4JDBA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-005
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-005
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4jdbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jdbA01
3A23A 3E0IA 3LCHA 4UTUA 1BKSA 2VEKA 4MFEA 2CU0A 2Y7FA 1Z41A 5LNVA 2G96A 3LTYA 4RZ6A 5F4SA 4FO4A 3C2OA 1VCVA 3F4NA 1JCYA 3MI6A 5LHEA 2E68A 3DFTA 3KVJA 3NQAA 3TCEA 2C19A 1QPRA 2E5CA 4JDBA 2QCDB 1GJPA 3W7NA 1KFCA 3ABSA 4ZQCA 2FPVA 1DQWA 3T78A 3VCRA 3W2LA 1ICQA 1TPB1 4I7WA 5U4NA 2EPHA 3C4UA 2FB2A 3L21A 1EWDA 4ZQMA 2V30A 3NA8A 3RLVA 4Y96A 3C56A 1TJPA 1ADOA 4OE7A 2H3DA 4JY9A 1KM0A 3ABRA 4ADUA 3RF9A 4MY9A 2QDGA 4RK8A 1WQ5A 3M5YA 4NJGA 4NXKA 3B0UX 1WDWA 2J9XA 5C6MA 4MLJA 2WJZA 1W3NA 4S1FA 4TR9A 3G1HA 2ZZ3A 3DFSA 1J5TA 3W7PA 2H3BA 4JEQA 3IEBA 3DI0A 4MIMA 4MUZA 1KFKA 3W2JA 1OK6A 4WD0A 2QUUA 5CSRA 2P1FA 3WJXA 2C13A 3M47A 1BTMA 1WA3A 1OABA 3FKRA 4GXMA 1ME9A 3B4UA 4O19A 3EEGA 1W1ZA 5F2MA 1PIIA 3I7SA 3SFKA 3LTPA 1X1OA 4JTLA 2P10A 1DV7A 5IM51 1EP2A 2HS8A 3IIVA 3IGUA 2FB3A 4UFHA 5G5IA 5AHLA 6ALDA 4ORMA 2ZZ1A 3W71A 4FB7A 3CWNA 3W1TA 4MZ8A 3BK0A 1WAUA 1DBTA 2CZEA 2QAFA 3W75A 4PTNA 1YLVA 3BPWA 2QUTA 4WY0A 1G7UA 4EWND 3L68A 3HO8A 4I9AA 1P5BA 4O28A 1N55A 4O16A 3UWZA 4MYXA 1OX4B 1HO4A 3HGJA 3LLFA 3OVRA 3RK8A 1WX0A 1FWNA 1VH7A 5DY2A 2JGQA 2ATSA 1TQXA 1JCJA 1W8SA 3IIPA 4JDYA 2RDTA 3WJYA 3HPSA 2Y89A 2H8XA 2ZCGA 5TIMA 1OX6A 2XN1A 1A5BA 1TPH1 4MY1A 5D03A 3P7YA 3W7OA 1MO0A 3G3MA 1FDZA 1VLIA 4Z1BA 1JUEA 1EB3A 2CZDA 1LP6A 2CLLA 3W1XA 3MUXA 4LRTA 5HR6A 2F84A 4IMFA 2X30A 1QNVA 2RFGA 3M0ZA 3PUDA 4Q32A 3B05A 2OJPA 5CPMA 5LNWA 4PL2A 3L5LA 3PAJA 3FJLA 3ATYA 3W7RA 3D0CA 3E49A 5K3VA 4GFSA 3NQDA 4AF0B 1KA9F 4E0CA 4RZ4A 1FUYA 3EXTA 3B8DA 3GK0A 3MHFA 3GNDA 2NX1A 3GNNA 1QPNA 1A53A 3QZEA 3G22A 4I7VA 1TCDA 4MZYA 1TJRA 3UZJA 1QAPA 4JYFA 2GJNA 2V5BA 4YMZA 4RX0A 1W5QA 3P74A 5LNUA 3IIZA 2BTMA 4JX4A 2GQ9A 4CCCA 1I2PA 3UNDA 2A4AA 2Y61A 1U83A 3CM4A 2CLIA 5I3GA 4FNSA 1W56A 3QEZA 5KSWA 2XN0A 4FNQA 3GDMA 4GUFA 3LERA 2CW6A 2VFHA 4LVGA 4Z1DA 1TPDA 2E1DA 3SY5A 2V5LA 5I3IA 4LVBA 4WUIA 3G1SA 5MHBA 3NR0A 3W7DA 1NEYA 4M6PA 1VHCA 5EPDA 2V8ZA 2CWNA 3NM3A 4HKPA 3UWQA 4GC4A 1NVMA 3EX4A 4NJIA 3R5EA 3GDKA 1HUVA 4P61A 4UTKA 4AVFA 1PHQA 2WQPA 3KRZA 2AGKA 4UUIA 3T7VA 2DZUA 3NZRA 4UTTC 4HPJA 1R2RA 4OQVA 3WK0A 4JTTA 3EWXA 4JGDA 4DF0A 3PBUA 5U7SA 3TSDA 1EUNA 1VQTA 3M5XA 5KINA 1Q45A 3PC0A 4R53A 1GVRA 3SR7A 1ZFJA 3NQGA 4JD4A 2X2GA 3UWYA 3OA3A 2WOQA 1V7YA 5A8GA 3MBDA 3C52A 4MY8A 4E2DA 3UY8A 1LOSA 1AL8A 2QCGA 4IX0A 4JR5A 1VRDA 5AYZA 3S8HA 5FF4A 1AG1O 1ZHAA 1Q6LA 4IWWA 2WNZA 1L9WA 1H51A 4K8EA 1WV2A 3RFAA 1PCKA 1XL9A 2WSRA 2I9EA 2WKJA 2C6QA 3MP3A 1F7BA 3W88A 1Q3NA 4HPXA 3KXQA 1JCLA 4IMDA 2PRMA 3HGOA 1HG3A 3DGRA 4UTLA 1F05A 3B03A 1LBFA 1K03A 3KRSA 1TPWA 2QDHA 4XWUA 5K7JA 5KITA 3OBKA 1H60A 4BK9A 3W2NA 2X1UA 4WX2A 4ZVJA 2V2HA 1GYNA 3N2MA 4O17A 3UXAA 2X16A 5HWNA 1XUZA 8TIMA 2LLEA 3PB0A 2YDAA 4JTHA 4O1CA 1VCGA 5FF0A 1WBHA 4JIPA 2YSWA 3FS2A 5IBXA 3CPRA 3I7QA 3BW4A 4LV4A 3W85A 2E6DA 4WZHA 3EWZA 4IQLA 1P0KA 4MZ1A 2RHGA 3NQEA 2BSLA 2ZRZA 5F1VA 5E1QA 4HSNA 2R94A 4UTJA 3S5OA 2Z6IA 1H63A 1VYRA 3IRDA 4EVZA 5K9XA 2QCEA 2ZRXA 3HG2A 4FF7A 3TV8A 4QAIA 3VNDA 2V0TA 1KV5A 3SW6A 2GQAA 4PC8A 3MHUA 3N73A 1SO4A 5FI8A 3W07A 1D9EA 4S2CA 1GZGA 4U28A 3KRUA 5I3JA 2XN2A 1QWGA 1F73A 4AAJA 3VKJA 2A7NA 1I2RA 3W23A 1MEHA 3W72A 1ZAJA 1G69A 1PL9A 3GAYA 4DF1A 1FWRA 5H91A 3GXTA 1FDYA 3G1AA 2Y70A 1JUBA 1B57A 1C9DA 1RV8A 5F2LA 3UYCA 1AW5A 2AQWA 4QISA 3O6YX 4UMAA 4CNPA 1LCOA 2BX7A 3CTLA 1QO2A 3ZWTA 1GOXA 2C0AA 4JX6A 1L6SA 3W1QA 4RJEA 5DCEA 3HOJA 1JRCA 2VEMA 3S5ZA 2FPYA 3KVKA 4EOUA 1I2QA 3QQ0A 3CEPA 1H62A 1VZWA 3P60A 3KOFA 3UD6A 4ALDA 4M5PA 4K6AA 2YPIA 4OV9A 3TR2A 3RU6A 3QQ1A 3BW3A 1W0MA 5FF3A 3Q2DA 3UWUA 3NZ1A 4WY0F 4Z1CA 2NV2A 2VEPA 3CLMA 3TFXA 3LCWA 4LT9A 1JQVA 1I4NA 2ZZ5A 1SZNA 1H7RA 3QJAA 2YFOA 1WOAA 3W7JA 4CNNA 3OIXA 5LGXA 3TKFA 4ZQRA 1HTIA 3PR2A 1ZAIA 5D2WA 2DORA 3FFSA 1RR2A 3T44A 3NQ7A 3TROA 4B5NA 2PURA 3C2VA 3CC1A 3ELFA 4IMGA 2V9DA 3W7GA 1YDOA 3SIZA 1ALDA 3EX6A 2TYSA 1VR6A 1TB3A 3O07A 2RH9A 4CQ8A 1OFEA 4LVAA 4OBTA 2ZRVA 2F7FA 4JTIA 3CU2A 3T40A 3E02A 1G4SA 1A5SA 3UQNA 3MWAA 5D05A 2ZA3A 2X1TA 3STEA 4UTWA 2DZTA 4AB4A 2Z0IA 3FKKA 3IIOA 3DZ1A 2PC4A 1IXQA 4IXHA 4BR1A 1OYBA 3CIWA 4JTKA 1B3OA 3CT7A 2D73A 1ZENA 5FF2A 4TMBA 3ZR4A 4OGZA 3QMTA 3M1ZA 3L2IA 3I7RA 3PSWA 5DN1A 3O06A 5BRBA 1TTQA 3TIMA 3GB6A 4UTWC 1TO3A 3QF0A 2ISVA 2ZTKA 3DFNA 2V2CA 1A5AA 3S1UA 2DP3A 4K36A 1CW2A 5FEXA 5G2HA 5G2IA 3EXSA 3LCIA 4X22A 4BWLA 5FEWA 3TA6A 4O4WA 3I68A 2A6LA 3NPWA 3EX3A 1XUUA 3A21A 1FCUA 3PVFA 1PE1A 5HNRA 1T96A 4MOZA 4O52A 5K4XA 3FEMA 3TFCA 1JVNA 1BWKA 5G1TA 2QAPA 1AW2A 3G0XA 4QJ1A 1IF2A 2ZFAA 5F1UA 3E9AA 4M19A 1UUOA 3TW7A 4MYAA 1N8FA 1ICPA 1YXDA 2FDSA 1W37A 5L6UA 4DO4A 3AJXA 5D09A 2AAMA 2QCCA 5AC8A 4TX9A 2NUYA 2QCHA 4TU1A 1Q6QA 2NUXA 3VI2A 4POCA 1K8XA 4NZJA 3F03K 3E96A 3KVLA 1AW1A 1JCXA 1GVQA 3NYZA 3LBCA 3L67A 2C16A 4FX7A 5CPNA 5D02A 2FTPA 2CFFA 2PRLA 1TRDA 3W87A 1DL3A 4FEZA 2G97A 4YWIA 