4JDNA

Secreted chlamydial protein pgp3, c-terminal domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
144
structure length
144
Chain Sequence
KAFNNFPITNKIQCNGLFTPSNIETLLGGTEIGKFTVTPKSSGSMFLVSADIIASRMEGGVVLALVREGDSKPCAISYGYSSGVPNLCSLRTSITNTGLTPTTYSLRVGGLESGVVWVNALSNGNDILGITNTSNVSFLEVIPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Chlamydia trachomatis immunodominant antigen Pgp3.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Cell invasion
molecule keywords Virulence plasmid protein pGP3-D
total genus 27
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1340 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jdnA00
4JDOA 4JDMA 4JDNA
chains in the Genus database with same CATH superfamily
3HNBM 3NRUA 2ZAHA 5B4NA 1AR61 5FZ7A 4ARYA 2WSUA 1X8MA 3ZN4A 5A3PA 2F6BA 1YEWA 2V73A 2TUNA 3A0NA 2CV6A 1K5MA 3EBRA 3CU7A 1G9FA 1W0PA 2BWCA 4UF0A 4GH4A 4Y33A 4GD4A 3K46A 5EWSA 4LKEA 3VKFC 4V2VA 3O1TA 3GDBA 5L73A 4DO0A 2E7QA 4IXLA 3VD7A 3I2IA 1COV1 1RYYA 3QOPA 2Y6FA 1COV2 2Z42A 2YROA 2FMYA 3LZZA 4ITCA 5FUPA 4GJYA 5A7NA 2W1UA 5C9AB 4J1XA 3RZLA 3NNMA 4JCKA 3AMQA 5A3MA 3NWKA 1LODA 3BCWA 2VM9A 2YPJA 3T2TA 1HB4A 4PF1A 5DAVA 1CN1A 4YZ5A 3SQOA 4IEQA 4XETA 4KG8A 1Y9GA 5FPVA 1GQGA 3PUIA 3BTZA 4FFGA 1NE6A 3FUOA 1OH3A 3SEPA 4AI0A 4R9CA 1REDA 3U78A 1IS5A 1NX9A 4D6QA 3NNLA 4LITA 2P4EA 4GH4C 4WZCA 1IG0A 5KHHA 1H1IA 1HQNA 4Y1VA 3POJA 4KI5M 4EQVA 2ADEA 4B1LA 2VG9A 4M0NA 4IESA 4XJAA 2ZOEB 1QDCA 3LDRA 1GOHA 2CAVA 1POQA 4IGQA 4P9JA 4PI0A 4XFGA 3I3DA 5FZ3A 1G9CA 3BB6A 5FBJA 3SITA 3O1VA 1DIWA 4YW5A 2ZEYA 4M3CB 1VPHA 4QB6A 5A32B 4D6SA 4YGBA 5T50A 5FZFA 1AUYA 1UMZA 4UF0B 3RMYA 3IAPA 5ACA1 4M0HA 1DYKA 2WL1A 3ZR5A 5FY4A 2GC0A 5CFCA 4N7UA 1MQTA 1AX2A 2XQXA 2ILMA 1NZCA 3AMNA 1GZCA 3USUA 3VKOA 5I8SA 4WBBA 1GP6A 5L9RA 2W5FA 3J7HA 3FN9A 2UWAA 4E4DX 1XU1A 2WWJA 5I0SA 2ZGLA 5DN2A 1ST8A 3KB5A 4WV8A 3RZMA 3AYEA 4ZY9A 1NKGA 5FP9A 1MZ6A 2O0OA 1SHWB 4CTEA 2B7YA 4FPCA 4P00B 4XDPA 2XL7A 1SEFA 3LE0A 1R093 4DRRA 4EWAA 1H8VA 3RDIA 1NY71 1R1ZA 1AX1A 2R063 4LKDA 4AVAA 4FTEA 4Q4V2 4YW1A 1SDWA 2VU9A 3EQEA 5F3GA 4L2NA 2ZJCA 4JZRA 5IVBA 2ENRA 4LJHA 4E4SA 2PHWA 1C5IA 5C5TA 1ODNA 1WCSA 1OBNA 1YJKA 1OLMA 2A71A 5CADA 2QVSB 2D44A 4O65A 3O1PA 3USSA 1GZTA 2YGLA 3H8OA 1HJFA 1YWKA 5L9BA 4XBQA 2XGXA 1VBB1 2UWBA 1TZOA 2WYSA 2P37A 4IW3A 3JB8A 3HWJA 1UZ0A 5LA1A 2WN2A 2ZMKA 4NHYA 1OI6A 3I3EA 4NPMA 4QXBA 1VE0A 1X9TA 4XMAA 5C70A 1KDMA 2EAKA 1PMIA 2OQ7A 3GHNA 1LCLA 3VBSA 2QQNA 3MPBA 2HEWF 4JGZC 5A7WB 4QPIB 4Z82A 2YC4A 4AGGA 2IXIA 1GSLA 2JXAA 3D82A 2G9ZA 3M8LA 1EV13 1KXGA 4LO7A 2VMIA 4Z2WA 3HQRA 2CWMA 2DF7A 2P1BA 3E1F1 2JD4A 5BYNA 1FMD2 3GZUC 2XWJB 1H6YA 1ZZBA 2DCKA 1NZIA 1R081 2X29A 4LHSA 3PVOA 1AR82 1HIXA 3AB0A 4LKSA 3TOJA 4CCOA 5KHKA 2R062 3DECA 2VJXA 3IPVB 2AENA 3NKTA 1R092 3HBKA 2OPWA 2D43A 5JIUA 5AC91 3AKPA 4XAEA 5ABJA 3T2PA 5AC92 4M3CF 4Z2AA 2RS53 4XABA 3ZYJB 1PNGA 1ULEA 2VMFA 2DTYA 2W87A 3W20A 3AK0A 1UX7A 1JODA 2HH9A 4OZOA 4A7KA 3FL7A 2WLQA 4BDVB 5ACA2 3IB3A 5BNQA 1DQ5A 2Y8KA 4N43B 4XFHA 3T2OA 1HLCA 4QDRA 4DMIA 2AGSA 1S2EA 2IFRA 4COZA 1B09A 1TMF1 5FZLA 3Q8CA 5FMOL 4XZUG 1XSQA 3RG0A 2K0GA 4AI2A 4MG2A 4BOWA 5FIXA 2R0HA 5IWFA 1UOJA 4S2FA 5DG1A 5FUIA 3T4VA 4V2WA 3AP7A 5LBFA 5LY1A 2IUWA 1AL0G 2CY6A 2KR2A 5DAPA 2O14A 3ZFGB 4PIYA 3V56A 2A7AA 5JXJA 1W8TA 4NN0A 3IM0A 2B9VA 5GZFA 2H6BA 5A7SA 5ABJC 2P17A 4H3WA 4JDMA 2HKXA 3KS7A 2YBSA 5I93A 