4JDBA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-005
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-005
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4jdbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jdbA01
1EEPA 3Q58A 3UWYA 4UTLA 1OG0A 4JYEA 4JTIA 1S5WA 2PURA 4UFJA 1E51A 1W3IA 1JUKA 3LXAA 3MBDA 1L6YA 4GBUA 5BRBA 4FF7A 3HG4A 5C5YA 3PUOA 3ABRA 3UWZA 2B4GA 4UFHA 3CIWA 4MYAA 3ABOA 5HUPA 2YW3A 3INPA 5CSSA 4IMFA 3NM3A 1EWEA 2G5WA 4RXGA 5AHLA 1KM3A 4IMGA 3AJXA 1FDJA 1AW1A 4MY1A 3IGSA 1P5BA 1RVGA 3W1NA 3N2MA 3HGRA 1EIXA 2V0TA 1HUVA 1SUXA 4MY8A 5D03A 3BGGA 1JUEA 5AC6A 3MI2A 1JR1A 1W5OA 2WO5A 3KAOA 3SY5A 1YXYA 2GQAA 3W7DA 3GX9A 3PWAA 4HNTA 3P67A 1QFEA 1WYIA 1AL7A 4KWWA 2A5HA 4Z0SA 1XC4A 2VFIA 1TB3A 1DJNA 1C9DA 2C16A 1OYBA 4O53A 3LTSA 3FYOA 3RLVA 1G4EA 2ZA1A 4M7SA 3TE9A 1MO0A 1XBVA 1F76A 1TRDA 2A7PA 2ZZ5A 4JTKA 4N9CA 5EL1A 3EWUA 4EF9A 4ZMGA 3G3MA 1TJPA 2ZZ1A 2R91A 2GPTA 5K9XA 5HQEA 2VXNA 2WJZA 3P8IA 3GXNA 4Z1CA 3M47A 3QC3A 4O12A 1K8ZA 2J9XA 3IRDA 3EX1A 1EP3A 3LCLA 2PRHA 1QO5A 3NPWA 3SSJA 5HWNA 5G2WA 3O15A 1Z41A 4KKXA 1G4SA 1ZFJA 2P10A 3ANYA 2Y7GA 3BO9A 4QIUA 1W5QA 3B0PA 3NQCA 4O11A 5FF4A 4HT3A 3M7WA 1SO4A 3YPIA 1IXPA 7TIMA 2YSWA 1DOSA 3LHUA 1ZHAA 4UFIA 3DAQA 5J5DA 3FOKA 1KFJA 1EP2A 2DZUA 3DI1A 3GAYA 2NUYA 1MEHA 1ZAHA 3G1VA 2V9DA 3KVJA 3W9ZA 4IXXA 4X3ZA 1PCKA 5D33A 1GYNA 4TU1A 4YL2A 3I65A 4BR1A 2CLFA 3STFA 3A5VA 4OBTA 5D09A 1DVJA 4QITA 4XZ9A 1SSGA 1U5JA 4QAIA 2YFNA 1SO5A 3HQ1A 3O05A 4CNNA 4DO5A 3LXCA 4UMBA 3O1NA 5HR7A 3PUEA 4L4LA 2QCGA 4LRTA 4ORIA 4UTUA 3H53A 3KX6A 4P2VA 4XWUA 3QSTA 3W2KA 2QCCA 3B4UA 3NG3A 3QMRA 1H51A 1HO1A 3C8FA 3PULA 1VLWA 2ISVA 3IIOA 3TAKA 1K7EA 4FEZA 3S1VA 4BI5A 5K2ZA 1HTIA 4TR9A 1OFPA 4K7VA 1H62A 3GKFA 4AHOA 1H7NA 4A21A 1KLYA 3W88A 3CLMA 5A8GA 5HWMA 1KV5A 1OK6A 3O07A 4FX7A 4JY8A 3EWYA 2BXVA 1OABA 3STCA 3LDVA 1X6UA 4UR7A 5EKYA 4JD4A 1RD5A 2ZCGA 5T26A 1YXDA 4K39A 3HGJA 3DFPA 3K30A 3I6RA 5LKYA 4D2JA 1LYXA 2A6NA 2ZDRA 3TAOA 1UUMA 2CW6A 4GRSA 3L66A 1LBLA 5AHEA 4LVFA 1OFAA 1GG1A 3LI0A 3MI6A 2GVJA 1I2PA 5I3KA 3MO7A 5GVJA 2CLLA 2NUXA 1TPUA 4AB4A 5FF0A 4JIQA 2QCLA 3QF0A 3P7YA 4IPJA 1W31A 3UXAA 4GUIA 1TTPA 4KFOA 3FEMA 5EYWA 3DFTA 4NX5A 3R8RA 4JN6A 4IMCA 3CEUA 1H1ZA 3W1XA 1XL9A 3PF3A 2WV8A 3V1PA 2BZNA 3L5AA 3OIXA 1IGSA 2QUUA 5KMYA 3SGUA 3IIZA 1G6CA 4FXSA 4MJZA 4IOTA 1KM1A 1B4KA 1UJPA 2PE4A 1FWSA 5LNRA 3OG3A 2CWNA 4AVFA 3QFEA 1DJQA 5KTLA 5AHIA 4JR5A 3PVFA 3CEPA 5CKSA 1GVRA 4CQAA 4EIVA 2C19A 1JQVA 1TJRA 4WJEA 3W2NA 3BARA 3L5LA 2B7QA 5CPNA 1FBAA 3NQMA 3SJ3A 2ZRWA 1Z44A 3T40A 3Q94A 1LTDA 2DZSA 1A53A 2ZFAA 4OWGA 4RKAA 2WNQA 4UTTC 5J5RA 3C2EA 2YYUA 3S5ZA 3DFSA 1BKSA 1Q6RA 4FNRA 2Y7EA 3NQGA 3PC0A 4LRSA 4Q4KA 3S1UA 4BK9A 1ZALA 4HSOA 4N9DA 4O13A 2RDWA 4R53A 3OHIA 2X1UA 4WZHA 5DCEA 3TMQA 3L5MA 1TO3A 4ZQRA 4CQ9A 1VR6A 4GNJA 4QISA 1RZMA 3PBWA 2TSYA 2ZZ7A 3MYOA 5CZJA 2ATSA 1A5CA 4O10A 1WQ5A 3W1PA 3UYCA 1XM3A 1M7OA 1CI1A 3A5FA 3IVUA 4AEOA 3TMLA 3TK7A 3UY8A 2CU0A 3GKAA 1PCWA 5CPOA 2EAWA 4DPPA 4JTHA 3IEBA 5CGQA 2A85A 1RQHA 5F1VA 2VEKA 5I3HA 1OF8A 1GTHA 4WQ6A 4RZ6A 4Z0JA 4N9BA 5D37A 3C6CA 3S5OA 5H91A 3BPWA 1NEYA 3LX9A 2NUWA 2V2CA 3W7MA 1ZAIA 3EWBX 4O4WA 1GWJA 4PODA 4ONVA 4ZVJA 2Z6IA 1T99A 2JK2A 3T55A 3S5NA 2HS6A 4PH6A 1FDZA 2EPHA 5G2HA 2H8ZA 5ABTA 1DHPA 1EA0A 3G1HA 1UBSA 3W2LA 3LCGA 1OYCA 4OT7A 1TTQA 1KTBA 2RHGA 3PSWA 3G22A 2A1YA 1B3OA 2FJKA 3C56A 1OX4A 4WY0A 5D32A 3MWAA 5LHEA 1H50A 3THQA 5D2XA 4HIBA 2GVLA 3L0NA 4O15A 3LLDA 1R46A 2DP3A 1F5ZA 3OVPA 3GAKA 1X8FA 3JRKA 5AOUA 4JEQA 1SW7A 1OFOA 3NQ2A 3TROA 3HIJA 2QJIA 3P80A 4N9EA 3UWVA 2X2GA 3KVKA 3HMJG 5AHMA 4K8EA 1TPH1 4YMZA 2VEPA 5AHFA 1PHQA 1KBIA 3M44A 1EPXA 3O16A 4ZQPA 2J24A 1EB3A 2XFWA 3C0JA 1GT8A 5HINA 4AAJA 2QJGA 4I7UA 1ME9A 1BTMA 1XXXA 1W37A 1P4CA 1PL9A 4JTSA 4YXGA 2OT1A 2P0OA 1O95A 4Y6GA 4JXCA 4RCXA 3IVSA 2NV1A 3LBMA 3W22A 3EKLA 4I7VA 1KM6A 3WK1A 2DJXA 3MBFA 4UFMA 4IMDA 2NXGA 1NAL1 3FKKA 3TH6A 3BW4A 2EKCA 2Z0IA 1ZENA 3UNDA 3UWUA 3EX4A 5K9CA 4RJEA 1GTEA 2A4AA 3F4WA 1IF2A 1D3HA 3W83A 2ZBTA 2E6FA 1YADA 2H3BA 1H7RA 3W2JA 3DH7A 5U7SA 1KA9F 2X30A 8TIMA 1ML1A 2VEIA 3KFTA 1TYGA 3R5EA 1L2UA 2AGKA 1SO3A 1W56A 1HFBA 4E2DA 1SZEA 2BLEA 3GXTA 2DU2A 3CM4A 6ALDA 3G24A 1FCVA 1YDNA 3P5YA 4HSNA 1IIGA 5BMWA 4MFEA 1SW3A 4JTFA 3N19B 4PFMA 4JTUA 5CPMA 3TIMA 3W70A 2CZ5A 1NSJA 3PS7A 3R13A 4LS0A 1IXQA 1GEQA 3NQVA 5F2IA 1A50A 4WOZA 1Q3NA 3WJSA 1QPQA 2VEMA 1DORA 4O52A 2AQWA 4UCGA 5LGXA 3U8GA 1S5VA 5CZSA 1JCXA 2BX7A 3JR2A 2BSLA 3TQVA 2UV8G 1Z48A 5G4WA 1TPC1 1F73A 4UTHA 2ZZ4A 3P61A 1LLWA 3GDKA 1LOLA 2YYTA 3M5YA 3R2GA 1FXQA 5FI8A 2C13A 4ZL1A 3W2MA 3B0VC 2ZQ0A 2FFCA 3ATYA 3TUUA 2YDAA 2HS8A 4NZJA 1W3TA 1H61A 1NF0A 4O0ZA 4R34A 1XBXA 3S9YA 4N6FA 4H6KA 4I7WA 2JGQA 4FNSA 1EUNA 2W6RA 2ABAA 1C8VA 1VYSX 3UY7A 3PSVA 4MZ1A 4MZ8A 1WOBA 1RR2A 1TCDA 3NL2A 2QR6A 3LBCA 3C61A 3BW2A 3DXIA 2QCNA 2V30A 3N73A 3QPZA 4O8RA 4ADTA 3P5ZA 4ZQMA 1VPXA 3NAVA 2W79A 1WBHA 4WY0F 1OJXA 4NNCA 4Y90A 4N6EA 3GDMA 4O54A 3WK2A 4ZQCA 2QCHA 2LLEA 5G1YA 5LNWA 3KHJA 2DZTA 4GXMA 2AAMA 1JCJA 