4JDNA

Secreted chlamydial protein pgp3, c-terminal domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
144
structure length
144
Chain Sequence
b'KAFNNFPITNKIQCNGLFTPSNIETLLGGTEIGKFTVTPKSSGSMFLVSADIIASRMEGGVVLALVREGDSKPCAISYGYSSGVPNLCSLRTSITNTGLTPTTYSLRVGGLESGVVWVNALSNGNDILGITNTSNVSFLEVIPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virulence plasmid protein pGP3-D
publication title Structure of the Chlamydia trachomatis immunodominant antigen Pgp3.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Cell invasion
total genus 27
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1340 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jdnA00
4JDNA 4JDOA 4JDMA
chains in the Genus database with same CATH superfamily
1H8VA 3HVDA 1UW8A 4M3CA 1DGWX 4CCKA 4XCBA 4ASMB 3ACGA 4MADA 3VBUB 2GNBA 2CWSA 4XUNA 3ZFFC 1O91A 2HWC2 4RR3A 1UY1A 2XHKA 1NZIA 5CKQA 2D3PA 1NCQA 1K45A 1X33A 2JIGA 5CFDA 3WEZA 2XG3A 4F3JA 3AKQA 1AL0G 1IZ3A 1EYBA 4FFIA 3RMYA 1BQPA 5DUWA 1MZFA 2VVFA 2PHUA 2OZ6A 3KV4A 3MW3A 3NJYA 1U5XA 4IW3A 4OMDA 5ABJB 3O1RA 4XQWA 3LZZA 1UY2A 1OFNA 1K5JA 3V0AA 1ZZ9A 3T2OA 4RS5A 1V6JA 4OLLA 5FMOL 3O0XA 4KU7A 4YVSB 3WQBA 4Y24A 4ZS2A 1OVPA 1VRH3 2ZHNA 1HXS2 2DBIA 1G9FA 4DY5A 4DS0A 3BN6A 2QVSB 3I59A 1MS3A 1SACA 3K75B 4AK3A 2HBUA 2LROA 2PLV1 1YFWA 4QU1A 5FYHA 3ZSKA 4M3CB 2IZWA 1UOFA 3A7QA 1NAEA 3FHAA 3T4HB 2YG0A 3V0BA 2W92A 5FXVA 2ZACA 1N3OA 4RR3B 4TN7A 4GMP0 4LO5B 1NCQB 3N35A 5A3WA 1SBDA 1NE6A 3WDYA 5JSOA 2E26A 2CSGA 2RHPA 1VBE1 3AKSA 4C8DA 3VD9A 1X36A 1Z7S2 1QJY2 2W2IA 1RMU3 2BBVA 2PHWA 3V0AB 4E4HA 2JDPA 2NN8A 4UBGA 1ND2B 4R9AA 1ZA4A 3K4ZA 2YY1A 5T5LA 1W8HA 3SC7X 3CF6E 3B7MA 3Q8AA 4GULA 5L7OB 1NA1A 3MIHA 4WM8A 4BQ1A 3SQOA 3TWIA 1OOPB 2DU0A 5FUNA 4Q8LA 4BZ4A 1L7QA 1PGW1 2ERFA 1B35C 3K48A 4LLFA 4Q0QA 2ZX0A 1VBA1 1V6IA 2HEWF 4P9WA 4UWDA 2OYZA 1AX0A 4IEWA 4MHRA 4BK4A 3RMXA 4XZUG 3RWKX 4HKOA 2PLV2 4GIQA 2OVUA 1ULEA 2VOXA 4CZSA 1YJKA 1MVEA 1AL21 5CKMA 5L9RA 1KD7A 4AI3A 1L7RA 1C5IA 4QXKA 5FZEA 1XXNA 2XPJA 1XSRA 2J1SA 4MGYE 1JZ3A 2JE8A 5DG1A 2L9LA 3PIJA 1VALA 1K3IA 4QPYA 5JOWA 3WDUA 5IHRA 3HN1A 4JTNA 1WA6X 4QGMA 3MICA 2R49A 2RDNA 4IL7A 3T1LA 1YUDA 2RJ2A 1QJFA 2JDHA 4LO4B 2TEPA 1LRHA 2BNOA 1OC1A 3KM5A 4N43B 2VECA 3LEKA 1JBCA 1MACA 4NOTA 2VE1A 4JDMA 4BQ2A 5C4WA 1W0NA 2HYKA 5AFEA 1XE8A 5FZCA 2CAUA 1NLRA 3OUJA 3Q8BA 4SLIA 2ET1A 5FP7A 1OLQA 1TVGA 5BNPC 4XXAA 2WBKA 2W95A 1LR5A 3GZEA 4S2FA 2UY8A 3B00A 1QF3A 1OA4A 2UU8A 3CQOA 1PGW2 1C1FA 4UFIA 5LBFA 2HJIA 1YQ8A 2IC1A 3A22A 2JDMA 3C2UA 3H1YA 4LE4A 5IVEA 1Q8VA 2JWPA 4HPKA 3URFA 2QQKA 3WCRA 1QNYA 1MZ5A 4L99A 3KF3A 5C9AB 2IXJA 4NRQA 5FKCA 5J98B 4L0PA 5GZEA 2F4PA 3MFAA 4CDWC 1H4HA 1ZBE1 1AL22 2XH6A 5LK7B 2Q1ZB 3OOXA 3VGIA 2FMDA 3AXEA 1AR91 1RUF3 3U14A 3WOGA 2WT2A 1QJX3 4D6QA 4QX5A 3ZO0B 4NRPA 1SHWB 2VL4A 4LQRA 1PM4A 3J26N 4ZZ5A 2W68A 3U4SA 4TLGA 4DRRA 3AZVA 4QPWA 5EFUA 1GZWA 5C4WB 1KJRA 5BNNA 1VMHA 4HANA 1KEXA 4IV3A 4R9DA 5EJ1B 5LA0A 4QXHA 1O3RA 2B8MA 2QQLA 1XE0A 2Y6KA 3R0RA 4Q0VA 2J1UA 4UW3A 4EN0A 1EV11 1RUD3 5IK7A 3VBSB 4XUQA 2QQOA 2RM22 5ISLA 3NW4A 2ZGUA 3N7JA 2WDBA 4DXTA 4H2AA 3POBA 1RUG3 1W2AX 3M2MA 5DZFA 2YU2A 1H8TC 2Z79A 3QH7A 5LA1A 2FCTA 1WLCA 4Y20A 4LJHA 1OLME 4XZPA 5IW0A 4N53B 3SMHA 4DXZA 5HXMA 1RUOA 1NE4A 4QD2A 3ZFEC 3RNSA 4DQAA 1MEC2 4R4XA 1D4VB 1TMF1 4AVBA 5JZGC 2CYFA 4KG8A 4LBNA 2Q8OA 4Q2FA 5FZHA 1JYXA 1A8MA 1P8JA 2V4VA 4DMIA 4BMEA 3ABZA 3LA2A 1O5LA 2BW8A 3WF1A 2R1DA 4DUVA 2P2KA 1QH7A 2WKKA 5IAXA 2WS91 1S4CA 4IV3B 3LA3A 3M8LA 4LBJA 1OD3A 3AP7A 5JUVA 1FPN1 4N90A 4OQ8A 3ILFA 4AQTA 4CCOA 1AJKA 2GN3A 2ZPXA 3BALA 5J48A 3WP4A 1CJPA 2G9ZA 4FTSA 1IKPA 1OPOA 1HQWA 4PF5A 5DMYA 4KQ7A 1CAWB 1KFUL 2A6ZA 2VZSA 1EV12 2JECA 1ZBA3 4Y20B 4IEZA 4OMCA 4BE3A 1CESA 3NQHA 5F7UA 4QB2A 1N1TA 1W39A 2HEVF 2J1VA 3HBKA 3HNMA 4YGDA 3WNKA 4CSWA 2RV9A 2QZ2A 3RZGA 1SZBA 1F31A 2D93A 3PU8A 1COV1 3OJBA 2EAAA 2VW0A 3AJYA 3FBMA 3VDCA 1UMZA 2HWB1 1FT9A 2VVEA 1G9BA 4HXCA 3W9AA 4Z1VA 5CBLA 5JIAA 3USSA 5CFCC 4PDWC 1TMF2 4AGGA 1REEA 2E53A 2EXHA 5FY5A 4PF1A 5DDJ1 5FY4A 4Q0UA 1BK0A 5FP4A 4ZU5A 1YJLA 5IUQA 1K5MC 1OLRA 2WO3A 2ZHKA 4Q4V2 4AGVA 2V4AA 3T2TA 1SDWA 4YGCA 1SLCA 3M4FA 1OF4A 2A3WA 2GP3A 2IXKA 2KA3A 4YNIA 5IYYA 1W0OA 3PVOA 4RGGA 1VB4A 1LODA 2Q0AA 2ZEXA 4EN9B 1LHUA 4YW3A 5CISA 3SKJE 2VW2A 1CX4A 2YB7A 4FXGB 3DF0A 5J3UA 3TEWA 4A44A 4Y22A 2WLQA 3I2OA 1ASJ3 4AHXA 3TN93 3PUHA 4AFCA 3CDZB 2OUHA 4ZKTB 4Q4Y1 5F1RA 5DUVA 3WDXA 3VDAA 3LA7A 1SLAA 2R073 5F9TA 1PO23 3NV4A 4AFBA 3UNPA 3ZYBA 1H1MA 3ZOIA 2ARCA 1COV2 3E5UA 2QQPA 4CPBD 2KXLA 3OD4A 5GALA 2ZMNA 5T50A 3K3NA 2D6PA 1MQTB 3ZYFA 2R0FA 2HWB2 1U5IA 4ONUA 4N9IA 1JH5A 3GM8A 4MGKE 5T5JA 5JIUA 1GWKA 3USUA 4FO9A 1ZYBA 1FOD3 1BCXA 1JI6A 4QXBA 2QQJA 4A7KA 5A3LA 4E4DX 2O0OA 1UL9A 2JX9A 5FZ8A 2XWJB 4ZY9A 4RR3C 3MZHA 1CIYA 1JOBA 2I74A 5FO7B 1NCQC 2RDQA 3PUSA 4LBMA 2VXRA 3LDRA 1O7FA 4I30A 4OQ9A 3VB9A 5CFDC 2TUNA 2UWCA 3ZN6A 2B45X 2WZPP 4Y22B 1W8TA 3AFKA 2HWE3 4BQ3A 2OW4A 4P5HA 2FD8A 2B4KA 1AXKA 3IAQA 1JOJA 4RS5C 1W6MA 5E16A 1VLNA 2JDYA 5F3EA 2GNTA 2YC4A 2PHFA 5G05L 5J1XA 1LEMA 2WN2A 3UESA 1QWRA 3MO4A 3AJZA 4FP3A 1CD3G 