1MS4A 3OD0A 4ZU7A 5DDJ1 3EYPA 5DDJ2 2CGNA 1OFNA 1BK0A 3LCPA 5IJRA 2ZGKA 5FZ6A 2NMOA 4Q2FA 3O0VA 1NAEA 3B00A 2ARAA 1PO12 2QQJA 1VBB2 3FBYA 3PMEA 1PO11 4R9DA 4DUWA 4I0WB 1RVF2 1N1VA 5FZAA 3ZYFA 3T0DA 1VBB3 3ENRA 4KL1A 4YGEA 3OUHA 3DXUA 2VCCA 3TWIA 1V9U1 4H2AA 5A7QA 3CMGA 5KXCA 1S0JA 1TEIA 1W6PB 4UFMA 1AVBA 1K5MB 1PMHX 3W21A 3WLUA 2YGMA 3JUUA 4R8HA 5CZKA 1T6BX 1KDKA 1URXA 4YGDA 1N1YA 1Y9QA 4AVCA 3ZIWA 4Q0QA 2IVJA 4XYXA 2VBBA 2GMMA 3BN6A 3QBQA 3FLRA 2RVAA 3WF4A 5AFBA 3GZEA 5DAXA 3BGAA 3PVEA 3VZNA 5FZBA 1WZXA 4KQ7A 3N9QA 4YVSB 2XMLA 1HXS2 3WNKA 3CNAA 4CE8A 3ZYRA 1ODMA 2RS31 4XQWA 4AEJA 3S5AA 1W2OA 1ZBE1 2DCJA 1L3JA 5IYYA 2E32A 3D0JA 2R061 4NHXA 2IVIB 3LA3A 1OVSA 1XB9A 2R042 1OFSA 1W9TA 4LBNA 4RGAA 1EAH1 5I91A 1S0IA 3UKTA 5GLWA 4GXLA 5HBAA 2I45A 3OGJA 2B4KA 3LDBA 1CAWA 4UI9L 4DXZA 3DUIA 4NIAA 2GAUA 2GN7A 3J8F2 2OA2A 2JE7A 1GWLA 1PGSA 1DFQA 1WW4A 3J8F1 1W6NB 1ZZCA 2LUWA 1I5PA 1AXYA 4E8CA 1FOD3 3BU0A 2V5DA 3FFQA 4XACA 3MUZ1 4Z8BA 5T5LA 1CIWA 2AREA 3MDPA 4A45A 1OQ1A 3KD4A 5HCFA 1MS0A 2EXIA 1QXPA 2FDKA 3WNOA 1W6PA 2BEOA 1ND2C 4FPKA 4JHTA 4W8JA 2RS12 4CXYA 4YLZA 5L36A 2ARXA 4FSJA 3HT2A 1OA2A 2WWUA 2EXHA 3AC0A 2YC2A 3CEWA 2JJ6A 4Y1XA 3GHMA 4MVTA 1OOPC 3MIEA 3SH3A 3ECQA 1UZWA 3KV6A 5FZOA 5FXXA 3RPQA 5A3LA 3CF6E 4D6RA 2FZ1A 1MZEA 1S0GA 2YPDA 4XF1A 1NCRA 4CP2A 1B35C 2JDZA 4OMDA 5F5AA 1ULGA 1W39A 4HPKB 4C8DA 1EP0A 1K12A 4LUKA 4ISQA 4UYBA 1XXNA 3JB4C 4HVOA 1YRZA 1R091 1C28A 3EXUA 4AHWA 5L9VA 1RVF1 4AEMA 3C7HA 4AYUA 3C8XA 5LEJA 4BQYA 5FDBA 2PXJA 1GP5A 1V6LA 3AMMA 3V64A 2VXRA 2LM3A 2D97A 3LFIA 1CGPA 1RJ8A 1IKQA 3FMGA 5BNNB 3I3QA 3LQCA 2AZ5A 2WO3A 2I2SA 2QQOA 3I59A 4F83A 3DGTA 2J42A 2DBIA 3CBNA 1PNFA 4OUMA 3ACHA 5C4WB 4OI0A 4Y24A 1RMU3 1HRV3 4DEQA 3H3LA 5ACA3 3THCA 1JTZX 4XFCA 3PHMA 2ZX4A 3SKJE 2VXJA 3TB0A 3HAGA 4XJ9A 1HV0A 1YO8A 2RG4A 2V72A 3LPFA 3GJBA 3NL1A 4L0PA 4SBVA 5IVYA 3M3OA 4QX1A 1STMA 4PI2A 4GB31 3MIGA 1UU5A 3MBWA 4KNCA 4OYUA 4Q4W2 3OB8A 1AXKA 4RS5C 5G04L 4E2SA 5JSOA 1Q43A 5HCAA 4ZU5A 2JG9B 2VZ3A 4I3PA 4MGSA 5G05L 2WO1A 2XJVA 1ZZ6A 3MIFA 5D8AC 3N9MA 4LK7A 2W94A 1I3HA 4J1WA 3U11A 1DGWX 4YZ3A 2VGDA 4KBZA 2X5IB 2PLV1 1Z7S1 4LHLA 1PZ8A 4XURA 2QBXA 3VZMA 2EIEA 1HJGA 1OH4A 5CFCB 1ZRIA 1O4TA 2VULA 2GP5A 2J1AA 2ZHNA 3OEBA 4AFBA 3LPGA 1DQ0A 3MLLA 5EYYA 4FXKB 3RJRA 3ST7A 5C9AC 3BTYA 2WO7A 1UQXA 4I02A 4Q1PA 4QGLA 3VLBB 1MS9A 4XMIA 2YBKA 4NIGA 2BRTA 3D0SA 4CXXA 2QJVA 3CJIB 1CJPA 1POV0 5FXZA 1ZRFA 5C3OA 4Y22B 3ACLA 3HT1A 3CO2A 2Q1MA 4QWNA 3VDDB 5HV4A 5HCHA 3E6BA 5K0UB 1WCQA 3EHKA 3DN7A 5EHDA 3MV11 4TXWA 1A6CA 5FK7A 4E4ZA 5FQ0A 2MEV2 3QH6A 4AEDB 1ZBA1 2RS32 2OZ6A 4K40A 4AVBA 2Q4SA 2XPJA 1QJU3 1EYBA 4WVWA 1CJDA 1K45A 3ZFEA 4Q4Y2 4R9BA 5I0RA 4CYDA 1SBFA 1RUI3 4B4QA 1QKQA 4CDUC 1UXZA 1VJ2A 1TQ5A 3H1WA 4LIVA 1C1FA 5BNOA 1KD7A 2A75A 2YUEA 5JZGA 1U5IA 2ZX2A 1DLCA 2FZ2A 1VB4A 4OUEA 4OCTA 3THPA 2JDYA 5A3WA 4QPIC 4A3XA 2PTMA 2X8KA 4GWIA 1NQJA 4WVMB 1FT9A 2OZJA 5GZCA 1X82A 1WD4A 4XTMA 3VBSB 2VQTA 1JZ5A 1JMUB 5FOJB 2DVFA 5JXIA 2B8MA 1QNWA 3KSCA 2Y34A 5FYTA 5DAQA 3USUB 3ZO0B 1Q8QA 1UKRA 1C1LA 4EN6B 3EMRA 2VOKA 1V00A 2KM2A 1JS9A 4GIQA 1GWKA 4I09A 1RITA 1X9PA 1ALYA 2WBKA 4QB2A 2AR6A 2D6KA 2VBPA 2X05A 5JSPA 4JTOA 4PQQA 4Y4YA 3ZXGA 4RGKA 2OW4A 2HYKA 1Q8VA 3ZXJA 2HWF1 4N53A 3WUCA 3POEA 3TNQA 2EICA 1D2QA 5CIRA 5F3IA 1WMFA 2A6XA 3PVBB 3M3CA 1C8M2 3VKMA 5GKAC 2Q8CA 1C8M1 1SFYA 4QDQA 4CDXB 3LIHA 5FYZA 4D0QA 1GMMA 