QDGA 3EX6A 2W79A 1OX6A 3R5EA 2QCEA 4WD0A 3KVJA 1DL3A 3LCLA 4GUIA 3TA6A 5K4ZA 3I7QA 3G1FA 1FWNA 1UBSA 2O7SA 3MI3A 4PC8A 3W1NA 3W7OA 2WOQA 1LM1A 1VHNA 1A5AA 4IOTA 4IXHA 1H5YA 4AWTA 2TMDA 2YW4A 4HT3A 4QIUA 1TPDA 2WNNA 2FPYA 2CZDA 5E93A 4ADSA 1SPQA 5AB3A 1ALDA 4UMBA 3Q2DA 2JKPA 1QOQA 4WXYA 3WK0A 1OX4B 2RFGA 1BEUA 4GBUA 1Z41A 4M7SA 4TMBA 2VFFA 1R2SA 1RQBA 3B8DA 2XN1A 2NX9A 3QSRA 3MJYA 4XTIA 2JKEA 3M44A 2WKJA 3QRHA 1QAPA 5AC6A 3G0XA 1KM3A 2WSQA 3M43A 1A5BA 3LCHA 3W88A 2YSWA 4ICNA 4O1DA 3B04A 1KFJA 4CQAA 3NQAA 3W1RA 1MZHA 4HKPA 3S1UA 3NQGA 4UNLA 4OU1A 4YWIA 3R89A 3M7WA 3MBDA 3TU9A 1QMLA 1WYIA 5FI8A 3C2FA 5AC8A 1SW3A 1W3TA 1KBIA 1KM2A 2DZVA 2C15A 5F1VA 4AHPA 2R91A 1JRBA 4NJIA 4JTKA 4AEOA 1HG3A 1BWKA 4EWND 4IGHA 3UPWA 2Y88A 3N34A 5D2VA 1TTQA 1H63A 1K3UA 5D04C 1PHWA 4AMAA 1MEIA 2WSYA 4K36A 5CPLA 2ZA2A 5I3FA 2D73A 5LNWA 5LNUA 1TRIA 2GQ8A 5EPDA 1PV8A 3S1VA 4DF1A 4O54A 4KWWA 4JXCA 1EEPA 1GVRA 2V2DA 4K6AA 3A9IA 2RDTA 4OHQA 1GVQA 2VXNA 3M6YA 3UD6A 4GXMA 1KBJA 2GPTA 5FEWA 3SSJA 4FNQA 3QEZA 3A23A 3UY8A 3TSMA 3IVSA 1W8SA 2NUWA 1VYRA 3W7LA 1SW7A 3KXQA 1K03A 5C5YA 1T99A 4JDBA 2C13A 3IIVA 4XKYB 2E6FA 2C19A 1UJPA 5IBXC 4WZHA 1H7PA 4BI6A 1OYBA 1A5CA 1H50A 4JEQA 2A6NA 3UQNA 3GZ3A 4ZMGA 5DCEA 3B0VC 2UV8G 2GVGA 1XCFA 2B4GA 1VYSX 5G2HA 3QPZA 3P84A 3WJYA 4MY1A 2NX1A 1QWGA 4UTTC 1B4KA 3O1NA 1TJRA 3CC1A 5EKYA 5BW6A 4IMEA 4JGDA 4QISA 3F4NA 1HL2A 3S42A 1I2QA 2TRSA 3GXPA 1NVMA 4JTTA 3U6WA 4NXSA 3LXCA 1LLZA 3TAOA 2C0AA 1QPOA 1PCWA 2HSAA 3W1XA 3LLFA 3UXDA 4XUGA 1OFOA 1B9BA 4MKNA 4UCGA 1QDSA 4I7VA 1IIHA 4U4MA 3DHDA 1U83A 1SU5A 2V2CA 4E2DA 3MWAA 1X1OA 3PBWA 5HINA 5AHFA 2E6AA 3PULA 3O8AA 4WY0B 2C18A 4HNTA 5U7SA 1FWSA 3QH2A 1DOSA 1LP6A 1XI3A 5I3HA 3P74A 4LVGA 5F2LA 5EA9A 3NL2A 3E96A 4IX2A 4MZ1A 3ZR4A 2DZXA 1YADA 4LS1A 4RZ5A 2EKCA 1DJNA 3KAOA 3CT7A 4PCFA 5HR6A 3MW7A 5DN1A 2A5HA 4TMCA 5G4WA 1YXYA 1WXJA 5G1YA 3A21A 3OVPA 4FXSA 1XDMA 3B03A 3PUDA 2Y85A 4FEZA 2WV8A 1EA0A 3WK1A 1QPRA 3THQA 2Z2UA 4O14A 4Z1BA 4AF0B 3GDRA 4N9CA 1W37A 4K37A 4LUIA 1GT8A 1VLIA 1YYAA 4IX0A 2OCZA 3BGJA 3UWQA 3GDMA 1DV7A 3TXVA 2YCEA 3DGRA 1JUEA 2GJLA 5AYXA 3HQ1A 4OQVA 2YZRA 1OK6A 4AHOA 5D09A 4MOZA 4C1LA 2QUVA 3SECA 2NV2A 4XBKA 1LRQA 1PIIA 1DKWA 3O6CA 1R30A 2BTMA 1VQTA 3NL6A 2JGYA 2HS8A 4O52A 2E68A 1OFEA 4O50A 1F6PA 5H91A 1YXDA 3TJLA 4XTDA 3W7HA 1AW5A 4UFLA 3KVMA 1Y0EA 1EPXA 3LTYA 5TIMA 1GOXA 1OYAA 2IQTA 4RK8A 1JCMP 3NPVA 4W9TA 3HPZA 3PB0A 1KM0A 3ZWSA 1G69A 1VC4A 2PRLA 4S2CA 3W7NA 5FEPA 2CLMA 3GIYA 1O4UA 3L21A 4JIPA 1ZAIA 2G5WA 2YW3A 4FIRA 3WK2A 2RKXA 1IGSA 2V81A 1ADOA 4R7JA 1GTEA 1N8FA 5EYWA 1Q6OA 3FJLA 1W5MA 3QJAA 4ORMA 4AAJA 4FO4A 1L9WA 4N4QA 4LC6A 5EMUA 5K3VA 2V82A 1W56A 4L4LA 2EF9A 3LCFA 4AB4A 2DU2A 5F2MA 3IIXA 3NAVA 1EUAA 1K7EA 1JJKA 1NEYA 4BFAA 2CLLA 4O53A 1FCUA 1HO1A 1QO5A 3RFAA 1T8XA 2NX3A 3WK3A 5FF7A 1FDZA 2QCMA 1VCFA 3PAJA 2NXIA 3LV5A 1H7XA 3OA3A 4PL2A 1S3HA 1WA3A 4JTHA 2Q3RA 4OT7A 3GB6A 3I7SA 1OF8A 4DF0A 3G1AA 3V75A 2H90A 2FLIA 4UFMA 1HTIA 1FCBA 3DH7A 2ALDA 3TE9A 5KITA 1LBLA 1SSGA 3NZRA 3P82A 4KKXA 4PEKA 4FNTA 2CLKA 2QCDB 2PCQA 3NQMA 3T4CA 3UXAA 4O12A 4LS2A 1KTNA 4DO4A 3UNDA 3GK0A 3P61A 2CW6A 2X1RA 3N19B 3W1AA 3OVQA 4JTEA 4JX5A 1GEQA 1ICPA 2ISSA 3DKLA 3L5LA 5MHBA 4QAIA 4NNBA 4O15A 4IPIA 3EKLA 2A4AA 5F4SA 3OIXA 1F05A 1H61A 5D33A 2J88A 4I9AA 2VFGA 1JCXA 2CWNA 3M0ZA 1KTCA 1O5KA 3W73A 1VCGA 2QCFA 3W23A 3C0JA 3STFA 3ZS4A 4H4IA 5J5RA 2QCLA 1SUXA 2CLFA 3KVKA 4NZFA 1K02A 5FF3A 4M6QA 4JX4A 2C1HA 1LOSA 4JTGA 1H7OA 2TYSA 2XN2A 4MYXA 1GYNA 4WX2A 5J5DA 4A2SA 1THFD 3W1QA 4MYAA 2J9YA 3W1UA 1NF0A 1J5TA 3UY7A 1DJQA 4ORIA 1ZALA 3R2GA 4AVFA 3HMJG 1AG1O 5C55A 5KMYA 3TAKA 3I65A 3PWAA 1Q6QA 4EF9A 3QQ0A 4TIMA 1ZENA 3CIWA 4CLMA 3S1XA 4LWWA 1XFBA 3UWZA 5D02A 3TXZA 2V2HA 2OJPA 4RR4A 4FF7A 4BR1A 1G4SA 1ME7A 3G1SA 1MSSA 1QCWA 3NL3A 1TSIA 2FPVA 4FX7A 4LY8A 1S5VA 2QCCA 1ME9A 3BG5A 3LB0A 2B7OA 3ATZA 1QR7A 3EXSA 1OJXA 1PCKA 4DF2A 3W7QA 1HFBA 4WUIA 3DBPA 1TPUA 4MPQA 5IBXA 5LHEA 3VKJA 1TPWA 3WJXA 5DELA 4QQ3A 1WBHA 3EWXA 3P5ZA 2VENA 3WJZA 3LCXA 5F2IA 3G8RA 4JTSA 3VNDA 3TSBA 