1TTIA 1P1XA 3W1UA 4LW7A 4RR4A 1Z42A 4U28A 2DZVA 4DELA 5H2ZA 1OFQA 1S5TA 2FTPA 1R2RA 3M16A 4FX6M 2YPIA 1QO2A 3G8RA 1VYRA 3P8JA 4CCDA 2E5DA 3FFSA 4X9SA 3WJXA 3GK0A 3S1XA 2CLEA 4DBDA 4NU7A 4LNYA 1FCQA 3Q2DA 4ICNA 4IMEA 5KZEA 5D04C 2FLIA 4GUJA 3G1XA 4CLMA 5AC8A 4XTDA 3MMTA 3MYPA 5DELA 2J88A 3BLIA 4GC4A 3IGUA 2DZXA 3JS3A 2Q8ZA 4H3DA 1VHNA 2J9YA 3W7JA 4PC8A 5LNVA 1BWKA 5EMUA 3WK0A 3C2FA 4UXDA 5AFDA 1KM0A 3S0CA 2Y88A 2J27A 3MP3A 2VENA 4JS3A 3STEA 5AYXA 4NT0A 3BLEA 3I68A 4A2SA 2FB3A 4EWND 4L4MA 2GQ9A 3DFNA 1TPVA 2ZRYA 2PRMA 3RMJA 3KVMA 4MLJA 1RQBA 1KM4A 2WNZA 5DBUA 2C14A 1XBYA 1VYPX 2ZTKA 2PRLA 3C52A 2OX1A 4HPJA 2E6DA 3CT7A 3TR2A 3W73A 5D05A 5DBTA 1ALDA 3G0SA 2QEZA 1WXJA 4MOZA 3QRHA 3DENA 2ZTJA 4HKPA 3O6YX 1J5TA 3KXQA 2CZEA 4FNQA 2V2DA 2OT0A 3ABQA 3QM3A 4GUGA 2V5BA 5AC7A 3W1TA 4R7JA 3M41A 1YPIA 1VC4A 3G8EA 3NDOA 4LY8A 3L0KA 4J9JA 2CLKA 1XBZA 1OYAA 3W85A 3G1SA 1MEIA 4S1FA 4IPIA 5I3GA 2TYSA 5K9DA 4E2BA 4QJ1A 3U2OA 4Y96A 3GDRA 5EPDA 1VCVA 2XN0A 3QQ0A 5I3IA 2V2HA 1WAUA 3E0IA 5D38A 1W5MA 1JJKA 3FS2A 1N7KA 5I3JA 3KRSA 5CZ0A 4QM1A 2ZYFA 4AWUA 5CPLA 3GR8A 1PHWA 1O5XA 3TSDA 2H8XA 4AF0B 1SSDA 1TV7A 3S6DA 2C3ZA 3RLUA 2E5BA 1FCUA 3W07A 1W3NA 3E49A 3L0GA 4WUIA 4LV9A 4AH7A 4DXVA 2JBMA 3W7QA 1PV8A 3GVGA 3UPWA 5G4EA 1KBJA 1H5YA 1YLVA 3T44A 2JGYA 1G4TA 3A22A 3C2RA 1YPFA 3F4NA 1WDWA 3B0UX 1GPWA 3DKLA 4AXKA 4JX6A 5KINA 1L9WA 3PUDA 1D9EA 1YYAA 2DZWA 1SO6A 3NNTA 2VKZG 4UFKA 4UMCA 5AN7A 1EWDA 3RK8A 1GVQA 1QPNA 2A7RA 3NO5A 3B8DA 2Q3RA 3W7HA 2FQIA 3CWOX 3C4UA 3CC1A 2O7SA 5HNRA 3OVRA 3MHGA 1QNVA 3WJZA 2FDSA 4DF0A 3SGZA 1I45A 2E5CA 3PBUA 1OFEA 4UTIA 4JTEA 3C2OA 4MLRA 2H6RA 2X1SA 1ICQA 4FIQA 5C6MA 2OZ0A 2I1OA 5CSRA 4O4VA 3UZJA 1QOPA 3BK0A 1LORA 1YXCA 1LDCA 4S2BA 5K7JA 4A22A 1SQ7A 1T96A 3ATZA 2X1RA 1TPDA 3BG3A 3CHVA 4FX8A 4BWLA 4XUGA 4MY9A 2B0MA 4UUIA 1TQJA 3DFOA 3B06A 3PBVA 1TMHA 1KLZA 1P0NA 2DZPA 5K4ZA 4LTSA 3A21A 3ZFHA 3LOTA 2R14A 4B5NA 3O8AA 2Z2UA 4MUZA 1PE1A 4DEFA 1LRNA 3LRLA 3STGA 4HPXA 3MHFA 1H7PA 1B57A 3HG3A 1EUAA 4JTJA 1H1YA 2QDGA 3NQFA 2ISSA 4FB7A 3GDTA 4Z08A 3SIZA 2WSYA 3LCFA 4ZZ9A 1JUBA 2V8ZA 3NGJA 4M5PA 3W1RA 2CLIA 3RFAA 1JRCA 1M6JA 4JDYA 4UNKA 1HO4A 5AHNA 3W2UA 3ZWTA 4JICA 3L21A 4Z1AA 5FESA 1VCFA 1FWTA 3QMTA 2F84A 5HMSA 1JCMP 4UTJA 3PB2A 1XKYA 3G1FA 5TQLA 4XBKA 3QYQA 3G18A 3R89A 3VE7A 3QJAA 1OFRA 2I9EA 1DBTA 5KITA 1L6SA 2ZRUA 3W74A 5FEZA 3MW7A 4MIMA 3P60A 3M5VA 2RH9A 1XDLA 1X1OA 4NUWA 3QW3A 3EXRA 2RDUA 4FIRA 5FEPA 1F74A 4TX9A 3B04A 1Q6QA 6TIMA 1UUOA 3I7RA 4M6QA 4N4QA 2QDHA 1VJIA 3KOFA 4WY0B 2FPTA 3A23A 2YX0A 3IV3A 3BVJA 4UMAA 1TSIA 3L65A 2ZZ6A 1OVDA 3TDFA 1TPFA 2O7QA 1VGAA 3GZ3A 3W75A 1K8XA 3KRZA 4G1KA 4TMBA 3LB0A 2GUUA 4HN4A 2VFEA 1SR9A 4UIOA 5F2GA 5KZMA 3W23A 1GVOA 3GB6A 3EWZA 3BGJA 1H7XA 3RF9A 3OVQA 1AW5A 3QQ1A 4GJ1A 3HJZA 3H54A 5A5WA 4NNBA 1T0OA 3LHTA 2Y7FA 5HULA 4JY9A 2Y61A 5LNUA 1AL8A 4LVGA 3BW3A 4LU0A 3ZR4A 2QCMA 3LHZA 3N14A 4DO4A 5C54A 2YGYA 2VOMA 2ZRXA 5K3VA 3LM7A 1DQXA 2CLMA 2R8WA 1W54A 4NVTA 3S1WA 2GJNA 4AWSA 4NXKA 3SI9A 3GIYA 3W1QA 4N02A 2YR1A 3MP4A 2DORA 2A21A 2NX3A 1NVMA 1I2QA 1H7OA 3EXTA 3FYPA 4LVBA 1LOSA 2QUTA 1ONRA 1AG1O 3H55A 3DI0A 4MPQA 1OX5A 2QJHA 2VELA 3W1MA 1T8XA 3LV5A 1TV5A 3W7EA 2Y6ZA 4BWLC 1MSSA 5E93A 3P74A 1IXOA 2VFDA 4HNNA 3W71A 4EF8A 4WX2A 4WXYA 2QAFA 5KSWA 5C55A 4LS1A 3LCXA 4JIPA 4UTMA 3NM1A 3TW6A 5DN1A 3DHFA 2QCEA 3LGEA 5E0KA 3ELFA 1WBJA 4JDBA 2XN1A 3W86A 4TIMA 5FEXA 2VC6A 1JVNA 4UTTA 3P82A 3G1DA 1V7YA 2WSRA 4NQ1A 3W72A 5FF7A 1LM1A 4X2RA 1I2OA 4Y9AA 3VI2A 3CU2A 4AWTA 3ABSA 2JKEA 4M7TA 3PG9A 1M7PA 2ATMA 1F7BA 4M6VA 4XTIA 1SFLA 4QNEA 3MI3A 2NX9A 3PY2A 4Y8FA 2RFGA 1JCYA 2NLIA 1VHCA 3S5YA 1YDVA 3GDLA 3HOJA 3ZWSA 5TBOA 2CZDA 1MXSA 3W1LA 4XKYB 4PCFA 1G7UA 3WJYA 1K02A 3LI1A 4K38A 3WFAA 1KV8A 1RPXA 4JTGA 3QH2A 4ADUA 4NXSA 3LXBA 3NZ1A 3NQDA 3TQKA 2XN2A 2EHHA 2Q8LA 3QMSA 4HHPA 1WOAA 3EEGA 3L2IA 1SFJA 1ZNNA 3PAJA 3HO8A 2NV2A 4RXFA 4FXRA 1GQNA 1NFBA 1G67A 4A29A 3W7PA 2GOUA 3W7RA 2NWSA 3MHUA 3HPZA 3DBPA 4OU1A 3S42A 2CLOA 3SECA 2J6XA 3TSBA 3O6CA 5D2WA 4ML9A 3EX2A 3NOEA 3VFLA 3T7VA 4ADSA 1FWRA 2FB2A 5EBUA 4JYFA 1I2NA 1VS1A 2HMCA 5SWUA 1LRTA 3LERA 1SZFA 2G97A 2I14A 4BI6A 1LOQA 4O19A 3NQ6A 2E77A 5G1TA 4ORMA 4UNLA 4DQWA 5IBXC 1FQ0A 4AHQA 3VKJA 1VH7A 5LZLA 1V5XA 2PC4A 1GYLA 4IX0A 2C1HA 1RQEA 3EX6A 1WX0A 2YZRA 2IQTA 1Y0EA 4LC6A 4LVDA 2B7PA 4MVAA 1DQWA 2QKFA 4LUIA 4NJHA 1LBMA 4JTLA 3N2XA 3NVTA 1QPOA 1IIHA 3G3DA 5HJLA 2B7OA 1LBFA 1FDYA 4O1BA 3PG8A 3NXFA 3HPSA 4GUHA 4EVZA 3NL5A 2B7NA 5F1UA 2E6AA 4O1DA 1KFBA 2A6LA 1B9BA 2A0NA 4O18A 5D02A 4OQVA 2GJLA 1GZGA 2C18A 3KVLA 4TO8A 2OJPA 3O06A 1THFD 2CZFA 3C2VA 3NPXA 5DLCA 1XUUA 3SW6A 2X16A 4XKYA 3P62A 1SW0A 4A2RA 3UQNA 2X1TA 2ZA2A 2D73A 3THAA 4TMCA 2YXGA 1QOQA 3KRUA 3LCIA 4PA8A 3BG9A 3PB0A 3NR0A 4BFAA 4NNAA 2NZLA 1R30A 4N2YA 3I7QA 3TKFA 2EF9A 2Y7DA 3BV4A 3LTYA 1FWNA 3UWQA 1OFDA 2YFOA 5DY3A 3UZ5A 3N3MA 3D0CA 3TXZA 4OV9A 4FHAA 1LP6A 1FCBA 3W1AA 5D2TA 1KFCA 3I7SA 2H3DA 1JCNA 2WQPA 1JCLA 4ZQNA 1O5KA 5TIMA 3DFQA 3CTLA 4CNOA 2G96A 3HPXA 5HUOA 4R33A 2E6YA 3QEZA 5F2MA 4C1LA 