2R1BA 5KHGA 2Q5TA 4HBNA 3OD4A 2F4LA 1D0GA 2XWBB 2EIBA 2WNUB 2QQLA 2CNAA 3DKWA 2PELA 2XUEA 1UYYA 2EAAA 4Q27A 1QXJA 3U4XA 4Q8KA 1LOFA 4UBHA 4M3CE 3HEIA 3P1IA 1YQCA 1N47A 2RMU1 4KGGA 2ZXQA 5FKBA 2DUPA 4LA2A 2QZ2A 2W1SA 5LATA 3WP6A 1LOAA 3KLSA 1MEC1 1HKDA 1VR3A 4G9SB 4Y22A 5F3EA 3SEEA 1O3SA 3M70A 3WNPA 4N53C 4OFGA 1S55A 3QD6A 2A3WA 4WM7A 4YGCA 4DEVA 3HIFA 3ELNA 4W50A 1S1AA 4QX2A 1H1AA 4C0HA 3DPRA 1DGRA 2A5ZA 3NO8A 2CSGA 5GLVA 4Q4Y1 1BHGA 1VMHA 2QDRA 1MPXA 1V6KA 3T3YA 1M06G 3A4UA 4UW5A 2R041 5F8PA 1WKYA 1ZRCA 3AL6A 4HK9A 1RUE2 3GBFA 2NMNA 4AF9A 3WG2A 5LEKA 2VVEA 2BGPA 2XB6C 2YU2A 3BIWE 5CFDB 2O8OA 2K46A 2ZGSA 3H1YA 3FX3A 5ABJB 1Q8SA 3GBGA 1HW5A 1Z78A 2VC9A 4QT6A 1QQP1 4UW6A 3ZX7A 4HANA 5F6KA 4QAWA 1R1A3 3P5BA 4I01A 1OUXA 3VV1A 5BUVA 1SFPA 2Z69A 5L7OB 1PZ9A 4PLOA 4HKLA 4RR3C 1JZ2A 5K0UC 5CKNA 3BI3A 4EROA 1VRH2 1VAKA 1W8ZA 2XQRA 4XAAA 4XFBA 1Z0HA 5C33A 2ZA9A 2VO5A 4NRQA 3AL5A 4NPLA 5FV3A 2Y33A 1ND3A 1YQ8A 3VKLA 5JOYA 3VUOA 1W28A 1ULFA 5CNAA 3UGHA 5A7WA 2P3IA 1FX5A 5APAA 5FLHA 5A6XA 2XJPA 3VHOA 2HWF2 2Q30A 3LEGA 5EZWA 2VZVA 3WX5A 5C4WA 3ACGA 4C1WA 2VECA 3RWKX 1D7PM 3TEXA 3OYWA 2RDNA 1HRV1 3AMPA 4KGQA 2P3KA 4YVSC 1DP0A 2JDPA 3W58A 2XXZA 1BYHA 2B5HA 4AVTA 1OSGA 1SCRA 4XJ8A 2E51A 2ZGOA 4HLTA 4L97A 2R49A 1WCKA 2UURA 5HXMA 3OBTA 5FY9A 2HWE1 2OIIA 1HQWA 4N8MA 1OLME 2QQMA 5E16A 2ZEXA 1QEXA 1DCSA 4YRDA 4P9XA 3K77A 5T54A 2JDNA 3VBFA 2MHFA 2D6MA 4SLIA 3HN1A 1ENQA 4MGKE 3ZN6A 2N7GA 4FPOB 1JXNA 1LGNA 1VBC2 3POBA 5CVRA 3X29B 4DUVA 1VBC1 4K20A 3KV9A 3W59A 3UNPA 1NCQB 1WMXA 2OVUA 3GF6A 4QU1A 4BXFA 4PIZA 3ASIA 2VZSA 3VBUA 4K3UA 2WNVB 2ZAAA 1KS5A 3WUDA 5F3CA 5C4WC 1AF9A 3NVCA 5CFCC 4P9YA 3T1LA 3SKVA 1L7RA 2WQ4A 3ILRA 3E5QA 1O8SA 4K21A 4GB32 4BYYA 2NQYA 1ZX5A 2SLIA 2YZ4A 1A8MA 4HPKA 2W1WA 3DPRB 2ZHKA 4FFFA 3WZ1A 4BMEA 4DOUA 3NV2A 2XLGA 1Q56A 5K9YA 1RUC2 1OLRA 2J1EA 4YFWA 4Q5OA 4YG3A 5F7UA 3B3QE 2XHNA 3VBFC 1HB1A 5JDBA 1OHFA 1VRH3 2ZTNA 5E89A 1VAMA 1P8JA 2DV9A 4GZ9A 4INDA 1BK1A 4LE3A 4ZPIA 1VBC3 4QPGB 2E7AA 4ATEA 5IFPA 1DQ6A 5A7PA 1SDDB 5J7MA 3KQRA 1O59A 1W8HA 4RSUA 1W8FA 4E4HA 3RZHA 1BVP1 4Q0VA 5BNPA 3E6DA 4BHPA 5A3NA 1ZZ8A 4BQ2A 5DAWA 4IETA 1RXFA 2R043 2GALA 5BNNC 2RMU2 3HOBA 1YC61 2VTFA 1OXCA 2ZGNA 1SACA 5T5OA 1V0AA 4ISRA 1ENSA 3WQ7A 3ZFGC 1SLIA 2DU0A 1GZWA 2E33A 2WT0A 3DF0A 4FT8A 4UXAA 4EN0A 5C8CC 3E6CC 2R071 2W46A 4XILA 5IK7A 2EALA 2ZGQA 1VMFA 4A3ZA 2XBO3 3BVCA 1DZRA 4LBQD 5FPLA 2WDBA 5KWRA 2RS52 2R7EB 1W2AX 4JX0A 4HMZA 2G1MA 1GOGA 4COYA 1AR72 1KGYA 1S0DA 5EFUA 2DWRA 2WZR1 2HLEA 3N9OA 3LSEA 3JQXA 4CCCA 2D6PA 1S4CA 2V4AA 3I54A 3WDUA 2DURA 1FATA 4BQXA 1YFYA 1FMD3 1GKBA 5IVFA 1I1EA 2LALA 2Z5WA 2A6VA 5JAXA 4UW3A 1HRI3 4QD2A 1RXGA 1W0OA 3J4UH 3IIAA 4QQLA 3K2OA 3CDZB 3MUY1 4Q0SA 2BDRA 3BALA 4AWDA 4QDSA 4IUGA 3K4AA 2VMGA 3F95A 5JXHA 1I6XA 1QJX1 1TVGA 2W95A 2YYOA 4XJUA 2P6CA 1WLCA 1H8TC 1WW7A 2JDHA 4YVWC 3FJSA 3WDTA 4PJYA 2BERA 4BA6A 3KT1A 1W3XA 4ZS3A 5AVAA 4I30A 1LR5A 1XU2A 5DABA 2BBVA 5FBZA 3LDKA 4JGYB 4IEOA 3WD5A 2CU5A 2HWE3 4Q4X3 4HETA 4AFAA 4C1XA 4TZDA 1PX3A 3ALQA 4NRPA 1TME2 1XYNA 3ZIXA 4LBOA 4LT5A 3THTA 1K42A 2HWD3 2PHTA 3GCXA 2E7TA 4TYSA 2XDVA 2Y6LA 4XJWA 4XOGA 4R4ZA 1ZREA 3I8TA 3EB7A 1LESA 1ZZ9A 3AXDA 4RD7A 4NMIA 1UO9A 4TSVA 4UWDA 5IW0A 4XUTA 3I59B 5I0DA 1IPSA 1PIV2 2H0VA 3GGLA 4L8QA 1FV3A 4D7SA 3ZXDA 4CP0A 1UYZA 2GC2A 1RUJ3 2EF6A 4XQDA 3K3NA 1W9YA 1BCXA 5T3NA 4IV3A 2GU9A 1E57A 3O5SA 3Q8EA 3Q9OA 