1M5WA 4O13A 4ICNA 3U2OA 1SW3A 4A2SA 4EF8A 2YYUA 1TTPA 1IIGA 5F2IA 3C6CA 1L6WA 1EWEA 5K9DA 4LUJA 4LRSA 2BLEA 1LRNA 1OX5A 4Y90A 5LNSA 3WJSA 2Z6JA 2CZFA 4UIOA 2Y62A 3O1NA 4JX5A 3FLUA 3W1NA 1OFQA 4JTSA 1FWWA 2B7NA 3BVJA 1EEPA 2VC6A 1XFBA 1OX4A 3H53A 2O7QA 1TPVA 2GJLA 1T8XA 2NXIA 4ZL1A 3C3NA 3LXAA 4CNOA 2DZPA 4FNPA 2E6AA 1DJQA 1K8YA 3G24A 4N4QA 1YDVA 4LS0A 2A21A 1R46A 1KBJA 4EF9A 5AHFA 5LHFA 1WOBA 4UTMA 3SECA 2QJHA 3PG9A 4UR8A 5G1YA 3NM1A 2TPSA 1VHNA 1KV8A 3QMSA 1O60A 3P8IA 1TPC1 2DZWA 3VE7A 1FY6A 3W6YA 4LVFA 5KZMA 1YYAA 3W1RA 2A7PA 3A5FA 2DZVA 2CLKA 1SR9A 3W7HA 4NJKA 3TSMA 1DJNA 4OU1A 1P0NA 3ANYA 1R2SA 3GXNA 3YPIA 3RLUA 4AF0A 4DO5A 1V5XA 3PBWA 3TDFA 1X1ZA 2VFIA 3PBYA 4NXSA 2DU2A 4ADTA 1EPXA 1QO5A 2H6RA 5GVJA 4PL1A 3QYQA 1LBLA 3PG8A 2VOMA 2ALDA 1RD5A 5C5YA 1LM1A 5CSSA 3KAOA 2WNNA 4PCFA 4AH7A 2VEIA 3OVQA 3L66A 3BARA 5J5DA 3L9CA 4GWEA 4KFPA 3SGZA 3EKLA 5CZ0A 1FCBA 3NPUA 4M7TA 4DBDA 1NAL1 4UFKA 1FXPA 4KFOA 4O1BA 1VLWA 3W7IA 1GG1A 3P61A 3P84A 2YW4A 3ATZA 1VYSX 3WJWA 4K8HA 2A1YA 1JCMP 4HNVA 4GE8A 5G2WA 3I6RA 2VFFA 4ML9A 2I1OA 3LHYA 4BI6A 1UBSA 5AN7A 3R2GA 1FBAA 4WOZA 4RXGA 1KFBA 1XBYA 2GQ8A 5AHIA 4LV9A 5CKSA 2NXGA 4UNLA 4O12A 5FEZA 1KBIA 4O0KA 3PULA 3S5NA 3LTSA 4K7VA 3GIYA 3TQVA 3FOKA 1P1XA 3TAOA 3E12A 1H7WA 1YXYA 3DFPA 3HQ1A 4UNKA 3SGUA 5ABTA 5DELA 1SZFA 3BO9A 5J5RA 2CLFA 5EMUA 3QW4B 1UJPA 4N4PA 2VFGA 1G4TA 4NNCA 2DZSA 3IGSA 3NQ6A 2PE4A 1OHLA 5EYWA 4GUJA 4Z1AA 3DFQA 4AWTA 2J9ZA 1G6CA 2Z1BA 3S0CA 3NXFA 1CI1A 3LRMA 1Y0EA 4X9SA 4NNAA 1TMHA 3TMQA 1XM3A 1MXSA 3TQKA 4N2YA 3MO7A 1SFLA 1B9BA 1S5VA 1MSSA 3N9SA 4UFMA 2HTMA 3GVGA 2GVGA 4WOQA 3GYEA 1GVFA 4IPJA 3LHTA 1W3TA 2J9YA 6TIMA 4UTHA 4XTDA 3O6CA 3H55A 4HNTA 3HPZA 4GUHA 4NX0A 4NJHA 2ZRWA 3I65A 2ZTJA 3NL3A 7TIMA 4U4MA 1SUXA 4N9BA 4CLMA 1GTHA 1QR7A 1U5JA 4CCEA 2Y88A 2YR1A 3LLDA 1LROA 3B0VC 1JCNA 1LDCA 3TW6A 3TNOA 3F1QA 1VC4A 2J6XA 1GVOA 4IX2A 2NUWA 3EX2A 1ICSA 2YX0A 4UR7A 5AHNA 3BGGA 1UB3A 2BWGA 4UFLA 4YCOA 1FDJA 1YDNA 3W83A 1DHPA 4XKYB 1X6UA 3ABOA 1KM5A 4IPIA 3M7WA 2HSAA 2V81A 5HJLA 3LDVA 1FCQA 1F6KA 2TRSA 4WXZA 3TAKA 2WV8A 3LCXA 3LM7A 2E6FA 1TTJA 5AC6A 1EUAA 4DQWA 4H4IA 1W3IA 4A3UA 1KW1A 2Q3RA 4DPPA 4Y8FA 3ZS4A 4LNYA 5DBTA 4JICA 3WK1A 5F2GA 4CQAA 1HL2A 4BFAA 3HIJA 5C54A 5SWUA 2WSQA 4K38A 1F74A 1SPQA 4G1KA 1AMKA 3P8JA 4O15A 3LV5A 4JXCA 5CPLA 1EIXA 2G95A 3P67A 3EB2A 2EF9A 3LXBA 3TU9A 1Z48A 3M41A 3PB2A 4AHOA 3CWOX 3KFTA 5CG7A 4X2RA 1B4KA 1TYGA 4DXVA 1E51A 3T4CA 4AMAA 4E2BA 2VKZG 4KWVA 4O4VA 1JQXA 4JS3A 1F5ZA 2B0MA 5K2ZA 4HHPA 3NPXA 2JKPA 1DORA 5LZLA 1YADA 4PEKA 3A22A 2E09A 4AWSA 1G4EA 3JRKA 2VELA 1OYCA 4XZ9A 1XDLA 3M5ZA 3S1VA 2NWSA 3UWVA 5IBXC 4O50A 4S2BA 1GVSA 4DBEA 1X7FA 2QEZA 1OK4A 3LBMA 2NZLA 2ZA1A 3OG3A 4UXDA 1GPWA 2ZZ2A 4IUOA 3NQ2A 1TV5A 3DU0A 3GDTA 4PODA 3C0JA 1RQHA 1VGAA 3S6DA 4H6KA 4IXXA 5LNRA 1T99A 1P4CA 2ZZ4A 1OFRA 3SSJA 3ABQA 5AHMA 4JYEA 3THQA 3W73A 4ZQOA 5L9FA 2Y7GA 1H7PA 3NDOA 1KM1A 3GKAA 3Q94A 5G4WA 5HINA 2BZNA 3BG5A 5HQEA 4XBKA 3TH6A 4MJMA 2QCLA 4K39A 1OFBA 2WSYA 3IVTA 4X3ZA 5DBUA 5EA9A 1LTDA 2E5DA 2FIQA 4L4MA 5HWMA 4A2RA 3W2MA 2Q8LA 3O8AA 4M6VA 4FIRA 5DXYA 3W7LA 4DPQA 4CCDA 3C2EA 4DO6A 4JTUA 1XBVA 4RZ5A 2C18A 2HMCA 3PUEA 2B7OA 5CGQA 3WK2A 4MJZA 1QCWA 3G1YA 3QH2A 1LZOA 4O10A 2QUVA 3G1VA 1LORA 3WJZA 1H7XA 2A0NA 1VYPX 3STGA 3W9ZA 1YTEA 2PCQA 3C61A 5H2ZA 1THFD 4MPQA 2ZDRA 4QM1A 2GPTA 4EIVA 2Y6ZA 4QNEA 1YXCA 3P5ZA 3NL2A 3DH7A 3W1PA 1DQXA 4TMCA 3ZFHA 4LUIA 4OV4A 1ML1A 5AYYA 1M7OA 4UFJA 3HGSA 1O5KA 3OEXA 4LW7A 1XXXA 2XFWA 3CB8A 1QDSA 3S1WA 2DJXA 5E0KA 2VFDA 3MW7A 4MLRA 5TQLA 4O1AA 3BG3A 2GVJA 1H5YA 1O5XA 2RDUA 4QIUA 1CX9A 4N9CA 3G1DA 4XQ6A 1KM6A 3STFA 2C3ZA 4OWGA 1JULA 3BLEA 4HN4A 4GUIA 2QCNA 3CIXA 4GNJA 3PBVA 3UZ5A 3INPA 4LTSA 5DY3A 4YXGA 3W1UA 1OFDA 1JR1A 3QPZA 4RKAA 2RDWA 2JBMA 1RPXA 3GX9A 3TJXA 1OFAA 1SZEA 1OF8A 1QOQA 3CQ0A 4NVTA 3MP4A 4UCGA 1TTIA 3HG4A 2DJLA 2NWRA 3L5MA 5BMXA 5I3HA 1ZCOA 4OT7A 1KTCA 5AFDA 1MEWA 3N9RA 5D2VA 3B06A 1FXQA 4Z08A 1J2WA 1M6JA 4O1DA 4R7JA 1K7XA 3LOTA 4ZZ9A 1S3HA 3BLIA 5G4EA 4PFMA 2VENA 4A22A 3LCFA 1FWTA 5DXXA 3O6DA 1TREA 3IVUA 3JR2A 2VXNA 5D2TA 3W1LA 1OF6A 3HPXA 4GJ1A 4YLWA 1PHWA 5AB3A 1GYLA 1TPEA 3O15A 1W5NA 4BWLC 1YPIA 3PSVA 1F2JA 3NO5A 3A24A 3MYPA 4FNUA 2J88A 5I3FA 5KMYA 3MMTA 3PY2A 1TQJA 5HUPA 4XTIA 3DKJA 4JNMA 1PVNA 3SJ3A 3G0UA 2YZRA 5F4WA 4KFNA 4Q33A 5AC7A 4ZQPA 4HSOA 3IIXA 3BLFA 3C8FA 2NV1A 4MKNA 4R33A 2Y7EA 1OVDA 3EX1A 4HIBA 3QW3A 3KVMA 1PV8A 4A29A 1WXJA 3O63A 1K7EA 3F4WA 1JUKA 5BW6A 3G1FA 3BV4A 5EKYA 3OHIA 3P62A 4ORIA 1LLWA 2RKXA 1LRQA 3QFEA 3TK7A 3O05A 3MP5A 5EY5A 2OX1A 3Q58A 3R8RA 3FYPA 3DHFA 3LRKA 4FX8A 3W7KA 1UCWA 3RMJA 3NQVA 1RQEA 5AOUA 2J27A 3HG5A 4M7SA 1KLZA 2ATMA 3LV6A 4OHQA 3PM6A 1F6PA 3PWAA 3UPWA 3M5VA 2R91A 3W3OA 1KFEA 1RZMA 3W2KA 3V1PA 5D04C 4J9JA 3CEUA 4PA8A 3TC7A 4AHQA 1EP1A 1XDMA 4JN6A 3W84A 1ME7A 4Y6GA 2B7QA 1GG0A 3GKFA 1C29A 3BW2A 1FCVA 4N6EA 5AHEA 4TIMA 3QM3A 4RR4A 3DFOA 1K8ZA 3BGJA 4ZMGA 2ZZ6A 4N6FA 1KFLA 3EKZA 3LHUA 3NAVA 1TSIA 4Z0JA 3TMLA 3R13A 2ZQ0A 5FEPA 3LGEA 3SZ8A 3H54A 3ZWSA 3SI9A 1G67A 