3C7FA 4Q4Y2 3CEWA 5DAVA 1OOPC 2ZHMA 4H14A 5E1RA 2V5YA 3EJKA 4GQ7A 4IEUA 5IFTA 2PMWB 2NQYA 3RZHA 1QU0A 4F83A 1QXJA 3CL1A 4C0BA 2WRAA 4META 3N9QA 1PIV1 4ATEA 1VBC2 4Q4X3 1A6CA 2RG4A 4QDSA 2E6VA 4O65A 2FDGA 3ZN5A 2C5DA 1LU1A 1MS1A 2FDJA 3KT1A 2CWMA 2E7QA 2WFPA 1BKZA 1LTEA 4QX8A 2VJXA 4QMAA 1OA2A 1CAXA 4L2NA 3CJIA 4IERA 3GJAA 2F17A 3ITQA 4MSVA 3J8F2 1J3RA 1VBB3 3DECA 3LEGA 5FV3A 4FPGA 3GHNA 2NYYA 3INAA 5FMBA 2DCKA 3D4KA 4XJWA 3WW3A 1NA1C 4WM8C 2QE3A 2WO2A 3FBYA 1KRIA 2DTWA 2IFWA 4HN1A 1VE0A 2ARAA 4COWA 2UWAA 3WF3A 4E2GA 1OQ1A 3FLPA 4V2VA 4QQLA 5FZ4A 1SEFA 5A3TA 3AKTA 2VXJA 4A6OA 1K12A 2HEYF 1W8ZA 4IE0A 3X29B 1W9FA 1DGWA 1HQLA 1TEIA 5BNOA 2RR11 3MI8A 2G1MA 4HT1T 1F8VA 3KLSA 1UU5A 3WQ0A 3RJ2X 3MIFA 5LBEA 1PIV2 5E89A 3ILNA 2AREA 5FZOA 1RHI3 3D3AA 2YC2A 5A7WB 4LBQA 1GICA 1O3TA 5HXVA 3WXPA 5DAPA 3QLQA 3MUY1 1VIWB 3WNPA 5ANQA 2EIBA 2ZGNA 3WINE 1EUUA 3IIIA 4LHLA 4C90A 2CDPA 2H0BA 1BMV1 1HRV3 2VW1A 5C4WC 2NMNA 1Y43B 1C8M2 3S5AA 1PVC1 2FDFA 1UZWA 3GZUC 4UW5A 1F5FA 2QDNA 4QKNA 1S0DA 4WV8A 4ZS3A 3SH3A 5KC5A 4W6YA 3GALA 3FE5A 3VBSC 4AHZA 2EXJA 2GC2A 1WUVA 5F2WA 4A2UA 2RDSA 2VZTA 5FWJA 2VMFA 4WZFA 2WL1A 3I8TA 3T2PA 3ZYJB 1E5HA 5AC91 1D4M3 1R1A1 4YM1A 1JYIA 4XJ9A 1CAVB 1W9TA 2B9VA 3NAPB 1W9SA 2BQPA 3WW4A 3CJXA 3OF1A 1ALYA 4UI9L 2GNDA 2WNEA 3WF0A 4IXLA 4NMIA 4FOYA 4CDUA 1ZZ8A 2BWAA 5IK8A 2BPA2 2UURA 2QQNA 2OIIA 4NIIA 2JKXA 2VY0A 4CP9A 1HRI2 5C3RA 1X8EA 4DXRA 4FPLA 2J1TA 1OSGA 5FYMA 4L97A 1W6OB 2XONA 2ZZJA 1RINA 1SBEA 2G19A 1DG6A 2A7AA 2HWF1 4FFGA 5FY0A 5FP3A 1AR63 4M3CE 2J1AA 3VN4A 4IV3C 2HWD1 5HPOA 5C8WA 1UY0A 4XJ8A 1BMV2 2YMZA 3AZXA 3VBHA 5JCTA 1PK6A 4YG0A 4KL1A 1EPWA 1KS4A 1W8OA 3NKTA 2Y26A 2E31A 4QX1A 4B4QA 2VG9A 1PVC2 4L9BA 2XBO1 3W21A 2TBVA 5F37A 5E6HA 1LJ7A 3TEXA 1LOFA 1ZZCA 5KHHA 4AEKA 4A4AA 5F3CA 4OHXA 4KNCA 1YFYA 1JXNA 1OQEA 3SHRA 1W05A 3MEPA 3AYDA 5AC92 4LOSA 2CDOA 1QIQA 1DZTA 3ETPA 2R6QA 1Q3EA 1RITA 3ZLIA 5HV4A 4D6RA 4CP9B 2ZOEB 5A3PA 4QPGA 4NVPA 2R0HA 4LOTA 5DXDA 3A4UA 4FVVA 4XIKA 3WUCA 4AVVA 1GU3A 2PAKA 2RS32 3SXWA 5I8YA 4HONA 1UMIA 1XOYA 5A33B 4B4PA 1RUE1 4YFWA 3JBG3 3CKHA 1M06G 5SV5A 2WNVA 3QACA 3EB7A 3WLUA 2X10A 2VO5A 4AG4A 4C1XA 1YIPA 2BEOA 2HWD2 1SDDB 4JHTA 4K8RB 2JDAA 1UKGA 3OPWA 4AVCA 2XXZA 4WM7B 2GC0A 3BTYA 1UN1A 1XPWA 5FPXA 3BIEA 4YFZA 2Z69A 1RUJ1 1UZ0A 3HMYA 1HN1A 1C8NA 5FQ0B 4IDZA 1YIFA 1DQ0A 3ZR5A 1ODMA 1JYCA 2DFCA 4HETA 2W3JA 1H2KA 1HJGA 2WJSA 3K51A 4BLJA 3U75A 1QQP3 1X7NA 2OT7A 5T52A 3IMMA 3H1MA 3E6DA 3Q8FA 1HKDA 1ZZ6A 2ZABA 4XVHA 4CU7A 1NX9A 3U07A 5A80A 1S2BA 4WZCA 1AR73 2W9XA 1GNZA 1UZZA 1MQTC 3POFA 5F5CA 1LECA 1Q8OA 2P1BA 4CUCA 1O4TA 2A6XA 2FQPA 2MEV3 5GZCA 1DGRA 1Y3TA 3GBFA 2WNVB 3OSDA 2FZ1A 5FR3A 1PO13 4FOWA 2Q8DA 5LY1A 2E63A 3NSTA 3B5LB 4YVWA 4OVEA 4R8HA 1ULCA 4FAHA 4BISA 5C33A 1TME1 5EV7A 1H8TA 3MF9A 1OF3A 1RUC3 3DCQA 4XF4A 4KG0A 2VMDA 3ZSJA 1R081 2RS13 1G8WA 1ULPA 2EF6A 1JMUB 3ZFEA 1OXCA 2BBAA 2VMCA 4GMP3 2XUMA 4GWNA 3VUOA 2V09A 4NHKA 3OB8A 1EAH3 4XUOA 2PHDA 5BYNA 4YRDA 2WYFA 2AZ5A 2EALA 2ORZA 3WCSA 1LENA 4X8NA 1GANA 1PNGA 1RUJ2 2YFZA 5H9QA 4DO0A 4YGEA 5IJRA 1RUI3 3IT8A 1OMIA 3M3IA 4CA9A 4RL7A 5LBCA 3VHRA 1ND3A 5I0SA 1W6QA 1DFQA 3KWVA 3RRDA 3WR0A 4D3WA 4OI1A 1URXA 5LRSA 2YPJA 4MXVA 3ZPOA 3U78A 1FYUA 5GLVA 2R043 3NMBA 2C26A 1MZEA 3SNMA 5IT6A 4EROA 2Y6HA 4QX3A 3DPRB 1ULGA 2ZGSA 3FJSA 4KH9A 1G6NA 3WG1A 1RVF1 2PA7A 1MS4A 3HR9A 1AUYA 4PLNA 4W6WA 1UX7A 1TME2 1DU3D 4OHZA 1SCRA 1SLTA 3J7LA 4Q27A 1XE7A 2YBKA 4XQ4A 4NE9A 1W6PA 1XNCA 4MXWB 2J42A 3PDQA 3UETA 2ZXQA 4JZRA 4PDWA 4IGQA 3UK9A 1DBNA 3KMHA 4S2GA 4EWAA 4XQDA 3OPTA 5H9SA 2EIGA 4NIAA 1ND3B 2O8OA 2WO1A 1W6QB 4LBLA 3WX5A 1K5MA 4K1ZA 4N53A 2WQZC 1POV0 5FO9B 4HMZA 2EA7A 1SLBA 3CZUA 3WVJA 3B9CA 1BEV3 2JG8A 5CG8A 5HI0A 3VBUA 3RS6A 3K46A 3PU3A 4PCRA 2AR6A 4HBNA 2VUDA 4TXWA 3PVEA 3N7KA 2DYCA 1T2XA 4GJZA 3VD4A 2CV6A 1F4AA 3KQ4B 4LUMA 3WUDA 4AFMA 3VBFB 2XMLA 5JR2A 3J7HA 1HXS1 1EUTA 4QX7A 3U10A 1W2UA 5ABJA 5FFOC 4OUEA 2VNOA 3F2ZA 5F5QA 2R063 3CJIC 1W03A 5BPXA 1RVF2 4YVSA 5AFBA 3I54A 4GH4B 4XHBA 3I2DA 2PAMA 1WZXA 5CNAA 5F8PA 2OPKA 4DINB 4E9KA 1ULOA 5AVAA 1FAYA 1WW5A 4P5YA 1G7YA 5FUPA 2PHLA 2WNUB 4XF3A 2BJSA 3LEMA 2FDIA 4NUBA 1V00A 5DPNA 3LOBA 3RZZA 3TB0A 4N9HA 4Y33A 2B7YA 3MF6A 4XAEA 2JG8B 2JIJA 4B8EA 1NLQA 2WIIB 4NPLA 3GYDA 3P6BA 1XJAA 1QJY1 1Z7S1 2RS51 1OBNA 2ZX2A 5BNOC 3THTA 5JOXA 5IVJA 3K3OA 1X50A 3LPFA 2JENA 3ES4A 5K7PA 4YLZA 1VAKA 4RHV3 3KT4A 3PUQA 3MYXA 2PYTA 2WAAA 3HOBA 2C6SA 3VKFC 3THDA 4UW6A 2RDRA 1FATA 2BERA 2RMU3 2W1WA 1BBT3 1W9YA 1YQ2A 1OFSA 2VCBA 4FOQA 4RYDA 5FWEA 1ND2A 1VBD3 1F4HA 3IAPA 2VZOA 3MV11 1ZX5A 5L7OA 3L2YA 2ZA9A 5CB7A 1WBFA 3AKRA 3CBNA 3CNAA 4HK9A 5FPVA 3IMNA 4F8AA 4HLTA 3B9IA 1OOPA 5IATA 1V6OA 1IS3A 4S2DA 4AQ2A 2JICA 4CCDA 1RMU2 2ZJCA 3OBZA 1IGOA 3VZOA 3PVNA 5EQUA 5IAVA 3LFIA 1I6XA 1QGLA 5FTTC 5I93A 3KZ4C 2W1QA 3BPZA 5FPZA 1H0BA 4AVSA 5GLWA 5A6QA 1GOHA 2ILMA 2VBPA 2ENRA 1LU2A 5A32B 1IS5A 4BWOA 4H3WA 3POIA 1DGLA 4UOJA 1FI2A 1ZRCA 2HWC3 2RS52 4CDUC 4CDXB 1S0IA 4YG3A 1WD3A 4E2SA 5L36A 4BJ0A 4EV0A 5GLTA 4JDNA 1A34A 3EQEA 4Y1VA 5CAZA 4IEYA 1C4RA 3D0JA 1OT5A 4N43A 5KC6A 1U12A 4LIUA 