5D2XA 1T0OA 3B0PA 4A29A 1TPB1 2LLEA 4UTTA 3TW6A 1OFDA 2C3ZA 4CCDA 2DJXA 4Q32A 3TKFA 4ZZ9A 2ABBA 2RDUA 1DQWA 4AF0A 2X16A 3W2UA 1I45A 5CSRA 1X6UA 3G0SA 3S0CA 5I3IA 4TU1A 1TPVA 3HOJA 2V0TA 2WNQA 1BWLA 3VE7A 1X1ZA 1AW2A 3ABRA 4UMCA 1RV8A 2J6XA 1KV8A 6TIMA 2H8XA 3W1LA 3W1TA 2NUXA 1I2RA 1XXXA 1QO2A 2VFIA 2CLHA 3IGUA 3GR8A 2QAFA 4K7VA 3M16A 4O8RA 2HTMA 1RVGA 1ZNNA 2RDWA 4Z08A 4DO5A 2P1FA 2ZFAA 2H3BA 2ZZ4A 1TREA 1NF7A 3A5VA 4DELA 3SIZA 1CW2A 4UTKA 3P67A 2R8WA 1FWRA 3W76A 1LCOA 1TO3A 1JCYA 3CWNA 5HMSA 3NA8A 2Y7DA 4RXGA 3GR7A 3LRMA 4ONVA 5LHFA 4PH6A 4JIQA 4JR5A 3EX2A 4UTWA 3P80A 1I2OA 1NFBA 3LGEA 4MFDA 2PURA 3SI9A 1K8YA 3W71A 5SWUA 4X2RA 1W1ZA 4B5NA 3TMQA 1MO0A 2Y61A 2FDSA 4NXKA 1U5JA 5AC7A 4Q4KA 2G97A 3W86A 2ZZ1A 1IXPA 3IIZA 2VELA 1YDVA 4JYDA 4MZ8A 4UFHA 4QJ1A 1WBJA 3EX1A 2E6YA 4UTJA 4XQ6A 4K7YA 3MHGA 4RX0A 1EB3A 2YXGA 3KRZA 4EVZA 3HPXA 1LORA 5F1UA 5KZEA 3W2JA 2ZA3A 5D2YA 2O7QA 2CU0A 3GAKA 1ZAJA 3EWZA 4BI5A 1G4EA 3BPWA 3DENA 1KM5A 4NZJA 1K8XA 5HJLA 2QCDA 1KFKA 2DJLA 2DORA 3EX4A 3R12A 1IXNA 1AMKA 2GVLA 3NQFA 1CI1A 3E9AA 4UC5A 5AN7A 3ATYA 1RR2A 2FB3A 1OX5A 4LV9A 4H3DA 3N2XA 1NAL1 3PBVA 3D0CA 2A7PA 2A2IA 2R14A 3DFOA 3LHWA 3RMJA 4QITA 4ZQRA 4GRSA 1OF6A 2ZCGA 1AL8A 2I9EA 4NU7A 3W7CA 3NEVA 3OG3A 3U8GA 4NX0A 4OV4A 4DBEA 5C6MA 1H1ZA 4FXRA 1H1YA 5BNKA 1TV7A 1GTHA 1R46A 3P60A 2TSYA 2QF7A 2ZRUA 5GVJA 3LRKA 1B4EA 2ZBTA 2V8ZA 2ZZ5A 3HJZA 4JNMA 4E0CA 4NVTA 4ZQPA 2DZUA 3LV6A 5I3KA 4Z0SA 3L0KA 4O1BA 1VH7A 4AHQA 1LDCA 3UZJA 3W74A 3O6YX 3TQ0A 3LCWA 4JTFA 3TQVA 3LHZA 3QMRA 4XZ9A 1W31A 1PVNA 3BGGA 5D03A 1ZCOA 4NJGA 4GJ1A 4Y6GA 1W3IA 4FNPA 3W7GA 3S9YA 1OFQA 5KZDA 4GUGA 3SW6A 3E0IA 3G18A 5LNVA 1TQXA 3C2OA 1VCVA 1XM3A 4X3ZA 1F76A 1LOLA 4AXKA 3S5NA 3UYCA 1L2UA 2DZWA 3DI0A 2WNZA 2Z1BA
chains in the Genus database with same CATH superfamily
1L8PA 4C6NA 3AZTA 1KXQA 3WMSA 3DKJA 3KBWA 4RXFA 3W2MA 1ZGDA 3H54A 1Z69A 3C2RA 5LA2A 5FJUA 5I03A 1EC7A 4E8GA 3E2QA 2X1SA 3BMVA 5HATA 3R8GA 1TB3A 2V5BA 5FL0A 2QW5A 3RYSA 1HVXA 3ARUA 2B7NA 4L80A 2AAMA 2FGLA 3EOLA 3UJ2A 1NIUA 1A47A 3WLJA 1OY0A 4RNIA 3KUMA 3AMGA 3BLEA 4G56A 5G2WA 3MV01 4IXXA 3UPBA 3CL8A 2GQAA 4NT0A 3P3BA 3CH0A 1JZ7A 3A9BA 1ZY9A 1TV3A 3W7DA 5G2IA 4OVXA 3FFSA 1XICA 4AY1A 4FK9A 3D3AA 1KBBA 3UETA 3PNUA 2X1UA 1TA3A 1HN1A 4CD5A 2FTWA 3NZGA 1YTKA 4JL1A 3A24A 5T26A 2CBIA 4UIOA 4J3VA 3TNBA 5HQMA 4U3CA 5HWMA 1GPWA 5A8QA 1SZFA 5A1AA 4KEZA 1KLZA 3QMSA 1ISXA 1XIJA 3AFBA 2CZEA 1BXBA 3WBXA 2X8RA 4M29A 1TE1A 3DFHA 4GC4A 4DM1A 2Z4GA 4RJEA 1Z44A 4H8UA 2HDJA 3E12A 2F9RA 2VX5A 3DECA 2Z1VA 3H7RA 1FVPA 3IEBA 2WLZA 3TYAA 3C8NA 4L9YA 1ZJIA 2VEGA 3W87A 1OFAA 3W37A 3S6TA 2F6UA 2P76A 5F2GA 3GX9A 4A2RA 3HG5A 2AKMA 1JEZA 4GLEA 5A8NA 1W54A 4WOQA 4QG8A 2ZA1A 5A8GA 2Z00A 1YHTA 1CPUA 1BTCA 5H2ZA 1ISWA 1Q6LA 2QVHA 4IG2B 1WAUA 1YXCA 1R2TA 3PPGA 3W6YA 2OYLA 2GOUA 1K7XA 3TIMA 1F6KA 1XD0A 2E1DA 4GCXA 4YTRA 1XKYA 1XLAA 1JCJA 3CHEA 2BS9A 3B0UX 3L0NA 4K39A 4D6JA 3E0VA 1N55A 4LTSA 4BEQA 2GQ3A 3HPSA 4AD2A 3ZT5A 4O10A 2P88A 3I3EA 1XLJA 2PP3A 5D4YA 2WCSA 4WDXA 2D23A 3H2AA 5I79A 4JD4A 3WX7A 1CGYA 2YB4A 4HIBA 2DT2A 2H8ZA 3VZZA 5C7VA 1G0CA 1V6XA 3AIEA 3CEPA 3QGVA 1PBGA 1TRDA 3CB8A 1RVKA 2PZNA 2XH2A 3L4YA 1YQ2A 3P62A 2VFHA 3C52A 4JTUA 3KX6A 8RUCA 3II1A 4Z1AA 3KHDA 2BZNA 4US5D 2BODX 4HSHA 4OECA 5FJPA 4LT9A 3EWUA 4ICCX 1SO4A 1FDJA 3UZZA 2YR1A 3PC0A 3KL3A 1ME8A 2QLYA 4HU4A 4OKDA 4DBWA 4O57A 5F4WA 1XSJA 1TKKA 4L5ZA 3SFKA 3IAQA 1FTXA 1QW8A 1FWFC 2UBPC 3CUHA 1FWTA 5D8ZA 4A3RA 2VDGA 2Z27A 4UR9A 2VMFA 5LIXX 1F8MA 1R0MA 4AH7A 1BSLA 2BP1A 5ABTA 2ZUVA 2OOGA 5DXXA 5A8MA 3APYA 3H22A 1YW1A 3WEMA 5K9DA 1XHGA 3KRSA 1OK4A 4DJEA 2G96A 2PWGA 1KW1A 3AXMA 3GNPA 1AODA 3WFZA 2OTDA 1W6TA 4KW2A 3EGJA 3CL7A 3PZQA 2A7NA 1ZBKA 1WX0A 2J8TA 3ZLHA 1KFEA 5JXQA 3GDBA 1XH2A 4ATLA 3V0UA 2YBVA 3IWPA 3TTOA 2QCGA 3UZ5A 3OHIA 3GKFA 2JIEA 3VOHA 2ZXQA 4M5PA 2OXNA 4NZCA 1EEXA 1IEVA 1QHPA 1G01A 4DYKA 1Q4NX 1RZMA 3O15A 2DT1A 3R10A 3HQPA 4ZO6A 3SY8A 4H9TA 4Y8FA 2PC8A 4OE7A 1LL6A 2YPIA 3ARPA 1E6XM 2J7BA 1R5YA 3UW6A 1FHUA 3GH5A 1E51A 2QZRA 5HULA 1O95A 1YTDA 2REQB 