1Z44A 3L65A 4HNNA 4W9TA 1W5MA 1GQNA 1JJKA 1IIHA 1PCWA 5D33A 4N9DA 2B4GA 3TUUA 3TQ0A 3LB0A 4AXKA 3GR7A 1ZNNA 2QCFA 5K9CA 3FJ6A 1Q6OA 1Q6RA 2EKCA 4UMBA 3NQMA 3DBPA 3W1MA 1I2NA 2R8WA 4O18A 3HGRA 4RXFA 4FX6M 2CLHA 4AHPA 4LWWA 4QITA 3NL6A 2FFCA 5D37A 5D30A 3VE9A 1A50A 2ZRYA 3A5VA 4PH6A 3W7EA 3W74A 1SW0A 2E5BA 1H7NA 1RQBA 2A85A 2CLEA 2TSYA 2FQIA 1KLYA 3UWWA 2YW3A 4RLIA 4O54A 2A5HA 4L4LA 4JTEA 3TX9A 5CZSA 3L5AA 4GRSA 2HS6A 3NL5A 1NSJA 1R2TA 3G1XA 3S1XA 3N34A 4GUGA 4JTGA 4IOTA 2E6YA 1LOQA 1ZJIA 2YCEA 5E93A 4O57A 1VPXA 2WO5A 4NU7A 1I8JA 3C2FA 4ADSA 1YTDA 3DKLA 2ISSA 1WYIA 2V2DA 1ZALA 5LKYA 3G3DA 2QR6A 2ABAA 1SU5A 2YXGA 2WNQA 3CHVA 4WY0B 3DENA 3W70A 4NQ1A 3U8GA 4UMCA 1EX5A 4UTIA 1HO1A 3DAQA 4ONVA 1OG0A 1LBMA 1IGSA 1ZY9A 3KHJA 2A6NA 5KZEA 1KM3A 2I14A 3DI1A 3UXDA 2QJGA 2Y63A 2BXVA 3N3MA 3IV3A 4LY8A 2QCMA 2QJIA 3KX6A 1WBJA 3QC3A 4YL2A 1KM4A 2Y85A 4XKYA 3MJYA 5F4XA 3UPBA 4HNUA 2EHHA 3EWBX 3LXCA 3TXVA 2EAWA 2ISWA 4LS1A 1FWSA 3M43A 4JIQA 4LC6A 4I7UA 1SSGA 3QMRA 3W2UA 3NEVA 1K02A 4Y9AA 1XKYA 5DCDA 2E77A 1H7OA 4NUWA 3S42A 2FJKA 1LOLA 3O16A 3TJLA 4IMCA 3N14A 3LCGA 3FYOA 3DHDA 1L6YA 1GT8A 3LI1A 3GDLA 1PS9A 1OYAA 1R47A 3B0PA 1H50A 2GUUA 5DCBA 1Z42A 5TBOA 1LRTA 4JYDA 3PF3A 3R12A 1C8VA 1VCFA 1O4UA 3JS3A 3QPYA 4UTTA 4FXSA 3LHZA 1D3GA 3W7MA 2OZ0A 1R30A 4FNRA 1G4PA 2QKFA 3NQ8A 3V75A 3QRHA 3NG3A 5A5WA 1K7FA 1XC4A 3LHVA 3LI0A 4LOCA 1SW7A 3UY7A 2C15A 3W7CA 5FF7A 2G5WA 3BG9A 4NNBA 3NQFA 2H90A 3NOEA 1XI3A 4LVDA 4H3DA 1XBZA 1ME8A 2O7SA 2V82A 3OVPA 2Q8ZA 4MFDA 5KZDA 4E38A 3HG3A 2W79A 4WXYA 3P80A 3B04A 1TV8A 1AL7A 1VS1A 4AEOA 2W0UA 1A5CA 1L2UA 1J4EA 3M16A 1T0OA 3PUOA 4QNWA 1NF0A 1QMLA 3LHWA 3LRLA 1W31A 3NPVA 5EBUA 1N7KA 3N19B 4FIQA 5LSMA 1IXPA 3G0SA 3LCLA 2CLOA 2CZ5A 2QF7A 3G18A 2A7RA 1S5WA 2H8ZA 2NXHA 3PS7A 3W22A 4RV8A 1G7VA 3NGJA 2JGYA 3IGXA 3GAKA 1BEUA 5HMSA 2Q3OA 4UFIA 3WFAA 1K3UA 3A9IA 4NX5A 1I45A 1XCFA 1ONRA 1SQ7A 1KFJA 4O8RA 1XBXA 2GVLA 2YFNA 3MHGA 4WJEA 4BI5A 3RNDA 1H1YA 4DELA 3S9YA 5DLCA 1SFJA 3GR8A 3EXRA 1KTBA 2YGYA 3GLCA 4TO8A 3EWUA 4N02A 1EP3A 3HJZA 1HFBA 3NQCA 3L0KA 4FHAA 2OT0A 4HT3A 2WPBA 4IJBA 4O11A 5BOOA 5FESA 2CLMA 3M44A 2A2IA 2KZHA 1OFOA 3G8RA 1SO3A 4GBUA 4D2JA 2NLIA 3P81A 1SO5A 4Z0SA 2OMAA 2NX3A 3W1AA 2ZZ7A 5C55A 1H61A 2J24A 3L0NA 1BWLA 4N9EA 3STCA 1SO6A 1DVJA 3WK3A 2UV8G 5HULA 3AO0A 1FX6A 1TPUA 1YPFA 3NNTA 4KKXA 3R89A 2VFEA 1MZHA 3W7QA 4NZFA 4C1KA 5BNKA 5HR7A 4BI7A 3W86A 5EL1A 5C2XA 1H1ZA 1UUMA 1YTKA 2OCZA 4O14A 3S5YA 4QSHA 4O0ZA 4XBSA 1FQ0A 4JTJA 2ZRUA 3MBFA 2Z2UA 1TIMA 3QSTA 3THAA 1EA0A 3QSRA 3GZ3A 3W76A 4C1LA 3G8EA 4Q4KA 5KTLA 2B7PA 4DEFA 1AK5A 2FLIA 2P0OA 1SSDA 2YYTA 3TE9A 3TC6A 2DZXA 3EWYA 5I3KA 4IGHA 1GWJA 1QOPA 4UC5A 3HB9A 4FNTA 4ZQNA 1W54A 1GEQA 1X8FA 1JRBA 3NVTA 4NJJA 1M7PA 2ABBA 2NX9A 2R14A 1TV7A 1F76A 3MYOA 3C2RA 3Q37A 4P2VA 1KTNA 1LYXA 3DXIA 2C14A 3U6WA 4KWWA 1QPOA 1OJXA 2X1SA 3GDRA 4WQ6A 3MI3A 4K7YA 1W5PA 2GOUA 1D3HA 1KM2A 4LU0A 5D32A 2EGZA 2ZA2A 3M6YA 1TRIA 5CPOA 4LC8A 4R34A 1O94A 4K37A 4CQ9A 3USBA 1IXOA 2Y7DA 3M9YA 2OT1A 5BMWA 3EWWA 4JTFA 5D38A 1VJIA 2ZBTA 5CZJA 1TPFA 2PRHA 5AYXA 1QPQA 4QQ3A 4IMEA 5D2XA 3T55A 1IXNA 2C1HA 1GTEA 3VFLA 3TSBA 5K4ZA 1MEIA 4JY8A 5HWJA 1W5OA 2FPTA 1ZAHA 3LX9A 3TXZA 1RVGA 5CZTA 4XUGA 2QCDA 5LGZA 4M6QA 3P82A 3K30A 1S5TA 3P5YA 5HUOA 1DKWA 1I2OA 3IVSA 2TMDA 4NT0A 4DF2A 3HF3A 5D2YA 2IQTA 1SZGA 1QFEA 2JKEA 4BF9A 1NF7A 4RCXA 4O53A 1O95A 1B4EA 1UASA 3L0GA 2JK2A 2W6RA 3N2XA 4A21A 1OFPA 3HMJG 3MI2A 1LLZA 4FXRA 2ZYFA 5T26A 3HBLA 4MVAA 4LS2A 1NFBA 4YCPA 3FIGA 3GXPA 2JKAA 1DOSA 4AWUA 2X1RA 3FA5A
chains in the Genus database with same CATH superfamily
3LCHA 1BKSA 4Q4PA 2CU0A 2G96A 3EB4A 1HJQA 4I8YA 5F4SA 4E4PA 2JF6A 1JCYA 4HYVA 3DFTA 3NQAA 1AZ2A 3UG3A 4B5TA 1QPRA 2E5CA 2QCDB 1GJPA 3IJQA 3WNPA 3HA1A 4AXNA 2YXXA 4M81A 3TQPA 2C91A 3N04A 4ZQCA 3NSMA 3EA1A 4AD3A 2VI0A 2BB0A 4GYKA 1XIIA 1R3WA 4V27A 1R0MA 3L21A 3VNKA 4ZQMA 2CEQA 3W29A 4Y96A 1TWIA 4CU8A 1TJPA 3QVQA 1CXFA 1PBGA 4ACYA 3ABXA 4MY9A 2QDGA 6REQB 1WDWA 3BAYA 4LYKA 3WZ0E 3MMWA 2PDLA 3GS6A 4W85A 3G1HA 4BS0A 4HBKA 3V5OA 1J5TA 3AIVA 4IFOA 5BU6A 4OOZA 3W01A 4BJHA 1JZ2A 1XLMA 2C1GA 4B2DD 3W2JA 1UZ4A 4WD0A 2QUUA 4GZ7A 3WKZA 4Q7IA 4S3AA 3M47A 1J10A 5EB8A 3FKRA 3SCOA 4MM1A 2VR2A 1IT7A 2YDRA 5F2MA 3QV6A 3I7SA 3UZXA 3FXYA 3HTWA 3AYTA 2V6AA 2FB3A 3SRFA 5G5IA 4ORMA 2JIWA 4GIRA 3CWNA 2HPMA 1WAUA 1DBTA 2VWSA 4PTNA 3SCWA 2UWFA 4QJ3B 3HQNA 2QUTA 4GLEA 1S2WA 3GU9A 4A05A 1G7UA 4Y9MA 3DC0A 3L68A 3VUSA 4I9AA 4XO7A 5G4HC 4O16A 3UWZA 4MYXA 1OX4B 4DWDA 2PWVA 3HGJA 3OVRA 1TR9A 3OW1A 3RK8A 1VH7A 3QGAC 3QY7A 1JCJA 4NILA 1W8SA 4GI6A 4JDYA 3FSUA 3WJYA 4JN8A 1MNSA 3GBEA 2PTXA 3HPSA 5I00A 1TPH1 5D03A 1EEXA 3P7YA 3SRHA 2Z1VA 2KX9A 1MO0A 3MKCA 4KS0A 4PB5A 1X8CA 2D0HA 3W1XA 3VZYA 4KMQA 2F84A 4DWSD 4UOJA 3M0ZA 3PUDA 3VGBA 2WMFA 1P0BA 1XRSA 2R1KA 3CPGA 4MNKA 3ITXA 3ATYA 1FWHC 3E49A 4C6QA 3FJ4A 4RZ4A 3LA4A 2PLMA 1AZ1A 2ZICA 1JAKA 1J12A 1P6CA 2CBIA 1FUYA 1P48A 3MHFA 4A3QA 1OCQA 6XIAA 4LUTB 3KWXA 3QHMA 4HCDA 1TCDA 4MZYA 3UZJA 1QAPA 3V4BA 4RX0A 5E9XA 2GUYA 