1H63A 4KFNA 3SZ8A 3B03A 3L67A 3W7LA 1K3UA 2OMAA 2YCEA 3GLCA 3M43A 3E12A 1CW2A 1FUYA 3NQ8A 4IGHA 4NJKA 1ADOA 2P1FA 2CFFA 1XI3A 3M9YA 1Q6LA 3E96A 5EY5A 1TPEA 5BOOA 2Y62A 3TXVA 3TJLA 1JRBA 3EXSA 4W9TA 1A5AA 3BLFA 3W7OA 3TA6A 1TV8A 4K37A 4UC5A 3SFKA 3PBYA 1K8YA 5U4NA 3QPYA 4JGDA 3TU9A 2Y63A 2TPSA 4CCCA 4CNPA 3LHWA 1UCWA 1VZWA 4EOUA 1F6KA 1QR7A 1QDSA 1TPB1 5HR6A 1KFEA 4FNUA 1KM2A 1I4NA 4NJGA 3NZRA 1YTKA 4JYDA 5HWJA 2V81A 4H4IA 1OK4A 4M19A 1WA3A 3NQAA 4K6AA 3HB9A 3UPBA 4DF1A 4PEKA 3B05A 4MKNA 3W7CA 3DHDA 1J2WA 2WOQA 5F2LA 4A3UA 4OGZA 4LC8A 3GR7A 4JX5A 4Z1DA 1YTEA 3TV8A 2WSQA 2ISWA 1ME7A 5LGZA 2VFHA 4LOCA 4YLWA 1MEWA 3W87A 1P0KA 4E0CA 2DJLA 2V82A 1QAPA 4I9AA 1XUZA 3GNNA 2BWGA 2ZZ3A 4O1CA 1MZHA 3CQ0A 4PTNA 1CX9A 2V5LA 3AO0A 1KTNA 1G69A 1TTJA 4UTWA 4MZYA 3HF3A 1K03A 4FNPA 3MJYA 4IWWA 5IBXA 2NX1A 1TIMA 3L9CA 4IUOA 3ZS4A 1EP1A 1W0MA 1AW2A 4UTWC 3TNOA 4O57A 1W8SA 2ABBA 2FPVA 3EX3A 4UR8A 4RLIA 5L9FA 3S8HA 3SR7A 1JQXA 4GE8A 1W5NA 3TC7A 1K7XA 3CPRA 1OF6A 3EWWA 3R12A 5KZDA 1G4PA 3OA3A 3FLUA 1GJPA 2ALDA 1PIIA 2Y89A 3G1AA 4K36A 3W84A 4YCOA 3W7NA 4CQ8A 1TPWA 4NX0A 5CG7A 5EA9A 4O28A 1QPRA 3NL6A 4LV4A 2TRSA 5CZTA 3EKZA 5DXXA 1FY6A 1OHLA 2Y85A 4JNMA 3DKJA 1HG3A 3GNDA 3GYEA 1A5SA 4DBEA 1R47A 2A2IA 1U83A 3E9AA 3EWXA 4DF2A 5DCDA 3CB8A 1SU5A 3TFCA 4IQLA 1ICPA 3NQ7A 4MYXA 2JKPA 1QCWA 3F03K 3LHYA 4NJIA 1KFKA 1OX4B 4K7YA 1VRDA 1DL3A 3RNDA 4GFSA 4ALDA 4PL1A 1FXPA 3QW4B 3NPVA 4O50A 1QWGA 2GVGA 3MP5A 1FWWA 5LSMA 2QUVA 3F1QA 5D2YA 3T78A 1GG0A 3O63A 2Y70A 2Z1BA 3M5ZA 1D3GA 3G1YA 3E02A 2ZRZA 2QCFA 2PCQA 1YDOA 3T4CA 1NF7A 5AYYA 1O4UA 1ME8A 3G0XA 1OFBA 5AB3A 5F4WA 5D2VA 3GXPA 2GQ8A 1BWLA 3TCEA 4AHPA 2NXIA 3HGOA 3NL3A 3FJLA 2EGZA 1KFLA 2C15A 2ZA3A 4P61A 4OE7A 2OCZA 1N55A 1JULA 1X7FA 2C6QA 5I3FA 3FKRA 3HBLA 2CLHA 4Z1BA 1ZJIA 2WKJA 1F2JA 4RZ4A 5DY2A 1K7FA 2R94A 2WPBA 4PL2A 3IVTA 3IGXA 4LT9A 4M6PA 3UD6A 2VFFA 1BEUA 2KZHA 4Q32A 1DKWA 3TSMA 3N9RA 3NEVA 3NYZA 1A5BA 3W76A 4RZ5A 2HSAA 3LRKA 4OHQA 4Q33A 1TQXA 2VFGA 2NXHA 5FF2A 4C1KA 1SZNA 3BG5A 3W7GA 2F7FA 3IIPA 4BI7A 2E68A 2WNNA 4KWVA 3TQ0A 4JX4A 4IX2A 3VE9A 4E38A 2E09A 1ICSA 3P84A 1H7WA 3LHVA 1J4EA 2YW4A 3QZEA 3W7KA 3TFXA 2BTMA 1IXNA 5G2IA 4GWEA 5BMXA 2HTMA 4WXZA 1PVNA 2QAPA 5D30A 4FNTA 1F6PA 1PS9A 4NZFA 3N34A 3VNDA 4MFDA 3DGRA 4U4MA 3UXDA 3CIXA 4X22A 3FIGA 5BW6A 2H90A 1YTDA 4AF0A 1LLZA 4XBSA 1ZY9A 4NJJA 3A9IA 1DV7A 4KFPA 3CWNA 2QF7A 4UTKA 3EB2A 3LTPA 3TC6A 4O0KA 1Q45A 4JTTA 3LCWA 2ZZ2A 3FJ6A 4RX0A 5DCBA 1F05A 1LRQA 1R2TA 3M1ZA 4DPQA 2J9ZA 2W0UA 1XCFA 3DU0A 3N9SA 3TX9A 1GOXA 1GVFA 5MHBA 2NWRA 3WK3A 3QSRA 1SPQA 5LNSA 3O6DA 1FX6A 3NPUA 1EX5A 2QCDB 4LVAA 1L6WA 3IIVA 3U6WA 3A24A 1UB3A 3Q37A 1KM5A 1O60A 3NA8A 1N8FA 4O17A 3V75A 1SZGA 1W5PA 2E1DA 1VQTA 3HG5A 4WOQA 3TW7A 1AK5A 3P81A 4QQ3A 1HL2A 1TREA 1LCOA 1UASA 4BF9A 5F4SA 5BNKA 2TMDA 4LUJA 2G95A 4WD0A 1I2RA 1LZOA 1Q6OA 3MUXA 4CCEA 3LLFA 3PR2A 3VCRA 2JKAA 1W1ZA 1XDMA 3W6YA 4N4PA 3OBKA 5K4XA 3W3OA 3IIXA 4FO4A 4XQ6A 2FIQA 4IJBA 1C29A 1X1ZA 4IXHA 3M0ZA 5AYZA 3USBA 1XFBA 3NQEA 1B4EA 3TJXA 3HGSA 3HG2A 2ZRVA 3LV6A 1RV8A 3UWWA 2Q3OA 4LWWA 4GUFA 2FPYA 1ZAJA 2RKXA 3LRMA 5DXYA 1G7VA 5FEWA 3M6YA 4YWIA 4POCA 4O1AA 5G5IA 2C0AA 3OEXA 4HNVA 4O14A 4K8HA 4O16A 1VCGA 4HNUA 4ZQOA 5F4XA 2RDTA 2A7NA 4OV4A 2Z6JA 4RV8A 5C2XA 3G0UA 1QMLA 2QCDA 1GVSA 5E1QA 4AMAA 3FA5A 1M5WA 1H60A 5L6UA 4QNWA 1I8JA 3RU6A 4YCPA 4RK8A 4S2CA 3LCHA 1LROA 3WJWA 4DO6A 3M5XA 1S3HA 1WV2A 1ZCOA 4MJMA 3C3NA 1TRIA 1AMKA 5FF3A 3DZ1A 4LS2A 4QSHA 5IM51 5LHFA 1KW1A 1VLIA 1KTCA 3PM6A 1O94A 4UFLA 3L68A 1R2SA 1OX6A 3W7IA
chains in the Genus database with same CATH superfamily
1XPYA 3L4VA 1E6SM 5DMYA 5LIXX 1W9XA 4UTLA 3MU7A 4JTIA 4JYEA 1W3IA 1JUKA 3HQPA 1JD7A 3LXAA 3MBDA 3SQSA 1UHVA 1P6CA 4GABA 2VT0A 3ERPA 3HG4A 3KS5A 2QW5A 3LS9A 2WMFA 1E15A 2YW3A 3FDKA 3N11A 4RNFA 4IMFA 2IPJA 1O68A 3CV6A 1R5YA 1FDJA 1AW1A 4MY1A 3F2CA 3CGTA 3N2MA 4HTYA 1EIXA 4H7ZA 2ZUUA 1Q85A 3JU2A 4NZ3A 1HUVA 1DYSA 3VOGA 4UB9A 3VDHA 1UC4A 4D6IA 1BQCA 3SY5A 5CPTA 2XGIA 1V3LA 3RIKA 3WUBA 4JCLA 3V5CA 2OGJA 4DJED 2CPUA 4MWAB 3N1AA 2C16A 1UWUA 4S3CA 3LTSA 3FYOA 1G4EA 5DT5A 2WMJA 4WRHA 2A7PA 3GC5A 4GBDA 3GR4A 3RO6A 4EF9A 2ZZ1A 1XDJA 2D22A 3M7SA 2FVLA 4Y9OA 2CXGA 3P8IA 4B3ZA 1K8ZA 2J9XA 3IRDA 1QO5A 1E4LA 2UY2A 3O15A 4E5TA 2JQXA 4FXFA 1G4SA 1ZFJA 2P10A 3ANYA 3R0KA 4QIUA 1A0CA 3B0PA 3WQ8A 4HT3A 2XSBA 1SO4A 4I5XA 1UPPA 2NQZA 2XH7A 1ZHAA 1JFXA 2QDDA 4DX3A 1GOIA 5A8PA 3C0LA 2RGLA 2G3IA 3GAYA 4DJDA 3KVJA 3W9ZA 2VGBA 4X3ZA 1K77A 4FOUA 5D33A 3I65A 4BR1A 1QK0A 8CGTA 1SSGA 3IUDA 1U5JA 2PDQA 3UERA 4KERA 3LXCA 5EMLA 3PUEA 4L4LA 2QCGA 3CUFA 4QCEA 1UZ1A 2Q01A 4P2VA 3QSTA 3NG3A 1H51A 3M0MA 3PULA 4WGXA 1VLWA 5D8ZA 1FWGC 3IIOA 4YJ5A 4FEZA 4BI5A 2QS8A 1HTIA 4ZOEA 3QQWA 1A5MC 1Z9AA 4N42A 4CNTA 1M7JA 1OWQA 3CLMA 5A8GA 1TVNA 1YX1A 4KWOA 3EWYA 4QS5A 4UR7A 4JD4A 2ZCGA 1OT1A 5T26A 5I00A 1YXDA 3AHZA 3K30A 5LKYA 3E1F1 2I17A 1XX1A 2CW6A 2WZMA 1LBLA 5AHEA 3L4WA 3T42A 1GG1A 3R43A 5A6BA 1TUFA 1I2PA 1M01A 2Z1KA 5I3KA 4FZIA 4KCTA 2G3MA 2GSJA 4IPJA 4GUIA 3GHUA 1TTPA 