1C8M3 1CD3G 1O3QA 1PGL2 1IQAA 5CBLA 5A33B 4NIDA 4CEWA 5FLIA 3A0KA 1JZ6A 4N9IA 5FPAA 5GLZA 2W91A 4FPHA 1UMIA 5A1AA 3B94A 1S0EA 2YHJA 4R4XA 5EV7A 3U37A 4FQ4A 3K4DA 1WLDA 4YW4A 5FZGA 1F2NA 1XPWA 1HB3A 2WNUA 4E8DA 1OD5A 3UKNA 4DIQA 1E5RA 1M4WA 1UWWA 2R6QA 2XVLA 4MGQA 4P08A 1OT5A 2BNNA 1AR93 1HV1A 3KWVA 4YM3A 1ZA7A 2WR9A 2D6NA 5FY1A 4ASLA 1HRI1 4CDQC 4XFFA 4LO4B 3IDBB 4NIHA 2MPFA 2DVDA 2XJRA 4W6XA 1V6IA 2WNOA 4XVHA 5EP9A 1MZFA 2DVGA 5GZEA 1V6NA 4K6BA 2BPA2 2JB4A 1OD3A 2VNRA 4NIIA 2C9KA 2W92A 4CSWA 2XR4A 2NPIA 2D7FA 4NRMA 4Q4W3 1Y7BA 4CCJA 1WLWA 3CL1A 4Z92B 4XF9A 4YM2A 1VB2A 5C3SA 2GNBA 1LKNA 4PCRA 4ZONA 4HG6B 2UY8A 1XNBA 1VIWB 1AYM2 3G7DA 4AAXA 4IV3B 1J84A 5K0UA 4W6YA 3VBUB 5F6LB 2W68A 2ZMLA 4BWOA 3OBAA 5FZ0A 3TAYA 1B35A 5FYMA 1RMU1 2B46X 1O6UA 1SLBA 5DZEA 1FNYA 1OF3A 1VBD3 2OXBA 5JUVA 2VUDA 4ZU4A 1O4YA 2H6CA 3RYPA 2ATFA 1IOAA 3FFZA 4E2QA 1H8TB 4FAHA 3BOPA 4MUVA 4Q4X2 1V6MA 1AL22 3PL0A 2HWE2 1N1TA 1H1MA 1UYPA 1PVC3 4Y5Z0 1DG6A 5LA9A 2WAOA 3UESA 1MQTC 4P9GA 4DFSA 5AVPA 3WW2A 4GMP0 1OLQA 1VBA1 3V0BA 2VH9A 4YW3A 4CEYB 2D5HA 5A6QA 5IK5A 4HSJA 3T4HB 5T5JA 2ZGTA 4LK6A 4NHLA 3RS6A 4PDWC 1NCQC 1NYWA 3MGUA 4OQ9A 4EWEA 2WO2A 2WNEA 3H8RA 2XLAA 3OG2A 2JDAA 2GZWA 1S0CA 5FYVA 1JZ3A 1QOTA 2VCMA 4M01A 3N7KA 4IEUA 1PIV3 2VMDA 4WM7B 1D4M3 1QJX2 4EWDA 4K8FA 4DUXA 1KITA 1RHI2 3ZMNA 2CGOA 1LU2A 4CP1A 4JVAA 2FCVA 1UOFA 2PAKA 2JG8A 4RA0A 3FC0A 4CU7A 4ATFA 1GQHA 1XNKA 3PUAA 1YLLA 1XRUA 1G6NA 3IN9A 5D8AA 5L19A 5FYUA 3LFMA 4AG4A 2UU8A 3GZAA 4IV1B 4BZ4A 4AOCA 3APBA 2D3PA 4DQAA 4RS5A 3UK9A 4Z1VA 2WABA 1FOD1 1VRBA 5JLVA 3HNYM 2Z79A 2QE3A 5F1RA 2JKXA 4B1MA 2HWB2 2R073 3WV6A 3Q8AA 1H2NA 5CAZA 1NCQA 3PTRB 2W39A 4DPNA 4DY3A 3T30A 2PHDA 3M4FA 1QH6A 3H1MA 4ET7A 1AR63 1AYN2 4MX3A 5FMCA 3ZFFA 4NVPA 5CB7A 2IWGB 1AHSA 3I2FA 3KT7A 3OOXA 4L11A 4KWLA 4YW2A 3RI9A 4CCNA 4IQPA 4RFRB 1L7QA 3OGRA 2V5YA 3WP5A 4C91A 4OQ8A 3MF6A 2D40A 1IGOA 4JKKA 2W0XA 4RGGA 4FCAA 4CCLA 4HT1T 2BOJA 3RZJA 1YI9A 2PHFA 4YFZA 3LEKA 3ETPA 3Q8BA 3TN92 4HKOA 3C7EA 1GFF2 1HXS3 1NXD1 4GALA 4WM8A 4YNIA 2ZMNA 2ETEA 2W47A 1PMJX 4FFIA 5FYSA 2IFWA 2QUOA 3NQHA 4J25A 1LHVA 3N7MA 1ASJ1 2V09A 4M4RA 1Z7S3 3WG3A 3ZFEC 5A3UA 1RUNA 3IPVA 1RB8G 2ZCWA 4FOWA 3PIGA 4QX7A 2WS93 1FV2A 4HN0A 4CP9A 3OPWA 4PBOA 1FMD1 5FQ0B 3NJVA 1R082 1FPN3 1DGRN 1RUD2 4JGYA 1YQ5A 3WF1A 3S57A 3CJIC 3WVJA 2QQIA 1BEV3 3WQBA 3S30A 1HDKA 1UY0A 4FPFA 1ND2B 3DCQA 3LIGA 4RYDA 4XXPA 5FCCA 5L7OA 2ADDA 5JZGB 1OUSA 1Y3TA 2YBPA 3J8F3 1NQDA 4QGNA 4WZFA 4HN1A 4L99A 1OC1A 1U5XA 1QU0A 1FNZA 3WCSA 4QPWA 1H2LA 1W6OA 2FCTA 3WEZA 2NP0A 1XC6A 4QKBA 4CUCA 5A6ZA 1O3RA 2CHHA 4PBPA 1ENRA 2BNOA 1DYPA 2XJSA 4KG0A 5IUQA 3WDXA 1RHI1 3VD5A 2PMWB 4OLLA 2VMHA 2WNUC 1AYN3 4V1PA 3C7FA 2C9AA 2DCTA 4X6QB 5KR7A 1QOOA 4F7ZA 4JAAA 3I2HA 1NY72 3WDVA 2C24A 2GH2A 2HYXA 1ZRRA 1JYIA 1GICA 4CDXC 2QQWA 1Q3EA 2G9GA 5CEHA 1JUHA 3ZYPA 2PAMA 5GLUA 2WZEA 4E27A 2D6OX 4BISA 3MV01 4LXLA 2VZRA 5LB6A 3MHZA 5FY0A 4FOVA 1KRIA 1W90A 1WD3A 4NR1A 4EE2A 3ZSKA 2PA7A 4ZKTB 5LCWL 2ERFA 2QZ3A 3U75A 4MGYE 1TE1B 2VVFA 1RUG1 4LMFA 1JYNA 4UOJA 1S0BA 2DCYA 1UY4A 3BODA 1VBA2 4ONUA 3W5NA 3O1MA 2R1DA 4G3YC 3NJYA 1RUH3 5BNPB 2A3YA 3MW2A 1PIV1 3NV1A 5FYCA 1V9U2 4DXTA 1AR83 3ZXFA 3WW1A 4LBQA 2WNVA 1ENXA 2P5BA 2BYVE 2WS92 1O3TA 4CCKA 3H42B 3J7LA 3UKVA 5JOZA 1RTVA 4GULA 3AP5A 1KQRA 4Y20B 4BM8A 1PK6B 5A7OA 3O0WA 4X8PA 3DKQA 4OHXA 3LSDA 3OUIA 4RHV3 1NT0A 3D3AA 3K48A 2L9LA 