3N4EA 4PUUA 2BTMA 4Z2IA 1GNXA 2PF8A 1U83A 3CM4A 3Q45A 3C2YA 1OD0A 1IYXA 1W56A 1NDWA 3UERA 3CMFA 1IE7C 2PLCA 1F3TA 1FHLA 4AVOA 1RLCL 1XLDA 3GDMA 3VPLA 3LERA 3W25A 2VFHA 2ZKMX 1KGUA 4FLOA 4LVBA 1XCWA 2HJPA 2DVTA 4EPKA 2V3GA 2CWXA 4M8UA 3T42A 3APGA 3CUZA 3UG8A 3VVGA 4HKPA 4LGXA 3KBSA 3DIPA 4PMDA 1NVMA 3IRSA 3R5EA 2CBJA 3WL0A 3M0KA 2C0HA 1B90A 5JVLA 2OLSA 3A12A 2WQPA 3KRZA 4DN1A 3LU2A 5EFFA 3KDOA 3GHRA 3NZRA 2Y8KA 4HPJA 1R2RA 4F79A 3WK0A 4GYPA 4JGDA 1QJWA 3DFYA 2PP3A 1CENA 1Q45A 2QUNA 3A13A 3K13A 2Y1HA 1ZFJA 1V02A 4DNMA 3OA3A 2EG6A 2WANA 5A8GA 3MBDA 4MY8A 2RAGA 2X42A 4LBRA 4F40A 4C7FA 4Q8UA 3S8HA 1FHVA 4PBGA 1PCKA 1CTNA 1FHDA 3E2SA 1J01A 3AIWA 3W88A 3AS2A 3VOIA 2PRMA 3HGOA 4TVUA 1HG3A 2J7HA 1LBFA 1UH3A 3OBKA 2YIHA 2QS8A 8A3HA 1UR8A 1MXDA 1GYNA 3RLHA 4O17A 3UXAA 4GABA 3UF9A 3WDHA 8TIMA 4Z42C 1R7OA 1VCGA 3WO8A 4JIPA 2JF7A 1YEYA 4V2XA 2OKTA 2WCAA 4IQLA 2E0PA 5EFDA 2J4GA 2OSYA 2NVDA 3LNPA 4H9TA 4I9JA 4HNOA 3GVWA 1Q13A 2G41A 2Z6IA 3K4WA 1XX1A 3K1GA 2CETA 2I5QA 3HG2A 3TV8A 4QAIA 3GH7A 1JGMA 1WZLA 3VNLA 3VNDA 1KV5A 5D9PA 3MHUA 1NWSA 2YB4A 1L0PA 4HNCA 1F3EA 1D9EA 4S2CA 4NKCA 1QWGA 1D3CA 3IAQA 1UWIA 3W23A 3GE7A 3B8IA 1TR1A 3GHUA 4QS6A 1PL9A 2PDJA 1FDYA 3G1AA 2FVMA 5F2LA 1C9DA 5A94A 3WQDA 5J8LA 3L2LA 4CNPA 5I06A 3AOFA 5BROA 4P8WA 4MDPA 3AIRA 4HPHA 1TA3B 3TYDA 3KTSA 1FWJC 3TTOA 2QIWA 4YHGA 1TX0A 1JRCA 4EOUA 3KVKA 3CEPA 1H62A 1VZWA 4XZNX 3NURA 1X97A 3QQ1A 4WJXA 3PFRA 3Q2DA 4L1WA 3RCYA 1TJ0A 1E1CB 3FHQA 1GHSA 2G0WA 3Q4DA 2DV0A 3UCQA 3LCWA 5BRPA 3CBWA 1AH0A 4GQRA 1BAGA 3M0YA 1ECQA 1V3LA 1QK2A 1RP9A 3OIXA 5LGXA 3CGTA 4PB4A 1TWSA 1B1YA 3FFSA 4QDWA 6PTDA 1RR2A 1EHAA 2X7WA 3TROA 2HBXA 2VMFA 2PURA 3CC1A 1UWAA 3MCMA 3WLTA 2Q02A 2TYSA 3RILA 1VR6A 1BD0A 1EJ7L 1OFEA 1TJ1A 3T81A 4AIOA 3UG5A 1PIFA 4C6BA 2V63A 4JTIA 5CPQA 4JHMA 2FVLA 5GJMA 5XINA 1E56A 4JHZA 3MWAA 3SURA 2ZA3A 3CMGA 4PUMA 2X1TA 3STEA 2Z0IA 4UTFA 1M04A 2OKOA 2WWDA 1EQCA 3CIWA 4JTKA 4W86A 3CT7A 2D73A 4DLMA 4TMBA 3ZR4A 4CD8A 2WHKA 4OGZA 3I7RA 4X0VA 4INFA 1W6TA 3TIMA 3WLHA 5I03A 3DFNA 2V2CA 1A5AA 3T05A 3B9EA 5TNVA 1CW2A 3EXSA 4NL1A 4L6HA 5FEWA 5LIKX 4ZSUA 3DYPA 2XSBA 2EPNA 3BDKA 1ITXA 3OZPA 2A6LA 4PMNA 4ZR8A 3UCCA 4MDOA 4S3EA 1FCUA 2ACQA 5HNRA 4MOZA 4BQ2A 4LJ3A 4XVEA 6REQA 2ZDSA 4RPPA 4ACZB 2P53A 3S6OA 1XFCA 4U2ZA 1D7KA 3TW7A 4MYAA 2IKJA 4EAYA 1W37A 3BH4A 1R9ZA 1UR1A 3EWDA 4DO4A 4FR1A 4DM1A 2QQ6A 4TX9A 3KBJA 3LM3A 1Q6QA 6CGTA 1K8XA 1EDQA 4C6PA 5FIPA 1V0KA 2VGFA 3WH6A 3TYAA 1JCXA 3JVAA 3WEZA 3GIQA 3CT2A 3NYZA 3F2CA 3BLPX 3L67A 3OVGA 2PRLA 2QV4A 5JQ9A 3W87A 3CWHA 4FEZA 1M5WA 2F6UA 3U2OA 3AUJA 1WB0A 4EF8A 1GQKA 2YYUA 1GORA 4XV0A 3D3FA 5F2IA 4LUJA 2XVKA 3CUXA 1ADSA 2BLEA 1LRNA 1NWTA 1MW2A 2CZFA 5I79A 4JX5A 3W1NA 4JTSA 2VO5A 2OLHA 4GKLA 5E9AA 2CIPA 1OX4A 4Q8TA 3HV8A 3H53A 4WDUA 3ARRA 5D9OA 3SCSA 4BF5A 2BHUA 1N8IA 1RJPA 2PGEA 3ARZA 4YVVA 4LS0A 4C6KA 1HVXA 1R46A 4EF9A 3VD3A 4LBSA 1LLOA 4UR8A 4J3XA 1DTNA 3WMCA 2TPSA 1Q8AA 2ZVIA 3IAPA 1S3TC 3AS1A 1WDRA 3PBGA 3QMSA 1O60A 1PDZA 3PNZA 3CUJA 1TPC1 2YBVA 1FY6A 4LVFA 5KZMA 2A7PA 1FWEC 2CLKA 3W7HA 4OU1A 3CMJA 4UR9A 4HYWA 3ANYA 4ZTYA 3GXNA 4F66A 1M7JA 3RLUA 4DO5A 1JNDA 3B8TA 1QO5A 3QYQA 4PYSA 3BL3A 4C6NA 3BCDA 3KW3A 5HATA 4LUTA 2XG9A 5IFPA 2GGJA 3BAXA 4PCFA 3WLMA 3OVQA 4QSFA 4F2UA 1DJGA 3RO8A 5J5DA 4GWEA 5CZ0A 3EDFA 5B80A 1FCBA 1SZRA 3LSCA 2UZ9A 4W7UA 3U4FA 2JFEX 4PRWA 2VX7A 1GG1A 3IJLA 3P61A 1PZ0A 2OZ3A 1O5QA 4L9ZA 3GZAA 3T6CA 3B8UA 4HNVA 5ABGA 4ML9A 1FKXA 2I1OA 1UBSA 4D72A 2PEVA 1E4NA 4LCRA 4HA3A 1FFRA 2ACRA 4O12A 5FEZA 4O0KA 1E9YB 4DJED 4JBRA 2WCSA 3PANA 1N8WA 3TAOA 3NSNA 1H7WA 3DFPA 3HQ1A 2E1WA 3USZA 1UJPA 4N4PA 1AQHA 1XIGA 3MSYA 1G4TA 2DZSA 5EYWA 4FXFA 2J9ZA 1E70M 3ITGA 1Y0EA 2BY3A 4D6DA 2GK1B 4DJFA 1TMHA 2WW5A 3NJ3A 1MXSA 3TQKA 4E5TA 1RK5A 4AIBA 3MO7A 3N25A 1S5VA 3N9SA 3T0CA 3GVGA 2J77A 1BKHA 4WOQA 3TOPA 3V0UA 4IPJA 1W3TA 3EZ4A 1NY1A 2RGMA 1EBHA 1RBAA 4GFIA 4XTDA 5AZ1A 5CC5A 2G50A 3HPZA 3SB0A 1G9HA 3NL3A 2IPWA 7TIMA 4N9BA 1QR7A 2HE8A 4ROQA 3TN5A 3P93A 3MT1A 4S3KA 1TX2A 3B0VC 2CHRA 1HJSA 1LDCA 2ZOXA 3TW6A 4C1NB 1EA9C 1XQLA 1DXFA 2G4JA 3EX2A 1ICSA 2YX0A 4HHLA 5AHNA 3BGGA 2FHFA 1QNPA 2QZRA 3AMGA 5H8PA 2BWGA 4XD4A 4UFLA 5A2BA 4D6FA 1YDNA 3BTNA 2D69A 3ABOA 3KS6A 1RXOB 3DG3A 1KM5A 4IPIA 1QNSA 5HJLA 1FCQA 1F6KA 4WXZA 4DQWA 3D46A 5A6BA 1C7TA 4A3UA 1TE6A 4MSSA 4DPPA 4Y8FA 5F2GA 5SWUA 1C7SA 2ZWYA 4DRSA 1F74A 4H7VA 4G1KA 3WNLA 5ABHA 5CPLA 1EIXA 2R24A 3P67A 3EB2A 3SCRA 1Z48A 3PB2A 4XAZA 1OZMA 1B4KA 3PZUA 4QQUA 3CAWA 3FN9A 4JS3A 3CJPA 4PR4A 4H19A 3CK5A 7XIMA 4HHPA 3NPXA 1KQYA 1E4IA 2ZUSA 2D1ZA 4GVHA 3THCA 4P8VA 4AWSA 1TA3A 4CN4A 4PMZA 2VELA 3TN6A 3ZT6A 4JIHA 2NWSA 3UWVA 2GVYA 4ZE5A 2DSWA 1GVSA 3A4XA 2OELA 3ANVA 1X7FA 1FWAC 4XAYA 3OG3A 1QU4A 2NZLA 3T2OA 1TFVA 2O9OA 3DESA 4DXXA 4U2YA 2ZZ4A 3KP1A 1V93A 1DWAM 4D6JA 1GW9A 1KR1A 3A4AA 1K9TA 5HINA 1AQ0A 1GKQA 2J13A 4LALA 2B31A 3I3DA 3WDQA 4K39A 4LAMA 4DBUA 4IUGA 4JN7A 3ZZ1A 5LA0A 3WF1A 2VCCA 2XWEA 4GQGA 4C91A 3R6IA 1LTDA 2E5DA 4L4MA 3WF4A 1W2PA 4GI8A 2Z7KA 4A2RA 4PMQA 2J7FA 1H4PA 1ZTVA 