3AS1A 4KFOA 4ASTA 3R8RA 1H1ZA 2VVNA 3N18A 2BZNA 4RW3A 3WSUA 2OLHA 3TNBA 3WDPP 4XZLX 1B4KA 1UJPA 2E67A 1FWSA 3OG3A 2CWNA 4AVFA 1Q2RA 4C6MA 2J62A 3CAVA 4U2ZA 1KGXA 3CEPA 4UQDA 3VIJA 1WXZA 1GVRA 4EIVA 2BOGX 4PTDA 3SUVA 3GXDA 4DZ5A 2H9AB 4WJEA 3BARA 2B7QA 3NDYA 3SJ3A 2ZRWA 4U3AA 4W5UA 1LTDA 4RKAA 1S5MA 2OYLA 1CBGA 2Y7EA 1XYLA 1KQYA 2OSWA 3PC0A 3AROA 4Q22A 3GNRA 4O13A 3OHIA 1MMFA 4WZHA 3GE7A 4DWSD 1TO3A 3MT1A 4FAMA 2VOTA 1A5UA 1X6NA 1RZMA 4GNJA 5CPSA 1A5CA 4DLFA 2GDQA 4O10A 3UYCA 2FMNA 3TK7A 4J2MA 4U5KA 3QY8A 2P8CA 2VDHA 1GQIA 3PTDA 4GYKA 1J5SA 1AH4A 2A85A 1RQHA 3OOQA 3H23A 1GTHA 1TWSA 1GNXA 1V6UA 2V2CA 5JVLA 5AZ1A 4ZVJA 3T55A 3KBNA 2E0PA 1E6ZA 4RDZA 1XFCA 3WO8A 5HQMA 1V3KA 3G2GA 2OU4A 4PH6A 4B2DD 3NTYA 1UD4A 3KL0A 2H8ZA 1DHPA 1EA0A 3ID7A 3G1HA 4GIYA 2YXOA 1NP0A 4YVPA 4NZ1A 3W28A 2A1YA 3WQPA 3UR8A 4UBPC 3ZQ9A 1B3WA 4WCJA 3MWAA 1HKWA 4ML4A 4R85A 5AC5A 1QNSA 3ZLHA 1KWGA 1X97A 3TTYA 1M53A 4ECLA 1PX3A 2OX4A 2AAAA 2WM0A 1EDTA 3CASA 3HIJA 5A1AA 1UOZA 4N9EA 3UWVA 3KVKA 3HMJG 3MKCA 5AHMA 1B30A 4HHHA 5AHFA 1KBIA 3O16A 5BZAA 2J24A 2CKSA 1IGWA 1EB3A 5HINA 3JVAA 4QBXA 1DJXA 3VIIA 3H2NA 5CC7A 4ZENA 1ISWA 3N13A 2PBOA 4YXGA 4TV5A 3RX4A 1O95A 4JXCA 3IVSA 3SO7A 1W17A 4JZ5A 4DAFA 4M1BA 1JYWA 1NAL1 2ZUWA 3UNTA 3WZ0E 2EKCA 1SGJA 5A6KA 2A4AA 5A6JA 4YNGA 3W83A 3SM0A 1YADA 3VX0A 3J7HA 4E4FA 3VIHA 2X30A 4NYUA 4KCWA 3R5EA 1L2UA 1SO3A 3GSMA 1QOXA 2YOCA 4G56A 3F5JA 6ALDA 3GXTA 3CM4A 1FCVA 3KW3A 1CDGA 1ENUA 3P5YA 4E8CA 3AU2A 3NWRA 3W70A 2DW6A 3PS7A 1EO7A 4LS0A 4LF2A 1HVQA 1RSCA 4WOZA 2E3ZA 1GYMA 3IK2A 1QPQA 3IAQA 3TOYA 2AQWA 5LGXA 5D9MA 4QTGA 5CZSA 4A6GA 2BSLA 2ISFA 1TPC1 1F73A 3EOUA 3GDKA 3M5YA 4ZL1A 5FI8A 1FXQA 2C13A 1PZ0A 2JEPA 1PTDA 5CZKA 2ZQ0A 3ATYA 3O9NA 4NZJA 5HK4A 3WBAA 1NF0A 3GXMA 4O0ZA 1AH0A 1XBXA 1NP2A 3GM8A 4HB7A 1JAKA 1VYSX 1YPXA 2HBVA 2QR6A 2J7DA 4W87A 1SJDA 2DIJA 5CBIA 3N73A 3QPEA 4ADTA 2BGNE 1H0IA 2XM1A 1JPHA 4WY0F 1OJXA 4NNCA 3IUHA 4C7FA 4XAGA 4O54A 3WK2A 4I6KA 4ZQCA 5LNWA 5G1YA 3GTIA 4PUWA 3BZJA 2BDQA 4GINA 1TTIA 5C9ZA 3A4JA 4KRUA 2DZVA 3N4EA 1OFQA 2YB4A 4FX6M 1FHVA 2YPIA 1VYRA 1RLDA 1M7XA 3QVQA 2X41A 3GK0A 1O1HA 3MVTA 4DBDA 4NU7A 3B8TA 3WL1A 3ZJ6A 3S5SA 3C3UA 1EF2A 4PUJA 3BLIA 3JS3A 4LUTB 2E1WA 4BY3A 4D6CA 3W7JA 3NOYA 4AZGA 4W84A 2VDIA 2QYGA 3TJ4A 5AFDA 3S0CA 3MP3A 1WDQA 2E8ZA 2E4TA 5HA7A 4CQCA 2WVTA 2FB3A 4EWND 1FWBC 1M41A 3VK5A 1RQBA 4EE9A 5DBUA 2ZTKA 2WMIA 1AQFA 1PYFA 4PN2A 4JNYA 1V6VA 3SCVA 1OIMA 4HPJA 3S2MA 4LEFA 4FXJA 3CT7A 3ME3A 5D05A 2QEZA 3DC8A 4MOZA 3DENA 2ZTJA 4DJFD 1J5TA 1OZQA 2GUBA 2OT0A 2INFA 3EOOA 5BWAA 1E4NA 1JI1A 4AFYA 4GUGA 2V5BA 4R7JA 3M41A 2Y5EA 7REQB 3K8MA 2VGGA 1SJAA 3SY8A 2ZC8A 3L0KA 4EACA 2CLKA 3W85A 3FCPA 4S1FA 1UJQA 4GO8A 4AY7A 1TWDA 3KZPA 4L6HA 4ERIA 3D47A 3CQJA 2I5IA 4HCDA 4PB3A 4HSHA 5EPDA 1JNEA 3GG1A 1VCVA 3AC0A 5D9OA 3QQ0A 4J3UA 2YLAA 3U7VA 2GDUA 3KCJA 4R3UA 5DFAA 5CZ0A 3SCTA 4QM1A 2ZYFA 3GR8A 1O5XA 3CXOA 2YBTA 4HMCA 3S6DA 5ABHA 2J47A 3NFUA 4QQUA 4JTAA 4ZBCA 1AA1B 1FCUA 2W3ZA 1W3NA 3L0GA 4R5EA 4LV9A 1HJQA 2JBMA 2IPWA 1DWAM 1GEHA 1I9CB 5G4EA 1YLVA 4ZODA 4PE8A 3LNPA 5GJNA 2TODA 4GKLA 4MDOA 4JBRA 4HOWA 4XIAA 1GPWA 4JKLA 1HGYA 2DZWA 1H0GA 3SRFA 2DIKA 1E6QM 4NI3A 1L0PA 2F38A 2GJXA 3RK8A 1S1PA 3RPTA 1YMYA 3TZFA 1YW1A 4W5ZA 5EGRA 4TQTA 3WF1A 3MHGA 2VX4A 1QNVA 3CT2A 3F5KA 4DF0A 5FJUA 4C1NB 3SGZA 1LL4A 1X96A 1EC9A 1OFEA 3C2OA 1AFSA 4DBUA 3WD4A 2AOSA 2H6RA 3T0BA 4PBEA 3SRDA 1BYAA 3I6TA 1N2VA 1QOPA 3BK0A 2VJXA 1YXCA 1UH3A 1G5AA 4Q4SA 4EXBA 1RVKA 3E0FA 1K9EA 3TC3A 1LWHA 4X60A 4CUCA 5CQ1A 2G4FA 3CHVA 1IEIA 4XUGA 2B0MA 3GW0A 1M3UA 2ZC1A 3B06A 3OZMA 4BQ4A 3UG4A 4LB3A 2CESA 4PRWA 2WHMA 1KLZA 2DZPA 2Y8VA 1CPUA 1PB0A 1X7IA 2J8FA 3S1GA 3ZFHA 3LOTA 4B5NA 3O8AA 3BANA 1M68A 5CGMA 1E9YB 5D9PA 4LYRA 1OC7A 3MHFA 1BAGA 4FOKA 4CCZA 1B57A 3HG3A 4JL2A 1PDZA 2BOFX 1EUAA 3NQFA 4XKMA 2ISSA 3SIZA 2QV4A 2FZ8A 2CLIA 3UFYA 4IPNB 3OU8A 3VUPA 4UNKA 1HO4A 3EPMA 2QPUA 3ZWTA 3MCMA 3L21A 4LBRA 2F84A 5HMSA 4UTJA 3GIQA 1FWDC 2FKPA 5FL0A 1UC5A 2FTWA 3H24A 4XBKA 3T2PA 3QYQA 3WF2A 3G18A 1E0UA 3ARRA 2I9EA 1FWAC 4QLKA 5KITA 3SCRA 2XIOA 3STPA 1N8WA 4NKCA 4NUWA 1W1A1 3AJ7A 2HISA 3EXRA 1QUMA 3B8VA 1P6WA 5HMFA 1P0DA 1XLAA 3ONBA 3B04A 1QK2A 4IIEA 4N4QA 2QDHA 2GSEA 4RPPA 5A6SA 2OLAA 2YX0A 3IV3A 4HNCA 1TSIA 2VRKA 1UWAA 2C0HA 3T4WA 1LLOA 5ABEA 4G1KA 1F3EA 3REQB 3S47A 1IHIA 1SR9A 3VOJA 4QEEA 3GB6A 1GOQA 4HVXA 3AXMA 3OVQA 3OBEA 1AW5A 3WDRA 3HJZA 4RUBA 3D6NA 5GNXA 4NNBA 3HV9A 3NSMA 4RPQA 4MNMA 3QHNA 2DDXA 2VZUA 5HULA 2Y61A 5LNUA 5BXRA 3GC2A 1B5TA 4LVGA 3B3DA 1DP0A 2WKGA 3BW3A 3FJNA 3AAMA 2WKLA 2V5DA 1O12A 2ZRXA 3WBXA 2X09A 4ZFCA 1DQXA 1W54A 1FHLA 2GJNA 4CNSA 4I8DA 3EOSA 3WFLA 1EF3A 1GW9A 5DX7A 1UMLA 4IP4A 3MP4A 2DORA 1V3IA 3PZTA 3CLWA 3QFWA 1NVMA 3OBAA 5A69A 3EPNA 3LQLA 3SDOA 3WEOA 1W8GA 3EXTA 3TYUA 4M0XA 1LOSA 1NOFA 1ONRA 4BF7A 1QI0A 4BEUA 2J66A 1T8XA 1DEDA 1HL8A 1MSSA 4IPLA 1IXOA 4WXYA 4EWJA 5KSWA 3PZMA 3LCXA 4UTMA 3BAIA 5BCAA 5BWFA 1H3GA 3DHFA 2QCEA 2IPGA 2XN1A 4JDBA 3W86A 4NQ1A 3W72A 1EXPA 1I2OA 3VI2A 3ABSA 2JKEA 5H8MA 1WXYA 