4LNYA 4ROQA 3L12A 4Q33A 1XYZA 3S5OA 1J2BA 4RLIA 3H8AA 2WC7A 2WVUA 2A3AA 4O18A 2WHLA 4XO7A 1CXHA 1DWGM 1M65A 4KFPA 1G1YA 1VPQA 3A64A 3HGJA 3TEVA 4WXZA 1G5AA 4H7ZA 2W0UA 3N18A 2RGLA 1TA3B 1YX1A 3S6DA 5HQEA 3QW4B 4RNHA 2FVKA 3ITYA 3AU2A 1VBHA 3FOKA 1CGTA 4JIIX 3H26A 3OZOA 2OZ3A 5L6UA 3VGGA 2F2KA 5I00A 3LM3A 2VCBA 1FH8A 3C2YA 1JPIA 5AHNA 4KWOA 4DEFA 4QE4A 4GYFA 2G41A 4P5UA 3LDVA 3LHYA 3QQ1A 1XLCA 1G67A 3FY1A 3NSXA 2A3CA 4NNCA 2AQOA 3TN6A 3L65A 1DWHM 1NSJA 4PUKA 3LQGA 4NASA 2YBUA 1UQZA 3H2FA 4GPNA 4WHBA 3VMOA 2VEIA 3G0UA 4L6DA 2YDSA 2Y7FA 2GOKA 3THCA 2ACRA 4F2BA 4LF2A 2ADAA 1P5BA 3HPFA 2KZHA 4O13A 3GXDA 4PA8A 1E72M 2BXVA 3O06A 3S2CA 3IGHX 3OBEA 4RL3A 2Q6ZA 4H9UA 2BHUA 3RM8A 4CD6A 3CUFA 1NY1A 2QMKA 1BG9A 1IXQA 1XISA 1HJQA 2GSHA 4JEJA 3PBUA 3BV4A 1EJVC 4LNCA 1ZQ5A 3CUZA 3U4AA 2XN0A 4TX8A 2C1GA 1QHZA 4LW7A 1GKRA 5I6SA 7REQA 3JR2A 3QW3A 3VNYA 2E77A 2Y6ZA 1UWTA 2PSNA 4KH2A 5LZLA 2VQTA 1BPLB 1JCNA 3N2MA 1GCYA 3H2EA 4ZOEA 1YDOA 1W9XA 1L0PA 3CM4A 1O94A 3E02A 2RJHA 3AYRA 3SJ3A 3BK0A 1GOKA 3I7RA 1B3WA 2WPBA 4M51A 4H7CA 3VOFA 1PX3A 4M3PA 4OV9A 1MW0A 1KGUA 4M82A 5HXMA 4JQ4A 3VOIA 3W75A 4UOQA 1F7BA 2PI6A 9XIAA 4DPQA 5AHIA 3FDKA 5A3HA 5I24A 3HTWA 3TWAA 1VJSA 1GOMA 1SO5A 1JUBA 4M56A 4OOUA 2CLOA 2BG5A 4EF8A 2R9RA 3FN9A 1JDDA 2HS6A 1HT6A 1J12A 1F07A 5FJTA 3N29A 3DERA 4CNPA 1J5SA 2WZTA 4MNLA 2VI0A 4EPEC 4LUJA 1REQA 1ML1A 4MNJA 3FAWA 2F6XA 2Z2AA 5JBDA 3LXBA 4UQ9A 5K9CA 2QPSA 2XZ9A 3M0YA 3IVTA 3SCQA 4QDWA 5JH2A 5TBOA 2FZDA 5C70A 4H9XA 4FLRA 4IMCA 1WKYA 2ZRVA 5EFDA 3W4RA 3G1RA 2OELA 2JE8A 1UP3A 3BE7A 4XZIA 1XIFA 5JBEA 1D7KA 4I7WA 4IPJA 4KPLA 1H1NA 3HBLA 4IT1A 4HZ7A 1UD6A 5FA5A 1JF5A 2AL2A 3QZ6A 1JQVA 3ARZA 1E9LA 2XIOA 3W1PA 4DUOA 5TQLA 2BVTA 2X7WA 1TV8A 3CAKA 3A3WA 3CQ0A 3U2OA 3C2VA 3NQEA 1A0DA 3DBNA 3VMPA 4AFYA 2WWDA 3TYDA 2X40A 1KQYA 3WCZA 2E1WA 3GVWA 3LXAA 1NWRA 2WZHA 1JCLA 2IPJA 2NZLA 3WJWA 2GL5A 2XVGA 3NPUA 4FALA 5LGZA 3VOJA 1M7PA 2WJZA 3AU6A 4DQWA 5D05A 1JPDX 3P14A 3BW4A 1ZAHA 4RDZA 2QV5A 1CENA 1JPKA 1PIGA 2FFCA 3NQ8A 1LF1A 1OABA 5I3JA 1DEDA 3VIJA 2BHZA 4JHMA 3HM7A 4I5RA 4LEFA 2I5QA 3UG4A 2WHMA 1M68A 4MFEA 4WKHA 3LTPA 3W02A 4H8VA 4QLLA 3MSDA 4QJ3B 1CX9A 1UR2A 2V30A 3PZNA 2A21A 2XFWA 4R88A 4M8UA 3QR3A 2GJNA 2J79A 4D1JA 4H9MA 4ZSUA 3WFAA 2OPJA 1WKDA 3UCCA 3IVUA 4JHOA 1H5VA 3RO6A 5HWJA 4MLJA 2ACSA 2J4GA 1XGEA 1MW1A 4IQLA 4G2DA 3KL0A 3BTNA 1FWDC 3DU0A 5M3WA 5JH1A 1IIGA 1RLDA 1KM1A 2WMIB 3UZYA 1HP4A 1H60A 3R4IA 3UA3A 5IHRA 2FZ9A 4PTVA 1IWAA 3LCGA 2FIQA 2PS2A 4HNOA 3KWSA 1UR1A 4I8YA 5CPSA 2IKJA 1SFSA 3L4TA 4JTIA 1NOWA 1AZ2A 4PGLA 1WP6A 3AO0A 4HZ8A 3PZTA 2DY3A 3QSTA 4ZENA 3W7MA 4LBSA 5HWNA 3PHAA 4ERGA 1QK0A 1H7RA 4K1GA 1E6QM 1LTDA 1SR9A 2WSKA 1TJPA 5G1MA 3FNDA 2O9RA 3PG9A 1ZUAX 1V7YA 1QNVA 3ENLA 3KOXA 2YLLA 4UFKA 1FQ0A 2YFNA 3KCOA 2E9MA 2ZUNA 3HV8A 4WSJA 1F4AA 2XFFA 4GZJA 1A5NC 2YDAA 4KRTA 4GK8A 5I06A 1X97A 2AAAA 3TVAA 5C9WA 1JAEA 7REQB 4ADTA 2QIIA 4H9ZA 3PANA 1UD5A 5A6KA 1D7FA 4PMYA 5CBIA 1RY0A 2CPUA 1HXJA 1LQAA 2NUYA 2J7FA 1BRLA 3UZWA 3L67A 1XBVA 1U5HA 3VGFA 1KA9F 4IMDA 1EA9C 4PFHA 2CEQA 3RN6A 1EP2A 3GS6A 3QVQA 4XSMA 3RM4A 1UWAA 5GNXA 1ZRQA 1FKXA 4F3HA 4A3QA 5BROA 3N17A 3TMLA 2Y2WA 4GISA 3O7UA 4QNWA 3IIPA 5LIUX 1W3JA 4Q8PA 4PMRA 4XIAA 3H23A 5BXPA 4MAVA 4HNLA 3N2OA 1UR9A 4GQQA 2YGYA 2YYUA 2ZUSA 4PBGA 4ZE5A 1AMYA 1PTGA 1U2YA 1O5QA 3U48A 3INPA 4F8XA 4UFJA 3W72A 1EGVA 1XRVA 1OCJA 4L7ZA 2P3EA 3MUCA 2NWSA 1P6CA 1PHQA 1RPXA 4J28A 4C6LA 2VR2A 3WF2A 2XHYA 1JL8A 1UJQA 1BQGA 3R0KA 3EWDA 4IQEA 1EJUC 4DZ5A 2NT0A 1NOFA 4ZXLA 1FCQA 4Z2LA 4W7UA 3NGJA 1MVYA 1UZ1A 3UWEA 3GDKA 2YFOA 1UD3A 1H11A 3WYZA 2DEPA 3C0SA 3ZWTA 1C8YA 1C91A 5CH9A 2P50A 2J9XA 3SGUA 1W3NA 4PODA 1C93A 1VBGA 4AG0A 2VX4A 2XYLA 4JYEA 4DWSA 3BQ6A 2RH9A 5FEZA 1L6YA 2AL2B 1E4IA 1XL9A 2ODOA 4J4KA 4ZTYA 3UWYA 4N0RA 4IP7A 1RJRA 3BLIA 4Y2WA 4Q4PA 3HFYA 2HISA 4PRRA 4XZLX 5C2XA 1NM9A 3DZ1A 1U1JA 5CZKA 3PF3A 2CYGA 3RHGA 4US5A 1DP0A 1MNZA 1LOQA 3I6RA 4TVCA 3GWQA 5B80A 1PKYA 3N25A 1F8IA 1P4CA 2YKKA 5KZMA 4K8HA 4D8ZA 4CCZA 2DH2A 1B30A 8XIMA 1E6ZA 1VFSA 4X0VA 3SZ8A 1TVPA 