2O4MA 4HCLA 1F3WA 4FIRA 3W7LA 5HK4A 3C2EA 3K4DA 1TV2A 3CNYA 2CBVA 5C9UA 5M5DA 3U7VA 4MJZA 1DWGM 1MXGA 2PDWA 4ASTA 1RALA 3WJZA 1UA3A 3HPAA 1UZHA 4YTRA 2A0NA 4CD7A 1VYPX 3W9ZA 5H2ZA 2PCQA 5BOFA 1THFD 3BC9A 4MAZA 1XLHA 3AMCA 1AH4A 3SRDA 2ZDRA 3R79A 1YXCA 3NL2A 2WMJA 1DQXA 3SN0A 3PZQA 5IRPA 4LUSA 5AYYA 5T91A 1OM0A 3NO3A 1S1RA 1W1YA 5HJXA 4AEFA 1ISXA 2Z00A 2IXUA 2VX5A 3OEXA 3AWOA 2OGYA 3T0BA 2CPUA 4DUOA 4HHMA 1XXXA 1C91A 5E0KA 3CH9A 2GVJA 2GSEA 3OP2A 4TUFA 1V3HA 4OWGA 3BLEA 3RGTA 1OG6A 4HN4A 2QCNA 2QMJA 3LS9A 4GNJA 4JCMA 3PBVA 3UZ5A 1ZP3A 2XH4A 4LTSA 2FZ9A 5DY3A 1R86A 1SYTA 4YXGA 7A3HA 1JR1A 2QVHA 3QPZA 4B5XA 2HK0A 4ACZA 1Q5MA 1A3HA 3ZR5A 3TJXA 4KBXA 1QOQA 4LCSA 1GCYA 3CQ0A 4I6KA 4J35A 1TTIA 3R8HA 2VZUA 1XIBA 2F2HA 1RUSA 4XK2A 2W62A 1ZCOA 2IMRA 4OT7A 3ZJ7A 5AFDA 2ZX9A 3PZGA 3IUDA 2ZX7A 3ALGA 4NRRA 1UWUA 3VMNA 4Y9OA 2ODOA 3BMVA 4PFMA 3TLLA 1SJCA 2PWGA 3LCFA 4XD5A 1E1EA 1NOUA 2VXNA 5D2TA 1W1TA 1B3XA 4HTBA 9XIAA 4B91A 4DYJA 3NO5A 3PZIA 1HT6A 4W88A 1W2VA 3MMTA 3HQPA 1HW6A 3DKJA 3SJ3A 3G0UA 1DTUA 2YCLB 4KFNA 2ON3A 3T2QA 4HSOA 1UC5A 1ZSXA 3GU1A 3EWCA 3OB8A 2NV1A 4R33A 3QW3A 4Z2JA 1V51A 1PV8A 2PUZA 5CLTA 3I6TA 3GW3A 1K7EA 1D2KA 1EIBA 1JUKA 1W9PA 2RKXA 3QFEA 3KRBA 4QE5A 1JI2A 2OX1A 2ZC8A 4PTXA 1HGWA 3FYPA 3NCOA 1KC7A 2J27A 3B97A 1KCZA 4OHQA 3L4TA 4C60A 1LQAA 3FY1A 5JUVA 3UPWA 4Z2GA 4ZEPA 1KFEA 3RN6A 4DB7A 3V1PA 5D04C 2ASHA 1QW9A 3GXIA 3CEUA 2OWCA 4AHQA 4JN6A 3AHZA 1V77A 3VINA 2HVMA 3R0DA 3W84A 1REQA 2B7QA 4LAKA 4W93A 4QTGA 4AZGA 1GG0A 1FCVA 3AI0A 4N6EA 1MQPA 3BGJA 2QHAA 4WR3A 4LEFA 2WYSA 3TMLA 2OXNA 3MVIA 2ISDA 4MPKA 1QASA 6XIMA 5A6SA 3I6EA 2GDUA 3CB3A 3W38A 2BVTA 8RUCA 3QTPA 2YL9A 1P7TB 3WLRA 1GQNA 1DXEA 4Q4QA 1EGMA 4F4RA 1IQ8A 3BAKA 3E1F1 3TUUA 3TQ0A 3LB0A 4IP5A 2VC9A 3DOPA 1F8IA 1ZNNA 2B81A 3GBDA 4ES4A 3GTIA 1UR2A 5K9CA 3UYIA 3FJ6A 3AISA 2AOSA 1Q6RA 2EKCA 4P8UA 2FGZA 1EC9A 4RXFA 1CBGA 2CLHA 2Y5JA 3BAWA 3H23A 2ZVRA 3SUWA 4RE0A 4PUKA 4QITA 1Q6CA 5A6KA 3A5VA 1D7FA 4PH6A 1KKOA 4ZCWA 1SW0A 4NZ5A 4H8HA 3OG2A 3WX7A 2TSYA 3H4XA 4TQTA 2GJRA 4UWMA 2OOGA 4CCZA 4X60A 4RLIA 1GQLA 4GO8A 2XSXA 3MV01 4GRSA 1P6BA 2GK1A 1V0NA 2J74A 4GUGA 3QQWA 1ZJIA 5E93A 1GK8A 4O57A 3CIVA 1CGUA 2X0YA 1JZ3A 2CBUA 2V2DA 1ZALA 5LKYA 3G3DA 1M03A 1ISYA 2QR6A 4I9TA 1JCTA 1V0MA 3FEQA 1SFSA 4GO9A 3W70A 4NQ1A 2FZDA 4UMCA 1EX5A 2IKIA 1XPGA 3DAQA 1IEVA 1OG0A 1LBMA 4GKTA 4ATDA 1KXVA 2Y8VA 2OSWA 4D6EA 3C3UA 5ABFA 3BLDA 1AD1A 2I14A 3OZYA 3MS8A 4HN8A 3W37A 2BXVA 1ZB5A 3L12A 3N3MA 4QJ5B 5FJRA 1UIPA 5C71A 4YL2A 5DEZA 4J3SA 2Q71A 5F4XA 3UPBA 1EOMA 2EHHA 3LXCA 3M6DA 1EJVC 4LS1A 3M43A 4PRTA 4I7UA 2J66A 5DCDA 1B31A 3B9OA 3GIPA 1QI5A 1VIWA 3MB9A 3A9BA 3O16A 1LOLA 3EMZA 1JFXA 4B5SA 2J62A 3LI1A 5D4YA 5REQB 4DIAA 2GUUA 3RDKA 5TBOA 1WKYA 1IEQA 2PDPA 3LHZA 4QJ4B 4S3FA 3W7MA 2WMIB 3E0VA 1XC4A 3LHVA 1MI3A 2ESCA 3TYZA 3GTXA 4JL1A 1UBPC 2OZTA 5FF7A 3KLLA 2J25A 3CZ8A 2O7SA 2XZ9A 3OVPA 3ZOAA 4MFDA 5KZDA 3EPMA 3HG3A 2W79A 4EAMA 4WXYA 3OO2A 3NZPA 1NDVA 5EBAA 6TAAA 2GZXA 4EPBC 1AL7A 1DIDA 2P8BA 1Q63A 5IHSA 7PTDA 1U1UA 4RDZA 4DAIA 1VFTA 3VNYA 4QNWA 5BXSA 1OGBA 2FTYA 3NPVA 2BXYA 2Z25A 3N19B 1VENA 4G8TA 2XVPA 1IXPA 4M3PA 2EG8A 3EDEA 3AXKA 2OLAA 3KZPA 2A7RA 5E09A 3AQUA 3W22A 1A5UA 3NGJA 3W02A 1R3YA 4LX4A 4NX5A 2X41A 1SQ7A 2ZWZA 1CCWB 3EOEA 4ZXLA 3MHGA 1IEXA 2HK1A 4WJEA 1J96A 1MRAA 3RNDA 1H1YA 3GG0A 1QW7A 2POTA 4L65A 3VABA 5DLCA 3EXRA 4LYPA 2YGYA 5AKQA 3BOFA 5FSDC 3P2VA 2Y4SA 4N02A 3NQCA 2PMQA 4XD6A 5CLWA 4IJBA 2PLJA 4HQVA 2V3FA 2CLMA 3LEPA 2BY0A 3M44A 1V3IA 4DY1A 4IQJA 4FPSA 4GNVA 1SO3A 2NLIA 2CZVA 4ZOAA 4HMEA 1K4HA 3CV2A 3CO8A 5G1MA 3STCA 3VX1A 1SO6A 3WK3A 4AU0A 3MKKA 3SQSA 1EJWC 1MZHA 3WQ8A 4NHVA 4C1KA 1XINA 2VR5A 1XYBA 2OTDA 1UC4A 3ALFA 4BI7A 1Z32X 1R7AA 3FCPA 1I75A 4MNJA 3S5YA 4O0ZA 4XBSA 5BZAA 1UWSA 1BXBA 1WUEA 3PTQA 3GZ3A 3AIEA 2OR2A 4TX6A 1OIMA 1SSDA 4P7RA 2XZ7A 5FSEC 5I3KA 4NG3A 1S2UA 1F3XA 4ZQNA 1NDZA 2WSPA 1X1NA 4YVXA 2P3ZA 4G5DA 4ZFMA 3H2EA 3TLQA 1VFSA 5EMLA 1OCNA 2QW5A 1QBBA 4ZFCA 3DXIA 2MNRA 4GQ0A 4B16A 2X40A 2X1SA 3MI3A 4KEZA 1D3HA 4LU0A 1MMFA 2EGZA 2IPJA 3M6YA 3RITA 4GH1A 4I5RA 1H0GA 4CQ9A 5BMWA 5D38A 1UKQA 1Z69A 4GGHA 5HNUA 2V5DA 3T55A 3TYEA 1ZUAX 2GJPA 3TSBA 4LYRA 3V36A 3M0JA 1W5OA 1JDAA 1K4GA 2FPTA 1JG9A 1G1YA 3LX9A 3TXZA 3VDGA 3VKBA 3GXDA 3GSMA 3WQFA 5LGZA 1GKRA 1EXPA 3NTYA 5CAHA 3P5YA 5HUOA 4YVPA 2ZX5A 4CUCA 4Q4RA 1SZGA 1AQFA 4IL0A 4CVUA 4RCXA 4O53A 1O95A 1UASA 2JK2A 2W6RA 3UZZA 4E6MA 3HBLA 4S3GA 4YCPA 1AVAA 3WBYA 3FIGA 2OEKA 3OLDA 3DEQA 4GGBA 3N11A 2VTFA 1UP3A 2X1RA 4AZCB 1PJ9A 2JE8A 3FA5A 3A23A 3E0IA 2VEKA 1ZJHA 3W28A 5LNVA 4HPNA 4FO4A 3C2OA 3S2JA 4A8LA 3KVJA 3SCNA 4AZ5A 3FW6A 2C19A 3W7NA 3IJIA 4JIIX 1DQWA 3N2BA 3W27A 5CQ1A 4I7WA 1C90A 1J0IA 3DX5A 1G5AA 4L80A 4NZCA 3C56A 4WKFA 1ADOA 1TZ9A 4XZBA 2H3DA 2DGAA 3SO7A 1I1WA 3K46A 4JY9A 2R1MA 3RF9A 4RK8A 3B0UX 2QULA 3QR3A 3LPFA 1U30A 1W3NA 5TD4A 4S1FA 4TR9A 4AQLA 2DZBA 3DN5A 4IIDA 1BVWA 2HE5A 2WBKA 5IHRA 1R3VA 3W7PA 3UPMA 4JEQA 3DI0A 3BQ5A 4MUZA 5HA7A 1FWIC 1DWIM 1V3KA 2YA2A 3BZJA 4GXMA 3ES8A 4O19A 3EEGA 2XIOA 