2OG9A 3JUGA 1SFLA 3W27A 3AHTA 2NX9A 3PY2A 3WD0A 4PB4A 1JCYA 2NLIA 1JIBA 4NF7A 4WSKA 3RR1A 3GDLA 1SR0A 5HMEA 1CB7B 3W1LA 5CJNA 3WJYA 2JALA 5ECVA 1B1YA 4FOJA 1RPXA 4ZE5A 4Y7EA 1NH6A 1H2JA 3T07A 4ADUA 2FHFA 4MWAC 3RLHA 1K70A 2XN2A 1JD9A 1FOBA 2Z25A 3QMSA 3PJTA 2YCKX 1WOAA 3L2IA 2JF6A 1EJXC 2VYOA 3KWXA 1R3VA 4RXFA 4KWSA 3DGBA 3W02A 4NAEB 2P53A 1GQNA 1NFBA 4A29A 3W7PA 4E2VA 3G1RA 4LXFA 3PZIA 1UQYA 3MHUA 3HPZA 2CLOA 1SYTA 4LX4A 5D2WA 3MVIA 1DIOA 4OIFA 4UQBA 2GUYA 3NOEA 4KBXA 3T7VA 4ADSA 4FI4A 3PPFA 4JYFA 5CAKA 5FJJA 1WZMA 2HMCA 3AYSA 3MSYA 2ASHA 2P76A 1SZFA 2G97A 1W3LA 3NQ6A 4G7EB 1ZZMA 2QGYA 5JMUA 4ORMA 1E56A 3WMCA 2POZA 4F8XA 1FQ0A 3DN5A 4CU6A 3VKJA 5FL1A 2HROA 3UCDA 4MB5A 1V5XA 2PC4A 3RR4A 2BB0A 1UKTA 2YZRA 3WN6A 4LC6A 2Z7GA 3OGVA 2CIPA 4JTLA 1YNYA 1QPOA 1H09A 4Y8EA 1S2VA 2Z2BA 3NXFA 4GUHA 2IKGA 3P0XA 2PZ0A 4H6EA 2FVMA 1B9BA 4TX6A 5HJXA 3GRIA 5C9RA 2A0NA 4O18A 4OQVA 1XRSA 4GGBA 3MUAA 1EX1A 3IWPA 2XVKA 3CL7A 4JIRA 4LUYA 2OJPA 2BY2A 1JF6A 1QU4A 1XUUA 2X16A 4HCLA 1F8IA 1OD8A 4ACZB 5I09A 3UQNA 4DZAA 2ZA2A 2YXGA 1S2TA 3KRUA 3NR0A 4BFAA 2WSPA 3WBWA 3XINA 1Q6GA 1FWNA 2F2KA 3N3MA 3TXZA 4OV9A 4FHAA 2C1GA 1FCBA 4HJWA 3W1AA 5D2TA 1KFCA 3ITXA 1JCNA 1NWUA 2J25A 3P14A 4EKJA 2OXNA 3VO0A 3FYYA 3QEZA 4C1LA 4GJIA 3S4TA 1PX4A 2OMAA 4IMAA 1HX0A 4AX7A 3LG3A 3M43A 3L4TA 3N6HA 1CW2A 1FUYA 4B5XA 4IGHA 4NJKA 1S3TC 2P1FA 2CFFA 3EPOA 2XZ7A 1XI3A 4HU4A 4LNCA 3E96A 1A0EA 2VX5A 1XLJA 3OLIA 1JRBA 3H8AA 1LWJA 3BLFA 4W8LA 3UEQA 4AU0A 4ROQA 7TAAA 2CCRA 3WLLA 1CENA 3ANVA 2P3EA 2TPSA 2NVDA 1EZWA 3LHWA 3VNZA 4EOUA 1Z8AA 1FWFC 4CD4A 1QR7A 3TTOA 1KM2A 4L1XA 1XYMA 1YTKA 5HWJA 2NLYA 2YCLB 2GFTA 3VGHA 4H83A 1Z6KA 1NDZA 2NW0A 3NQAA 2OYMA 2WAGA 2C7FA 1J6PA 3DHDA 2FJUB 4C6OA 4LC8A 4AY1A 4JX5A 4ATLA 5J04A 1YTEA 2WSQA 2OEKA 1M65A 2OQYA 2J74A 5CSYA 2VFHA 4YLWA 1P0KA 3W87A 3OW1A 2V82A 1B3YA 3AXIA 1XQKA 4I9AA 2ZX5A 2W9MA 2ZX8A 3LMZA 1HKKA 1DJZA 4FSAA 5IHRA 2BWGA 1NTHA 1CX9A 2P5NA 2V5LA 1X98A 4GZIA 4PFHA 1TTJA 4UTWA 2ZIDA 1P6BA 1RCXB 3HF3A 1K03A 4CN6A 1VFUA 3BXWA 4IWWA 1PSCA 4UTWC 1LT8A 4RW5A 3TNOA 1W8SA 2FPVA 3VC5A 3E3HA 1XQLA 1K7XA 3EWWA 2C79A 1OQFA 4Y9PA 3OA3A 2WLZA 1WUEA 4R9OA 1YE4A 3W7NA 2VRQA 4CQ8A 1TPWA 4NX0A 2PDLA 3QGVA 2PSNA 2WCAA 4IPPA 5EA9A 4LV4A 1OCQA 2TRSA 5EFFA 5DXXA 1CLVA 5JUVA 3U9IA 1A5SA 3E9AA 4F79A 2W63A 4M80A 3TFCA 3ES7A 5LA0A 4MYXA 5TD4A 4HPNA 1QCWA 3F03K 3DHUA 1GW1A 1P0EA 2ZXAA 3RNDA 3OG2A 1NOWA 4ALDA 1J0YA 2V5CA 3QW4B 3NPVA 4UQ9A 4AZCA 1BRLB 1FWWA 1GG0A 2Z1BA 1DWJM 2PLKA 3R10A 2BY1A 1GOKA 3SAZA 4GQGA 3E02A 3TTEA 5CCZA 5AYYA 1LUCA 6ENLA 3NCOA 1O4UA 4J28A 5AB3A 3GXPA 2GQ8A 4BA0A 4OTKA 4AHPA 1U1JA 3NL3A 3F4VA 1EC7A 1IR1A 4S3GA 2PDWA 5C8BB 4EPEC 1ZJIA 2FZNA 1F2JA 4RZ4A 4RE3A 3H21A 2WPBA 3PTMA 4F2UA 3IVTA 3UD6A 2VFFA 1K9FA 2KZHA 2W4XA 1DKWA 3N9RA 5E70A 2HSAA 3LRKA 4AMCA 1TQXA 4RNIA 3BG5A 4WDTA 1XLKA 3IIPA 3OQ8A 1Q2SA 2WNNA 2YBVA 3NDZA 2WMHA 1OCBA 1H7WA 1R3SA 5A6AA 3TFXA 3MA8A 2BTMA 2Z00A 2ZADA 2YDRA 2VURA 3V4BA 3QBUA 5HJYA 3VNDA 4U4MA 1HJVA 3UXDA 3FIGA 1D2KA 4DUWA 1OCNA 4NJJA 7CGTA 4KFPA 4OKDA 2DW7A 2ZXQA 3TYBA 4DI8A 2ZZ2A 2VEGA 2PWFA 1UYQA 3ZMRA 4RX0A 4XZWA 1LRQA 1R2TA 3TLQA 3BSMA 4ATDA 1XCFA 1GOXA 2V63A 1R7OA 2NWRA 3WUFA 1SPQA 5LNSA 3MSGA 3WLPA 4LVAA 1BYBA 3U6WA 2ALRA 3QLLA 1FA2A 4HMDA 4O17A 1IWPA 1SZGA 3WUEA 3HG5A 1ZS2A 3TW7A 2A3LA 2XFFA 1E70M 4LYPA 2BXYA 4AZBA 1TELA 1ESWA 1K4GA 3A9BA 3SJNA 1LCOA 4C6IA 4BF9A 3ARYA 2Y5JA 3OZYA 5BNKA 4MJ2A 4JAWA 1EEXA 4BQ3A 4MB4A 4M6UA 1JGMA 1A3WA 4XBJA 4D71A 4HN8A 2J77A 4IJCA 5I5RA 3LPPA 2FIQA 1RUSA 1ZBCA 3BLLA 3USBA 3GY1A 4YN5A 1JI2A 3HG2A 2Q3OA 3HTWA 1F3WA 4DYEA 1SMDA 3FV9A 4GUFA 1VIZA 2YDSA 5FEWA 3OYZA 4YWIA 3VAVA 4O1AA 2C0AA 3LN3A 4ILSA 3AXXA 4K8HA 1VCGA 4JOMA 4HNUA 5F4XA 1A5LC 1E71M 4ZQOA 4B5UA 1XSIA 1PDYA 4RV8A 5C2GA 5C2XA 2D0GA 3M0IA 2QCDA 1GVSA 4AMAA 3FA5A 2Q6ZA 4C60A 4RDYA 4B5WA 3M5XA 1O5RA 2Q71A 3C3NA 2PD9A 3DZ1A 5FF3A 3RU8X 4YYCA 4QSHA 4EX4A 2EEXA 3BUVA 2OSXA 2DSKA 2XH0A 3WH8A 1O94A 4GX8A 4H6RA 2BOEX 4LUTA 2IKJA 3Q58A 3ARXA 3UWYA 2DSWA 5I3DA 1E9LA 3SQLA 1S5WA 2PURA 4C6JA 1Q6DA 4GBUA 4LYQA 1NM9A 3PWIA 4FF7A 5C5YA 3PUOA 3ABRA 3ICJA 1J8VA 3INPA 5CSSA 2CETA 1EWEA 2F8QA 2G5WA 4JEJA 5A6TC 3RITA 3IGSA 3OTRA 3W1NA 3ISIX 3HGRA 1E1EA 2V0TA 4Z2IA 4MY8A 5D03A 1WZAA 5AC6A 3KDOA 3MI2A 1JR1A 2WO5A 3CAWA 3KAOA 3ZVIA 2GQAA 1C92A 3GX9A 3PWAA 4HNTA 2VEFA 4J35A 2A5HA 3W26A 1TB3A 1DJNA 1U30A 4O53A 1AD1A 2O4QA 5AVNA 2YA1A 3DG6A 2ZA1A 4GH3A 1E6NA 5MKGA 2R82A 5IFPA 1HKIA 5FJPA 4B91A 3CL8A 4ZMGA 2DVTA 3G3MA 1V0MA 5A6BD 3KRBA 1D8WA 1FWCC 2VXNA 4ZEPA 3M47A 3QC3A 4F0RA 3WYZA 4RDWA 1EP3A 3LCLA 2PRHA 3NPWA 5T9CE 3SSJA 5HWNA 5G2WA 1Z41A 3BO9A 4QJ3B 2P88A 1CGUA 3GNOA 3O0KA 3E5BA 1IEXA 4UFIA 5J5DA 1G0CA 4NY2A 1KFJA 1C9WA 4PCPA 1EP2A 1MW3A 1XISA 2B31A 2DT1A 2Y5SA 2NUYA 1O7AA 1DQUA 1ZTVA 1MEHA 3D46A 4K68A 1TR9A 5BXSA 2IPFA 2VUYA 1REQA 1PCKA 3R11A 3VD3A 3WUGA 4TU1A 1KRBC 3U48A 3ARVA 4YL2A 4YTQA 3VIOA 5D8WA 4HYWA 4QITA 1LL6A 2VM8A 4QAIA 2YFNA 1LQ0A 4GNVA 4RZBA 1OBAA 1VEPA 2A3EA 2BY0A 4DO5A 1CYGA 1QNPA 2XYLA 3UR7A 4UMBA 