4JKMA 3IJ7A 2X42A 1XG3A 1OC6A 1IF2A 3EX6A 1DXIA 3ANUA 1VB9A 4HNCA 4A6GA 4HPGA 4WD0A 3KVJA 1RCOB 1DL3A 3LCLA 4GUIA 1RJQA 4KS0A 3GTHA 1FWNA 3GHRA 4TTUA 5HK4A 3FK4A 2EQDA 4AD3A 4DX3A 1PDZA 4R9OA 3LSCA 2ZC8A 3LGDA 2E9LA 4QIUA 3MU7A 3AXXA 1TPDA 2FPYA 3IANA 2DSKA 3URNA 5AB3A 3SUWA 4UMBA 3VCCA 1CGXA 4D6HA 1OZQA 4WXYA 1S39A 2G3NA 2RFGA 2VR5A 3T1GA 4TMBA 1DWIM 4IIEA 2W92A 3HV9A 1XFCA 4LYQA 4KF1A 2KX9A 4E5TA 3G0XA 1KM3A 2QQ6A 2ZE0A 4ICNA 4O1DA 1QBAA 3B04A 1V93A 3FX4A 4IL2A 2E40A 1MZHA 2V69A 3NQGA 2X2YA 3ARQA 4YWIA 3GHSA 2EJ1A 1AJZA 4KMQA 3M7WA 3MBDA 3PWGA 3ZSTA 2VL4A 3VDBA 3C2FA 1H09A 5AC8A 3IJ8A 1KBIA 3BQ5A 2QGHA 2C15A 1S38A 8XIAA 1E4MM 2Q71A 4IH3A 1JRBA 2VNCA 4JTKA 2PWEA 1HG3A 1MW2A 1BWKA 3EZ4A 1CNVA 4HA4A 3EDDA 4XO6A 4LSBA 5GNZA 4YTSA 2Y88A 1TTQA 3VGDA 1K3UA 8CGTA 1IT7A 2FDMA 3AYTA 3MPGA 4AMAA 2WSYA 3GW3A 3KBVA 4K36A 2HZGA 5CPLA 2D73A 3S2MA 5LNWA 5BWFA 1TRIA 5EPDA 2IW0A 3EPNA 3V1HA 4JXCA 1EEPA 1GVRA 4K6AA 1GVQA 2VXNA 2NQ5A 1I9CB 1WXYA 3GNOA 5FEWA 3TOPA 3QEZA 1YNPA 3TSMA 3IVSA 2O9TA 4PB4A 4AYGA 3WL1A 4CN6A 4YTUA 2HPIA 4XZNX 1I0DA 5C5YA 4JDBA 2C13A 2PDMA 3M0JA 3H7VA 2C19A 4MKVA 5IBXC 1TZ9A 1H7PA 1UG6A 3NURA 1BRLB 4QBXA 1N82A 4H6RA 3W6MA 4ZMGA 5DCEA 2JEQA 3VD7A 1UR3M 2EPOA 3B0VC 7ENLA 1VPYA 1GVIA 2Y5SA 2VJXA 2WHKA 2V5DA 3P84A 3L23A 1XIDA 2GGJA 3O1NA 3CC1A 1RXOB 1KXTA 5A6MA 3DOPA 1E43A 4QISA 4ZA0A 5FSEC 1J79A 4E4UA 3LXCA 2Q01A 1ENUA 1UOKA 5A95A 1KO0A 4GI4A 2XG9A 1B5TA 3QV7A 1ZJBA 4B3KA 5EMYA 3GVRA 3T07A 3UCQA 1IIHA 3WENA 1NP0A 1SU5A 1FHLA 2PDCA 1DOSA 3IS4A 3P74A 5EA9A 2HNHA 3DX5A 1O7AA 2J62A 3SRKA 4RZ5A 3EOEA 4JFSA 3ZIZA 3CT7A 4PCFA 1KBKA 2OODA 3N12A 3MW7A 3ZSSA 2A5HA 4EX4A 2WB5A 1WXJA 5G1YA 3LD5A 4DWSB 1ITUA 3VKCA 2WHJA 2WSPA 3CUGA 3BAIA 4QDPA 1ZJHA 1XLKA 1WE5A 4NY2A 2WQDA 4QLKA 2R82A 2PDBA 4NI3A 4B5TA 3WY1A 4MF4A 1Q6FA 2VC7A 1YYAA 2PTYA 1W32A 5E70A 2BXYA 3SQLA 5CPQA 3DGRA 2GJLA 5AYXA 2CLPA 4OQVA 5REQB 1OK6A 4AHOA 2ZX7A 3MS8A 3CPUA 1UW9A 3SECA 4H41A 3WQPA 1H4PA 1SGJA 1LRQA 1PIIA 3RCMA 3SGGA 4NYYA 1R30A 2GGIA 1XRTA 2HS8A 2E68A 1OFEA 3CHCA 3WNPA 4PMQA 1YXDA 3WNLA 1UYQA 1OYAA 4RK8A 2I56A 4A8NA 3AI0A 2R6OA 4G5DA 2QULA 3ITVA 3PB0A 1QNRA 1XYFA 1DJXA 3W7NA 3MO4A 1O4UA 2YW3A 4FIRA 3WK2A 2RKXA 1IGSA 2V81A 4GKTA 4AZIA 5EYWA 3FJLA 4J3ZA 1DJZA 1W56A 4X0NA 2EF9A 3GVVA 1EUAA 5A2CA 4O53A 4UWMA 1HO1A 1ADDA 3RFAA 1XLFA 1T8XA 2NX3A 1TWDA 1U33A 3VGHA 1VCFA 3NJ3A 4A8RA 4XUYA 2NXIA 1FHVA 1H7XA 2J6VA 1S3HA 3EEZA 2Q3RA 2PMQA 3DUGA 3AXHA 1FKWA 1HL8A 4DF0A 3R11A 5BU9A 3QN3A 2ICSA 3DH7A 3M07A 1F61A 5KITA 2FGZA 1MFVA 1SSGA 1VBRA 4PEKA 2CLKA 3UXAA 1F6YA 3ICJA 3WLRA 3P61A 2BOEX 2PTZA 3W1AA 3N4FA 3AJ7A 4MWAA 1PZ0A 1ICPA 1ZJAA 4AU0A 4ZGYA 5MHBA 3ZLFA 4QAIA 5XIAA 1Y5XA 4PUJA 4I9AA 3VNZA 3F4VA 3VM5A 3VDAA 1O5KA 3W23A 3ZS4A 1X39A 3UVIA 4PE8A 5JMUA 2QCLA 4LCQA 2CLFA 1IT0A 1K02A 4DXKA 5FF3A 3RILA 4H6QA 3B8WA 3WH7A 4JTGA 2TYSA 2OOFA 4K3ZA 4DZHA 5A2BA 1XPYA 4JQ1A 2FFIA 1XGZA 4KT2A 1ZCCA 3A47A 3EOUA 2J9YA 3W1UA 1NF0A 3UY7A 4AD4A 4BS0A 3R2GA 4GYJA 4U2ZA 3U5YA 3PWAA 1Q6QA 2VD9A 4JPGA 4LUSA 1OBAA 2PEVA 1XFBA 5BZAA 1W1TA 2Z1SA 3LQLA 5D02A 3GU2A 4RR4A 5FL1A 4FF7A 1G4SA 1ME7A 3G1SA 1MSSA 3VC6A 1A5KC 1ME9A 3LB0A 3EDJA 3EXSA 1QR7A 1PCKA 3UF9A 3O9NA 4WUIA 1TPUA 1UC5A 3VKJA 1UC4A 2KAUC 2FVLA 1XF0A 1W2PA 4C7FA 2BMBA 5F2IA 3G8RA 1DXEA 3JZUA 4XZHA 1EQPA 2LLEA 3OHMB 3RDKA 2C3ZA 2VUNA 3KLLA 3UEQA 4CCDA 1JPMA 1HL9A 3TKFA 4WGXA 3AS2A 5DEZA 4J40A 1DQWA 3AHYA 4AF0A 4LYKA 3PTKA 1JZ4A 4B2DA 3R0DA 4A05A 1A5LC 1TPVA 1DWFM 4D6EA 2WNQA 3RU8X 1BWLA 4CU7A 1YE4A 1DYSA 4NRRA 2NW0A 2XSAA 4UMCA 4Z2HA 5ABFA 3ABXA 5HNUA 1RSCA 1S2AA 1V6WA 3NQBA 1XRSA 3R79A 3HU7A 1RUSA 2BXZA 2QNEA 1Q6CA 1QO2A 3IGUA 4E2VA 4MNKA 3M16A 4O8RA 3ZR6A 3E2VA 3WD0A 4X2PA 1V0NA 1E0VA 4E2OA 5BU6A 4GC3A 2XH7A 4M6UA 3SIZA 4H1ZA 4PTWA 2ZXBA 4R7WA 4BQ5A 4UTKA 3W76A 2VX6A 3BAXA 4AVOA 3ES8A 2XIQA 2WYSA 3FXGA 3T4WA 2WANA 4PH6A 3H4WA 5DRIA 3KEHA 2CBVA 3W28A 1I2OA 4GY1A 3N9KA 4MFDA 3SI9A 1K8YA 2VM8A 1M9HA 4B5NA 3CB3A 1RHCA 4Q4KA 2G97A 2ZZ1A 3PWIA 3EA1A 1W9UA 1UR8A 3R43A 2WWCA 3P0WA 4JYDA 4MZ8A 3N2CA 