5FJPA 1PIIA 2PU0A 4JTLA 2P10A 2VC7A 4UFHA 3L4UA 4LF2A 3GTNA 2VDGA 2BY1A 3WG6A 1YLVA 4PCSA 4QLJA 3V7PA 4Q4MA 1AD4A 4L5ZA 1NM9A 1UKPA 1P5BA 5I02A 1YMYA 2GGEA 2X0HA 4KQNA 4R27A 7CGTA 3ME3A 2DDXA 3C0LA 3ZSSA 1FWNA 1HKJA 2WHJA 1MYRA 3VK5A 1IWPA 4KEMA 4A6GA 3GR4A 1ODUA 4D1JA 1I0DA 2Y89A 2H8XA 5TIMA 1OX6A 4J4KA 2BVWA 1CDGA 1K77A 3G3MA 1VLIA 2CZDA 1YNQA 2OO0A 3V0SA 1FWCC 1O12A 3MUXA 4LRTA 3UGRA 4LQ1A 3HZ3A 3AHVA 1U22A 4IMFA 3W53A 2J7CA 4FLRA 3IK4A 4Q32A 3B05A 2OJPA 1RY0A 1B3WA 3W7RA 5PTDA 5K3VA 2Y5EA 2EPMX 1CLVA 4DZHA 1HN1A 1KA9F 4CN6A 7REQB 3BICA 1KNWA 1V0LA 3GNDA 3BV7A 3N29A 3ZR6A 1A53A 3G22A 2VL4A 4I7VA 4HOXA 2WMIA 4JYFA 3T07A 1H41A 1E6ZA 3RPDA 1VP5A 2WC4A 1NQKA 4CCCA 1J18A 1MFUA 2XM2A 2A4AA 4GINA 3TA9A 1CXKA 2CLIA 1H49A 3GFXA 4Q3MA 4FNSA 3RM4A 1LT7A 3LPOA 4DHGA 1KCKA 4FNQA 3QGKC 2EG7A 3KBNA 4REQB 2X7VA 4Z1DA 3DDMA 1TPDA 4DUXA 4L61A 2V5LA 4PZVA 2E4TA 1U1JA 4WUIA 3FXGA 4ZGYA 3UBPC 3NR0A 1NEYA 2WM1A 4M6PA 2V8ZA 2DSZA 3NM3A 1JPHA 3GDKA 3E6EA 1HUVA 2NQZA 4NAEB 1PHQA 5JIPA 3T7VA 1OC6A 2DZUA 3GU2A 5HDRA 3E2QA 4DF0A 3EWXA 3DECA 1VFLA 2VVNA 1EUNA 1EL3A 3FHAA 3G2GA 3M5XA 2G8ZA 4XZIA 4HMCA 3O2LA 4JD4A 3E5BA 3N6JA 1EH9A 3C52A 4QG9A 4AVNA 3UY8A 1IZJA 1IT0A 3EPNA 1VRXA 4IX0A 5EU9A 2YDSA 3BUVA 5I6SA 2PP1A 1Q4WA 1PWLA 1ZHAA 5C70A 4GIEA 2WNZA 1H51A 1MWOA 1WV2A 1UH4A 3RFAA 4QLKA 3L23A 2X09A 2V67A 2WSRA 4A8NA 2WKJA 5HPCA 1XKJA 3VNIA 4ZXOA 2YCJA 2O9RA 4AD0A 1Q3NA 3BQ6A 3WLSA 1JCLA 3CPUA 4IMDA 3TEVA 3ZVHB 1A5MC 2DQXA 4U33A 5A95A 2NQ9A 3LD5A 3B03A 4L64A 3MCOA 3SIMA 4TVDA 2QDHA 4XWUA 5K7JA 5KITA 4BK9A 2VCAA 3D5HA 3NGFA 2X1UA 3R0UA 5HWNA 1YIXA 1XUZA 1GOKA 1ZPTA 2LLEA 3VZXA 3UJRA 5FF0A 1GZ1A 2YSWA 5HQLA 5IBXA 5LIUX 1K9DA 4QE1A 5HNTA 1WAWA 2E6DA 4WZHA 1AJ0A 3EWZA 1YW1A 1NP2A 1LQ0A 1MFVA 5F1VA 3IRDA 2CLPA 1UPPA 2ZRXA 3WLKX 4TV6A 3ITCA 2IW0A 4FF7A 1EFZA 2V0TA 4GI4A 3SW6A 2GQAA 3K4AA 5I0DA 2O0TA 1GZGA 5GJPA 5I3JA 2XN2A 3U0HA 1F73A 2PD5A 2DVXA 2D3NA 3CV7A 1PX8A 5JU6A 2IQ0A 3VTRA 3GYCA 3CAVA 4ICCX 4YWSA 5H8UA 1CZ1A 3W72A 4IF2A 3GAYA 1O68A 4IH3A 3GC5A 4D8ZA 1W3JA 3GVQA 3ID7A 2WXDM 1BVNP 1HL8A 1B5TA 2L5HA 1AW5A 4QISA 4UMAA 2WKLA 3ZWTA 2C0AA 2W4XA 3K8MA 4JX6A 1L6SA 4RJEA 3F7JA 3R10A 5DCEA 2VEMA 3S5ZA 1I2QA 1CNVA 2WKGA 2YPIA 4OV9A 3RU6A 2QJNA 1XLKA 1UZDA 3BW3A 1ONXA 3VMPA 4XSLA 2HEJA 3NXLA 3JUGA 2VEPA 3CLMA 1KRCC 1JQVA 4LCQA 3UG4A 2YFOA 4GBDA 3W7JA 5JMUA 4CNNA 3CHFA 4ZQRA 3CUFA 1ZAIA 2D2GA 1DXIA 2CCRA 3T44A 2EO7A 1B3ZA 4MJ4A 4B5NA 3ELFA 4IMGA 4J2MA 4PRRA 4AYGA 2VP8A 1W1PA 4MKVA 3MV11 1TB3A 5FD0A 4A3HA 2ZADA 2F7FA 1Y5XA 1CLXA 2J7BA 3MC5A 1J0JA 3T40A 1OSEA 3PTMA 1JZ4A 3V5FA 1T41A 4AZCA 1SM9A 3AHTA 3LSBA 4AB4A 2X8RA 3GG8A 3IIOA 4LPCA 3DZ1A 4PSPA 4FZIA 4AD2A 1B3OA 4TTUA 5FF2A 1F4AA 4IGNA 3M1ZA 3UGVA 3PSWA 1XSIA 3FV9A 2CHNA 2ZUMA 3GVVA 4UTWC 2C8NA 3URBA 3E74A 2ISVA 2G3FA 2DP3A 5JXQA 3VD5A 3CUHA 3LCIA 4AY7A 4GIYA 4RDYA 4X22A 4BWLA 1J9YA 3M46A 4H9UA 3NPWA 5GPRA 4F48A 1US0A 1U1HA 3PVFA 1T96A 2GYIA 4MWAC 2WMGA 3OIHA 5K4XA 2Q8XA 2VEGA 4GI9A 5G1TA 4NZ1A 1AW2A 3G0XA 4QJ1A 1TVNA 3OGSA 4CQCA 1TVPA 4GXPA 1AQMA 4GG9A 4C6LA 1QPKA 3AJXA 3A3WA 2QGHA 2Z1KA 3K5XA 5AC8A 2NUYA 5XIMA 1XJBA 3F03K 3E96A 5E6ZA 5GNXA 1OT2A 1PX3A 4F9JA 3GNPA 3II1A 2BOGX 4YYFA 3DERA 4J2PA 2FTPA 2QIIA 3PPFA 2D24A 1J5SA 4YWIA 2XUCA 4ICNA 4PEEA 3ZSTA 3AICA 1LUCB 3K8KA 4A2SA 1TTPA 1OZQA 1GQJA 1L6WA 2WVVA 1NARA 5I23A 2WPGA 5DANA 1OX5A 4Y90A 2PDUA 4H2CA 1SJBA 3ITLA 2PA6A 4ICMA 1EEPA 2VC6A 8XIMA 3SUSA 3GNOA 1IZKA 1XFBA 4WGHA 2DT2A 2XVGA 1TPVA 2GJLA 1T8XA 5M03A 4L1GA 2DZPA 1V3JA 2HXUA 4FNPA 2E6AA 5BYWA 4D6CA 1K8YA 2Z2BA 4V15A 2A21A 2NT1A 4EXAA 1VBRA 4UTMA 5CPSA 4E8GA 2QJHA 2WJEA 1VHNA 2F2KA 4PB3A 2NLYA 3DYOA 5HMDA 1KV8A 1YRRA 2P76A 2DUAA 1VEMA 1Z6KA 3VE7A 4B9ZA 1YYAA 4CD4A 2DZVA 4M1RA 4KCUA 1EJRC 3TSMA 4JQ3A 2G37A 1GONA 2DIKA 1T8QA 3PBWA 5LIWX 1HP5A 1X1ZA 2DU2A 3EB3A 2H6RA 5GVJA 2ZXDA 4GIAA 3PG8A 2AKZA 2VOMA 5C5YA 2BHYA 1LM1A 4KIEA 4B90A 4G2DA 3IPWA 5A6MA 5AVNA 3L66A 4S39A 3CQKA 3L9CA 3U5YA 3EKLA 2BOFX 3SDOA 2UY2A 1R87A 2D3LA 2Z27A 3W7IA 4S38A 3EA3A 5GNZA 1XIEA 1EPVA 1VYSX 3OZMA 4B4FA 1HXJA 2PDMA 4OKDA 3WJWA 4REQA 1JCMP 5G2WA 3I6RA 4BI6A 2GQ3A 3LHYA 1JIBA 1V6TA 2BVYA 4C65A 1ELSA 3R2GA 1KFBA 3CYVA 2XINA 5AHIA 1ZGDA 4UNLA 3PULA 1E6QM 4H1ZA 4JKMA 3LTSA 5I78A 3WNNA 3T0AA 3GIYA 1V6YA 1KBBA 3TQVA 3ORWA 2HRWA 5E70A 2WK2A 3SGUA 2I17A 5AC4A 4E4FA 4MF4A 5D8WA 4UCFA 5A8NA 4I5UA 3NQ6A 4GUJA 2WLYA 4NY2A 1M01A 2Z1BA 4NP7A 3S0CA 4HTYA 2ZUNA 3L4WA 4NNAA 1RHCA 2INEA 3P0XA 1JZ8A 1B9BA 1MSSA 3LYEA 1GJUA 3RRAA 3HU7A 3BLOA 3NQBA 4EWJA 3DHPA 3JZUA 3PP7A 3O6CA 4QE4A 4N7QA 3AXXA 4PE8A 3ZYZA 7ENLA 3UA3A 2XH0A 2YLAA 4CLMA 1U5JA 4NRSA 3IUIA 2XFRA 3LLDA 5ENLA 3TTEA 1L8NA 4D8AA 3F1QA 1OT1A 2NUWA 5EGRA 3LMZA 1I6NA 3B9AA 3PAOA 2OX4A 2VVSA 2I16A 3RAOA 1FP9A 1ONEA 1LG1A 2HDJA 4OBSA 4GYPC 1BFNA 4Q22A 3A64A 1CIUA 1C3FA 3CHEA 3LZ5A 1XGDA 2E28A 3ARWA 1RA5A 4Y8EA 5HBFA 4UZUA 3VGDA 1TTJA 3WQEA 1W3IA 4J3VA 3IGHX 1GVEA 1KW1A 4JAWA 3HQOA 2HZGA 3WK1A 1HL2A 2EPOA 3HIJA 4HPGA 4BFAA 1SPQA 4GX9A 4O15A 3B9NA 3PZOA 3LV5A 3IJ9A 