3WNMA 1UO9A 5FY1A 3S57A 5DG2A 4HVQA 1QJU1 1JTZX 1FMD3 2D6MA 2WFF1 3DYOA 4IEPA 3UYJA 4EE2A 3KB5A 5JMCA 3FLRA 4JKMA 3JD71 5J96B 2ARXA 2OS2A 3KHBA 4RSUA 4YGBA 2GC3A 2K2SA 1JUIA 2K0GA 5JSPA 5KXDA 1N47A 2A3XA 1L7LA 2FDKA 4O61A 1EY2A 1AX1A 1JZ5A 3VBHC 1PK6C 4JC1A 5SV8A 3ZIWA 1VJ2A 3ZFGA 2X29A 4YSFA 3AVRA 3A0NA 1J1TA 2JG9B 2PTMA 1ENXA 2H6CA 1QEXA 3O0VA 5C9AA 4Q4W3 1LOFC 4XJAA 3LCPA 4NHLA 3LOIA 3AMMA 1NKGA 1JYVA 4PIZA 3MLKA 2VM9A 1F5JA 1OQDA 2FBEA 2IVJA 2D97A 1REFA 3D0SA 5LA2A 4CYDA 4QKBA 3ZKUA 1YC61 1LHOA 4QPGC 2GMPA 1VRBA 1JU3A 3MIBA 4JAAA 2G9FA 1QOOA 4H7LA 1NQJA 4ITCA 3WV6A 2RM21 5KHKA 1OI6A 1O6UA 2ATFA 1SQ4A 2PQSA 3PTRB 4W4ZA 3RI9A 3V64A 2AEYA 1QJU2 2WFF2 4LPLA 4OULA 2PHTA 2WNVC 2ZGRA 3VBSA 1GLHA 2N7GA 5FOJB 2JB8A 4G3YC 3JD72 3TBDA 3VD5A 2VZRA 2WSVA 3AYAA 3ZFGB 5IVBA 4GB32 2D6NA 2OPWA 4NIDA 2GMEA 3C7EA 4FFHA 2Q5TA 1MEC1 4YWAA 1JN2P 4DXSA 3LWCA 3PMSA 3GBWA 5A7OA 1RUD2 2PLV3 5J7MA 2D6KA 3DYPA 3MHZA 1XRUA 4XFGA 3ZDVA 1IPKA 1X9PA 2ZCWA 4KGGA 1FNZA 2FZ2A 1TNRA 1RUG2 3FC0A 5LATA 1LNSA 3W20A 1GQHA 3CO2A 5FK7A 4CCEA 4EWDA 5CU1A 5FLJA 1DHKB 4OYUA 1NT0A 5A3MA 4AEDA 1IHMA 4XXPA 2C24A 2JKBA 3LF7A 3P1IA 1U0AA 4I01A 5FYBA 3MPBA 2Z2SB 4MO3M 1VBE3 1FV2A 1DCSA 4MHUA 2D6LX 3IWZA 3TNPB 4OI4A 5I91A 2P4EA 3L2HA 4CXWA 2TNFA 3OEBA 3AL6A 4XILA 3I3QA 4YM0A 1REDA 3U1XA 1CVNA 3W59A 5FZFA 4QHZA 4KMQA 1SFYA 5K0UB 5K4LA 4UFHA 1NUKA 4YVWC 2PHXA 3W5MA 5LASA 1CAWA 2DBNA 1RIRA 4JGYB 3O14A 2YBPA 2GC1A 4NWVA 1PMIA 3GCWA 3UGGA 1VBA3 2JDUA 3JZVA 3OG2A 2P3IA 2DVFA 2IWGB 3N9NA 4CDQB 1XBFA 1YFXA 2MHFA 3B69A 4GKYA 2DVBA 4RFRB 4UW4A 4WBBA 4R9BA 2Y6GA 4CCNA 2E9QA 1CZSA 3IN9A 1BK1A 3K77A 4HK8A 1ZBA2 5FRAA 4Q4V1 1AL23 4QHOA 4AEDB 4A3ZA 4XE9A 2UYBA 1UZVA 1POQA 1ND3C 2ZMKA 4WVMB 4BHPA 3LPGA 1KDKA 2PHRA 4Z07A 2WABA 2QQVA 2LALA 1UOGA 3N9PA 2LRPA 3P5BA 4TYSA 4JQTA 2XL9A 1CWPA 2IXLA 3MBWA 3NL1A 4P9LA 5DUXA 3FL7A 5FYCA 5FREA 5FMOS 3R4UA 2LM3A 3POJA 3NKGA 1H1AA 4Y5Z0 2A1XA 1YI9A 4XJZA 4LTAA 3GDBA 4BQYA 3N4MA 4Y4YA 4AVAA 4BH9A 4XW3A 3SKVA 1US3A 1SMVA 5JOZA 5LWBA 1LESA 5H9RA 3I3MA 1UMHA 4BQXA 4QQOA 4CUAA 1H2LA 3AM2A 1H4GA 2JDNA 2AENA 3E6BA 3FLTA 3NNJA 4PJYA 4Y1YA 2P6CA 3ZX7A 1DZQA 4AF9A 5KWRA 2BV4A 4D0QA 3VZKA 2WINB 5FYSA 4ES9A 2GH2A 1LGCA 1ASJ2 1V9U1 1X8MA 4DZGA 5A1AA 1A8DA 1MQTA 1SBFA 1V6NA 3TN92 4GWIA 1W0PA 4UYBA 4B4RA 2BTVC 1K42A 1GZCA 2BNMA 4HSJA 4N53C 1ZBE3 4UFLA 5C8CB 2ZX1A 4Q1RA 2XOMA 1YI7A 2ARBA 3HEIA 3WHTA 1UPSA 3VHPA 4XDQA 2JG8C 4QX2A 1AR93 1IPSA 1J3QA 3BUCA 4IV1B 3VBUC 3ASIA 1G9CA 5GLUA 2H6BA 2IFRA 1MS0A 1RB8G 3KGLA 3PJYA 3ZMOA 4EZ4A 2LUWA 2P3KA 3ATGA 3FHQA 4UT5A 3MW4A 4GAZA 5FCCA 3MLLA 4QKDA 1NLSA 3ETQA 4J25A 4DUWA 1NY71 1XQNA 5ABJC 1EV13 5KR7A 2DUQA 3DYMA 1RUNA 5FYIA 3UKVA 4YVSC 2JDKA 4UF0B 4XFIA 4OHWA 1C5HA 4SBVA 2CGOA 4QX0A 1WMXA 3RYPA 3KV6A 5D2AA 1UWWA 4GJYA 1W2NA 3BOPA 4Z82A 1W2OA 2WO7A 2HWE2 2P6HA 4A42A 1HDKA 1WCDJ 1PM7A 1UNBA 1VBC1 1SLLA 5T5OA 3APBA 2SBAA 4XDOA 3VD3A 4LIVA 4QPIB 5C6CA 4F7ZA 4XBLA 1H2NA 1J3PA 5DAQA 4LMFA 3H3ZA 1TMF3 1V9U2 3B93A 3MV01 1JZ6A 5FDBA 1OH3A 1QJZA 3OBAA 2VZVA 2MPFA 3LGRA 2BNNA 2YDEA 1I3HA 4JGZB 1V6MA 1NCRA 4NIHA 1JYTA 2BZDA 2W94A 4AR2A 5FYYA 1ENSA 3DXUA 4NO4A 4D6SA 3J8F1 2WS93 3OGSA 1GKBA 4KWUA 2D5HA 1KDMA 1RJ8A 1UY4A 2VMGA 3KF5A 3OPZA 5F5IA 4CDXC 4RQPB 1FPN3 5EYXA 1BLZA 5T55A 1RUH1 1YQ5A 2XVGA 3ZXAC 1J59A 4AI1A 2VZQA 5FZ6A 2ZEZA 3OCPA 2DVDA 1ND2C 1XU2A 4FOVA 3IIAA 1NY72 5ANNA 5FUIA 2WUHA 4Q5OA 4OI0A 2VQ0A 3WZ1A 5L7OC 1GP5A 1PX4A 1YFUA 4FSJA 5APAA 3WD5A 4AAPA 1YHFA 4C91A 3UKNA 5FPUA 1YEWA 2YBSA 4UAPA 3NNFA 1COV3 4XJUA 1VBB2 2XL7A 3ZXFA 4HZFA 2VQUA 4XAAA 1MS9A 3SCFA 2BP6A 2YZ4A 3P3PA 2HWB3 4GALA 5FAXA 1MS5A 2B42B 3EBRA 5A3NA 1R091 2WZ8A 2JG9C 2O1QA 1Q43A 4ZHNA 4QQHA 2WZR1 2DURA 1NCRB 4YW4A 5CVRA 5DDJ3 2Y0OA 3IPVB 3J7MA 3JXSA 3GHMA 4JVAA 1LAJA 1VMFA 2W1UA 3EXUA 4KBZA 5A7WA 5GJ6A 5JI7A 1AXYA 1EP0A 3T2QA 1C1LA 3RDIA 4TZDA 3N7LA 5FMDA 1C8M1 1POV1 4N43C 2XQRA 3NV1A 4QWNA 3OGGA 3FZ3A 1RUH2 4Y5SA 2R30A 5K8SA 1N1YA 3GGLA 2GSYA 3RZLA 4IEQA 1G9DA 5F39A 4Q29A 1ZRFA 4BK5A 1JOPA 2ZGQA 2BUKA 3Q8EA 2CY6A 5JOYA 4Q4Y3 2VNVA 1IS4A 1GZ9A 2XGXA 5LY2A 4COZA 1SPPA 2PAEA 1WCUA 3NRUA 2DUPA 4I0AA 4H7MA 3ZFGC 1VAMA 4NAOA 1S55A 1SG3A 1GMMA 3CU7A 1CAVA 2H0VA 3C7GA 1N3PA 3FHIB 3HWJA 4PI0A 4PQQA 3NAPA 4EN6B 5C9AC 1HRI1 1LGBA 3UGHA 3OUHA 3VL9A 1R092 5C5UA 4WVVA 4MZUA 3UL2A 1OUXA 3RPQA 2WZR2 4W6XA 3H3UA 1WLDA 2JJ6A 1WLWA 2D5FA 3IDCB 4CRQA 3D8CA 1D4M2 2Q30A 2G4IA 4MGTA 5JI9A 2Y33A 3NVCA 2MNGA 2P17A 3FMGA 1ZRRA 2CU5A 1S0CA 1WW6A 4RGAA 4PLOA 5FP8A 1W6OA 2P5BA 2A75A 3O1TA 2GU9A 1LULA 1V6LA 4PBPA 4QGLA 3O1MA 3PVBB 4GA9A 1AYN1 1PGL1 5J36A 4LXLA 4COYA 1T6BX 3LIHA 2VQAA 1GWLA 1CR7A 1PZ9A 2VOVA 1SPPB 1QKQA 5IK5A 4FQZA 5IVVA 3KT7A 5K0UC 3ZSLA 1WW4A 4V2WA 3KV9A 1W8FA 2YYOA 2E32A 2B39A 2WC2A 4AE2A 4LK7A 3VD7A 4QDRA 3WQ1A 4CEWB 3EMRA 3VKOA 2V5DA 1AHSA 2Q8CA 3BU0A 1PIV3 4YM3A 2WA3A 1YNAA 1S0GA 2RS31 3SH5A 5M0TA 1DLLA 4WVZA 2WLPA 3MFCA 2XB6C 1Z0HA 1APNA 4AHYA 3IZOA 1M4WA 3EO6A 4BLIA 4P9JA 3VZMA 3I2IA 4AEDC 1OHFA 5EP9A 4AAXA 1C57A 3AXDA 4Z92B 5LEKA 1DQ6A 2A6VA 3BIWE 5A33A 4Z2WA 2FCUA 4KWLA 2ET7A 2JB4A 2VZ3A 3KSCA 