3O1NA 4XSLA 4IHCA 3TQPA 4JHZA 2I9UA 3H53A 5REQA 1I0BA 4XWUA 4FLQA 3W2KA 3B4UA 3C8FA 1DE6A 3R94A 2WJFA 1TJ1A 3VNLA 4B90A 5K2ZA 3NJ3A 4TR9A 4H8VA 1OFPA 3E2QA 4E3TA 1FWHC 4GYPC 3GKFA 4I5RA 4GI9A 2YKKA 5HWMA 4KEVA 1QNOA 2VGIA 4JY8A 1BTCA 3OPSA 1Q4WA 3AYTA 5EKYA 1RD5A 4K39A 2GWNA 3HGJA 3VD9A 1OGSA 1CXIA 2A6NA 3NO1A 4GRSA 1OFAA 3TVAA 1CECA 3LI0A 3MI6A 1JNDA 5CPQA 5HPOA 5FD0A 4E4PA 2PWHA 1P1MA 1S2WA 2CLLA 4D6DA 1ZL1A 4CD7A 1KKOA 3VOHA 5FF0A 2QCLA 3QF0A 2Z29A 3V36A 3PPCA 5BXPA 3W1XA 3EOEA 4EPBC 1OINA 1OEPA 4PCTA 3V1PA 1IGSA 5KMYA 4S3AA 4FXSA 5A8MA 5FAJA 3PWGA 3E0LA 2REQA 3GU9A 4PGLA 1GQKA 5LNRA 3AIEA 1DJQA 3GZAA 3XISA 2WWDA 2XGBA 4JR5A 2NSOA 3PVFA 3VDBA 1QPKA 2Z4GA 5BU9A 2UY4A 3WQ4A 3WMSA 3AI0A 2Z1SA 3W2NA 3QTPA 2HE8A 3ZIZA 1GZ1A 3VOFA 3AMKA 3AWNA 3NQMA 4R9XA 3CZKA 3Q94A 3PZ9A 4X9YA 2DZSA 1ZBKA 1A53A 2ZFAA 5J8LA 3UZXA 4OWGA 5CAHA 1XICA 2WNQA 2WWCA 4MKSA 4UTTC 5J5RA 3AUOA 2BVTA 1Q6RA 5LA1A 1RHCA 2PGEA 3UJ2A 4GXWA 4Q4KA 1E5JA 4GFIA 1ZALA 4HSOA 1PKNA 4I6VA 3DEQA 3AIWA 3MS8A 5C0QA 2XSAA 4PB5A 1UG6A 1OG6A 2TSYA 1GVIA 4F2BA 1UD5A 1YE6A 3IVUA 3A5FA 4RNHA 3ZVHB 2V67A 3VTRA 5I07A 2D23A 5IDIA 5CPOA 2EAWA 1CIUA 4ZSUA 2HNHA 4KPLA 3UCCA 5GPRA 1RP9A 4RZ6A 3A3WA 3C6CA 4HMEA 3S5OA 4KRZA 1CCWB 1EJVC 3LX9A 3DYMA 4L1GA 4E3VA 1ZAIA 2PTXA 1AMYA 1T99A 1ITQA 3S5NA 3PZVA 2FVKA 3ZT7A 3MUZ1 1UW9A 2RJGA 3VM7A 1UBSA 5GQBA 3W2LA 4OT7A 3N25A 3WQ5A 4X0NA 4WDUA 2V38A 1B3OA 1ODUA 4XV0A 2WSKA 3AS2A 4GY1A 3EA1A 4HZ6A 5DQPA 5I02A 4XG1A 1H50A 4Q4RA 1CXLA 4US6A 3IAPA 1EPVA 5CEWA 3OVPA 5AOUA 4AZIA 4JEQA 1SW7A 4YPJA 3NQ2A 1W9VA 1ZJHA 3E2SA 2BHZA 4ZOCA 2VCBA 4G9PA 4XAPA 3I10A 1MUMA 2XFWA 1GT8A 3R58A 1N8IA 3T05A 2QJGA 1HJUA 1XXXA 5KZ6A 4V28A 1QBAA 4QDWA 4S23A 2E7FA 5RUBA 1I60A 2P0OA 4GCAA 4DJDD 1W1B1 4KRTA 2OQLA 4HMNA 4RCXA 3LBMA 3LM3A 4GVGA 3EKLA 4I7VA 2PDUA 4OECA 2DQXA 2DJXA 4E4UA 2BXZA 1US2A 3MBFA 2NXGA 3TH6A 4PUUA 3UU0A 1TZ7A 2GVYA 1AVAA 2QHAA 1CLXA 2D3NA 1D3HA 2XWDA 1MUWA 2ZBTA 2GGIA 1P7TA 2E6FA 1A4LA 1R9XA 1KA9F 4MWAE 3UVAA 2VEIA 3KFTA 2AGKA 4E2DA 1XPGA 1SZEA 4KWUA 3IK4A 5BMWA 4MFEA 1SW3A 2EXOA 3TIMA 1QW8A 1OCJA 1L8PA 4HNLA 2WQDA 3WQGA 3CTTA 1A4MA 1GEQA 5F2IA 2NQLA 3WJSA 2VEMA 4W86A 1E55A 3R7MA 4UCGA 3U8GA 1VBRA 1S5VA 4UNIA 4H9XA 5JBDA 2CWXA 2UV8G 1Z48A 3G6MA 3AYRA 4UTHA 4IFRA 2XFRA 3R2GA 3TTSA 3WLKX 1P7TB 7PTDA 3B0VC 2YDAA 2HS8A 3TTQA 1J0HA 4IQEA 3MZ2A 4R34A 1KXQA 1MUCA 3WCZA 4H6KA 4I7WA 2JGQA 1V08A 2C71A 1EUNA 2ABAA 4L5ZA 3UY7A 4GIRA 1HJWA 4MZ8A 1WOBA 1W9DM 1WDRA 3C61A 4C6CA 3DXIA 2OQHA 2RGMA 3D3AA 3QPZA 4O8RA 5EU9A 3P5ZA 3UETA 1VPXA 3Q65A 3VD4A 4Y90A 1Q6EA 4N6EA 1IEQA 1G1YA 1H49A 2QCHA 2DZTA 3SFWA 4HP5A 4AZ6A 2AAMA 1GPFA 4XD6A 1Z42A 3APGA 4DELA 4QJ4B 3IJQA 5DMLA 1JDFA 3WQFA 2UBPC 4AYGA 4GNKB 1IR2A 3AZSA 3RRXA 3M16A 1QO2A 3G8RA 3P8JA 3WJXA 4IICA 3FAWA 3Q2DA 4ICNA 5KZEA 5D04C 2FLIA 2FGBA 5AC8A 2X1IA 4XTDA 3MMTA 3MYPA 5DELA 2J88A 3IGUA 1ZP3A 2DZXA 4GYPA 4L7ZA 1T8QA 3CS2A 1BWKA 3BJFA 4J5NA 4UXDA 3V18A 4DWSA 4B16A 2J27A 1RJPA 4EAYA 3DESA 4JS3A 5CLWA 1IT0A 3STEA 4NT0A 2ZVIA 3L12A 3GHSA 4CD8A 4L4MA 3DFNA 1TPVA 5CGTA 2OOGA 3AIVA 1KM4A 3ZJKA 1VYPX 3UYIA 4V2XA 3R1ZA 3P93A 1HW6A 3ALFA 1MZRA 3WFZA 3TR2A 3GQYA 5C9WA 4J40A 3IV8A 3G0SA 1QI4A 1XLIA 2OO0A 4JN8A 3FEQA 1CXEA 4JHMA 1C90A 3CUXA 4A8LA 4I8YA 3ABQA 4B15A 3U7BA 3QM3A 4W88A 4GC3A 1EDGA 2CBUA 1VC4A 3G8EA 4LY8A 1XBZA 1OADA 3A6OA 1OYAA 1V77A 4H41A 5FACA 4D72A 1MEIA 2CXEA 2WVSA 4IPIA 4OBSA 5I3GA 5K9DA 1CGTA 1KBKA 1IWAA 1J10A 3CUJA 1JGIA 4Y96A 4UWMA 3H4XA 2DIEA 4BCEA 3ABXA 2XN0A 3T2QA 5I3IA 4PMOA 2NVCA 1WAUA 4LCSA 4S3BA 3E0IA 5D38A 4BZYA 1JJKA 2QF8A 4AWUA 5CPLA 3WD1A 1KXVA 1X1NA 3K2GA 7A3HA 2H8XA 2PZNA 3B8SA 1SSDA 4NRSA 4C1NA 1O1ZA 4M82A 3RLUA 2IMRA 1RPKA 3AOFA 4B4FA 3W07A 1BG4A 1XGDA 5CG0A 3PJWA 4Q8QA 3W7QA 1PV8A 5JXQA 4QGCA 3VKDA 2YCLA 1VKFA 3A22A 3BICA 3W82A 1WDWA 3LPGA 5KINA 2G37A 1SO6A 3B40A 2O4MA 2PDIA 5C7VA 3WLSA 4GQQA 1EWDA 2GJPA 1GVQA 2QJJA 3ONCA 4JN7A 3N4FA 3WEMA 3CWOX 3C4UA 4ACYA 4DWSC 4ATWA 3WQEA 2FDSA 1I45A 2E5CA 1XSJA 4JTEA 5HNTA 4MLRA 1L2QA 2YBUA 1G94A 3UT0A 5B7YA 4GQRA 4IH3A 1D7KA 4FPSA 3TJIA 5C6MA 2OZ0A 2I1OA 4AZ5A 1BD0A 3W38A 4KF1A 5K7JA 5M3WA 1T96A 2OKOA 4YS1A 1XLHA 3KOYA 2XIIA 3S9IA 4FX8A 1V02E 4MY9A 4UUIA 3CMJA 3DFOA 1VEMA 3M6DA 1GVEA 1TMHA 1O6IA 1TR1A 1LF1A 1MNZA 4I9TA 4LQ1A 4GISA 3JW7A 4BEQA 3II1A 4AIOA 1KR0A 4E2OA 5LIWX 3QOKA 2VD8A 4HPXA 2PWVA 2QUNA 1VRXA 4M81A 1TMLA 2PDMA 3VOCA 4JTJA 1H1YA 1I0DA 4DIAA 2WB5A 3GDTA 4NZ4A 1Q7QA 1SFSA 3EDFA 1JUBA 2X40A 3KOWA 1YQ2A 3W0KA 1JRCA 5AHNA 4JICA 4ZTXA 4RE0A 3H4GA 5FESA 4Z1AA 1VCFA 3QMTA 1OGGA 2P50A 2PLJA 3PB2A 2XIJA 2XIBA 3QJAA 2A3HA 1V02A 3UA3A 3MW7A 4JNZA 2RH9A 3TN6A 4CQBA 3QW3A 3IACA 2PAJA 5FOOA 4XD5A 2XM2A 6TIMA 1EZ2A 1UUOA 2O9OA 1VJIA 4WY0B 1EXBA 4HZ7A 4K1GA 4D6JA 3GVWA 3TDFA 1TPFA 1PPIA 4AVNA 4CEXC 1VD6A 1VGAA 1K8XA 2DSUA 1Y5WA 3F2DA 2Z28A 3LB0A 3HFTA 4UIOA 5KZMA 3W23A 4QJ5B 3EWZA 3RF9A 3NSNA 4F2TA 2ZWZA 3QQ1A 5AVHA 2DFAA 4AD3A 1V0LA 3C0SA 5A5WA 3LHTA 2PBGA 2GJXB 4JY9A 4MNLA 1UD2A 4PMYA 4Q3MA 1EYEA 2WLYA 1WNOA 3WQWA 3U2EA 