1LHWA 1PX4A 1AZDA 2AACA 2ZS6B 1GANA 4GQ7A 1ULCA 5FYYA 4DY5A 1NCRB 2RJLA 1X50A 4LHKA 2YU1A 4MZUA 5GALA 3L2HA 2WAAA 1ZBE2 3HQUA 3LEMA 4I0BA 5A1FA 4YM1A 4IEXA 2FBEA 3ZDVA 1W6MB 1LHOA 4XC9A 1EY2A 4AQ6A 1RUG3 1AR62 5J3UA 3ZPYA 1FYUA 4UFLA 3IKWA 2AUYA 5FXVA 5ISLA 4JRAA 5J37A 4CUGA 3VD3A 5JVVA 3U07A 1J1LA 1UNBA 3JU9A 3M3IA 3CHXA 3MLJA 2XKPA 5BXXA 4EZ4A 1ND2A 2A73B 4QQOA 3KF5A 3V0AB 2VW0A 1PM4A 1KFUL 5H9PA 4JTNA 3VBHB 1UU6A 1XJAA 1G9DA 1AJOA 4LLOA 3SMHA 3ZXLA 4AEKA 4DZGA 3E5XA 4IE6A 3HVDA 3BIEA 4LEJA 3WY6A 3H7JA 1PO13 1BBT3 4HKWA 4K8RB 5EQUA 2A3XA 4X6RB 1SMVA 1SZBA 5DPNA 1CESA 4HK8A 3IMNA 2ET1A 1EV12 4IEWA 1EV11 4IERA 3I3MA 1ZVFA 1XE7A 4UFIA 4MADA 3BYWA 3IWZA 1QQP3 1XBFA 1ASJ2 4MLOA 4B4RA 5CA6A 5FZ4A 4NAMA 1F31A 2WN3A 3PUHA 2RDRA 2OQ6A 1IG3A 3ZDSA 4NROA 2Z2SB 1L7LA 2GN3A 1WBFA 3RNSA 1RUD1 4F8AA 3IMMA 2ZZQA 1WCDJ 2E63A 1H9WA 1Q8PA 3BTXA 2WFF1 4M3CA 4I0AA 2FCUA 4YZ1A 1S2KA 5A32A 3OTFA 1JZ7A 2IXLA 5FWJA 5LA0A 4ARXA 3SH4A 3EJKA 2P3JA 3ZXAC 5FMOS 1U12A 2PLV3 1H4GA 5AFEA 1KFXL 4FPYA 2IXHA 2WS91 2XUMA 2FHRA 4XIKA 1J83A 2BUKA 5ANNA 4EN7B 1A34A 1GNZA 3IDAA 2J1SA 1TMF2 1ASJ3 1XQNA 2ZHMA 1W2TA 1J1TA 5LY2A 4AI8A 1XSRA 1MEC3 4BQ1A 1POV3 2XVGA 4PHZA 4Y5SA 1EUUA 1H4HA 2A6ZA 3B93A 2C4XA 2FDGA 1HXS1 1HN0A 4IEVA 4JC1A 4Q0UA 4QB1A 3RWNA 3O1UA 1Q5OA 3MLKA 4XIOA 3WOGA 5I0UA 4D69A 4AEDC 5FRAA 3TRSB 4FO9A 3H50A 1US2A 3VL9A 1F4AA 2LS6A 1YXWA 4HL0A 3C3VA 2WLPA 5EPAA 3NV4A 4ZXEA 3I2DA 3R4UA 1JU3A 2YXSA 1KJLA 1NA1A 1XYPA 4D8MA 1H30A 4YYOA 5GZGA 2WUHA 4FPGA 4E9KA 3AP6A 1REFA 1WMDA 5GLTA 5HXVA 4LIUA 2E53A 2UYAA 1PK6C 1QIQA 5FP8A 5FZIA 3WDWA 1W99A 5HI0A 3VBOA 1MS5A 4DXSA 3AZZA 4XUNA 2VZPA 2Q0AA 3RGBA 1UIJA 2ZBJA 5FYIA 2PYTA 5E8AA 3J26N 4KBBA 5BNPC 3J7NA 3O7OA 1BZWA 3ACFA 1W6OB 1TNFA 3B01A 3NNGA 2WWSA 4IE7A 2Z4FA 4E2GA 4CDUA 3IZOA 1SG3A 2R30A 5JR7B 2B9UA 2CTVA 3D8CA 4CU8A 2JICA 5C8CA 4G4FA 1NA1C 1QH7A 2PQSA 1UF2C 2QNKA 3I7DA 3MIBA 3N35A 2DDUA 4LBLA 3ZSEA 1ZBA2 5JMCA 2RS13 4C0BA 1YNAA 2VMCA 4LTAA 3WQ0A 5C3RA 4FXGB 2Y38A 4LA3A 4LBMA 4C90A 1QJY3 3PU3A 3O1OA 4B29A 1ULDA 3ZM8A 1W05A 1C8NA 2BOIA 2R32A 1XYOA 1AR73 5H9SA 3AFKA 1RJ7A 1W03A 2G9FA 2VUAA 1ONAA 2Y64A 4AFMA 5D1IA 1DYOA 1WA6X 4QKFA 2DTWA 2WZPP 3KF3A 1RUF2 2GMPA 3OY8A 4OZXA 2X5IC 5CKQA 4A44A 1DGLA 1SBDA 4N90A 3HQXA 3GYDA 1NXMA 5JPMB 5KXEA 4XF3A 1QHDA 1TG7A 2VMEA 2PHLA 4JGZA 1SQ4A 4ES8A 2ES3A 2JIGA 4NJ4A 4PF5A 3MZHA 2YFZA 2CGPA 3U14A 3U10A 3T1MA 4YVWA 3E97A 1EAH3 1KS4A 3GM8A 1LHNA 1US3A 3N9PA 3POFA 3PVNA 2IXKA 5FPBA 5BPXA 1LOEA 4QKDA 1DZQA 4LBQB 1CZVA 2RS11 5FFOC 1LTEA 3KGZA 1GZWB 5C6CA 2B39A 3OGVA 1WW5A 4N43C 3CIHA 1K5JA 1XOYA 5JIAA 4EJRA 1BQPA 4MV2A 3MYXA 1EUTA 3OBRA 2J1VA 1D2SA 2DUOA 4JDOA 3UV9A 3KHCA 2FDHA 2FDFA 3DYPA 1G8WA 4QX5A 1ULOA 2BTVC 2WIIB 1JYXA 3KV4A 1JZ8A 1W2NA 1XNTA 2HBTA 2RR11 3JD71 5BNOB 2WFF3 3P6BA 3VHPA 1BJQA 1OA3A 4GB33 5A3OA 3LOBA 3N36A 4OMCA 2AH2A 3ZXEA 1YYNA 2ET7A 3OPZA 1OPMA 1LB2A 5K7PA 4M00A 2Q1ZB 3PU8A 4FTSA 2BVVA 4QM8A 2DFCA 2E31A 3FHQA 3VDCA 3AKSA 1ZRDA 4JGZB 5DDJ3 4K7JA 3V0AA 4YPJA 5FZHA 2RE9A 3D5OA 2O8QA 4P9LA 4URTA 1YCIA 1VBD1 5FZEA 4IGOA 5IT6A 2QKDA 3ZMOA 1RGSA 4RR3B 4UAPA 4A4AA 3CKHA 4L92A 4NO4A 3URFA 2D98A 4FPEA 3WNXA 4H7LA 1RUJ1 2BP6A 4EYUA 2VZUA 3QLQA 4HSLA 3SC7X 2IC1A 4QM9A 1YIPA 3ZSJA 3HR9A 1BVVA 4QX0A 4LO6B 4COWA 3JBG1 1LEMA 3AKTA 3OGGA 4MXWA 2D93A 4Q4W1 4HONA 2OUJA 3I2KA 4BPZA 1GBGA 4Q4V1 2YB7A 3VBFB 2DYCA 5FY5A 3ZSMA 