3NJZA 4YZ3A 3T1MA 5J37A 1GUIA 1Y9GA 3M1HA 2Y6JA 4DEVA 1XC6A 3FFQA 1GP4A 1TNFA 3PUAA 2W0XA 3NV2A 4P9GA 2W1SA 2YHJA 4QU2A 1AYN2 1PGL2 2IVIB 4C1WA 2NPIA 2WSUA 4WM7A 2OA2A 3VKMA 4YZ1A 3G6JB 5I0UA 4X8PA 4P02B 1PHMA 3EHKA 4L92A 3ZDSA 3I4IA 5FZ3A 3PJQA 5FQ0A 4EQVA 1XB9A 4NN0A 5CADA 2VUAA 2LW8A 4FTEA 4IQPA 4XBQA 4FPEA 1QY4A 2OQ6A 5JXGA 3RZJA 1E5RA 2RR13 4QQPA 5KXBA 3BTXA 1WKYA 1YWKA 3ACHA 3MIDA 3ZXJA 3OGJA 1CONA 4IEVA 3HQRA 1XNDA 4XUPA 1KS5A 3I2JA 3JQXA 3FWEA 5DABA 1TZOA 3BYWA 1HIXA 3ZSMA 4E27A 1W04A 5A1FA 4R9CA 3VV1A 4IGOA 4IV1C 3K4AA 2WWJA 4YG6A 3I2HA 1AR72 4JV4A 3THCA 5JWPA 2J7MA 3VZLA 5DQ0A 1Q8SA 3GBGA 4NHMA 4K21A 5A7SA 2C9KA 1BZWA 3ZXDA 1PVC3 1PO12 3SH4A 1GNHA 1YXWA 2XJTA 1MR5A 1B35B 1QNWA 1QMJA 4LK6A 1Q8PA 4YZ4A 4Z8BA 3LKJA 2GMMA 4UFKA 5BUVA 4P14A 1JYWA 3FUQA 1V6KA 3VBRB 1UIKA 5C3OA 1J1LA 1RUC2 1A78A 3NO8A 2AUYA 5AC93 1R1A3 4EYUA 2RS12 3IB3A 1W8WA 4GZ9A 1W06A 3HT1A 3SITA 2IXHA 1FXZA 4RGKA 5ACA1 1JZ4A 1HB1A 4YYOA 2YUEA 4COUA 4I3PA 1DGRN 1EAH2 2Z5WA 1KGYA 3IKWA 3HQXA 2VZUA 1DQ5A 4LKFA 3RZMA 4QPIC 3N7MA 3S6PA 1I9RA 3O0WA 1IS6A 2QFEA 1GZTA 4HVOA 5FPAA 2BDRA 2OX0A 1G86A 2RJLA 4LKSA 5C3PA 4KBBA 4AI9A 3I2GA 3I97A 3LDKA 5FLHA 3RYRA 3S5QA 2DF7A 3DPRA 4LNVA 1OH4A 4PIXA 4KGQA 4LULA 2HWF3 2XLAA 4Y3OA 3SEPA 3DKWA 1S0JA 5FIXA 2HWD3 2YV8A 5FY8A 5JDBA 1AYM1 1W90A 3WP6A 1HW5A 4RQPC 5BNPB 1UY3A 4WVWA 2DWRA 5A70A 3ENRA 1OPMA 5A7PA 2HH9A 1AR81 4ZZ8A 3BCWA 4MXWA 5FP9A 2XBO3 4CUGA 4J6GA 2VNRA 3AMPA 4OZOA 5E8AA 1YLLA 3J7NA 3O1SA 5FPLA 2Y0IA 3QCWA 4AFDA 3RJRA 2QZ3A 5B2GB 2BGOA 2QCSB 2DUOA 3ORJA 1E57A 4NPMA 5F6LB 2DCYA 4AEJA 5KHJA 4U36A 5ACA2 4J1XA 2VH9A 4HFSA 2Y6LA 1RGSA 4AI2A 5D8AB 2ZGTA 1MPXA 4JRAA 2NM1A 3ZIXA 1VPHA 2QBXA 4ZPIA 5JVVA 3E5QA 4IEOA 3ZYRA 4PI2A 5IWFA 4DEQA 2E51A 4OCTA 2X05A 4CCJA 2BGCA 1NCRC 2J1EA 2EVXA 5EZWA 3ZYIB 4I2OA 2EXIA 2QJVA 3NNMA 4XF1A 1UF2C 1UYXA 4Y4RA 4IEXA 1RUE3 3VBFA 1BEV2 1KFXL 5H9PA 4E8DA 3I2FA 2XLFA 1LKNA 1QDOA 2DFBA 2OQ7A 3WP3A 1ST8A 1NXD1 1DLCA 4GH4A 3A23A 4P00B 1SLIA 4LHNA 3RSJA 5FK8A 5FYUA 1GP6A 2FMYA 3Q8CA 3VDDB 3AMHA 1AYM2 3I3DA 4LO7A 4PQ9A 5CIRA 4XYXA 3S0MA 4AGRA 2WNUA 3M70A 1VRH1 3N9OA 4XF9A 4I0WB 4MYEA 4YZ2A 1AR82 1W9WA 4K3UA 1RUJ3 2R062 3QBQA 3POEA 1BVVA 3GXUA 2ZEWA 5GLZA 2DU1A 3OD0A 1HV0A 5BY5A 4HKWA 3ECQA 1VMJA 1JZ8A 2J22A 2Y64A 3LAGA 3LSEA 4ZU4A 3RQ0A 3BI3A 5JZGB 3POSA 4NR1A 4W50A 2VC9A 4XTMA 4PLMA 3VKNA 1LHNA 3CHXA 5FY7A 2DCJA 3J4UH 4IETA 4HL0A 4INDA 3VBOA 2WAOA 1UD1A 4AOCA 4CTEA 1GQPA 3UJOA 1Q5OA 2EICA 1QH6A 1RMU1 1TME3 3AMNA 3GNEA 3MIGA 3RFRA 3TEZA 3IM0A 1UAIA 1WBLA 1R083 4M3CF 2W08A 4XUTA 5F5AA 1PNFA 3ZN4A 1GV9A 1W6NB 4PIYA 1YQCA 2ZHLA 2GAUA 1OKOA 3GZTB 4XFBA 2B5HA 4RD7A 1BBT2 1Z78A 3HIFA 4BXSV 4D7YA 1J84A 2A6YA 1VBD2 5CZKA 3TRSB 1VRH2 4M0HA 3KD4A 1JW6A 1C3HA 2UY9A 4D94A 3HPNA 4OUSA 4ET7A 4ISRA 5A3UA 2I2SA 1HQNA 4TSVA 4CPBA 2ZKNA 5LA9A 5A32A 1JU4A 3AK0A 3R4DB 3NAPC 4CCLA 4CE8A 3LQCA 4B1MA 2YXSA 5C70A 3S7EA 5CFCB 4CP2A 3WDWA 2VTXA 1ULDA 1WCQA 4CDXA 3I49A 3VBOB 2ID4A 3LIGA 2UYAA 3FFZA 5FBZA 4LEJA 1HB3A 2BU9A 5T54A 5CA6A 1YCIA 2EIDA 2Y34A 4LBQD 2IUWA 3WW1A 1US2A 3RWNA 5C5TA 2AGSA 3M3CA 4M00A 3M7AA 1ZRIA 4IESA 1PGSA 2VCCA 1RVF3 2XWBB 5F3IA 5JXHA 4ASLA 2BOIA 5EJ3A 3T0DA 2NZ9A 4XBNA 1LHWA 2A6WA 2B9UA 4FP2A 4XC9A 1AF9A 3HNYM 1XNKA 4ATFA 1N3QA 1VP6A 4BB3A 3O12A 1O4YA 1QOSA 1FMD2 2JG9A 3SLIA 5EIYB 4BQWA 4BQ4A 4RA0A 5I0RA 4QHBA 3WY6A 1ZZ7A 4P9YA 3BVCA 3B01A 2VTFA 3K2OA 2WNOA 1H9PA 4CEYA 1WMFA 1WCKA 2PN5A 5LCWL 1ZM1A 5LB6A 1ACCA 4JKLA 2ZGLA 2P3JA 4BPZA 3AB0A 3K4DA 4C0HA 1W99A 3DXTA 4NWWA 2WA4A 2VAUA 4NPRA 4Q4W2 1RUF1 4CCCA 2BVBA 1QJX1 4HOOA 4OFGA 1S0BA 4XPVA 1HB4A 1XU1A 2YGLA 3MDPA 4ORFA 3U4XA 5C3QA 5CFDB 2O8QA 4X6QB 1HXS3 3VLBB 2HLEA 4GB31 5FZ0A 1U5ZA 2DCTA 1W8UA 2JEMA 4BIFA 5FYZA 5DAWA 3TYJA 4HN0A 4H55A 2KD7A 1VR3A 5AVPA 3OEAA 2CL2A 2P34A 1WMEA 4FI9A 3CIHA 5FJKA 1RUD1 2VOWA 4QGNA 4RS5B 3WNNA 2V73A 4YW2A 3PLQA 3RYKA 3H7JA 2UWBA 3S7IA 1O3QA 4FPCA 3IBMA 1BYHA 3WDVA 4WM7C 1JODA 5FZDA 3H8UA 1H1IA 4P9XA 1RUG1 4CEYB 3ST7A 3KGZA 4XHXA 3I59B 3SCHA 2JXAA 1XSQA 1GOFA 3ZPYA 3OGRA 1FNYA 2E33A 1OD5A 1LEDA 4AI0A 2VUJA 1UYPA 2Q4SA 4GWMA 4D7TA 4AQ6A 4DRVA 2CGPA 2G9GA 3VBRC 3T30A 1ZREA 2GZWA 4I0BA 3U0ZA 1Z7S3 1QJY3 2RS53 3ACIA 4FPHA 3T09A 3VL8A 1E5SA 2JE9A 3MIEA 3V0BB 2XLGA 2YFUA 1DP0A 3IDAA 4MX3A 5DZGA 3ZXGA 2RVAA 3GCXA 1F15A 5EPAA 5FZKA 1RUF2 3AZWA 4A45A 1QJX2 2BFUL 3H0OA 4HKLA 4NROA 5K0UA 5L9VA 1DIWA 1AVBA 4AZZA 3O1UA 5G04L 4TTGA 1VBE2 2D43A 4Q1PA 1XYNA 4YZ5A 3C7HA 4JGYA 3H8OA 1LOAA 1GWMA 2VCAA 2CAVA 5JLVA 1NA1B 3KVBA 3OBTA 4WM8B 2GP5A 1LOCA 3GZAA 3N9LA 2ZEYA 1PVXA 1GOGA 1ZBA1 4I3GA 2NMOA 1EPZA 4CDQA 5FZ7A 3J9SA 1AZDA 1CN1A 4XFAA 4EN7B 1ZA7A 3ZXLA 1PMJX 4IGPA 1WCSA 1D2SA 4OZXA 5CKNA 2VBDA 5TSWA 3ACFA 1RYYA 4DUXA 5KBFA 5BNQA 1HV1A 2DCZA 1CZTA 3Q9OA 4YPJA 4TLFA 1VBA2 4PBOA 2AC1A 2VCMA 3CZJA 4QXCA 4WVMA 3E6CC 3AKPA 5FYVA 3KVAA 4W65A 5JMOA 3NJXA 4FTBA 1D0GA 4G9SB 4N7UA 3ROUA 5FY9A 5A7NA 2WT1A 4HSLA 1PX3A 5EJZB 5D8AC 1NZCA 3N9MA 1DQ4A 3M3OA 3MUZ1 1H6XA 1UKRA 2C9AA 2XDVA 1QJU3 2DDUA 2WFF3 2YPDA 1G9AA 3DPRC 4LLOA 2QKDA 3MGUA 3R4SA 3VHNA 3THPA 3JD73 2BRTA 1QHDA 