4LU0A 2YB1A 3LHZA 3SCPA 4DO4A 5C54A 4OUEA 2YGYA 2VOMA 4DWDA 2R8WA 1SJBA 3S1WA 4AWSA 4NXKA 4AW7A 3W1QA 4N02A 5EMMA 4H9ZA 2A3BA 2NSXA 2A21A 2DUXA 2PDGA 1I2QA 2AL1A 4D9PA 1EKOA 2WMIB 1KCXA 3C0QA 4NHVA 2ZVRA 4FLOA 3FYPA 4LVBA 2QUTA 2VL4A 4HYVA 5E6ZA 4MPQA 1OX5A 1ZCCA 1XLFA 2DEPA 3G5EA 1VJZA 2Y6ZA 3S2NA 3UVIA 5E93A 3F7JA 4KIEA 1EGVA 4HNNA 3W71A 5EB8A 1JFHA 2YA0A 5I7GA 3GG0A 5M1TA 2QLYA 2NVAA 4PUDA 1UKQA 2C91A 3RX2A 5DN1A 1BXCA 1TWIA 3LGEA 3URAA 3A4AA 1WBJA 5FJOA 3MKVA 1JVNA 4UTTA 1XV8A 2XG9A 2WSRA 2NQ9A 3LZ5A 3LYEA 7REQA 4Y9AA 3CU2A 1L6GA 4AWTA 2Z26A 1M7PA 2ATMA 4M6VA 4XTIA 1R87A 1R9YA 3WLTA 4C7DA 2OEJA 3IRSA 3HOJA 1CGXA 2CZDA 1MXSA 1G7UA 1NDYA 1K02A 3ZLGA 5I03A 3LI1A 4P7NA 4K8GA 3VOIA 2W66A 1KV8A 1UR9A 5JBFA 3N15A 1AQ0A 3NZ1A 4XUYA 2Q8LA 4HHPA 3MMDA 4F48A 3HO8A 2NV2A 4J3VA 2I56A 2AQOA 2BVYA 1ECEA 2PP1A 1G67A 4JHOA 4WVXA 3K13A 3N2TA 5IRPA 3W7RA 2PTYA 4C6DA 3DBPA 2EJAA 2J6XA 4Q8OA 3MSDA 2R1KA 1XCWA 3A3XA 1PEZA 3K5XA 1M03A 1FWRA 2FB2A 3QY6A 1UMYA 1LRTA 5FSEC 2JF7A 4MMWA 2I14A 4BI6A 1RY8A 1TCMA 4Q4PA 1MXGA 1HNYA 4DQWA 1FH9A 3BSHA 4HA0A 4AHQA 4MF4A 1MW2A 2PDKA 2C1HA 1F3TA 1XLBA 1XG3A 2CEQA 5A6MA 3MV01 3I4KA 3LD5A 2B7PA 3QR1A 4GMEA 4NJHA 3B4YA 2OSYA 4F9JA 4UR9A 4D8AA 4PULA 3G3DA 4O1BA 4J1OA 1BXBA 2J75A 4INFA 1UR0A 1C93A 2B7NA 2Y1HA 2YDQA 4XZNX 4QXIA 1TWZA 5CC3A 2A6LA 3UXLA 4LUSA 1PBGA 3EYPA 1OD0A 3B9EA 1B54A 4TO8A 4GYJA 3K1GA 1THFD 5DLCA 2ZX6A 1BRLA 3SW6A 3FNDA 4D8LA 3S3GA 4NL1A 2QZRA 3SCUA 3THAA 2DVUA 1QOQA 4PA8A 4DJFC 2CBVA 5JBEA 3HN3A 4JFUA 2NZLA 4N2YA 3I7QA 3MCNA 4DBSA 2Y7DA 4GO9A 1V6WA 5I6SA 5IDZA 3MC5A 3UZ5A 3D0CA 4HHLA 3UJFA 3FA4A 2VGFA 3I7SA 3N6JA 3EA3A 1PZ3A 3SGGA 2WQPA 1JCLA 1Q63A 3PZOA 1XIMA 3DFQA 4DUXA 2G96A 4KFNA 3DC0A 3SZ8A 3B03A 3L67A 3W7LA 2YCEA 3GLCA 1HP4A 3SBFA 3UZWA 3K8KA 4NSBA 2BGQA 1NJJA 3N29A 1KC7A 1IWBA 3LK6A 5EY5A 5BOOA 3N6QA 1ISYA 1A5AA 4YU1A 4B5VA 3BAYA 3W7OA 3TA6A 2GYIA 2ICSA 3GUWA 4K37A 4UC5A 1XLCA 4M51A 2V5KA 3OP2A 3QZ6A 5D4YA 3CMFA 4OJYA 3RN6A 3URQA 4CCCA 4HOZA 1VZWA 2W62A 1F6KA 1TPB1 1UIOA 3CYJA 4PCNA 4FNUA 3LPFA 1QW7A 3MWCA 2G3FA 1HQTA 3SY1A 4AD0A 2P0IA 4JYDA 2DZAA 2AKZA 2PU1A 3OZOA 1OK4A 3VDCA 1WA3A 4K6AA 3HB9A 4DF1A 3W7CA 3PZNA 5F2LA 2WOQA 4A3UA 4TVUA 2V3EA 3VILA 4Z1DA 2PI6A 1ME7A 1UR2A 3A13A 1E4MM 4FR1A 4TVCA 2D2JA 3BOFA 1S1RA 5LGZA 4IG2A 4E0CA 1W9UA 1HL9A 4PTWA 2IKIA 4HGXA 3EZ4A 1XUZA 2PODA 3GNNA 3UESA 4O1CA 1MZHA 4GCXA 3AO0A 4CQDA 4GZJA 3UJEA 1FWIC 3PZGA 4C6NA 1E0WA 3N17A 2NX1A 3L9CA 5HMDA 1QHZA 4QLJA 3H7RA 3M0YA 3AXHA 4O57A 4RLIA 2VD9A 2D24A 5KEZA 3ENLA 4WJ8A 3KE0A 1JQXA 4GE8A 2WMGA 3CPRA 1OF6A 3V5OA 4U31A 2QVHA 2A3CA 2ALDA 2XH2A 4B4HA 2Y89A 4K36A 1Y7VA 1V8EA 4YHGA 4YCOA 5IOBA 1KKRA 3VABA 1QPRA 5CZTA 2GGHA 3DKJA 3R25A 3GNDA 4NRRA 2A2IA 3CB8A 1U33A 4PUMA 4IQLA 1ICPA 3NUKA 2E9MA 4JQ1A 2PDJA 3DOPA 2O9PA 3GYCA 4K7YA 1J0IA 1DL3A 9RUBA 1GGOA 4O50A 1QWGA 1BG9A 2UWFA 4Q7IA 1MFUA 1ONWA 3T78A 5MF5A 1H4PA 1Z89A 2Y70A 4EPDC 2QDEA 2VZOA 2XHYA 4NZ5A 2QCFA 3NSXA 1YDOA 3WLNA 4TOQA 1ME8A 2VR4A 5BOFA 5F4WA 1BWLA 3QN3A 2EG7A 3LBOA 2NXIA 5H6HA 4KEZA 1V3MA 2EGZA 2C15A 2ZA3A 4P61A 1EDQA 4OE7A 1JULA 2C6QA 3KEHA 3PPGA 3FKRA 1UZ4A 2OVLA 1MVYA 4PMZA 3HBLA 4AZHA 1XG4A 3U4FA 1JXJA 2WKJA 5DY2A 3VZZA 4CKQA 2R94A 2BHYA 1J9YA 4R27A 4AXNA 1TA3A 1E73M 4F3HA 4Q32A 4HA3A 5DEZA 4OHQA 4Q33A 3HU7A 2VFGA 4C1KA 5FF2A 2E68A 4KWVA 2ACRA 1PKYA 3VE9A 4FF5A 2E09A 1B3ZA 3P84A 1CWYA 2XIMA 3QZEA 2BP1A 4PMJA 1IXNA 2XWEA 1FKXA 3UCQA 2CBIA 3M07A 5D30A 4FNTA 3RUBL 1PS9A 4NZFA 1VBJA 2AGTA 4MFDA 3ZJ8A 3LMYA 1VFOA 1UP0A 1YTDA 4MWAD 3UXIA 3VA8A 1AUSL 3A9IA 1DV7A 1YNQA 2EPLX 6A3HA 2VC5A 4UTKA 3LTPA 7ODCA 4O0KA 1Q45A 1DWIM 5M03A 1MQQA 1JDAA 1F05A 1PZ2A 3NZPA 4NYYA 2HE5A 1RK6A 4DPQA 3ALGA 3BMWA 5GJPA 5HANA 3WK3A 2PWGA 3QSRA 5LXEA 1E4IA 3U5UA 5GNZA 1EX5A 3A24A 1DJYA 1UB3A 4ROPA 1LUCB 4P8UA 1F4AA 3LLXA 3Q37A 1KM5A 3FAXA 3V75A 4QG8A 1W5PA 1YHTA 3WELA 1FVPA 2VQTA 1ONEA 3P81A 1HL2A 1TREA 1VBHA 1K9DA 1UASA 1TIWA 2Z1VA 1R3WA 2IUZA 4QEHA 2TMDA 4DNHA 4WD0A 4C65A 2EPNA 3LLFA 2QIIA 2JKAA 3CPGA 1W1ZA 1NFPA 2XPKA 3L4XA 3W6YA 1V93A 4N4PA 4ICMA 3OBKA 3DFHA 1V3JA 3W3OA 4IFOA 2VX7A 3IJDA 2MNRA 2PWDA 2XH4A 3GH5A 4XVDA 4J3TA 1B4EA 3N2CA 3TJXA 1VBUA 1U22A 1RV8A 4LANA 3UGRA 3M0LA 3PJUA 1XYFA 5DXYA 1ZAJA 3LRMA 3AALA 1G7VA 1DXEA 3M6YA 1A5NC 3SUTA 5G5IA 5AECA 9CGTA 2RDTA 3U2CA 2ACQA 2Z6JA 3G0UA 1KBBA 1QMLA 3S83A 4NAEA 3SB0A 5I77A 2QJMA 3RM8A 1R3YA 4S2CA 3B97A 3LCHA 3U3HA 3O7UA 4MJMA 3MCOA 3GTNA 1TRIA 2GLKA 2FH8A 4Q8NA 4LS2A 3LNMA 1KD0A 1KW1A 1VLIA 2WC3A 3T08A 1CEOA 2QULA 1XLLA 1GJUA 1R2SA 2NQHA 1EEPA 3BDKA 1OG0A 4J2PA 1HVXA 4UFJA 1E51A 4LALA 1P43A 4JIEA 3RX3A 3WNNA 2D0HA 3UWZA 2B4GA 4UFHA 1JZ4A 3M0XA 3CIWA 4S39A 7ENLA 2V6AA 3ABOA 4MNKA 3SUWA 3UG5A 2VWTA 1ECQA 4RXGA 2I5GA 1KM3A 3RCMA 4GY0A 4ZO6A 1WKYA 1PX8A 2ISDA 1RVGA 2TAAA 1JYXA 3SRKA 3CHEA 1GK8A 5HATA 3WBYA 3BGGA 2IKHA 3WQ6A 3AU6A 1YXYA 3W7DA 4Q8UA 3AS3A 3S46A 3P67A 1QFEA 4W85A 1WYIA 4KWWA 1C9DA 3TOPA 4GYFA 4M7SA 1MO0A 1XBVA 1TRDA 1EFZA 2QIWA 4N9CA 4GX9A 4WKAA 5EL1A 4V1XA 3MV11 4FLSA 2R91A 