4AE2A 5DUVA 1ZZ7A 5TSWA 4NWVA 2HWD1 4LPLA 1DGWA 2NZ9A 2PAEA 2RJKA 4ASMB 2BFUL 4QXKA 1CAXB 3NJZA 1CX4A 2VAUA 2Y60A 5T5PA 1K3IA 1CWPA 1OMIA 4XFAA 1CIYA 2JECA 4XTPA 4QX8A 3WQ1A 5HV0A 1W9WA 5B2GB 1YHFA 2XJUA 3DYMA 5FMBA 3OBZA 4YVSA 2Q8EA 1LOFC 5DZFA 4COVA 4DRVA 3AZYA 4RQPB 5FOBB 1ACCA 1YFWA 1LOCA 2W2IA 4LUMA 5IK4A 2WT1A 4ZZ5A 3PURA 2Y0OA 1MS1A 2VOTA 4QHZA 1F15A 3UETA 1W6MA 1CQ9A 2DVAA 2E26A 4BK4A 5A3TA 3QCWA 4PT6A 1VP6A 2ZEWA 3I3BA 1UZYA 4JV4A 4LBKA 5GZDA 1V6OA 4WM7C 4ES9A 4XDQA 1F35A 5DUWA 5JI7A 1VALA 3ME2A 1AXZA 4QKNA 2QQKA 3C2UA 3DPRC 3VBOC 4FOYA 3NAPB 2A70A 2HWC2 2OUHA 5FZCA 5KC6A 4TLGA 1LRHA 2W3JA 1CVNA 3ACIA 3HD8B 3KCYA 1G7YA 3MF9A 3ILNA 2GC1A 5I8YA 3TYJA 1QF3A 4A6SA 4CEYC 2VPVA 1CPMA 3OSDA 4BMBA 5JWPA 4DB5A 2P3YA 3DV8A 3HBZA 1CR7A 3MFAA 4KMQA 1CAXA 1PVXA 2DCZA 2Y6JA 3D4KA 4YW7A 4BIOA 4O9EA 2BGOA 4AHXA 1GZ9A 4XUOA 1VBD2 1X8EA 5F5QA 1CZTA 1APNA 1QNYA 2TNFA 4PDWA 2A6WA 4CDWC 1NG0A 3A23A 1QJZA 2RDSA 4Y20A 1MZ5A 5D21A 2OS2A 4JKLA 3N4MA 1RUF3 1NCRC 1UX6A 3N9NA 5A80A 1BEV2 5D2AA 1ND3C 2W9XA 4Y5TA 5AC93 2BW8A 2IXJA 2VNGA 2W08A 1WBLA 1OKQA 2XG3A 1WGPA 2YFUA 2EXJA 4CRQA 1R083 4R52A 2X5IA 3HPNA 3MO4A 3VDDC 5FKCA 3ZOIA 3O14A 2VBDA 4UFKA 4EZHA 4ZHNA 2WA4A 4AEDA 2C6SA 3TEZA 4YWAA 2JG9A 5IAVA 1PHMA 4FVVA 4CCDA 4XE9A 2PLV2 3NAPA 3NJXA 3RI8A 3ZFFC 3ZYHA 4QPGC 5KC5A 1VBE3 4LHNA 3AJYA 3PJQA 2VQUA 2EVXA 3NNJA 1PGW2 3JD72 1XNAA 5BNOC 4MXVA 4P9IA 3LB9A 1MR5A 1OVPA 2R16A 3VBHA 3GCWA 5C5UA 5JOWA 4OUSA 2LW8A 4UW4A 4CUAA 3IDEA 4LR4A 4NUBA 3HMYA 2TEPA 3J7MA 2Q1FA 4D94A 1PK6A 1JI6A 1Y43B 4B4PA 4MSVA 3RMXA 3LGRA 4AI1A 3V65A 1H2MA 1IS6A 4PDWB 4KWKA 1XNDA 3FWEA 1CAVA 3WNLA 4LE4A 3VBRB 3VDDA 3WHTA 2MEV1 4WM8B 5E1RA 2VQ0A 3F2ZA 2JG8B 2PFWA 2GSYA 1RUJ2 3KV5A 5FZDA 3IBMA 4BH9A 2RS51 2YV8A 4PQ9A 1LGCA 4A6OA 3NAPC 1COV3 3ZKYA 1QJY2 1GUIA 2B42B 1CZSA 4IEYA 4IE0A 4YG6A 1HX6A 3DEMA 4S2HA 4FP2A 5FPUA 3SLIA 1ZBA3 5FO9B 3KCCA 4IEPA 1S0FA 1LU1A 2WZ8A 1QDOA 1NUKA 4NE9A 4XBLA 2C1FA 5CG8A 1KJRA 2HWD2 5FZ1A 3RZKA 4RHV1 3BPZA 4HOOA 2GC3A 2IXCA 5FP3A 5SV8A 3OGSA 3ZVXA 3WNMA 1YIFA 4H14A 1S2BA 4XDOA 3PUQA 4XQ4A 3ZFFB 5IFTA 3K75B 1GWMA 1VRH1 2O1QA 2QFEA 5CKMA 3UL2A 3MW4A 1X36A 5FZMA 4XCBA 5DMYA 2BBAA 2CDOA 3POIA 2QDNA 3HNMA 4Q29A 4Y3OA 3T0BA 1BEV1 4CEWB 5CG9A 4YZ4A 4XBNA 3JD73 3WW3A 1R64A 2ZX1A 5JSRA 2AYHA 1C3HA 3T0AA 3UGFA 4X8NA 2QQUA 3ZYGA 2KA3A 3POGA 5FPZA 1GV9A 1UMHA 1OOPB 5I0TA 3ZFGA 3I49A 4Q26A 2P6HA 3S7IA 4B7KA 1O91A 1JHJA 5JZGC 2XKOA 2ZX3A 2PQQA 1OURA 2JDUA 4A7YA 1BLZA 2UWCA 2WQZC 3MPPG 3S0MA 1JHNA 5IK8A 2YMZA 4Q4V3 5KHIA 4CDXA 3PIJA 3UYJA 4AVVA 4KWJA 4DS0A 2RR12 1U5YA 3ES4A 3T08A 3WF2A 3ZPOA 4BQWA 1PGW1 1VBA3 3N9LA 4GH4B 4TLFA 4Y26A 4FI9A 4EV0A 5IAXA 5F2WA 4QU2A 4AI3A 2RHPA 4OVEA 2UYBA 5LASA 4CZSA 1N3OA 1YI7A 1F4HA 2Q8OA 4K9SA 3QH7A 4LO8A 3WDYA 1UY3A 4CEWC 4NOTA 2B45X 1Y9MA 1LENA 4O61A 5DXDA 3WCRA 5M0TA 4RR3A 5LWBA 5ERLA 3RZZA 3A21A 2EXKA 2GH8A 4RFT0 2YY1A 3H9AA 4K1YA 1MS8A 1OQDA 2VZ1A 4ZZ8A 1JOPA 3AJZA 5LBCA 1NLRA 3AM2A 1AR92 2F4PA 4CPBD 2QQVA 3VHRA 1PM7A 2G19A 2AEZA 4P9WA 4RQPA 5FK8A 3AX4A 2JWPA 2LROA 2XH6A 4QPYA 3SCGA 4GJZA 5FREA 3S5QA 3JBG2 1QJY1 5I8TA 4Y4RA 4B7EA 3R05A 3AKRA 2ZEZA 4D3WA 2DBNA 1Q8OA 4AFCA 5F9TA 5J36A 2K2SA 5FYBA 4XHXA 1MACA 4YARA 1K5MC 1GOFA 1VBE2 1W8WA 2VR4A 4RHV2 3TEWA 1VBE1 1ZA4A 3KHBA 3MEPA 3OCPA 4BB3A 1BXHA 4Q8LA 5CFDA 3RRDA 1DF0A 1V6JA 2Y6GA 2DU1A 3IDCB 3L9JT 3OUJA 3VBOB 3NMBA 2RM21 3RFRA 