1Y9QA 1JZ2A 2ZGKA 3N3HA 2GN7A 4GB33 1E5IA 1O8PA 3D82A 3M3QA 2QTWB 3UT0A 2W39A 4R4ZA 4P08A 5CYYA 2FDHA 2GALA 1UZYA 1UOBA 1ASJ1 2AYHA 4S2HA 1ENQA 3TN91 4QB1A 2XJUA 4YW7A 5FLIA 3VDDC 4BM8A 2FHRA 4ES8A 4JRLA 2XQXA 3OY8A 3O1VA 2QDRA 2R071 1PO21 4COVA 1ULFA 4GD4A 1BVP1 3BOWA 4HPKB 5C3SA 1JUHA 1TQ5A 4JQRA 3B02A 3W58A 1V70A 3AZYA 2C1FA 3ELNA 3BGAA 4MV2A 3WG3A 4V1PA 5A1LA 3AFGA 5C8CA 2I07B 2P37A 2QQMA 3LSDA 3ALQA 5I0TA 4BA6A 4NIGA 3LE0A 2WN3A 1HJFA 4IV1A 1S0FA 4DOUA 2XVKA 1BJQA 2D3RA 3JCIA 4AL9A 3RVHA 4E4ZA 1FOD1 5FJHA 3RG0A 5KHGA 2B46X 4GKXA 3ZSEA 5IVCA 4LITA 4Y1XA 5F3GA 2RM23 1ZBE2 5JSRA 1WD4A 2SLIA 1GSLA 2XJSA 2ZGMA 4YW1A 2OUJA 2XKPA 3VBFC 4AXOA 4Q8KA 5IK4A 1OUSA 3FN9A 5DN2A 4M4PA 1GZWB 2CGNA 4K6BA 1AR92 1UYZA 5DZEA 2YU1A 1IQDC 5BNNB 1W3XA 1JHNA 3VZJA 1J58A 2WWSA 4BYYA 1RC6A 2VTXJ 1QXRA 2HWE1 4GH4C 4UF0A 1WWYA 1WA4A 4AFAA 4UFJA 3JQWA 1S1AA 4XIOA 1MEC3 3OY8B 4P9IA 4MOAA 4R52A 3WF2A 2WNUC 4FBFA 2XJQA 2D98A 4XOGA 3SISA 4KI5M 4QPIA 1KQRA 3T3YA 4MVTA 1WMDA 3V56A 2R072 4HG6B 1PO22 3DEMA 3AP6A 3MW2A 1ONAA 2VU9A 2VQTA 1O5UA 4B7KA 2ADEA 1W2TA 2ZMLA 3S30A 2PFWA 5K9YA 2D6OX 4JGZA 3C7OA 4ASKA 4Q4X1 4LORA 2YC0A 2ZX3A 5FZGA 1SFPA 2GH8A 5EYYA 4BDVB 2R7EB 2VUCA 3JUUA 1O59A 3AYEA 1FOD2 1NYWA 4NHXA 4RQPA 3HAGA 5DUUA 3NNGA 4A3XA 3VBOC 5A6YA 4JX0A 5HV0A 5KXEA 5F2SA 1UQXA 3HD8B 5EXOA 1OKQA 4UXAA 3UGFA 2XUEA 2PELA 2WS92 1VBB1 2XJRA 5F32A 3HT2A 4LHSA 1UYYA 1RJ7A 1FPN2 3AL5A 3T0BA 2Z4FA 4CXYA 2VPVA 3W5NA 2BGPA 1VAVA 2ZAAA 1AXZA 1N1VA 1WGPA 4XFFA 3GF6A 5BXXA 1UCXA 3TNQA 5FXZA 3I3EA 4YW6A 3H8XA 2I45A 4FXKB 2XR4A 3AX4A 1FX5A 2WYSA 1L3JA 2K46A 4MGIE 3PNAA 4AI8A 5B4NA 2Q1FA 3ME2A 3H50A 4Q4V3 5D1IA 5L73A 1WLTA 2RE9A 2VD7A 1A3KA 2WR9A 4G4FA 1ZRDA 2HKXA 3HJRA 3IPVA 4NHYA 5FZ1A 2KM2A 1XNBA 2ETEA 2WQ8A 3HBZA 4ZONA 2JD4A 1C28A 4Q4X2 1OVSA 4MG2A 5D21A 1RHI1 1X9TA 2R16A 2OKXA 4AYUA 3VDBA 2BFUS 2W5FA 1XNAA 4K8FA 2CHHA 2IXCA 2LS6A 2ZX4A 2VMHA 2X8KA 5DDJ2 5I8SA 1D2QA 1SFNA 5FYTA 4Y26A 5C7GA 2WZEA 4LBOA 4A7YA 4PHZA 5FOBB 4CVUA 2D40A 3NV3A 1O4ZA 5JPMB 1FV3A 4JTOA 4BU2A 4D7SA 1GFF2 3ACLA 4EWEA 1BHGA 1HRV1 3LDBA 4Y1UA 1GNYA 1W8NA 2BWCA 5A3OA 1NQDA 4CCMA 2DTYA 4MGZE 2VBBA 5LW9A 1WW7A 4YM2A 3KCCA 1MVQA 4Y5TA 4L8QA 2XKOA 4DFSA 4XACA 3VKLA 3T4VA 1V9U3 2EXKA 4M0NA 4Q26A 1D4M1 4M4RA 5JPNB 1ZNPA 4CEYC 4JKKA 3ON7A 2C0ZA 1YO8A 2WWUA 4GWJA 4GXLA 3PIGA 4QDQA 3WW2A 5KXCA 4B3NA 5GKAC 3O1OA 3PURA 1CPNA 4Q0SA 4LHKA 3D6EA 4QT6A 2AEZA 1B09A 1UU6A 3E1F1 3KCYA 2OZJA 4FFFA 2GNMA 2X5IA 5T5PA 2Q8EA 3USUB 1STMA 2VOKA 3ILRA 5I0DA 4URAA 1RHI2 5FZBA 1V0AA 4FPJA 2VVDA 1IOAA 3RGBA 1H6YA 3WNXA 3BKZA 1W28A 4XURA 5FBJA 3ZN6B 4BIOA 1XYPA 5IVYA 2GDFA 1AR61 2CTVA 3TOJA 4J1WA 5FKBA 4A41A 3O5SA 3ZM8A 1PMHX 1QXPA 4AEMA 3T0AA 1HRV2 1HN0A 1W6MB 3T08A 4BXFA 1S2KA 3VZNA 4CP0A 2VZ1A 1UXZA 3WHUA 4XFCA 1VBC3 3AVSA 3WQ7A 5HCAA 4QB6A 3KV5A 2OXBA 5FXWA 1JYNA 4KU8A 4CEWA 2ZTNA 3WG2A 3MLJA 2A70A 2QUOA 4LR4A 1RXGA 3I2KA 2Z42A 3AZZA 4QM9A 2D3SA 3ES1A 4IE6A 2KR2A 2XJVA 2X5IB 3AYCA 3NJVA 5GZGA 4PT6A 2JD9A 2E7TA 1KITA 3FUOA 1DQ1A 4MGQA 5FZMA 3ZFFA 2C4XA 1LCLA 4DNYA 3J8F3 4QM8A 1Q56A 2W46A 4ARXA 2RJKA 1H30A 3ZVXA 2D7FA 2IXIA 4XEZA 1RUH3 2QQUA 3OUIA 2F6BA 3QD6A 4I09A 1UIJA 1KXGA 1OLMA 4AWDA 3H9AA 1J83A 2CNAA 3JBG1 1CAXB 4DIQA 3PL0A 5CG9A 3CJIB 1GBGA 1X82A 2BOJA 3PTYA 3PUIA 4OUMA 2W91A 4FPFA 4N7IA 3VHOA 1AR62 4LO6B 4JGYC 2VGDA 1JHJA 1CQ9A 1LHVA 4Y1ZA 5J09A 3CMGA 3TAYA 5FZLA 2VOTA 2LTNA 4FPYA 4LA2A 2VZPA 3WNOA 4CDQC 5FXXA 1JZ7A 1YRZA 1GYKA 3H8RA 1LGNA 1CGPA 4E8CA 4L11A 5E88A 1BXHA 3AP4A 1R093 1U5YA 2WZR3 5T3NA 3ZFFB 1XYOA 1QQP1 1RTVA 1SCSA 2A71A 5BNOB 1OA3A 1F9KA 1KJLA 1HB2A 1RL3A 1O8SA 4K20A 2ZGPA 3ZMNA 1H9WA 1AR71 5FZOB 4JDOA 5LK5A 2RR12 4LBQB 2MEV1 3PHMA 1C8M3 1POV3 1UOJA 5A6XA 5LEJA 3RZKA 1PO11 1TG7A 5BV6A 5HCHA 2A3YA 3BU7A 4LKEA 3JBG2 1R64A 4NRMA 2E7AA 1RUC1 1DYKA 2A5ZA 1D0HA 3U11A 3JB4C 2RS11 4ZXEA 1B35A 2PQQA 1CIWA 2YGMA 4LA3A 4ZXKA 2Q1MA 5BNNC 3TEYA 2XJPA 4GMP1 4O7XA 5EHDA 3VBRA 2P3YA 1EAH1 3H1WA 5GM0A 3DKQA 1CX1A 1VB2A 1CAUA 3NWKA 2WQ4A 5ERLA 3JB8A 5B4XA 1F35A 3EYPA 2K9ZA 3G7DA 1HRI3 1NG0A 4CUBA 5FZIA 1UU4A 1RUI1 2W52A 3AMQA 4QAWA 4CU9A 4DB5A 1AJOA 1ZVFA 1LOEA 3HNBM 4I02A 4BQ5A 4FQ4A 5C8CC 1YYNA 1QQP2 3I3BA 4CDUB 4D8MA 1R1A2 1Y7BA 4MH0E 1I1EA 4FPKA 1GQGA 1GR3A 2ZS6B 4B7EA 1I5PA 2JE7A 2W87A 2YROA 2R041 4RN5A 1CJDA 3POYA 2MEV2 5F6KA 5LBBA 3WT3A 1NXMA 5JXIA 4D69A 4K7JA 3ZKYA 3AP5A 5L9BA 1AYN3 3P3NA 4AVTA 2AH2A 3B94A 3D5OA 4B1LA 5BNPA 5A6ZA 3C8XA 4B29A 3I7DA 2R1BA 3GJBA 4FT8A 3SCGA 3OBRA 3VBHB 1UX6A 4FAGA 1PK6B 2HWF2 3BODA 3RI8A 5I8TA 2HYXA 1CAUB 4AW7A 2ZKLA 5DAXA 2Y60A 2HBTA 4OHYA 1IQAA 4CU6A 2NLRA 1DYPA 2VR4A 4EZHA 3OGVA 4BMBA 2EAKA 1HLCA 1LOGA 1MS8A 4A6SA 4CDWA 5D8AA 2W47A 2RS33 2XBO2 3LB9A 1RUI2 3HN3A 3U37A 4K1YA 4XETA 1BEV1 4E2QA 4OI2A 3WF4A 4XFHA 4JGZC 4QPGB 1CPMA 3R6SA 2QQWA 2DVGA 1T6GC 1Y9MA 4ARYA 1QOTA 3OTFA 1I5ZA 2ZGOA 3KQRA 4LUKA 4XTPA 3DL3A 4MGSA 3DV8A 5FMCA 1UXXX 4BCUA 5IFPA 1ODNA 2R042 3DUIA 1ZZBA 1QJEA 3NNLA 5GZDA 1DZRA 4YW5A 1N1SA 3H42B 3QH6A 3VDDA 3R05A 3ZR6A 2PXJA 4UFMA 2D44A 2R061 3F95A 1CZVA 5FZ9A 3E5XA 3JU9A 4LBKA 1RUE2 1NOVA 5JXJA 4Z2AA 