1WZAA 2YL5A 1EFZA 2V6AA 3M0XA 3FVDA 1HJVA 1TZZA 2ONEA 2YXGA 3KRZA 5F1UA 1DIOA 2E3ZA 5D2YA 2IS7A 1XYAA 3M64A 4XAZA 5EU9A 2EEXA 3DENA 1C7TA 4NZJA 1K8XA 3EX4A 4RDYA 4C60A 5BOEA 3NQFA 3TN4A 1S5MA 2E8ZA 4GQGA 3ATYA 4AZBA 3ISIX 4LV9A 1NAL1 9XIMA 3CQHA 2A2IA 4DJFA 3DFOA 3RMJA 3IUHA 1RBLA 2ZUUA 4GRSA 3THUA 2I9EA 4NU7A 4IGNA 4NX0A 4IZGA 4I90A 5C6MA 5BNKA 1TV7A 3OGVA 1A4LA 1B4EA 2ZZ5A 4DJEC 2J7EA 2RAGA 4D9PA 1JI1A 4S39A 1Y5VA 3VX1A 3WDPP 5I3KA 4Z0SA 3L0KA 4AHQA 1OWQA 1X8CA 4MWAB 3W74A 4HYVA 3TQ0A 3TQVA 3BLPX 4J3UA 1W31A 1GVEA 1PVNA 3T05A 4Y6GA 2NVCA 1ADSA 4AXNA 4H00A 3WBAA 3CZ8A 2Z2BA 3FHAA 2PDJA 5BWAA 1E70M 4XSLA 1LG2A 2CIPA 1FHDA 5LNVA 1TQXA 3AS0A 1VCVA 3VGBA 2OQLA 2W62A 4FPSA 4EAMA 1ITXA 5C9RA 4UQEA 4UTIA 5EB8A 1HGWA 4ADUA 4O4WA 1ICSA 1XDLA 3CZEA 3W7JA 1QPNA 1MW3A 1VFTA 2P10A 1BYAA 3CPGA 3MMWA 4S3JA 3BXWA 1MI3A 2Z1KA 1OVDA 3AOFA 3KDNA 3AC0A 4LUSB 3FGCA 2VZTA 3ORWA 4CKQA 3KOWA 3M0HA 2C1IA 2GQ9A 5HPCA 3RNDA 3W7IA 4PUEA 1WPCA 7CGTA 1XLLA 1PL9A 3E6EA 3G1DA 1CLVA 3ONCA 2PGRA 1KLYA 5E0KA 3C61A 2EJAA 3C8FA 2YA1A 1SSDA 1YDNA 1JD7A 4V15A 1D3GA 2HWGA 4ICMA 4IMGA 3CQKA 2WKGA 2FJKA 2GYIA 1OYCA 2GDQA 4G1KA 1C29A 2DIJA 3MYOA 4C90A 2V3GA 3GY1A 1KXHA 1R3WA 5FJIA 2GDVA 2NQJA 3UBPC 3GXMA 4OUEA 2DZTA 4MY8A 3DFYA 3ZJ6A 4LXFA 3GU9A 1FX6A 2QPUA 2GJRA 1DIEA 3GAYA 1A0CA 4DBDA 3WFLA 3GG8A 4WEVX 2QJGA 3S5YA 4IICA 1W1IE 3WLMA 1QFEA 3HG4A 3RRAA 1RQHA 1M7OA 3NQVA 4GIYA 1CXIA 4QS5A 1W1A1 4I9MA 1GKPA 3GNXA 3S9IA 1J6PA 3MP4A 4F0KA 3ZFHA 3BZGA 2ATMA 2CLEA 3QV8A 1BGGA 1JZ2A 2Y89A 5ECUA 5IDIA 3KHJA 5EFFA 1RQEA 5D32A 1V3MA 2ZX9A 3C5QA 4KCWA 4GABA 2WK2A 2BHYA 3LTSA 2PFHA 4GI6A 4NX5A 3RX2A 5AHEA 3WIJA 4D71A 2FHCA 5KINA 1EP1A 3H21A 1E1EA 4B16A 4GG9A 1HJSA 2XU2A 4XWUA 5KEZA 1O60A 2ON3A 2CKSA 1ZP4A 2GUUA 3WQ6A 3RMEA 2W6RA 2DSUA 2EG8A 4FNUA 1LBFA 2J7CA 3ERPA 3LI0A 2PZ0A 2VQUA 3ABSA 2OSXA 1TUFA 3LHUA 4P7OA 4O11A 4S3EA 1GVFA 1C9WA 5HNNA 1LWHA 2NVDA 3GYEA 3WLLA 4JOMA 3ECQA 2XISA 3VOGA 3GC4A 1ZBVA 4AWSA 4ZFMA 3FKKA 3F4DA 1GZ1A 4DO6A 1GJUA 4KEVA 3RK8A 3RU6A 3N9RA 1GVSA 3ZMRA 3FDGA 4PFMA 2QS8A 3SURA 3OYXA 3KZPA 2VKZG 1Y8BA 3TR2A 3BSHA 4J2MA 1XC4A 3RITA 5K4XA 2RHGA 5AY7A 2Z6IA 2VYOA 1IE7C 4NQ1A 3QKEA 1QNPA 1M03A 5CZJA 1LT8A 4C65A 4O16A 4CEXC 3E2RA 1SFJA 1RP8A 2OWXA 3QMTA 3NR0A 5D2WA 3C2EA 3DHFA 3L2IA 1IHIA 3TC3A 1MXGA 4RZBA 1E73M 2VCAA 1PSCA 5DRCA 1VLWA 4PULA 5JU6A 4TX6A 4JY9A 3FJNA 2DT3A 5A6TC 2EG6A 7TAAA 1QOPA 3LBMA 3MZ2A 1PX4A 3QY8A 4JBRA 4JCLA 2VX7A 5HQLA 4GUFA 3BSGA 1G7UA 4HN4A 4HNUA 4JFWA 3WF4A 1UZ4A 4IJBA 2J47A 1KRMA 1W0MA 3AHVA 4DLMA 1TMLA 1QHOA 3TOYA 4NHVA 3I4KA 2BFGA 5HJXA 3FEQA 1BWVA 2D22A 4GIRA 2J9ZA 3N6HA 4F9DA 4WSKA 1CZ1A 3V0SA 2YA0A 3MMTA 2VEKA 5TNVA 5G5IA 3VE9A 4RV8A 1YIXA 3JUGA 3CBWA 3WUEA 3PPHA 4IISA 1VPXA 1DQXA 4O19A 3T2PA 1UP0A 1XLBA 3T55A 3L5AA 2VOTA 4RZ6A 1OG6A 3M5XA 2XH4A 1WUEA 1VD6A 3H2OA 3GC5A 4U2YA 1EXBA 3T0DA 2A6LA 4PUDA 1ODZA 4O1FA 2B31A 4PR4A 3CO4A 4ALDA 3FGCB 1B57A 4QRNA 4Z2KA 4BA0A 1I2NA 5KZ6A 1TYGA 2I5GA 4Q4MA 5DLCA 2Y70A 3VCRA 4O0QA 3AYVA 4UNKA 1BKHA 2Y4SA 1M3UA 4POCA 4XD3A 4U10A 1R85A 4KEUA 4CCCA 1VF8A 1S1RA 4TV6A 3M4HA 1EJXC 4GHRA 5C71A 4KERA 2VC9A 4XAGA 2HNEA 3LNPA 2IXUA 3KVLA 1T7LA 3SGZA 1F3EA 2O56A 4MKSA 5CKSA 2HBXA 1AH3A 1R2RA 1Z3NA 4GUHA 3IIOA 3STCA 4B9YA 4HOWA 3ZM8A 3PUGA 1W9BM 4WDUA 4YXGA 4NJJA 1FDYA 2V68A 1LLOA 4LY4A 3WKZA 2EBNA 3QF0A 2EPKX 1G6CA 3S2NA 1JCTA 3HG2A 2AGKA 3MANA 3U4FA 2G0WA 4TXEA 5FKYA 3TA9A 5JUVA 3VILA 5D8WA 4F0LA 2Z1BA 1AK5A 4C6DA 3NQDA 2NV9A 3N9SA 4AD1A 3O6DA 3P93A 2X30A 4E4PA 5AYIA 2DUXA 1O5XA 4GA8A 1UWIA 3BZJA 4B91A 3KM8A 1E4LA 1EX5A 3QHNA 3FS2A 3W1MA 2OYKA 2X7VA 2XVNA 1J2WA 4GVFA 1HKMA 4W8AA 1IV8A 4LCSA 4LRSA 1JR1A 2XINA 1AQHA 1M53A 3TYZA 4D1IA 5A6BD 4KCVA 5IM51 2HV5A 5CC3A 1DBTA 1VBUA 1DXFA 4OFCA 3CLMA 3GKAA 1VIWA 1GWJA 1I4NA 4JY8A 4FR6A 3CHVA 5CQ1A 4V33A 1GVYA 3BDKA 4MB4A 3TROA 3UNTA 1OADA 3ABZA 2V3DA 2PP1A 3AIBA 2NQZA 2Z6JA 2EG7A 2PDGA 3WMCA 1XD1A 2VFEA 3C6CA 3DYMA 3SY5A 2NXHA 2I1OA 2QMJA 1VFMA 1H62A 2XM2A 3GTXA 1XLDA 3Q45A 4S3FA 3V4BA 1Q45A 4ZB2A 3PZ9A 1CIUA 5I0DA 3HGRA 