3GALA 1UU4A 3FZ3A 3ZYBA 4AAPA 1MQTB 3I4IA 4U2AA 1U0AA 5C7GA 4XF4A 3AMHA 1JOJA 5C9AA 2BQPA 1DBNA 3TEYA 2ZACA 4I2OA 3ZN6B 2WA3A 3PTYA 5J1XA 2BWAA 4IDZA 2D3RA 5FO8B 2J22A 1AYM1 3AZXA 2XOMA 2EA7A 3B7MA 3WP3A 3POSA 1OF4A 1F5JA 5D8AB 5E6HA 2V4VA 1HRV2 3MIHA 3UT0A 5JMOA 4LULA 3WF0A 1W0NA 2VW1A 4GWNA 1GP4A 5A6YA 4MYEA 3TN93 2BZDA 4FFHA 1DQ2A 1O7FA 1UXXX 3AYAA 3PMSA 4LORA 3T2QA 3VD9A 1YUDA 4META 2NM1A 4CCMA 1N3QA 3VDAA 1AR71 3ZR6A 4FBFA 1AL21 1D0HA 1J58A 2HJIA 2HWC1 2VZOA 2WZR2 4AXOA 2ARCA 5LA2A 3SH5A 4GKXA 1QY4A 1ZBE3 1YQ2A 3ABZA 3NSTA 4Y1ZA 3VBHC 3ES1A 1VLNA 4RS5B 3WNNA 3LF7A 4AZZA 3LOIA 3PNAA 1RUI1 1PO23 1ND3B 2YDEA 4JDNA 3VHNA 2HWC3 4QGMA 4CXWA 4MHRA 5HCBA 5C3PA 1W6QB 4NHMA 1QJU1 3KGLA 3ZXKA 4QMAA 4HXCA 1A78A 4OULA 4CDQA 1LJ7A 3TNPB 4XZPA 4LO5B 4AQTA 4QQPA 1CPNA 1A8DA 1IHMA 1V9U3 1RUC3 4IEZA 4YG0A 2JKBA 1AR91 4QXHA 3VDBA 3LWCA 5FXWA 4H7MA 3AZVA 2VE1A 2HWF3 5A33A 4FTBA 3O0XA 5F5IA 1WW6A 3M2MA 5FWEA 2CAUA 2R0FA 3AYDA 2BJSA 4FAGA 2XJQA 3HN3A 2ARBA 4I3GA 4BU2A 4BQ4A 1EPWA 1O8PA 1T6GC 1LEDA 2VY0A 4GWMA 5IHRA 1HN1A 3HJRA 3M1HA 2ZKNA 4MOAA 4OI4A 5FP4A 1GNYA 1Z7S2 1CAUB 4XF0A 4AI9A 3JCIA 3TBDA 1JUIA 4ORFA 5K8SA 3U0ZA 3WG1A 2FQPA 3SHRA 4COUA 2HWB1 5FY8A 2XL9A 4CDWB 1BBT1 3GXUA 1PO21 1W2UA 2ZZJA 3FBMA 3ROUA 3POYA 2ZGRA 2VOXA 3AZWA 2F17A 4TN7A 2ZHLA 3ZKUA 3H7YA 4YZ2A 4IV1C 2JG9C 2QCSB 2WZR3 2UY9A 1CONA 3JBG3 4BQ5A 1AL23 2J1TA 3LAGA 4LNVA 1JU4A 2ID4A 2VTXA 3GBWA 4JKMA 1JYWA 1POV1 3H8XA 1ULPA 1D4VB 2ORXA 2BNMA 3ILFA 5FYHA 1UW8A 5DZGA 3D6EA 5C71A 3TN91 3OEAA 2OKXA 4AL9A 3U1XA 4JGYC 2RDQA 3NKGA 2HWB3 1H2KA 2R072 1YFUA 4XPVA 3SCFA 3LEIA 4AHYA 2KD7A 1V70A 2C26A 2TBVA 4BJ0A 3AYCA 4B3NA 5H9QA 4MH0E 1UOGA 3MICA 3JXSA 1J59A 3PDQA 5IATA 3LA7A 1G9BA 5A70A 5DG2A 4LBJA 3CZJA 2VZQA 1WWYA 2OT7A 1HB2A 1FPN2 1RUD3 1I9RA 5LZ6A 4UFHA 2WINB 4D7YA 1O5LA 5F32A 5BV6A 2J1UA 1JYVA 2GNTA 3VL8A 4CUBA 3VBRC 3I2JA 4GMP1 3WP4A 4Y1YA 1RC6A 2BVBA 1W8OA 2RR13 4OI2A 1UL9A 1ZM1A 2I07B 1N3PA 3CQOA 2EIGA 2FMDA 4BIFA 1W9SA 1NLQA 4U36A 4AK3A 1O4ZA 1WCUA 2VOWA 3IT8A 4DNYA 1W6QA 1C57A 3RQ0A 2JB8A 2NYYA 2YC0A 2JDKA 4QHBA 5FZKA 1LGBA 4WVMA 4Z07A 1RUE3 4RL7A 5LW9A 1GR3A 1LNSA 1RUH1 4WVZA 3VZKA 3ITQA 3ZN5A 1IQDC 4YVWB 4ZS2A 2C5DA 4PLMA 2VVDA 1DHKB 3R0RA 4QQ2A 1GU3A 3WG4A 1GYKA 2OX0A 3N7LA 3OYWB 2A6YA 2XBO1 2ZGPA 3BPSA 1JH5A 4CA9A 5KXBA 2WKKA 2VQAA 2X09A 3H3UA 2KXLA 2XONA 3OPTA 3AFGA 2DFBA 2JENA 5FR3A 1XNCA 3VBRA 5CFDC 3KMHA 1WA4A 1TME1 4MGZE 2CL2A 3VN4A 5EYXA 4NAOA 4XW3A 1RIRA 3H3ZA 4MGIE 1NOVA 2VUJA 1F8VA 4K1ZA 5ANQA 4Q4X1 5CISA 3MI8A 4JHZA 1CAUA 2QQPA 3E5UA 4O9GA 3WF3A 1DDLA 4WVVA 1AYN1 1AYM3 2CYFA 3T09A 2RJ2A 2D3SA 5IVVA 4KU8A 1RHI3 5IVCA 3W9AA 1DLLA 3PLQA 3VB9A 2QTWB 1NE4A 1RUI2 1LULA 5FJKA 4L9BA 4CVUA 4FQZA 1FI2A 1G9AA 1MEC2 1QJU2 1UY1A 1XE0A 1TME3 2RS33 1QWRA 2X53S 1XE8A 1GQPA 2FDJA 4XFIA 3CLPA 4FP3A 2RM23 1PGL1 1LAJA 1R1A2 1FAYA 2DVBA 1DU3D 4UT5A 4AVSA 1IPKA 1VMJA 4R9AA 5B4XA 5FZ8A 1CAVB 3H8UA 2FD8A 2WFPA 3H0OA 3POWA 5SV5A 3KQ4B 4MGTA 2JIJA 4W4ZA 3QACA 2JX9A 1FPN1 5C8WA 1RUE1 2VNOA 3M7AA 1EPZA 4QQHA 2GDFA 1IZ3A 1HQLA 3O12A 5F5CA 5FZOB 4N7IA 5BY5A 2WYFA 4JQRA 1F5FA 3N3HA 4HVQA 5HPOA 1H6XA 4YM0A 5KHJA 1G86A 2WQ8A 3MW3A 1VAVA 4HZFA 4MXWB 3VZLA 4B8EA 4KWUA 1QQP2 1SLCA 2JE8A 4KH9A 1JOBA 3BTAA 3VBUC 4IL7A 1J3PA 1HRI2 1UIKA 4FOQA 4PIXA 2GNMA 2RM22 4S2GA 4QXCA 1BBT2 3AVSA 3P3NA 2Y26A 3VKNA 4XEZA 3K51A 5FTTC 3NW4A 1A3KA 1X33A 4W6WA 5E88A 