4HSHA 4IIBA 5C9ZA 2R1PA 1VJZA 1TUFA 2EF9A 3LXBA 1OEPA 4AZHA 2POZA 5T8GA 3KFTA 4TXEA 2XHYA 3VD4A 3DUGA 5BCAA 3I4EA 3SQLA 4DXVA 4AMAA 1X7IA 1A5NC 4X61A 5K2ZA 1P1MA 3MUAA 4YU1A 4H7ZA 3QV9A 1DORA 2J79A 3A22A 4M29A 3MANA 4UB9A 1RLDA 3QLDA 4YTSA 5FAGA 3VNJA 4DBEA 1TZZA 2QEZA 2PODA 2ZA1A 3WYZA 1WPCA 4UXDA 1GPWA 3GDTA 1RQHA 1IR1A 2WMKA 1P4CA 4V28A 3ABQA 3KCLA 3THQA 3W73A 2F6KA 2VQTA 4ZQOA 5L9FA 3GKAA 5G4WA 1GHRA 3BG5A 5I2UA 3TH6A 4CQBA 1E6NA 1Q6GA 4MJMA 2QCLA 3IWPA 1OFBA 2WSYA 3GFYA 5DBUA 2RJGA 1VPYA 2Y2WA 3L4YA 3W2MA 5I07A 1HQTA 3H4GA 4DLFA 1WDDA 5I24A 4DPQA 4CCDA 4DO6A 3BXWA 3N17A 1UOZA 4Q4SA 2C18A 2XU2A 3PUEA 2G4FA 5CGQA 3SCUA 3QH2A 3G1VA 3EOSA 4MADA 1EBGA 4H9VA 4YPJA 3TTSA 4Z2LA 4BEUA 3SUVA 4MPQA 1CXIA 2GPTA 5CZKA 4QNEA 1NU5A 4TMCA 3ZFHA 4UFJA 3HGSA 3TYBA 5GJNA 3R0KA 4V33A 2BGNE 2GLKA 1DWFM 1LWJA 1N2VA 3UFYA 1QDSA 3OGRA 4A3RA 4ZODA 4MLRA 5TQLA 4DUWA 4O1AA 1M65A 1Y7VA 1ADDA 2RDUA 4R3UA 1U2YA 1XPYA 1CX9A 4N9CA 2OEMA 2GSHA 2Y5SA 3STFA 2VZOA 3GG7A 1KCXA 2BDQA 5LIXX 1JULA 1QUMA 2P5NA 3INPA 1E0VA 3BSMA 4RKAA 1E0UA 4DUVA 1RPXA 3N2TA 1WDPA 3RIKA 3GX9A 5KETA 1SVDA 3L7RA 1X6LA 3R58A 3Q67A 4UCGA 4XB3A 3OBEA 3MY9A 3GG1A 3BOLA 2NWRA 3L5MA 2NSXA 3T2PA 3N9RA 1FXQA 4Z08A 1J0HA 3EYPA 4J40A 1OB0A 3S9IA 4O1DA 1XYFA 4R7JA 1K7XA 1DYSA 3LOTA 1SGJA 3BLIA 3HM7A 5IDZA 3U9IA 3WQCA 1YPXA 1XP3A 5DXXA 2GGIA 3IVUA 4XBJA 3HPXA 4GJ1A 1E0XA 4I5XA 3MVTA 1GOWA 3QHNA 1LUCA 1W5NA 3O15A 3VKKA 2FZNA 1PWMA 1YPIA 3PSVA 4H41A 2ZXQA 3MYPA 2J88A 1V03A 3GXMA 5I3FA 1YBQA 3PY2A 2DY3A 4EACA 2FHCA 3V0TA 1UPMB 1PVNA 3SUUA 2DZAA 1H11A 1YKWA 3ZLGA 2WQDA 1OGGA 3MDWA 3BLFA 4EE9A 1V4YA 5FJOA 3MZNA 4R85A 3RMEA 5IXEA 2GDVA 3WY1A 3KVMA 4GYJA 1WXJA 2ZX6A 1XH0A 1MDLA 3F4WA 3BV4A 5EKYA 1LRQA 3KZSA 1E73M 3R8RA 3ERPA 4L4PA 2ACSA 4BCEA 3LG3A 2PSNA 3DHFA 4FX8A 3WFZA 5T9BG 3VIHA 2PTDA 2A3EA 5AOUA 3HG5A 1KGXA 3LV6A 1AA1B 1F6PA 3NFUA 4PMUA 2R91A 5FOOA 2R1NA 3VDBA 4AUBA 1UH2A 2HVNA 4J9JA 4PA8A 1WKFA 1POJA 2O55A 4Y6GA 3ICJA 3GKFA 1XD1A 4TIMA 3MWCA 3DFOA 4JTAA 3LHUA 5KEZA 3OYZA 1TSIA 3VOCA 2VX6A 3LGDA 3ZWSA 3SI9A 4HNNA 4K1WA 4JFUA 1W5MA 1MUWA 1JJKA 1IIHA 3CZJA 5D33A 1K8CA 3N2OA 3KE0A 2PS2A 3GR7A 2QCFA 1JL8A 1VBUA 2NQ5A 1B3YA 1E5JA 4PMRA 3MQTA 4IGSA 1R9YA 4NYUA 3QTGA 4O18A 5E5CA 4FX6M 3NOYA 2WZIA 4MTVA 5CC3A 3PBMA 2Z1SA 3FAWA 5D30A 4UZSA 4KT2A 3W7EA 3W74A 2E5BA 3ONCA 1RQBA 1DJYA 3MSDA 2A85A 3BJTA 3W6MA 2CLEA 3P14A 1B54A 1KLYA 2WLZA 3UWWA 1T40A 2WB5A 2A5HA 4JTEA 3TTQA 2BFGA 5CZSA 3L5AA 4WGXA 1XSJA 3Q65A 2VOTA 3S1XA 1P6WA 3ARUA 1V7AA 3B8WA 3DHUA 3PFMA 2WO5A 1Z89A 1DWHM 3C2FA 2PDBA 5JH1A 2ISFA 3OA5A 3H7UA 2WMHA 3DBNA 4IG2A 2ABAA 3NSXA 3H2CA 2YXGA 1GYMA 1C8YA 2J78A 4WY0B 3W81A 3OOQA 1ITQA 4GH3A 4J3UA 4NIRA 4DZIA 4GOAA 2ZE0A 1ISVA 3DI1A 2QCMA 5A8PA 1XLLA 2W9MA 1KM4A 1I60A 3GM8A 2Y85A 3MJYA 1M53A 3QC0A 1OCJA 4M24A 3EOLA 2CNCA 3TXVA 4HK7A 3BE7A 5CGMA 2EAWA 3CAQA 2OB3A 4GY0A 4JIQA 4QLLA 3QMRA 4Y9AA 3WQ4A 3S42A 1E9ZB 3N14A 1PZ3A 3E2RA 4W87A 3GDLA 1PS9A 1R47A 3XIMA 5DCBA 1W32A 1Z42A 2AQVA 2Q09A 4PMJA 1LRTA 5CGTA 2OWXA 1QI2A 1K1DA 4KEVA 1JYWA 1C8VA 1VCFA 1RY8A 2FYMA 2D0GA 2VCBA 4UTTA 2VWTA 1D3GA 2OZ0A 1G4PA 3TZNA 3V75A 3PPHA 1K7FA 4YTUA 3WLIA 1SW7A 3D3AA 3WSUA 4H04A 3LQLA 4B3LA 4WF7A 2G5WA 5B7YA 1JXJA 3NOEA 3OQEA 1XI3A 4LVDA 4H3DA 3ARTA 1XBZA 4GY7A 3DYMA 1CGTA 1CGYA 1E55A 2RGLA 2CESA 4Z1YA 4MNMA 4AEOA 1BVZA 2W0UA 3MUCA 4WDWA 3EMQA 4KETA 5DQPA 2GJXB 4R5EA 1UKOA 3D6NA 3L4ZA 3LRLA 1W31A 4FR6A 4PBEA 2HV5A 4FIQA 3G0SA 3LCLA 4K8GA 4IPPA 3VNMA 2QF7A 4XAGA 2NXHA 4RV8A 3VDHA 1G7VA 1NP0A 4RW5A 1J79A 3GAKA 1LG2A 4US6A 1H5VA 1LL6A 1ODZA 4IQEA 4V1XA 3WFAA 3A9IA 2VDIA 1XCFA 2UY3A 1KFJA 4O8RA 4DJDD 3T09A 3DCPA 2YFNA 4PULA 3MSGA 4AC1X 2YCIX 1SMAA 3SGGA 3S9YA 3ZMRA 1BRLA 1O66A 4HMDA 3GR8A 4EPEC 3ZO9A 2XDFA 4TO8A 5AYIA 3WUEA 4AW7A 2PZNA 3QPEA 1EP3A 2CHOA 3L0KA 4MB5A 1BLIA 4EANA 1XRFA 3OYXA 2WPBA 4O11A 3AIQA 2KZHA 3G8RA 4GBUA 1AUSL 5JBFA 3RRXA 4R9OA 4AWEA 2NX3A 3W1AA 4GACA 2ZZ7A 4MUPA 1H61A 2J24A 2O4QA 1BWLA 4IFKA 2UV8G 5HULA 2E67A 2ZUTA 4WKAA 4KKXA 4Z2KA 2VFEA 4I90A 4FAMA 4NZFA 1FVPA 1B9ZA 3KBVA 1H1ZA 2YCKX 2VZTA 3OHMB 1JPMA 2OCZA 1S2AA 3AZSA 2P88A 4B3KA 1XW8A 5H1WA 1C8QA 4JTJA 3MBFA 2Q01A 4UNIA 4DEFA 1AK5A 2FLIA 2GWNA 1ZBKA 1JYXA 3EDJA 2R1LA 4OUIA 1XLJA 2AL1A 3EWYA 3AS0A 4B15A 1CWYA 3HB9A 3ES7A 3VD7A 2YL6A 1XG4A 4QGCA 4W5UA 1MW0A 1HNYA 1M7PA 2ABBA 1H1NA 1XC6A 4OUEA 4P2VA 1ZP4A 2WZMA 1JDEA 3CHCA 3QN3A 1OJXA 3WIJA 4WQ6A 4RDWA 1KM2A 4A8IA 4G56A 1UMYA 4DJEC 4FOKA 5CPOA 2V5CA 4QEHA 1O94A 4K37A 4HHHA 1UWTA 1NWRA 4Q7NA 1YDYA 1YX1A 3IJ6A 3R43A 4QQ3A 3ONBA 3KM8A 1NIUA 2WJDA 5CEWA 2QDDA 1GTEA 3SCPA 4H01A 4DJFD 1SR0A 1MEIA 2HISA 4JY8A 5CC6A 2HWGA 2A3LA 1ZAHA 4ZE4A 3WH8A 1DIKA 2PDNA 1RVGA 3W00A 2QCDA 4M6QA 3D47A 3K30A 4HGXA 1DKWA 3IVSA 2XPKA 2BASA 2PDKA 2VR4A 2IQTA 3URNA 1NF7A 4MMWA 1M68A 1C93A 1B4EA 1ZU8A 3L0GA 3TJ4A 1KBKA 3N2XA 4A21A 3H2AA 3MI2A 1LLZA 5T26A 4MVAA 1V3MA 3PZVA 4DI9A 4LY4A 3SUTA 3LK6A 2JKAA 1TO3A 4UTUA 4MFEA 2PDGA 2Y7FA 3O3RA 4RPQA 2NQJA 4RZ6A 1UG6A 5XIAA 1VCVA 3I3BA 4F2BA 5IDIA 4IIHA 