4YWSA 3SN4A 3AICA 5T8GA 4TOQA 1PPIA 3I68A 4P7RA 2ZQ0A 4ACZA 4FMVA 3KBSA 2PD9A 1UOZA 3OEXA 2JK2A 3ZZ1A 4E8CA 4S2BA 2OKOA 5FCZA 4B5SA 1QJWA 1WO2A 5ABHA 1UR0A 1WXZA 3A12A 2Y8VA 1YLVA 1Z89A 1CGVA 3W38A 3W2NA 2ZKMX 4J27A 3RLHA 4FAMA 2ACQA 4LH8A 3FEMA 4WOZA 1TUXA 2PD5A 1PKLA 3DFSA 2NQ9A 1BXCA 4LEQA 3RF9A 4I3GA 1GW9A 1JDAA 1KM6A 3QLLA 3QGAC 3KBNA 4BI7A 2WZEA 3SJNA 4X22A 3NZ1A 3E0LA 1VYPX 3WBYA 4DWSC 2DUAA 4DYJA 3UESA 3CUIA 4ZVJA 4L1WA 3AMLA 5LGXA 2BOFX 2Y24A 2QKFA 2PCEA 3MI2A 4GUJA 2XGIA 2EGZA 4N6FA 3MVTA 3FA4A 3DGBA 4YCOA 1AW1A 3CS2A 3MSRA 4L4MA 4UFIA 1X6LA 1R9YA 4NAFB 2ZXDA 3IUDA 3EXTA 3N2BA 1UMLA 1R3YA 5I77A 4G9PA 1K77A 1IEIA 4PTXA 4EP8C 5DBUA 2H6RA 4N9EA 3ZT7A 4N7QA 3JRKA 1UB3A 1UBPC 1CXEA 2VD8A 3C3NA 3BV7A 1B3ZA 1GPFA 3W2LA 2D3NA 4D8LA 3DC8A 4LVDA 4ZO9A 1WV2A 4I8DA 3KZSA 3UXKA 3WSUA 4I7UA 5LIKX 3NG3A 1VRDA 3NIYA 3W84A 3TW9A 4XAYA 1NU5A 1T96A 2VC6A 5E9XA 1JD9A 1TZ7A 1F5ZA 4QROA 3EWCA 2GGEA 4S3BA 1WDWA 3MA8A 5EL1A 4G8TA 1DIKA 3OTRA 3AHTA 1K6WA 4MADA 3T8LA 3XISA 4GNKB 5FF2A 2Y63A 2QUNA 4B90A 4LRTA 3NVTA 3OA5A 3MZNA 3CZKA 1R87A 1P0NA 3SCWA 4JIRA 4JTJA 4JTLA 4UXDA 5E1QA 4N9BA 5HMDA 4ZXOA 4XAPA 2AOSA 4TR9A 3GQYA 3BARA 6REQA 2OSYA 4FXFA 3HPAA 1FWJC 4UQBA 3BLDA 1RAKA 2JFEX 3W9ZA 3MSYA 1VR6A 1EOMA 4M6PA 3LZ5A 1QVBA 4I5UA 4HYRA 3BURA 1GOWA 2J7HA 2ZUWA 1EL3A 3FKRA 3KRUA 1H7WA 5J8LA 1CLKA 5CGTA 3SADA 1BF6A 1TTPA 5CSUA 2ZRYA 3G1YA 3NQ6A 2J24A 1F74A 3KP1A 1TQJA 4CD4A 1LYXA 4D8AA 3C56A 1P0BA 4P8WA 3BOXA 2ZRZA 4C6CA 4ZO8A 4DJDD 4GQBA 1OINA 1R86A 2D1ZA 4ZQCA 3NPXA 4PTNA 2W3ZA 4JTRA 4M80A 3ZJ7A 1TMQA 1J01A 1RY8A 2F84A 2BLEA 5I09A 6XIAA 3MP3A 1W5OA 1YE6A 4PMOA 4J3TA 1R9XA 4BQ2A 4GQ0A 3WBEA 6ENLA 2WMGA 2W5FA 1YNQA 2C0HA 1XINA 3K30A 3IK4A 4YCPA 4HB7A 1X96A 1QWKA 3NQ2A 1YBQA 3EBVA 3NEHA 4PUMA 4PL1A 1BYDA 4O17A 1XH0A 1KD0A 3L66A 1T41A 1D3CA 2QR6A 4P8VA 4Z2IA 3M1ZA 4IFKA 5CZTA 6A3HA 5T9CE 1N7KA 4RE3A 1F73A 1KFBA 5BRQA 2IQ0A 3TYUA 3VM7A 4IFRA 1EIXA 1K9EA 1BGAA 3RPMA 1FA2A 4ACZB 1X7IA 3VUPA 2Z25A 1L6SA 4DPPA 2HPMA 1M7XA 3T0TA 2C16A 3UZXA 4DNHA 4C6MA 4UTMA 3W29A 2OSWA 1V6YA 1VEMA 1BFNA 5FJRA 3K1GA 4PBFA 2X2GA 5H8MA 1GQNA 4P8UA 3TYCA 3LI1A 3K8LA 5GJMA 3GTIA 2EPNA 3G22A 1TWZA 2NWRA 3AHZA 1NFGA 3UWVA 3OZPA 3QGKC 3GNDA 3SUTA 3EDFA 4LBUA 4KWUA 3REQA 3CV1A 2NLYA 3FV9A 2Q8ZA 4OZOA 4F0MA 2ZWZA 3L5MA 3U3HA 3W00A 2QCNA 3BANA 3HO8A 3N3MA 3LM7A 1OT2A 3KDOA 1J0ZA 3BOLA 3OVGA 3CJPA 2H3DA 4BQ4A 4LAOA 4NILA 1ONRA 2Y8UA 1J0YA 1QPKA 2OLHA 3S3GA 5BMXA 3BAYA 1U1HA 3UJEA 4INFA 2A85A 4J3SA 3VXGA 1LL7A 3VAVA 4LVFA 4Y8EA 5C54A 1H7NA 1B0IA 2Y8KA 4DI9A 2V9DA 4YMZA 4EIVA 4Z2GA 2OT0A 2J7GA 8TIMA 4NJKA 1DQUA 3EPOA 2W4XA 4QM1A 3SFWA 3HGOA 2DV0A 3A13A 3WQOA 4GYPC 3HB9A 3D5HA 4E3VA 4CQ9A 1TPC1 1LQ0A 2FQIA 3FYYA 1BKSA 1E6NA 3PZIA 1EHAA 1VEOA 2SFPA 3LN3A 4MB1A 2E67A 3VUSA 1XPGA 4HA1A 1QRQA 1DORA 4ZQMA 1WDRA 1B54A 3CIXA 1V51A 1V08A 5C0QA 2QDGA 5MKGA 3D3FA 2W79A 1OX6A 3R5EA 2GVEA 2DT0A 3UR7A 1Q2RA 4W5ZA 4R85A 1UBSA 4PC8A 4MB5A 4AD5A 2XUCA 2WMKA 3W7OA 2WOQA 3SCSA 3TWBA 1YEYA 4LAKA 1RBAA 4IXHA 2ZIDA 3F7JA 2ZOXA 2TMDA 1EYEA 4HT3A 1IEXA 2YW4A 3MCNA 2WNNA 2CZDA 3WQWA 3A4WA 1F9CA 4RNFA 2JKPA 3BLOA 6REQB 2EXOA 3I6TA 1BEUA 1Z41A 3MKVA 4YN5A 4FA3A 3GBEA 2VEFA 1R2SA 3UFYA 1LWIA 1JAKA 3VD9A 3MJYA 1UMYA 9RUBA 2JKEA 1QAPA 3URAA 1WCGA 3W88A 3UCDA 2YSWA 4WCJA 1YMYA 4CQAA 3T6CA 3AMCA 4MWAC 3W1RA 1PUDA 2ASHA 4MM1A 1ZSXA 4F40A 2ZVIA 3CHFA 3H70A 3WF0A 4CU6A 2W61A 1HKIA 2I9UA 1SW3A 1W3TA 2QVNA 5F1VA 3LY0A 4AHPA 1C92A 1BG4A 2R91A 1MNSA 2XFRA 4AZCA 4PSRA 1U22A 3PJTA 4EWND 4JAWA 4IGHA 3N34A 1EKOA 3DHPA 4LAMA 4JQAA 5D04C 1PHWA 3TN5A 2VR4A 1EOKA 2GQ8A 1CGUA 2XSBA 1KR0A 3S1VA 4DF1A 2UY4A 4O54A 3L7RA 3QQWA 1TG7A 3IV8A 3A9IA 1M04A 3M6YA 1E1CA 1BAGA 1YBQB 2Z7GA 4GXMA 3RG6A 4ZTXA 2IXVA 3SSJA 3G5EA 5DQPA 1SM9A 3W7LA 1SW7A 3GM8A 1K03A 3IIVA 1UJPA 4H2CA 4IFKB 4BI6A 4IP5A 1GQKA 3BSMA 2A6NA 3GZ3A 1JYNA 4B15A 2QT3A 2GVGA 2OLAA 3LZ3A 1XCFA 4QX4A 5G2HA 1MYRA 3QPZA 3V16A 3WJYA 4MY1A 2PWFA 3KCLA 1QWGA 1B4KA 4JTAA 3FA3A 3KS6A 3ITXA 3KW3A 5LXEA 1TWIA 5BW6A 1Z8AA 4DN1A 1HL2A 1OGGA 4JTCA 