2VNGA 5FPBA 2ZAHA 4JHZA 3LD8A 4CXXA 2X09A 4NAMA 3QOPA 4XF0A 3WNLA 2AACA 3V65A 1DQ2A 4ZU7A 2VMEA 4E4SA 4CDWB 4O9GA 2Y6FA 2R32A 2ADDA 2FCVA 5L19A 3UV9A 4ISQA 4XMIA 4IE4A 5JZGA 1LOBA 1D7PM 2NP0A 4JCKA 2VULA 4DPNA 1O3SA 3OYWA 3PMEA 1IPJA 1IG3A 5EWSA 1OURA 4YARA 3KS7A 2O14A 3E97A 4QQ2A 1AX2A 4EJRA 1ENRA 4RHV1 4RFT0 4X6RB 1QDCA 4FPOB 4XABA 5FZAA 3ZXKA 2XHNA 3ZYPA 3KCXA 4AHWA 3WDTA 1DYOA 1S0EA 1S2EA 4EN8B 4LT5A 2RMU1 1BBT1 4CU8A 4A7ZA 4LE3A 2VMIA 1VBD1 3WG4A 1XNTA 1IG0A 1RXFA 4YVWB 5C71A 3ZYHA 1W6NA 1H8TB 4XMAA 3UKTA 5CEHA 1JS9A 1R1ZA 3POWA 4HVRA 4M01A 3ZFEB 2EIEA 4DY3A 4O9EA 3IDEA 3LEIA 1R082 3MPPG 4MLOA 3B3QE 2JDZA 3DGTA 4LO8A 4QKFA 3WP5A 3O1PA 5ACA3 3OYWB 1YQ6A 3A0KA 4OHVA 5HCFA 5CFCA 3HQUA 1IKQA 2ES3A 5JAXA 3WSOA 4IE5A 4U2AA 3BTZA 4AQSA 3BB6A 2Y38A 4KWJA 4UBHA 2HWC1 1Y4WA 3AC0A 4IUGA 1DDLA 3AP9A 5LRRA 2ORXA 1PZ8A 3H7YA 4NJ4A 2X5IC 4K9SA 2ZZQA 4BOWA 2Y8KA 3C3VA 4RHV2 4TWTA 3BPSA 2WT0A 3ZXEA 3KHCA 1UPIA 3M3EA 2QNKA 1DF0A 2V72A 4XDPA 2ZBJA 2J1RA 5A7QA 5JR7B 1FMD1 2RMU2 2BYVE 4Q0PA 1AYM3 5FO8B 4MUVA 1TE1B 3N36A 5HCBA 2DV9A 2F4LA 3BTAA 4XCAA 3L9JT 2DVAA 4KWKA 4K40A 3IDBB 1MZ6A 1AR83 3O7OA 2QQIA 5KHIA 4IE7A 4URTA 3FX3A 1W3VA 4LKDA 3UJQA 1LB2A 1Q8QA 1W6PB 2BVVA 3CLPA 1H2MA 3H3LA 4W8JA 3A21A 1F2NA 1HX6A 2A73B 3POGA 2X53S 3LFMA 4N8MA 4PDWB 4FCAA 1PZ7A 3ZYGA 5GZFA 4Q4W1 3DN7A 4CEWC 5HBAA 5IVFA 2XVLA 5LZ6A 3SEEA 1K5MB 4CP1A
chains in the Genus database with same CATH topology
1H8VA 1UW8A 4M3CA 1DGWX 4ASMB 3VBUB 2GNBA 2CWSA 3ZFFC 1O91A 2HWC2 4RR3A 2XHKA 2D3PA 1NCQA 1X33A 5CFDA 2XG3A 4F3JA 3AKQA 1AL0G 1IZ3A 1EYBA 3RMYA 1BQPA 5DUWA 1MZFA 2VVFA 2PHUA 2OZ6A 3MW3A 1U5XA 5ABJB 4XQWA 3LZZA 1OFNA 3V0AA 1ZZ9A 4RS5A 1V6JA 4OLLA 5FMOL 3O0XA 4KU7A 4YVSB 4Y24A 1VRH3 2ZHNA 1HXS2 1G9FA 4DY5A 4DS0A 2QVSB 3I59A 1MS3A 1SACA 4AK3A 2PLV1 1YFWA 3ZSKA 4M3CB 2IZWA 3V0BA 2ZACA 1N3OA 4RR3B 4GMP0 4LO5B 1NCQB 3N35A 1SBDA 1NE6A 3WDYA 5JSOA 2RHPA 3AKSA 1VBE1 1X36A 1Z7S2 1QJY2 1RMU3 2BBVA 2PHWA 3V0AB 2NN8A 4UBGA 1ND2B 4R9AA 1ZA4A 2YY1A 5T5LA 3CF6E 3B7MA 4GULA 5L7OB 1NA1A 3MIHA 4WM8A 4BQ1A 3TWIA 1OOPB 2DU0A 4Q8LA 4BZ4A 1PGW1 2ERFA 1B35C 3K48A 4LLFA 4Q0QA 2ZX0A 1VBA1 1V6IA 2HEWF 4P9WA 2OYZA 1AX0A 4IEWA 3RMXA 4HKOA 2PLV2 4GIQA 2OVUA 1ULEA 2VOXA 4CZSA 1YJKA 1MVEA 1AL21 1KD7A 4AI3A 4QXKA 1C5IA 1XXNA 2XPJA 4MGYE 5DG1A 1VALA 5JOWA 4QPYA 3WDUA 3HN1A 4JTNA 4QGMA 3MICA 2R49A 4IL7A 3T1LA 1YUDA 4LO4B 2TEPA 1LRHA 2BNOA 3KM5A 4N43B 2VECA 1JBCA 1MACA 4NOTA 4JDMA 5C4WA 2HYKA 5AFEA 1XE8A 2CAUA 1NLRA 5BNPC 4SLIA 2ET1A 1OLQA 4XXAA 1LR5A 4S2FA 2UY8A 3B00A 1QF3A 1OA4A 2UU8A 1PGW2 1C1FA 2HJIA 2IC1A 3C2UA 3H1YA 4LE4A 1Q8VA 4HPKA 3URFA 3WCRA 1QNYA 1MZ5A 4L99A 5C9AB 2IXJA 5J98B 5GZEA 2F4PA 3MFAA 4CDWC 1H4HA 1ZBE1 1AL22 2XH6A 5LK7B 2Q1ZB 3VGIA 2FMDA 3AXEA 1AR91 1RUF3 3WOGA 2WT2A 1QJX3 4QX5A 3ZO0B 3J26N 2W68A 4DRRA 3AZVA 5C4WB 5EFUA 1GZWA 1KJRA 5BNNA 4HANA 4R9DA 4IV3A 1O3RA 2B8MA 3R0RA 4Q0VA 4UW3A 4EN0A 1EV11 1RUD3 5IK7A 3VBSB 2RM22 3NW4A 2ZGUA 3N7JA 1RUG3 3M2MA 5DZFA 1H8TC 2Z79A 3QH7A 4Y20A 1WLCA 4XZPA 3SMHA 4N53B 4DXZA 1RUOA 1NE4A 4QD2A 3ZFEC 3RNSA 4DQAA 1MEC2 4R4XA 1D4VB 1TMF1 4AVBA 5JZGC 2CYFA 4KG8A 4LBNA 2Q8OA 4Q2FA 1A8MA 4DMIA 4BMEA 3LA2A 1O5LA 2BW8A 2R1DA 2P2KA 1QH7A 2WKKA 2WS91 4IV3B 3LA3A 3M8LA 4LBJA 3AP7A 1FPN1 4N90A 3ILFA 4AQTA 5J48A 1AJKA 2GN3A 2ZPXA 3BALA 3WP4A 1CJPA 4FTSA 1IKPA 1OPOA 1HQWA 4PF5A 4KQ7A 1CAWB 1KFUL 2A6ZA 1EV12 2JECA 1ZBA3 4Y20B 4IEZA 4BE3A 1CESA 1N1TA 1W39A 2HEVF 4YGDA 2QZ2A 1F31A 2D93A 1COV1 3OJBA 2EAAA 2VW0A 3AJYA 3FBMA 1UMZA 2HWB1 1FT9A 2VVEA 4Z1VA 3W9AA 5CBLA 5JIAA 3USSA 5CFCC 4PDWC 1TMF2 4AGGA 1REEA 2E53A 2EXHA 5DDJ1 4Q0UA 4ZU5A 1YJLA 5IUQA 1K5MC 1OLRA 2ZHKA 4Q4V2 4AGVA 3T2TA 1SDWA 4YGCA 1SLCA 3M4FA 2IXKA 2A3WA 2KA3A 4YNIA 1W0OA 3PVOA 4RGGA 1VB4A 1LODA 2Q0AA 4EN9B 1LHUA 4YW3A 2VW2A 1CX4A 5J3UA 4FXGB 3DF0A 4Y22A 2WLQA 1ASJ3 4AHXA 3TN93 4AFCA 2OUHA 4ZKTB 4Q4Y1 5F1RA 5DUVA 3WDXA 3LA7A 1SLAA 2R073 5F9TA 1PO23 3NV4A 4AFBA 1H1MA 1COV2 3E5UA 2QQPA 2KXLA 3OD4A 5GALA 2ZMNA 5T50A 2D6PA 1MQTB 2R0FA 2HWB2 1U5IA 4ONUA 4N9IA 1JH5A 4MGKE 5T5JA 5JIUA 3USUA 4FO9A 1ZYBA 1FOD3 1BCXA 4A7KA 5A3LA 4E4DX 2O0OA 1UL9A 2JX9A 2XWJB 4RR3C 3MZHA 2I74A 5FO7B 1NCQC 5CFDC 4LBMA 2VXRA 4I30A 1O7FA 2TUNA 2UWCA 3ZN6A 2B45X 2WZPP 4Y22B 3AFKA 2HWE3 2OW4A 4P5HA 1AXKA 1JOJA 4RS5C 1W6MA 5E16A 1VLNA 2GNTA 2PHFA 1LEMA 1QWRA 3AJZA 4FP3A 1CD3G 4Q4Y2 3CEWA 1OOPC 2ZHMA 4H14A 5E1RA 2V5YA 3EJKA 4GQ7A 4IEUA 2NQYA 1QU0A 4F83A 1QXJA 3CL1A 4C0BA 4META 4ATEA 1PIV1 1VBC2 4Q4X3 1A6CA 2E6VA 3ZN5A 2C5DA 1LU1A 1MS1A 3KT1A 2CWMA 2E7QA 2WFPA 1BKZA 1LTEA 4QMAA 1OA2A 1CAXA 4L2NA 3CJIA 4IERA 4MSVA 3J8F2 1J3RA 1VBB3 4FPGA 3GHNA 2NYYA 3INAA 2DCKA 3D4KA 4XJWA 3WW3A 1NA1C 4WM8C 2QE3A 3FBYA 1KRIA 2DTWA 2IFWA 4HN1A 4COWA 2UWAA 4E2GA 1OQ1A 3FLPA 4QQLA 1SEFA 3AKTA 2HEYF 3X29B 1DGWA 1HQLA 1TEIA 5BNOA 2RR11 3MI8A 4HT1T 1F8VA 3KLSA 1UU5A 3WQ0A 3RJ2X 3MIFA 1PIV2 5E89A 3ILNA 2AREA 1RHI3 4LBQA 1GICA 1O3TA 5HXVA 3WXPA 3QLQA 1VIWB 2ZGNA 3WINE 4LHLA 4C90A 2H0BA 1BMV1 1HRV3 2VW1A 5C4WC 2NMNA 1Y43B 1C8M2 1PVC1 3GZUC 4UW5A 1F5FA 2QDNA 3SH3A 1S0DA 4WV8A 5KC5A 4W6YA 3GALA 