2GPTA 3M0KA 5K9XA 4P7RA 4QG6A 2WJZA 1ODZA 1S2AA 3H2FA 1TG7A 3DBNA 3OO2A 1FH8A 3F2BA 5C2CA 1POJA 1JDCA 4Y9MA 3UW6A 1E5NA 4A3RA 3NEHA 4KKXA 2Y7GA 1W5QA 3WY1A 4YTTA 8A3HA 5HOSA 3M7WA 4IT1A 3E2VA 4UZUA 1ZP4A 4G7FA 1EJWC 1DOSA 1UR3M 3DAQA 3FOKA 1RK5A 4J3ZA 1KWKA 1VPYA 2DZUA 1DJGA 1EQCA 2PTZA 1ZAHA 1UP3A 2J8GA 1XKJA 2R1NA 1DPMA 2FGLA 4BJHA 3BLDA 2DT3A 4AVOA 2CLFA 3A5VA 4GIAA 3QHMA 5D09A 4GVHA 2WVVA 4LB4A 2ONEA 2FMOA 2RUSA 2BBFA 3FSUA 3VKCA 1MQPA 2VNCA 3KBJA 3WF0A 4ORIA 4UTUA 1XW8A 2VWSA 3KX6A 2QCCA 3CMGA 2DH3A 1HO1A 1DJWA 4WKFA 3V0SA 3CZJA 1K7EA 4Q6XA 2KAUC 3FY1A 4JKKA 5TAOA 2G41A 4AHOA 1HKJA 4A21A 2GK1B 4S3EA 1ITUA 1E3ZA 3TCSA 1OABA 3STCA 3LDVA 8RUCA 1WB0A 4HZMA 1ZBVA 1PYMA 4Z2HA 3C5QA 1A49A 1HJSA 2X0SA 4Q6JA 1U1HA 4IF2A 5JIWA 2DY3A 4W4QA 4D2JA 1LYXA 2DT0A 2ZDRA 3SN1A 3NXLA 3L66A 4DYJA 3RXZA 4G7EA 4LVFA 4IIBA 2GVJA 4ZR8A 3MO7A 1K6WA 3TZNA 4H04A 3S2JA 4AB4A 2YCIX 4JIQA 1VIWA 1W31A 3UXAA 5IFTA 3FEMA 3BWWA 4NX5A 4IMCA 3CEUA 5E9AA 5LIYX 1IZJA 1VFSA 3PF3A 4WJXA 2WV8A 4ZE4A 3L5AA 2QUUA 1JEZA 3IIZA 1TA3B 1G6CA 1UKOA 4NI8A 1XHGA 1KM1A 2PLMA 4QHRA 1QW9A 1Q6CA 2OWXA 2XU2A 3OYXA 3WD3A 2C19A 2OKTA 4WSJA 4US5A 4DN1A 1JQVA 2IXUA 2XZ9A 2YXXA 5E9XA 1FBAA 4AG0A 4CEUC 5HNNA 1Z44A 3T40A 2OEMA 2HJPA 3VZXA 4QS6A 5FKYA 3WH6A 1M1BA 3DDMA 3DFSA 1BKSA 2PDYA 1AQMA 2ZDSA 4FNRA 3NQGA 1PAMA 3MTWA 4JTCA 4LRSA 4IL0A 3S1UA 1YBQB 1ZJBA 4N9DA 4UOJA 2DVXA 2RDWA 4R53A 4IGMA 1X39A 2X1UA 5DCEA 3TMQA 2D0FA 3GU2A 3L5MA 5IHSA 2OOFA 3U0HA 1VR6A 3CO8A 5CZJA 2VRJA 4LAZA 1WQ5A 3COTA 1XM3A 3HQOA 1M7OA 1CI1A 1AODA 4AEOA 3UY8A 2FHCA 2CU0A 3M64A 3MDWA 1DJIA 3H22A 4K2SA 4XD3A 1PCWA 5DANA 1E1CA 3IJ7A 4JTHA 5CGQA 3VIFA 3CZ8A 4Q4QA 1WKDA 5E5CA 4RNJA 2VEKA 2PC8A 3PZUA 4UOQA 2X05A 3V1HA 1F6YA 4X0VA 4N9BA 4F0MA 2W92A 2X2YA 4A4AA 3EWDA 5H91A 3BPWA 2BY3A 3WLQA 3W7MA 4PSPA 4FS9A 3NIYA 1GWJA 1UUQA 4PODA 1E0TA 4ONVA 2Z6IA 2JK2A 1FDZA 3HPAA 2EPHA 3VFCA 1TV2A 2JE8A 4ERGA 5ABTA 1I6NA 2YL8A 4G8TA 4ZCWA 1TVPA 1FP9A 4PUKA 4JCMA 4C90A 3T0DA 2ZXBA 3VZYA 1HN1A 2CYGA 3RM4A 4MB3A 3LSCA 3C56A 3IJIA 4DZHA 3BLPX 1OX4A 1POKA 5D32A 4C6LA 1A5KC 2ANUA 3THQA 2GVLA 2CHRA 2R1LA 3K8LA 4O15A 4A8NA 2ZUVA 4AIUA 2IQDA 2OTDA 3K4WA 1X8FA 2GSHA 1V0NA 3BV7A 3P80A 3VKAA 4EXQA 1GUVA 5EBAA 4K8EA 4YMZA 2VEPA 2O9TA 3GTFA 3M44A 1R7AA 4ZQPA 3WBEA 2V3GA 1P0BA 4ZSTA 3BOXA 1TX2A 4JTDA 2VMFA 2WNWA 1HJXA 4QROA 2E9LA 1W37A 3WQCA 5HDRA 4HZ8A 4JTSA 5JIPA 3O6AA 3CAQA 1TZZA 4Y6GA 2NV1A 4QX4A 3W22A 1Q6FA 3T0TA 2VCCA 3TN4A 1KM6A 2XUCA 4YTSA 1I75A 3BGAA 4UFMA 4IMDA 3FKKA 2DUZA 3FK4A 1ZENA 3UWUA 3NVDA 3SN4A 1GTEA 1K6AA 1IF2A 4XAFA 3V3WA 1TJ2A 2EKGA 2IS7A 3W2JA 3O0FA 1XINA 3QR3A 3V7PA 8TIMA 1ML1A 1V6TA 5A95A 3WLIA 1KO0A 1TYGA 4EP8C 4CU7A 3IUIA 2J7FA 1EJUC 1RXOB 3G24A 4HSNA 3URBA 4JTFA 4PFMA 5CPMA 4UOZA 3KLLA 2CZ5A 1MDLA 1E6XM 1IXQA 3NQVA 1Q3NA 1RCQA 4O52A 2UY3A 5T91A 1JCXA 2BX7A 1P48A 5E0CA 4ZFMA 4KCVA 5G4WA 3ARSA 1QWKA 2ZZ4A 3P61A 4C6FA 1LOLA 3ZSTA 3W2MA 2FFCA 4PTVA 2DUAA 4F4RA 3BJTA 1W3TA 1RJRA 5REQB 4V27A 4N6FA 4FNSA 1LG2A 3N2OA 1C8VA 3VMOA 3PSVA 2WC7A 2WMKA 3WLRA 3LBCA 2RDXA 3BW2A 3FHQA 2QCNA 1KCKA 2Q02A 3SUUA 4L80A 4ZQMA 3NAVA 1JYNA 1WBHA 4L9XA 3WMLA 3GBEA 3GDMA 2R9RA 4DY1A 5I79A 2LLEA 3KHJA 4GXMA 4WSHA 4GZ7A 1NFGA 4RR4A 2EG6A 5CBBA 2PUZA 3VIGA 3GNXA 3RJXA 3PK7A 2XIQA 4CCDA 2E5DA 3WEZA 1E3XA 3GHRA 1WDSA 3VMNA 4JQAA 4FLRA 3S1XA 2H9AA 3AZTA 3PNZA 2HVNA 4LNYA 1FCQA 1FFRA 4IMEA 3ZVHA 3G1XA 1TV3A 1V03A 4EK7A 2XJ7A 1G01A 4PMRA 2VX6A 1PIFA 3N12A 2PA6A 2XTKA 1PKMA 4IZGA 4YVXA 1VHNA 1XIIA 4Y9NA 5LNVA 1W3HA 4HPHA 2D3LA 4MAVA 1KM0A 3PBGA 2Y88A 4PTMA 1FKWA 3GH7A 2VENA 2HV5A 1BGAA 3B0YA 4L9YA 4EAMA 2HXUA 2PRMA 3RMJA 1ISVA 4D6HA 2WNZA 2PRLA 5LXXA 3R8GA 4DRSA 3C52A 4WEVX 3OIHA 3RM9A 3W73A 1LG1A 1WAWA 4HKPA 3O6YX 1TE1A 1OSEA 4R7OA 4FNQA 2PWUA 1W6TA 4S3FA 3TYEA 4AWEA 3WNMA 5AC7A 4WLCA 1LQ2A 3FHAA 2CZVA 2OR2A 4J9JA 3F4DA 1XLDA 4XK2A 2EPKX 2HEJA 2VP8A 3PUGA 3G1SA 1NWSA 1LT7A 1UH4A 1W9PA 1HGWA 4KGLA 4QJ1A 2AKMA 2HBXA 5A94A 4GACA 2X7WA 4HU8A 3B9NA 4C91A 5DO8A 3TYCA 4I90A 1W5MA 3FS2A 1KXTA 5EMYA 2J4GA 5I3JA 3KRSA 2JEQA 3WQOA 4GZEA 4WGHA 1PHWA 3TSDA 4ES4A 1Q5MA 4AF0B 5DRCA 3BAKA 1TV7A 3LGGA 2C3ZA 4H1ZA 2E5BA 3E49A 2AMGA 3GVGA 1KBJA 3L2LA 6REQB 2P8BA 2JGYA 4HTBA 4Z17A 1YPFA 4A05A 3F4NA 2J13A 4LCRA 4AXKA 5B80A 4MDPA 3PUDA 3POHA 1NELA 3NNTA 4GI6A 1UWSA 1Q65A 5AN7A 1YDYA 3D5HA 4IGNA 1W3JA 2A7RA 3NO5A 1UWQA 3W7HA 2FQIA 2F6KA 3CC1A 2I57A 5HNRA 3OVRA 1QHOA 1WKFA 3WJZA 3BAXA 1Z7AA 3EGJA 1FRBA 4AUBA 4CVUA 1F61A 5HPCA 2PF0A 4XAYA 3WG6A 4YHEA 2X1SA 3E6EA 3T0AA 4AIEA 5CSRA 2QPXA 4KGJA 1RAKA 3UZJA 4YTUA 2J7CA 1BKHA 1LORA 4PMVA 3SCQA 4A22A 3VVGA 2X1RA 1V6YA 4J7RA 1S39A 1FHDA 4REQB 4WF7A 3BG3A 2F9RA 5DT7A 4BWLA 1EYWA 1TWWA 1TQJA 3OHMB 3VGGA 3PBVA 2YIHA 2XVLA 1P0NA 1V6XA 5A8QA 3EDEA 2PWEA 1T40A 4WHBA 4PUEA 3A21A 3EDDA 3A4XA 2R14A 1IYXA 1PUDA 4MUZA 3MPGA 4JQ2A 1XR2A 4DEFA 3GXIA 3LRLA 3STGA 1R86A 3E2RA 3IJLA 3SRHA 4P8XA 4XZBA 1KBLA 4DYKA 4KH2A 2QDGA 4LY4A 4ZGYA 1DJHA 3FGCB 4Z08A 2WSYA 3CH9A 4ZZ9A 1WKEA 4PYSA 1MXDA 2VC7A 1E1FA 4JDYA 1BF2A