2OQYA 1I2QA 4QP0A 3GXPA 3S42A 4B9ZA 2ZE3A 1IZCA 4QHRA 5A8OA 1LLZA 2JQXA 4EPDC 1Q7MA 2C0AA 1VEPA 1R3QA 2W27A 1PCWA 1DJWA 3W1XA 3LLFA 1BVZA 3GIPA 1WZMA 3D6NA 3TTEA 3UXDA 1OFOA 4UCGA 4I7VA 4I9TA 4U4MA 3DHDA 1U83A 4HCHA 5HINA 5AHFA 4EXAA 2E6AA 3S4TA 3AYSA 3REQB 3MSGA 3IPWA 3VKDA 3M6DA 1TWSA 5C9XA 3QH2A 1LP6A 1XI3A 1P48A 1Q63A 4LVGA 4UZSA 4MZ1A 2QJNA 4HTBA 1YADA 4LS1A 5M03A 3VINA 2ZXAA 2OO6A 2EKCA 3XINA 1WKEA 5DN1A 4WR3A 4TMCA 3A21A 5HAOA 1XDMA 3B4YA 4ZSTA 2X0YA 4FEZA 1QOXA 3WK1A 4L64A 4AEFA 3THQA 3BWWA 4PZVA 4O14A 2YCJA 4QEHA 1UPMB 2DFAA 1TV2A 1KGXA 3C0QA 3CZGA 1VLIA 2O4MA 4CD8A 1MDLA 1W1PA 5DT5A 4J3XA 5CXPA 3GDMA 1JUEA 4ZOCA 5D09A 3HZ3A 4WKFA 4XBKA 4DWDA 2HE5A 2HRWA 4O50A 1QXLA 3V0TA 3W01A 3R94A 5H91A 1J0JA 3TJLA 4XTDA 3W7HA 2PLCA 1Y0EA 1AQMA 4EKJA 2YL9A 2IMRA 1GOXA 2XGBA 1JCMP 3IJLA 2PRLA 3ALGA 1ITQA 5FEPA 4DJFC 1E0TA 3L21A 4DY1A 1OM0A 1PX8A 3T0BA 4IIGA 2XWDA 4R7JA 3C86A 3NWRA 4UOJA 1N8FA 4Q8NA 1Q6OA 3TR9A 3QJAA 4ZOBA 4ZB0A 4J3WA 2V82A 4L4LA 4AB4A 2DU2A 1QATA 3NAVA 1JJKA 1QO5A 3GTFA 2QCMA 4E8DA 3E2SA 3S46A 3OLIA 4FOJA 1EO5A 4C6EA 3W6LA 4BHYA 2JF6A 1KGWA 4JTHA 3KTSA 4PCSA 1VRXA 3I7SA 2O9OA 1KCKA 1WUFA 1FCBA 3RJYA 1IZKA 1LBLA 3GG1A 3DC0A 4FNTA 4PMZA 1YRRA 3NQMA 2EKGA 4O12A 2PTWA 2PU0A 1FWHC 3UNDA 1QU4A 2X1RA 5CLWA 3N19B 3PAOA 4JX5A 5EBAA 4AZCB 3IAPA 3DKLA 1R3VA 2ISSA 5A69A 4AX6A 2GDUA 3W53A 4O15A 1XCWA 4IPIA 3EKLA 2A4AA 5F4SA 3OIXA 5D33A 2VFGA 2CWNA 1B31A 4PMVA 1KTCA 1VCGA 3STFA 3CV2A 2BNJA 4DB7A 3FVMA 4YTQA 4AZGA 1AH0A 4IMAA 3QYSA 1SR0A 2I17A 1H7OA 3NOYA 3OQEA 1E1CB 5D9OA 2OQHA 2XN2A 2OU4A 4MYXA 1GYNA 4WX2A 5J5DA 4HTYA 4HCDA 4C5YA 4D6IA 3HJEA 4MYAA 4W89A 1E0XA 1DJQA 3M0IA 4ORIA 1ZALA 1S1PA 4LX4A 3LMYA 3VIHA 5C55A 2PDLA 4F9JA 3I65A 4EF9A 4OBSA 4TIMA 3FW6A 4A8LA 4CLMA 3S1XA 2DW6A 3UWZA 1V7AA 2V2HA 4Z17A 2FZMA 1H3GA 1JDFA 3QLDA 1QCWA 2QCCA 3S2LA 3BG5A 2Z24A 3W7QA 4PB5A 3DBPA 3PPFA 1E3XA 4MPQA 4X63A 1NWSA 3VIPA 2HK1A 2QIWA 4I9JA 6CGTA 2VENA 2WMHA 1E9YB 2ANUA 3UR5A 4JTSA 3PBGA 4A29A 3OU8A 4L6HA 4ML4A 3U7BA 4XKMA 3NO1A 3H6OA 1I60A 2HXTA 4XD4A 3G6LA 3WEOA 3GUGA 5HBFA 2DUZA 3AZSA 4KGLA 1XGDA 3W2UA 1I45A 2E8YA 3V7PA 3QY7A 1HJXA 4TU1A 2V0TA 3DDMA 3NDYA 3O3RA 1XH1A 4H04A 1GORA 1RV8A 2J6XA 3WLOA 2VGBA 1XRFA 3W1LA 1TX0A 5EMKA 1XXXA 2CITA 1ITCA 4EE9A 2W9MA 3P6LA 2YXOA 1RVGA 3IUIA 4DO5A 4CNTA 2P1FA 2H3BA 1ZP3A 2YL8A 1K9DA 3NYDA 5DMLA 3CWNA 5HMSA 2RJGA 3WDQA 2VRKA 3EOSA 2DQXA 3GR7A 3LRMA 4ONVA 5LHFA 4I6KA 5A6SA 1RALA 2G4FA 3EX2A 1KKRA 3LGEA 2PURA 5SWUA 4X2RA 3TMQA 2FDSA 3WQEA 1BD0A 2Z7KA 1IXPA 4HK5A 3IIZA 1NQKA 4D6GA 2RDXA 1WBJA 3EX1A 4YYFA 4UTJA 4P7LA 2HEJA 4K7YA 1EYWA 2XIMA 1NFPA 1JNDA 4EVZA 3GZAA 4W88A 3SB0A 1OD8A 3W2JA 5PTDA 2J77A 5E9AA 1OC5A 3H2NA 4BI5A 1G4EA 3BPWA 4IM4A 1KM5A 2WC4A 4A3HA 2QCDA 2VWSA 2DORA 1AMKA 2XDFA 1PKMA 3R58A 2F61A 4UC5A 1B3VA 1MWOA 4XISA 1PXGA 3B8UA 1X1NA 2G37A 1UA3A 3WNMA 4GACA 1AL8A 3AUJA 1CXFA 4AVNA 4QE1A 1Q6GA 1JXKA 4D6FA 3MB9A 1R38A 3PK7A 5XINA 5E6YA 4ATWA 4DBEA 4FXRA 2I5IA 3E1F1 1D2KA 2VDIA 1J0KA 5GVJA 4M81A 1E56A 2ZBTA 4ZB5A 3NZPA 3TJIA 2ZX8A 4GZEA 5E6ZA 1IQ8A 4E0CA 1TJ0A 4NVTA 4PMJA 1X98A 5XIMA 1Y65A 2DVUA 4O1BA 1LDCA 3UA4A 1FH7A 2D0GA 3LCWA 3WLNA 4JTFA 3LHZA 4LGXA 4JNZA 4ASTA 4MDPA 3BGGA 3UG3A 1W3IA 4FNPA 1TJ1A 1RK6A 1UD8A 3S9YA 2V38A 1B90A 2ZVRA 3C2OA 1XM3A 4X3ZA 1OIFA 3L4XA 3BMWA 3ARRA 1VENA 2XIBA 3S5NA 3UYCA 1L2UA 2Y5EA 1QASA 4KWVA 3DI0A 3B9NA 2D20A 3PFMA 3VMNA 3AWOA 1DVJA 1OFPA 3NL5A 2WMJA 3MP5A 3B97A 1SQ7A 4KBXA 1MFUA 1FWIC 3CASA 3O2LA 3WQGA 2ZRWA 3GNRA 5LNRA 2ABAA 1MQRA 1JZ6A 4HCLA 4FZIA 4US6A 4R27A 4KIEA 3GO2A 2CWXA 3D46A 2CHNA 4YPJA 2EAWA 4CN1A 3S47A 1ECQA 1XBZA 3COTA 2ISFA 1H2JA 2WBKA 2UY2A 3VZXA 4N9DA 3AISA 1TPFA 3PY2A 4J7RA 4LV4A 2F6KA 3KCJA 4A21A 4ENLA 3ID7A 2WO5A 4B5VA 3ZQ9A 3GXNA 3G3DA 1WZKA 4X61A 1ZTVA 4F4RA 1W91A 3PS7A 2Y7GA 4ZR8A 3C4UA 1C9DA 1UCWA 1H0IA 4UTWC 3MDWA 2ZUMA 3THAA 4YTTA 3LPFA 5BRPA 1KV5A 1V6VA 4DHGA 3G77A 2R1NA 1F3XA 3IGXA 3EYPA 2BSLA 2GK1A 3N4AA 3Q37A 4GO9A 4EANA 3S9ZA 4W93A 2XFYA 4GQRA 1F3WA 4X60A 3SRDA 5BCAA 1SFLA 1EH9A 3DG6A 1MZRA 