3MI6A 1PYFA 2E68A 3QV7A 3TCEA 4JDBA 1CLKA 3B40A 1NWUA 1KFCA 3ABSA 2Z2AA 3T78A 3GHTA 3U2ZA 3VCRA 4MB4A 5A6BD 3L4XA 2W66A 1BGAA 4MWAB 1ICQA 4JFSA 3N4FA 4QDMA 5U4NA 1WZAA 3C4UA 2QVNA 2FB2A 3KUMA 1UR0A 1EWDA 2V30A 1JEZA 3F5KA 3NA8A 3RLVA 5D9MA 4U5IA 1PB0A 9RUBA 1KM0A 4ADUA 4GQBA 4JOMA 1WQ5A 3M5YA 4NJGA 2NVAA 4NXKA 1R3QA 2PTWA 2OVLA 5A8MA 4CD6A 2J9XA 3EMCA 5C6MA 4MLJA 4IL2A 2WJZA 4O1FA 4BEQA 2YB1A 1HZYA 3DFSA 4JNZA 3QOKA 4OZOA 4DJDA 2G3JA 1MRQA 2FDMA 2RUSA 3IEBA 2JEQA 5AECA 4MIMA 1OK6A 5CSRA 2P1FA 3WJXA 4QFUA 3WDPP 3B4UA 3ENLA 2INFA 1CPUA 2PCEA 4IPNB 1PTAA 4C6FA 3RLGA 5IM51 1EP2A 2HS8A 3IIVA 2EQDA 2IQDA 6ALDA 4S3CA 3W1TA 3FVMA 4MZ8A 3BK0A 1S2CA 2CZEA 5M2FX 2QAFA 3B8VA 3E3HA 3OQ8A 4H7CA 1WXYA 3BPWA 4WY0A 3PJWA 4GC3A 4EWND 1LWIA 3IV8A 1HO4A 2E9MA 2Z28A 3F5LA 1PKNA 1VB9A 1IEIA 4LYQA 4MKSA 5DY2A 1ISWA 2ATSA 4S3BA 2RDTA 1FA2A 3FX4A 2XN1A 4MY1A 3W7OA 1G94A 4Z1BA 1IZCA 1LP6A 1BYDA 3WD1A 1G0CA 2PU1A 2X30A 3RYSA 2RFGA 1UQYA 4HK6A 4IT1A 5A2AA 4ZB0A 4XKMA 2IPFA 1UJQA 4PL2A 3R94A 1ZLPA 3FJLA 3D0CA 4BQ3A 2D2OA 4GFSA 4RE2A 3NQDA 2PDXA 1W9UA 1KWKA 3GH4A 4E0CA 2TODA 1R6WA 3GK0A 4XIAA 4F0MA 3GNNA 3AYVA 4JQ2A 1JPIA 1Z3NA 1A5KC 1TJRA 3KL5A 3PNUA 2GJNA 2V5BA 1IT8A 2PDYA 1W5QA 3P74A 1R9XA 1CB7B 3GTFA 2WHMA 5A1AA 4FI4A 3U2EA 3UNDA 1PX4A 3HFTA 3BMWA 4QDPA 5I3GA 2C1IA 3MUZ1 4GUFA 1CGWA 2OYKA 3QV8A 4FMVA 4LVGA 4XAPA 3N18A 1R3SA 3SY5A 5I3IA 1KWGA 2J7GA 5MHBA 3UU0A 2GSJA 2PGFA 3N1AA 1XH1A 3WCZA 4WLCA 2FTWA 3UWQA 4GC4A 3QY8A 1UW9A 1HJXA 1QI4A 3EX4A 4YN5A 4NJIA 2YDQA 4KCWA 1CT5A 3BLLA 4P61A 4UTKA 4AVFA 2FJUB 3C5QA 3QKZA 2NQLA 1AJZA 4OQVA 4JTTA 1FP8A 2GOKA 3PBUA 5U7SA 3UR7A 4EX4A 3ITTA 3LMYA 5KINA 2QLYA 3SR7A 1GVRA 3AZRA 4AYSA 1IWBA 2V3EA 3NQGA 4IIGA 2X2GA 4GNKB 3UWYA 3QXBA 1OQFA 3WUFA 1LOSA 1AL8A 2QCGA 3WEMA 4YTTA 2WSKA 5AYZA 2PD9A 2VUYA 5FF4A 3VOHA 1F9CA 1Q6LA 4US5D 4HU0A 4IWWA 1L9WA 4HD5A 4K8EA 1XL9A 2I9EA 5C8BB 2C6QA 1JF6A 4HPXA 3KXQA 1W3LA 3PN8A 2OGJA 4BHYA 2DQWA 5CG0A 2ONEA 1FWGC 4UTLA 3R8GA 1KQZA 4JFVA 1K03A 3KRSA 1NH6A 1C8XA 4IJRA 4S3JA 1H60A 4AEEA 4WX2A 4ZVJA 2V2HA 2BY2A 2X16A 2R9RA 3AMLA 5B7ZA 3CL8A 3PB0A 4JTHA 3GUGA 1EYWA 1BG4A 1XH2A 3CPRA 1HKMA 3BW4A 4QROA 1EZWA 5DT5A 4CNUA 3POCA 3NQEA 3WUBA 2HCVA 2ZRZA 1UR3M 5E1QA 4HSNA 2R94A 3NEHA 3OBAA 3DG6A 2QCEA 3NVDA 5CSYA 3H8AA 2ZC1A 4XIMA 3N73A 1GOQA 4H6EA 4M1BA 5BXTA 1E1CA 1JNEA 4U28A 3WF2A 4XVDA 2QJJA 2BHZA 4GVFA 2I57A 2A7NA 3VKJA 1JZ5A 3RR1A 5ECUA 3WL1A 1FH9A 3B4YA 4LSBA 1G69A 4DF1A 1FWRA 1XLCA 2Y70A 1JUBA 2ZUUA 1RV8A 2IUZA 3UYCA 3GHSA 5C2GA 3WD2A 4W8LA 3O6YX 4XX6A 4L9XA 3RPTA 2X2YA 2BX7A 3H12A 1Q66A 1QO2A 3CTLA 4ZBCA 1GOXA 3ZJ6A 2VRQA 3W1QA 2BV9A 4BQ4A 1GOOA 3TJIA 4DVOA 3TR2A 3UWUA 3QLLA 2Y24A 3GY1A 3VZZA 4PCNA 3VX0A 3I10A 5JBDA 1I4NA 1OY0A 1SZNA 1A47A 2P8CA 1WOAA 4G7EB 1L6FA 4NAFB 3TKFA 1HTIA 3TWAA 4ZO9A 2HNHA 2DORA 1S38A 1QI0A 3T08A 4IICA 1IWAA 3NQ7A 3F5JA 3C2VA 2V9DA 3W7GA 3SIZA 1ALDA 1MZRA 3WELA 3O07A 1Q4NX 4CQ8A 2OO6A 3ZLHA 2VRJA 4LVAA 4OBTA 2ZRVA 3RM9A 4JTRA 1R85A 3CU2A 2OSXA 2W5FA 3E02A 1G4SA 1A5SA 3UQNA 4ML4A 3A4WA 3PJUA 5D05A 3VC5A 1K9FA 4UTWA 2DZTA 3R4IA 2PC4A 2I7GA 4IXHA 3UR2A 4BR1A 1WDSA 3HV9A 1BXCA 1ZENA 4WDXA 2GL5A 3QMTA 4DWSB 5BRBA 4C6CA 4PMYA 2EKGA 3QZAA 4LXFA 1VAHA 3VD9A 4IM4A 4KH2A 2ZTKA 2PFHA 2Z4GA 4EXQA 1R5YA 4L1XA 1MDRA 4K36A 5CAKA 5G2HA 1OIFA 5G2IA 3NDYA 1PDYA 3PWIA 4O4WA 4HZ7A 2DPEA 1YNYA 3EX3A 3SY1A 4W8AA 2TAAA 1YNPA 3TNBA 2ZUVA 3TFCA 1KXTA 1JVNA 2VRKA 1TWDA 1OCBA 2DEPA 3E9AA 1H0IA 2BOEX 1UUOA 2GDQA 1N8FA 1ICPA 1YXDA 4Z17A 4CU6A 2PTZA 4Z2HA 5D09A 5CJMA 2QCHA 4BZYA 3COTA 3VI2A 2DH2A 4HCHA 3QBUA 2PF0A 3ZJ8A 5C0QA 3KVLA 4OOUA 4ZO8A 1A3WA 3AZTA 4EPDC 1JXKA 4C6OA 1UWRA 2GUBA 4XG1A 4Q6XA 4US5A 3V5CA 4GD0A 5A3HA 5AVHA 2CFFA 1Q2RA 4C5ZA 4H9YA 1F6YA 2G97A 1JZ6A 3CL6A 1IIGA 1PAMA 1EWEA 5CCZA 4J5NA 4E2VA 2FVKA 3LNMA 3CAKA 3P3BA 4LRSA 4XZLX 4YNGA 5H8MA 3WJSA 4DI8A 1V6VA 2Z6JA 3GDBA 2D2HA 3TOYA 2Y62A 2V5JA 1OFQA 1FWWA 1A0DA 3BVJA 1XLAA 1L6GA 2O7QA 4FA3A 2GGHA 3FSTA 1EGZA 2NXIA 4ATWA 4ZL1A 3C3NA 4CNOA 3EBVA 2QYGA 2D2JA 2ACUA 2J8TA 2QPSA 4F0RA 4U3CA 4N4QA 1PEZA 1KBJA 5AHFA 4PUJA 2PGRA 3AWNA 4ZENA 4IQDA 3PG9A 4B5WA 2I5IA 5G1YA 1EJSC 4D8LA 1W8GA 2DSVA 3T8LA 1Q7ZA 3LPPA 2DZWA 4KRZA 3AYSA 3W6YA 3W1RA 4H6QA 3ISIX 4RV3A 4NASA 4GMEA 2ANUA 4NJKA 4X63A 1DJNA 1WE5A 4HA0A 3SSZA 2QF8A 1TIWA 3NYDA 3VGFA 3YPIA 1WUFA 1V5XA 4HOWA 2XWDA 1ZBCA 2E3ZA 4ADTA 4E8CA 1EPXA 4RL3A 4PL1A 3VKDA 3WNOA 2ALDA 5CSSA 1BWVA 2E40A 1Q8JA 3KAOA 2WNNA 2O9PA 4AH7A 3SRKA 4YS1A 1NTHA 5I3DA 3G6LA 1NAL1 2DVUA 4UFKA 4HP5A 1FXPA 3ARSA 2E9BA 1I1XA 4YYCA 1LT8A 4KFOA 1XISA 2HPIA 4O1BA 1HJVA 3AALA 1W1IE 1QI3A 2YW4A 2YKKA 3WEOA 4HVXA 2A1YA 2VFFA 5M17A 2F38A 2O92A 5AN7A 4UQAA 3O0KA 5C2CA 4RXGA 5CKSA 2NXGA 3O9NA 3OZOA 3S5NA 3TTYA 4QBXA 1OGSA 4KERA 4K7VA 1KBLA 1BSIA 3FOKA 1P1XA 4GISA 4UNKA 5ABTA 1HKWA 3PPGA 1SZFA 3BO9A 3VIMA 5J5RA 3GTHA 2DSUA 5HAOA 4BF7A 2E25A 4NNCA 4O8AA 4F9DA 2PE4A 4Z1AA 4C1NA 3DFQA 3T9PA 2ZX8A 4ILSA 1G6CA 4DAFA 3LRMA 3EEZA 4X9SA 1MQRA 2XIMA 4GJIA 1Z8AA 2PB1A 1XM3A 3TMQA 3AFBA 3UCDA 3WBWA