3FE5A 3VBSC 4AHZA 2EXJA 2GC2A 1WUVA 4A2UA 4WZFA 2WL1A 3I8TA 3ZYJB 5AC91 1D4M3 1R1A1 4YM1A 1JYIA 4XJ9A 1CAVB 3NAPB 2BQPA 3WW4A 3CJXA 3OF1A 1ALYA 2GNDA 2WNEA 4IXLA 4CDUA 4FOYA 5IK8A 1ZZ8A 2BWAA 2BPA2 2UURA 2OIIA 2VY0A 1HRI2 1X8EA 4FPLA 1OSGA 4L97A 1W6OB 2ZZJA 1RINA 1SBEA 1DG6A 2A7AA 2HWF1 1AR63 4M3CE 3VN4A 4IV3C 2HWD1 5C8WA 4XJ8A 1BMV2 2YMZA 3AZXA 3VBHA 5JCTA 1PK6A 4YG0A 4KL1A 1EPWA 1KS4A 3NKTA 2Y26A 4B4QA 2VG9A 1PVC2 4L9BA 2XBO1 2TBVA 1LJ7A 1LOFA 1ZZCA 5KHHA 4AEKA 4OHXA 4KNCA 1YFYA 1JXNA 1OQEA 3SHRA 3MEPA 3AYDA 5AC92 1DZTA 2R6QA 1Q3EA 1RITA 2ZOEB 4QPGA 4NVPA 2R0HA 5DXDA 3A4UA 4FVVA 4XIKA 3WUCA 4AVVA 2RS32 2PAKA 3SXWA 5I8YA 5A33B 4B4PA 1RUE1 4YFWA 3JBG3 1M06G 5SV5A 2WNVA 3QACA 3WLUA 4AG4A 4C1XA 1YIPA 2BEOA 2HWD2 1UKGA 4AVCA 4WM7B 2GC0A 1UN1A 5FPXA 4YFZA 2Z69A 1RUJ1 3HMYA 1C8NA 5FQ0B 1YIFA 1DQ0A 1JYCA 2DFCA 4HETA 1H2KA 2WJSA 3K51A 4BLJA 1QQP3 1X7NA 5T52A 3H1MA 3E6DA 1HKDA 1ZZ6A 2ZABA 3U07A 1S2BA 4WZCA 1AR73 1GNZA 1UZZA 1MQTC 1LECA 1Q8OA 1O4TA 2A6XA 2FQPA 2MEV3 5GZCA 1DGRA 1Y3TA 3GBFA 2WNVB 2FZ1A 1PO13 4FOWA 2E63A 3NSTA 3B5LB 4YVWA 4OVEA 4R8HA 1ULCA 4FAHA 5C33A 1TME1 5EV7A 1H8TA 3MF9A 1RUC3 4XF4A 4KG0A 3ZSJA 1R081 2RS13 1G8WA 2EF6A 3ZFEA 4GWNA 4GMP3 2XUMA 3VUOA 2V09A 4NHKA 1EAH3 2PHDA 5BYNA 4YRDA 2AZ5A 2EALA 1LENA 4X8NA 1GANA 1PNGA 1RUJ2 5H9QA 4YGEA 1RUI3 3IT8A 1OMIA 3M3IA 4RL7A 3VHRA 1ND3A 5I0SA 1W6QA 1DFQA 3RRDA 3WR0A 4D3WA 4OI1A 1URXA 5LRSA 2YPJA 4MXVA 1FYUA 5GLVA 2R043 1MZEA 3SNMA 5IT6A 4EROA 3DPRB 1ULGA 2ZGSA 3FJSA 4KH9A 1G6NA 3WG1A 1RVF1 2PA7A 1MS4A 3HR9A 1AUYA 4PLNA 4W6WA 1TME2 1DU3D 4OHZA 1SCRA 1SLTA 4Q27A 1XE7A 4XQ4A 1W6PA 1XNCA 4MXWB 4PDWA 3UK9A 1DBNA 3KMHA 4S2GA 4EWAA 4XQDA 5H9SA 2EIGA 1ND3B 2O8OA 4LBLA 1W6QB 3WX5A 1K5MA 4K1ZA 4N53A 2WQZC 1POV0 5FO9B 4HMZA 2EA7A 1SLBA 3WVJA 3B9CA 1BEV3 2JG8A 5CG8A 5HI0A 3VBUA 3RS6A 4PCRA 2AR6A 4HBNA 3PVEA 3N7KA 2DYCA 2CV6A 3WUDA 4LUMA 4AFMA 3VBFB 1HXS1 3U10A 5ABJA 1W2UA 5FFOC 2VNOA 5F5QA 2R063 3CJIC 5BPXA 1RVF2 4YVSA 5AFBA 3I54A 4GH4B 4XHBA 3I2DA 2PAMA 5CNAA 2OPKA 4DINB 4E9KA 5AVAA 1FAYA 1WW5A 1G7YA 2PHLA 2WNUB 4XF3A 1V00A 3LOBA 3RZZA 3TB0A 4N9HA 2B7YA 3MF6A 2JG8B 4B8EA 2WIIB 3GYDA 1Z7S1 1QJY1 2RS51 2ZX2A 5JOXA 5BNOC 3THTA 1X50A 2JENA 3ES4A 5K7PA 4YLZA 1VAKA 4RHV3 3KT4A 3MYXA 2PYTA 3VKFC 4UW6A 1FATA 3WCSA 2RMU3 1BBT3 1OFSA 4FOQA 1ND2A 1VBD3 1ZX5A 5L7OA 3L2YA 2ZA9A 5CB7A 1WBFA 3AKRA 3CNAA 4HK9A 4F8AA 3IMNA 4HLTA 3B9IA 1OOPA 1V6OA 1IS3A 4S2DA 4AQ2A 2JICA 1RMU2 2ZJCA 1IGOA 3VZOA 3PVNA 1I6XA 1QGLA 5FTTC 5I93A 3KZ4C 3BPZA 5FPZA 1H0BA 4AVSA 5GLWA 2ILMA 2ENRA 1LU2A 5A32B 1IS5A 4BWOA 4H3WA 1DGLA 1FI2A 1ZRCA 2HWC3 2RS52 4CDUC 4CDXB 1S0IA 4YG3A 1WD3A 4E2SA 5L36A 4EV0A 5GLTA 4JDNA 3EQEA 4Y1VA 5CAZA 4IEYA 1C4RA 3D0JA 4N43A 5KC6A 1U12A 5DG2A 4HVQA 1QJU1 1JTZX 2WFF1 1FMD3 2D6MA 4IEPA 5JMCA 3KB5A 3FLRA 3JD71 5J96B 2ARXA 4RSUA 4YGBA 2GC3A 2K2SA 1JUIA 2K0GA 5JSPA 5KXDA 1N47A 2A3XA 1EY2A 1AX1A 3VBHC 1PK6C 4JC1A 5SV8A 3ZIWA 1VJ2A 3ZFGA 2X29A 4YSFA 3A0NA 1J1TA 2JG9B 2PTMA 1ENXA 2H6CA 3O0VA 5C9AA 4Q4W3 1LOFC 4XJAA 3LCPA 4NHLA 3LOIA 3AMMA 4PIZA 3MLKA 1F5JA 1OQDA 2FBEA 2D97A 1REFA 3D0SA 4CYDA 1LHOA 4QPGC 2GMPA 3MIBA 4JAAA 2G9FA 1QOOA 4H7LA 1NQJA 4ITCA 3WV6A 2RM21 5KHKA 1OI6A 2ATFA 3RI9A 1SQ4A 3V64A 1QJU2 2WFF2 4OULA 2PHTA 2WNVC 2ZGRA 3VBSA 1GLHA 2N7GA 5FOJB 4G3YC 3JD72 3TBDA 2WSVA 3AYAA 3ZFGB 4GB32 2D6NA 2GMEA 2Q5TA 1MEC1 1JN2P 3LWCA 3PMSA 3GBWA 1RUD2 2PLV3 5J7MA 2D6KA 1XRUA 4XFGA 1IPKA 2ZCWA 4KGGA 1FNZA 2FZ2A 1TNRA 1RUG2 3FC0A 4EWDA 1GQHA 3CO2A 5CU1A 5FLJA 1DHKB 5A3MA 4AEDA 1IHMA 4XXPA 2JKBA 4I01A 1U0AA 3MPBA 2Z2SB 1VBE3 1FV2A 2D6LX 3IWZA 3TNPB 4OI4A 5I91A 3L2HA 2TNFA 4XILA 4YM0A 1REDA 3W59A 1CVNA 1SFYA 5K0UB 4YVWC 2PHXA 1CAWA 1RIRA 4JGYB 3O14A 2GC1A 4NWVA 1PMIA 1VBA3 3JZVA 2P3IA 2DVFA 2IWGB 4CDQB 1YFXA 2MHFA 3B69A 4GKYA 4UW4A 2DVBA 5HCFA 4WBBA 4R9BA 2E9QA 3IN9A 1BK1A 4HK8A 1ZBA2 5FRAA 4Q4V1 1AL23 4AEDB 4XE9A 2UYBA 1ND3C 2ZMKA 4WVMB 4BHPA 1KDKA 2PHRA 4Z07A 2LALA 4TYSA 2XL9A 2IXLA 3NL1A 4P9LA 5DUXA 5FREA 5FMOS 3R4UA 2LM3A 3NKGA 1H1AA 4Y5Z0 1YI9A 4XJZA 4LTAA 3N4MA 4Y4YA 4AVAA 4BH9A 4XW3A 1SMVA 5JOZA 1LESA 5H9RA 4QQOA 1H2LA 3AM2A 1H4GA 3E6BA 2AENA 3FLTA 4PJYA 3ZX7A 1G9BA 4Y1YA 5KWRA 1DZQA 4AF9A 3VZKA 2WINB 4ES9A 1LGCA 1V9U1 1ASJ2 1X8MA 2GH2A 4DZGA 1A8DA 1MQTA 1SBFA 1V6NA 3TN92 4B4RA 1W0PA 2BTVC 1GZCA 2BNMA 4HSJA 4N53C 1ZBE3 5C8CB 2ZX1A 4Q1RA 1YI7A 2ARBA 3WHTA 1UPSA 3VHPA 4XDQA 2JG8C 1AR93 1J3QA 4IV1B 3VBUC 3ASIA 1G9CA 5GLUA 2H6BA 2IFRA 1MS0A 1RB8G 3KGLA 3PJYA 3ZMOA 2LUWA 2P3KA 3ATGA 3MW4A 5FCCA 3MLLA 1NLSA 3ETQA 1NY71 1XQNA 5ABJC 1EV13 2DUQA 1RUNA 3UKVA 4YVSC 4XFIA 4OHWA 1C5HA 4SBVA 2CGOA 3RYPA 4Z82A 3BOPA 2HWE2 1HDKA 1WCDJ 1PM7A 1VBC1 5T5OA 1SLLA 3APBA 2SBAA 5C6CA 4QPIB 4F7ZA 4XBLA 1H2NA 1J3PA 3H3ZA 1TMF3 1V9U2 3B93A 5FDBA 1QJZA 2MPFA 3LGRA 2BNNA 2YDEA 1I3HA 4JGZB 1V6MA 1NCRA 1ENSA 4NO4A 3J8F1 2WS93 1GKBA 2D5HA 1KDMA 1RJ8A 2VMGA 3OPZA 4CDXC 4RQPB 1FPN3 5EYXA 5T55A 1RUH1 2XVGA 3ZXAC 1J59A 4AI1A 3OCPA 2DVDA 1ND2C 1XU2A 4FOVA 3IIAA 1NY72 4OI0A 2VQ0A 3WZ1A 5L7OC 1YFUA 4FSJA 3WD5A 1YHFA 4C91A 3UKNA 1COV3 4XJUA 1VBB2 2XL7A 3ZXFA 4HZFA 1MS9A 