4EPKA 4O8AA 4BK9A 4IQDA 1VFUA 2A3HA 3CO8A 4R34A 1VJZA 1HKWA 1OT1A 5CC5A 3OBKA 4ATDA 2YXXA 2R1MA 2VURA 3P81A 1UUQA 1GVOA 4CNOA 3FSUA 3ARYA 4P61A 3QZEA 4HNNA 3TX9A 3R0UA 3OZYA 3DCPA 1TVLA 1XP3A 4MVAA 1HO4A 5AOUA 3G6MA 4WY0F 2R94A 2R1LA 1TVNA 1UH4A 3ZJ8A 4CQ8A 4FNSA 5LIWX 1RCXB 3OLDA 1TWWA 1MUMA 2CZ5A 3BG9A 4IUOA 4UR7A 5EMMA 3P2VA 6TAAA 3B8IA 3TCEA 2NLIA 1YPFA 3ZR5A 1UKTA 4MJZA 1VJIA 3L0GA 5HMEA 2QUTA 4Q3MA 2HVNA 4TO8A 5ABEA 4RPQA 5AHMA 2PDIA 2VDHA 1L2QA 2CETA 3L9CA 4GGBA 2OB3A 1A80A 1TELA 1PB0A 4DRSA 1PDYA 3SBFA 4DXVA 1JULA 2AQVA 1OCNA 3KTXA 1HVQA 2BY1A 5FAJA 4IWWA 1K8CA 3AJXA 3EXRA 1RD6A 2ZDSA 2D0HA 3APTA 3GXTA 1GG0A 3EX3A 5CPOA 3POCA 4IL0A 1J93A 3DAQA 3IRDA 5DX7A 3GC2A 3IV3A 3FIGA 3UJSA 1W1VA 2G3IA 2BVWA 1EWDA 1E6PA 4TVDA 4HSNA 1UP2A 3M5ZA 5CLTA 4D2JA 4PEEA 3MVIA 1H51A 4EACA 1GJPA 2FPTA 1CXLA 1UKPA 2NXGA 3F2BA 4H19A 4QQUA 4QG9A 5AVNA 3BJSA 4FX6M 2C6QA 3OJGA 4PUWA 2GWNA 1M7JA 1P1MA 3ZT6A 5BOOA 2O92A 3G8EA 3TW7A 4WLCA 4GO8A 4AW7A 1KB3A 4J1OA 3CTLA 3K4WA 4YHGA 1KWKA 4A35A 1UD2A 2Z0IA 2PBOA 4Q4RA 1QI3A 3K1DA 1A3HA 3STEA 1LROA 4Q4SA 4NF7A 3OP2A 5EMJA 3S8HA 2WVVA 3VD3A 4XBSA 4N42A 2OZ0A 3WNNA 2QDDA 1REQB 1UD4A 1E5JA 2E25A 4CNSA 3KOYA 3T2QA 3VD5A 4LC8A 4NNAA 5RUBA 3QHMA 4PUNA 4NZ1A 4LYRA 3W85A 3NOEA 1P6WA 3T44A 1CCWB 4LOCA 1HX0A 1R6WA 1CB2A 2PDHA 1JYVA 3LBOA 4H9YA 1L6WA 4ZQNA 3N1AA 1IWBA 1X8FA 1CECA 3LHTA 2PDQA 1TCDA 1YDYA 1AZ1A 5HUPA 2GWGA 1IEWA 4HNVA 5DMNA 3P5YA 3TLQA 4RZ4A 4P2VA 1EBGA 5FD0A 3A6OA 2ZDRA 3PZVA 4FOKA 3PFRA 3A5FA 3WH6A 4AMCA 4RW5A 5DXYA 1O1HA 1H49A 3T78A 2XZ7A 4ZQOA 1HUVA 3MUAA 1P43A 1BSIA 4E38A 3PM6A 3YPIA 4M0XA 5HPOA 3GNNA 2YZ5A 3UGRA 2ZC1A 4WQ6A 2AMXA 4N6EA 3TC6A 3CHDA 2PC4A 3TN3A 2J74A 2GK1B 3TFXA 2FTPA 3DHUA 4IG2A 3UJRA 5HANA 2DQWA 3U57A 3TTSA 4DYEA 2QEZA 4GXWA 5TF0A 5DANA 1G9HA 1C8QA 4R33A 4YU1A 3SRHA 2ALRA 2QHAA 4QNEA 3N13A 3EWWA 2BOGX 2DZPA 4DVOA 4JQ2A 3SSZA 4H9VA 1UZDA 3MY9A 3NQ7A 4D6DA 2I7GA 3I3BA 4HSOA 3MQTA 4PTMA 1TTJA 2YIHA 3GSMA 4GH3A 1UZHA 1NP2A 4MLRA 1VFLA 4GD0A 2VOMA 4DBSA 2CHOA 4CQBA 4RDWA 4BWLA 5K7JA 2IKIA 2PLKA 1K7FA 4QG6A 1SO6A 3BAKA 4AWUA 1S2TA 1MDRA 3NM1A 1KRAC 3T0AA 1AVAA 1C3FA 3HA1A 4IIDA 4Y9NA 4KETA 3GXFA 1M6JA 3K2GA 3UXLA 3M5YA 4UCFA 4HHPA 2IKGA 4N02A 3M9YA 3G2GA 3IGSA 3H7UA 2PWHA 3K8MA 3NDOA 5HOSA 3WD4A 4WVXA 5IFTA 4BF9A 3M0VA 3PSVA 3V1PA 2YDQA 1FWAC 3G1XA 1FWWA 3HQOA 2YDRA 1Q7ZA 3QFEA 4UTFA 3C0LA 4RCXA 2OR2A 1CTNA 1OGBA 2NQLA 7TIMA 2PWUA 5DCBA 2BGNE 3A4AA 1PEZA 5BOFA 4NP7A 5C8BB 4W86A 2P53A 2B7QA 2YBTA 2Z29A 2QDHA 1Q8AA 3L2LA 5FJOA 5CBBA 2BASA 1QI0A 4G7EA 1QI5A 4V27A 2Z26A 1HIZA 3MMDA 2DDXA 5HNRA 4HU3A 3BH4A 1JDCA 1XUUA 1UIOA 3K46A 3VYLA 3QY6A 4AC1X 2VVSA 3UG5A 2I57A 4F0HA 3NPWA 4MGGA 1KBLA 2OFJA 1I1WA 1TPH1 2E4TA 1ICQA 2E0PA 3CMJA 5HNTA 3KBJA 1QNSA 1OHLA 1DWAM 3WF1A 2QJHA 3ARXA 3QYQA 4O4VA 3NFUA 4CCEA 3KWXA 3O16A 3R1ZA 3VIKA 3P8JA 3TJXA 2L5HA 2AMGA 3WMBA 4L1XA 1V3HA 3QZAA 3MYPA 3RLUA 3RAOA 5I2UA 4W8LA 5G4EA 3OBAA 2REQA 4AUBA 1R8LA 4F0RA 4S1FA 4MIMA 3JS3A 3STGA 4JDYA 3LBCA 4Y9OA 1UWSA 5AZ1A 3RR1A 1U1UA 1KTBA 2WVVB 3O05A 4GOAA 4NRSA 1F3TA 1ZB5A 3Q65A 4JHZA 3FYOA 4YS1A 5HJYA 4RKAA 1J10A 4FLOA 4WJEA 3EWYA 2ZZ6A 3FJ6A 2G4JA 2P0OA 3V5CA 3IJ6A 1S5TA 2VTFA 4GWEA 4C6FA 4KEMA 1WKFA 2ZX5A 1KFCA 1AD4A 2ZZ7A 1NDYA 4GFIA 3NXLA 3LPGA 3W22A 2C91A 1XUZA 3T09A 4CQCA 3VFLA 2Q3OA 1Z6KA 4RDVA 1QNQA 4HU0A 5I3GA 4H7VA 3T08A 4X9SA 3SQSA 5B7YA 3GDLA 3LRLA 1SZGA 1AD1A 5D38A 3NNTA 3ES7A 3VK5A 1AL7A 4KFNA 5KTLA 3SCRA 3B8VA 1SW0A 1I75A 4Q8MA 2QCHA 2CCRA 4KGJA 3MHUA 4KFOA 4GJJA 3VVGA 3N11A 1QNOA 3W3OA 1O5RA 5KETA 1US2A 3DFQA 1G7VA 1XYLA 3LS9A 1NWTA 4R9XA 1O66A 4UNIA 1IXOA 1OX4A 5GPRA 3CUXA 1EJWC 3SAZA 1Z9AA 4GYPA 5IOBA 2F2HA 4Q7BA 5LA1A 4Z1CA 4C91A 4IIFA 2FYMA 2ZX6A 3VIIA 1VKFA 1XYBA 4UTLA 2F7FA 3BG3A 1MQQA 1F4HA 1JPHA 4AISA 2PGEA 2EPHA 2QAPA 2WC3A 5BRBA 1B3OA 4IPPA 1HKJA 2CESA 3S1WA 1E71M 1R47A 3N6QA 1XQKA 2P8BA 1FUYA 1VHCA 3ITOA 4B5WA 4UZUA 1V79A 1HP5A 5F4XA 4JIHA 2YOCA 4Y9AA 1XLGA 1FRBA 4Q22A 1CLXA 2INFA 1SMAA 2TAAA 3H2CA 4LJ3A 3WD1A 4DWSD 5DBTA 1VAHA 3AIQA 2YX0A 4H01A