3SCFA 2YZ4A 3P3PA 2HWB3 4GALA 5FAXA 1MS5A 2B42B 3EBRA 1R091 2JG9C 2O1QA 1Q43A 4QQHA 2WZR1 2DURA 1NCRB 4YW4A 5CVRA 5DDJ3 2Y0OA 3IPVB 4JVAA 3GHMA 3EXUA 5GJ6A 5JI7A 1AXYA 1EP0A 1C1LA 3RDIA 4TZDA 3N7LA 1C8M1 1POV1 4N43C 3NV1A 3OGGA 3FZ3A 1RUH2 2R30A 5K8SA 1N1YA 2GSYA 4IEQA 1G9DA 1ZRFA 4Q29A 2ZGQA 2BUKA 2CY6A 5JOYA 4Q4Y3 1IS4A 1GZ9A 2XGXA 4COZA 2PAEA 2DUPA 4I0AA 4H7MA 3ZFGC 1VAMA 1S55A 3CU7A 1CAVA 2H0VA 3FHIB 1N3PA 3HWJA 4EN6B 3NAPA 5C9AC 1HRI1 1LGBA 3VL9A 1R092 4WVVA 4MZUA 3UL2A 3RPQA 2WZR2 4W6XA 3H3UA 1WLDA 2JJ6A 1WLWA 2D5FA 3IDCB 4CRQA 3D8CA 1D4M2 2Q30A 2G4IA 5JI9A 3NVCA 2MNGA 2P17A 3FMGA 1ZRRA 1S0CA 1WW6A 4RGAA 4PLOA 1W6OA 2A75A 2GU9A 1LULA 1V6LA 4PBPA 4QGLA 3PVBB 4GA9A 1AYN1 1PGL1 5J36A 4COYA 2VQAA 1PZ9A 1CR7A 2VOVA 1QKQA 5IK5A 4FQZA 5K0UC 3KT7A 3ZSLA 1WW4A 2YYOA 2B39A 2WC2A 4AE2A 3WQ1A 4CEWB 3VKOA 1AHSA 1PIV3 4YM3A 2WA3A 1YNAA 1S0GA 2RS31 3SH5A 1DLLA 4WVZA 2WLPA 3MFCA 2XB6C 1Z0HA 1APNA 4AHYA 1M4WA 3EO6A 4BLIA 4P9JA 3VZMA 4AEDC 1OHFA 4Z92B 1C57A 3AXDA 5LEKA 1DQ6A 2A6VA 3BIWE 5A33A 4Z2WA 4KWLA 2ET7A 4YZ3A 3KSCA 3NJZA 3T1MA 5J37A 3M1HA 3FFQA 1TNFA 2W0XA 3NV2A 4P9GA 2YHJA 4QU2A 1AYN2 1PGL2 4C1WA 2NPIA 2WSUA 4WM7A 2OA2A 3VKMA 4YZ1A 3G6JB 5I0UA 4X8PA 1PHMA 3EHKA 4L92A 3ZDSA 3I4IA 3PJQA 5FQ0A 4NN0A 5CADA 2VUAA 4FTEA 4IQPA 4XBQA 4FPEA 1QY4A 2RR13 4QQPA 5KXBA 1YWKA 3ZXJA 3MIDA 3OGJA 1CONA 4IEVA 1XNDA 1KS5A 3JQXA 3FWEA 1HIXA 3ZSMA 4E27A 4R9CA 3VV1A 4IV1C 4YG6A 4JV4A 1AR72 5JWPA 3VZLA 1Q8SA 3GBGA 4NHMA 4K21A 1BZWA 3ZXDA 1PVC3 1PO12 3SH4A 1GNHA 1YXWA 2XJTA 1MR5A 1B35B 1QNWA 1QMJA 4YZ4A 1Q8PA 4Z8BA 5BUVA 3LKJA 2GMMA 4P14A 3FUQA 1V6KA 3VBRB 1UIKA 1J1LA 1RUC2 1A78A 3NO8A 2AUYA 5AC93 1R1A3 2RS12 3HT1A 3SITA 2IXHA 1FXZA 5ACA1 4YYOA 2YUEA 4COUA 4I3PA 1DGRN 1EAH2 2Z5WA 3IKWA 3HQXA 1DQ5A 4QPIC 3N7MA 3S6PA 1I9RA 3O0WA 1IS6A 2QFEA 4HVOA 1G86A 2RJLA 4KBBA 5FLHA 3RYRA 2DF7A 3DPRA 4LNVA 4PIXA 4KGQA 4LULA 2HWF3 2XLAA 3DKWA 1S0JA 2HWD3 2YV8A 5JDBA 1AYM1 3WP6A 1HW5A 4RQPC 5BNPB 4WVWA 2DWRA 3ENRA 1OPMA 1AR81 3BCWA 4MXWA 2XBO3 4J6GA 2VNRA 3AMPA 5E8AA 1YLLA 2Y0IA 3QCWA 4AFDA 3RJRA 2QZ3A 5B2GB 2QCSB 2DUOA 1E57A 5F6LB 2DCYA 4AEJA 5KHJA 4U36A 5ACA2 4J1XA 2VH9A 4HFSA 1RGSA 4AI2A 5D8AB 2ZGTA 4JRAA 2NM1A 3ZIXA 5JVVA 3E5QA 4IEOA 3ZYRA 2E51A 2BGCA 1NCRC 5EZWA 2EVXA 3ZYIB 4I2OA 2EXIA 2QJVA 4XF1A 3VBFA 1UF2C 4IEXA 1RUE3 1BEV2 1KFXL 5H9PA 2XLFA 1LKNA 1QDOA 2DFBA 3WP3A 1NXD1 4GH4A 1SLIA 4LHNA 3RSJA 2FMYA 3VDDB 3AMHA 1AYM2 4PQ9A 4LO7A 5CIRA 3S0MA 4XYXA 4AGRA 2WNUA 3M70A 1VRH1 4XF9A 4I0WB 4MYEA 4YZ2A 1AR82 4K3UA 1RUJ3 2R062 3QBQA 1BVVA 5GLZA 2DU1A 3OD0A 1HV0A 5BY5A 4HKWA 3ECQA 3LAGA 3RQ0A 3LSEA 4ZU4A 5JZGB 3POSA 4NR1A 4XTMA 4PLMA 3VKNA 1LHNA 2DCJA 3J4UH 4IETA 4HL0A 4INDA 3VBOA 1UD1A 4CTEA 3UJOA 1Q5OA 1QH6A 1RMU1 1TME3 3AMNA 3GNEA 3MIGA 3IM0A 1UAIA 1WBLA 1R083 4M3CF 2W08A 1PNFA 3ZN4A 1GV9A 1W6NB 4PIYA 2ZHLA 2GAUA 3GZTB 4XFBA 2B5HA 4RD7A 1BBT2 1Z78A 3HIFA 4D7YA 2A6YA 1VBD2 3TRSB 1VRH2 4M0HA 3KD4A 1JW6A 1C3HA 2UY9A 4D94A 4OUSA 4ISRA 2I2SA 1HQNA 4TSVA 2ZKNA 5A32A 3R4DB 3AK0A 3NAPC 2YXSA 5CFCB 3S7EA 4CP2A 3WDWA 1ULDA 4CDXA 3VBOB 2UYAA 3FFZA 5FBZA 4LEJA 5T54A 5CA6A 1YCIA 4LBQD 3WW1A 3RWNA 2AGSA 3M3CA 4M00A 3M7AA 4IESA 1PGSA 1RVF3 2XWBB 4ASLA 5EJ3A 2NZ9A 4XBNA 1LHWA 2A6WA 2B9UA 4FP2A 1AF9A 4ATFA 1XNKA 1N3QA 1VP6A 3O12A 1O4YA 1QOSA 1FMD2 2JG9A 3SLIA 5I0RA 4RA0A 4QHBA 3WY6A 1ZZ7A 4P9YA 3B01A 1H9PA 4CEYA 1WMFA 1WCKA 2PN5A 1ZM1A 2ZGLA 2P3JA 4BPZA 3AB0A 4C0HA 4NWWA 2WA4A 4NPRA 4Q4W2 1RUF1 2BVBA 1QJX1 4OFGA 1S0BA 4XPVA 1XU1A 2YGLA 3MDPA 4ORFA 3U4XA 5CFDB 2O8QA 4X6QB 1HXS3 3VLBB 4GB31 1U5ZA 2DCTA 2JEMA 4BIFA 3TYJA 4HN0A 4H55A 1VR3A 5AVPA 2CL2A 2P34A 1WMEA 1RUD1 2VOWA 4QGNA 4RS5B 2V73A 4YW2A 3PLQA 3RYKA 3H7JA 2UWBA 3S7IA 1O3QA 4FPCA 3IBMA 1BYHA 3WDVA 4WM7C 3H8UA 1H1IA 4P9XA 1RUG1 4CEYB 3ST7A 3KGZA 4XHXA 3I59B 3SCHA 2JXAA 3ZPYA 1FNYA 1OD5A 1LEDA 4AI0A 2VUJA 4GWMA 2Q4SA 4D7TA 4DRVA 4AQ6A 2CGPA 2G9GA 3VBRC 1ZREA 2GZWA 4I0BA 3U0ZA 1Z7S3 1QJY3 2RS53 4FPHA 3VL8A 2JE9A 3MIEA 3V0BB 2XLGA 3ZXGA 4MX3A 5DZGA 1RUF2 3AZWA 1QJX2 2BFUL 3H0OA 4HKLA 5K0UA 1DIWA 1AVBA 1VBE2 2D43A 4Q1PA 1XYNA 4YZ5A 4JGYA 1LOAA 5JLVA 2CAVA 1NA1B 3OBTA 4WM8B 1LOCA 3GZAA 1PVXA 1ZBA1 4I3GA 2NMOA 1EPZA 4CDQA 3J9SA 1AZDA 1CN1A 4XFAA 4EN7B 3ZXLA 1WCSA 1D2SA 4OZXA 5TSWA 5KBFA 5BNQA 1HV1A 2DCZA 3Q9OA 4TLFA 1VBA2 4PBOA 4WVMA 3E6CC 3AKPA 4W65A 4FTBA 1D0GA 4G9SB 4N7UA 3ROUA 2WT1A 4HSLA 5D8AC 1NZCA 1DQ4A 3M3OA 1UKRA 2C9AA 1QJU3 2WFF3 1G9AA 3DPRC 4LLOA 2QKDA 3MGUA 3R4SA 3VHNA 3THPA 3JD73 1QHDA 1Y9QA 2ZGKA 3N3HA 2GN7A 4GB33 3D82A 3M3QA 2W39A 4R4ZA 2GALA 1UZYA 1ASJ1 2AYHA 4S2HA 1ENQA 3TN91 2XJUA 5FLIA 3VDDC 4BM8A 2FHRA 4ES8A 4JRLA 3OY8A 2QDRA 2R071 1PO21 4COVA 1ULFA 1BVP1 3BOWA 4HPKB 1JUHA 1TQ5A 4JQRA 3B02A 3W58A 1V70A 3AZYA 2C1FA 3ELNA 4MV2A 3WG3A 5C8CA 4V1PA 3AFGA 2I07B 2P37A 3LSDA 5I0TA 3ALQA 4BA6A 4IV1A 1S0FA 4DOUA 2XVKA 1BJQA 2D3RA 3JCIA 4E4ZA 1FOD1 3RG0A 5KHGA 2B46X 4GKXA 3ZSEA 4Y1XA 2RM23 1ZBE2 5JSRA 1WD4A 2SLIA 1GSLA 2XJSA 2ZGMA 4YW1A 2OUJA 2XKPA 3VBFC 4AXOA 4Q8KA 5IK4A 1GZWB 2CGNA 4K6BA 1AR92 5DZEA 5BNNB 1JHNA 3VZJA 1J58A 2WWSA 4BYYA 1RC6A 1QXRA 2HWE1 </