5J98B 3SCHA 1J3RA 1RINA 2VL4A 2P34A 1W8UA 4UBGA 4HVRA 1DZTA 1SFNA 2P2KA 4ASKA 2DUQA 3IAQA 5FY7A 2Y6HA 3I2GA 5EJZB 4BK5A 1UPIA 1UN1A 4Q4Y3 5F39A 1MVEA 4FPJA 5JPNB 4AGRA 3PJYA 4A7ZA 2BFUS 2VZTA 4BCUA 4CDQB 2XBO2 3RVHA 3WHUA 4OI1A 2FDIA 1UY2A 2WNVC 3N7JA 4LOTA 3KM5A 4F3JA 1IPJA 1BMV2 3FUQA 2YG0A 1LHUA 3KZ4C 2XJTA 5FO7B 1RMU2 5H9RA 3B9CA 1YQ6A 1W04A 3DYOA 3GZTB 5CYYA 1TMF3 2XVKA 1OOPA 1UZVA 3UJOA 1NA1B 2PHUA 3J9SA 2JG8C 1AJKA 4P5YA 4AR2A 1IKPA 2ZPXA 4DINB 4AQSA 2X10A 3O1RA 3FLPA 3G6JB 4IE4A 1DQ4A 5DQ0A 2HEYF 3VZJA 3ATGA 5LK5A 4CEYA 4EN8B 3BUCA 2J7MA 4YSFA 3FE5A 2J1RA 3SXWA 2VUCA 1PZ7A 2PHRA 4IV1A 2WT2A 5F2SA 5BNNA 1E5IA 3M3EA 4P02B 4LOSA 5F37A 4HFSA 1F9KA 2OYZA 1JYTA 3RYKA 2VOVA 4Q0PA 1UCXA 4A2UA 1UAIA 2BGCA 1UPSA 4CPBA 3CZUA 1X7NA 4CDWA 3RZGA 2W1QA 3OF1A 4PLNA 4TWTA 4XXAA 2RV9A 3I97A 5J48A 1B35B 3LA2A 1UKGA 5EJ3A 4GWJA 3WT3A 1OPOA 1C4RA 1GNHA 1RUH2 1E5HA 2WC2A 2XHKA 5CU1A 4ZXKA 1GLHA 1QGLA 3KVBA 3B02A 4GMP3 4YW6A 5LBEA 5LRRA 2PHXA 4J6GA 3A7QA 1SLTA 3AVRA 3C7OA 5GJ6A 1BKZA 3EO6A 2IZWA 4JRLA 4LKFA 5DUUA 2WRAA 4Q1RA 1RUC1 1PVC1 1I5ZA 3NV3A 5LRSA 3KVAA 2LRPA 2WSVA 4LQRA 5FPXA 4AGVA 3AP4A 3VGIA 3R4DB 3THDA 1QOSA 4BLIA 5JI9A 5J09A 1ZNPA 5JXGA 5IVEA 1Y4WA 1FOD2 1WUVA 2C0ZA 2MEV3 2CDPA 2JDMA 2AEYA 3OY8B 3P3PA 4H55A 4LLFA 2VTXJ 3GNEA 1SCSA 4D7TA 1CX1A 1SPPA 3AKQA 1WLTA 4XCAA 2XLFA 1T2XA 2A1XA 2HEVF 1PO22 4MO3M 3UJQA 2ZKLA 5JCTA 3CJIA 2OPKA 3L2YA 2D5FA 4XUQA 1RUG2 2VCBA 4QPGA 3S6PA 2E9QA 4M4PA 4OHVA 5T52A 3ORJA 3ZSLA 2RMU3 4CU9A 1D4M1 2G4IA 3B9IA 1FXZA 2BV4A 1RL3A 2PN5A 1UD1A 4GAZA 5EIYB 5IVJA 3ON7A 1JZ4A 2GMEA 3U4SA 3PUSA 4N53B 5K4LA 2H0BA 2Q8DA 1LECA 1W06A 1YJLA 3GJAA 4W65A 2E6VA 4CP9B 1R1A1 3LKJA 3DXTA 3ZFEB 3VZOA 3MIDA 2CWSA 1ZYBA 4JQTA 1SLLA 4OHYA 1N1SA 2VD7A 1H9PA 1U5ZA 1AR81 1YFXA 3IIIA 4MHUA 3KT4A 2ORZA 5FAXA 3SNMA 3MFCA 3W5MA 1IS4A 1CAWB 2W52A 3DL3A 5C3QA 2SBAA 3WW4A 3CJXA 4S2DA 4NHKA 2K9ZA 1RUF1 5FMDA 3WR0A 4OHZA 5LBBA 3FHIB 3K4ZA 3S7EA 1LOGA 2BU9A 2WJSA 1TNRA 2JEMA 4AHZA 4GA9A 1E5SA 1LOBA 1UOBA 3B69A 4QPIA 4BQ3A 1W8NA 1MVQA 1OA4A 4N43A 3KCXA 4GKYA 4WM8C 4EN9B 3R6SA 3WXPA 1C5HA 4CU6A 5KBFA 4P14A 2Y6KA 4NWWA 3SISA 3I2OA 4KU7A 4AQ2A 4URAA 4XJZA 5T55A 3VD4A 4QX3A 1WMEA 5EJ1B 3RSJA 1H0BA 2ZABA 4CCEA 1MS3A 4QHOA 1REEA 3OJBA 1DQ1A 5FJHA 1J3QA 4BE3A 1O5UA 5JOXA 2JD9A 4O7XA 5A1LA 4IE5A 1JW6A 1W9FA 2AC1A 5J96B 5JR2A 4CDUB 2NLRA 1BMV1 3VBSC 1IS3A 1QXRA 5C8CB 2VNVA 1SLAA 3ZYIB 1H8TA 1UYXA 2GNDA 5FUNA 1W3VA 4A42A 1OKOA 3C7GA 1NLSA 5L7OC 1JN2P 4RN5A 3LD8A 3JQWA 3AP9A 1QMJA 1RUOA 2GP3A 2EIDA 4IGPA 2VCAA 5DUXA 3WSOA 3V0BB 3O1SA 2I74A 1SPPB 3ETQA 3M3QA 4BLJA 1RVF3 3NNFA 2WFF2 3B5LB 3FLTA 1JYCA 2LTNA 2JE9A 4N9HA 4OHWA 1D4M2 1QJX3 5EXOA 3RYRA 4AFDA 1JBCA 2MNGA 3JZVA 5FLJA 4Y1UA 1QJFA 3RJ2X 1AX0A 1UZZA 3UGGA 1W6NA 5FP7A 5GM0A 3R4SA 3WINE 2VW2A 2ZX0A 3BKZA 4P5HA 5LK7B 3FHAA 4TTGA 2ZGUA 4BXSV 3K3OA 4FPLA 1SBEA 3AXEA 4UFJA 3Q8FA 3ZLIA 1QJEA 2HBUA 2Y0IA 1KEXA 4XUPA 2D6LX 4XHBA 5KXDA 1OQEA 3INAA 4AW7A 3A22A 4NPRA 4DXRA 3BU7A 4IV3C 5FZ9A 4A41A 2NN8A 1PVC2 3BOWA 4RQPC 2ZGMA 1EAH2
chains in the Genus database with same CATH topology
2ZAHA 1AR61 2WSUA 1X8MA 3ZN4A 2F6BA 2V73A 2TUNA 3A0NA 2CV6A 1K5MA 3EBRA 3CU7A 1G9FA 1W0PA 2BWCA 4GH4A 5EWSA 3VKFC 5L73A 2E7QA 4IXLA 1COV1 3QOPA 1COV2 2Z42A 2YROA 2FMYA 3LZZA 4ITCA 5C9AB 4J1XA 4JCKA 3AMQA 5A3MA 3NWKA 1LODA 3BCWA 2YPJA 3T2TA 4YZ5A 1CN1A 4IEQA 4XETA 4KG8A 1GQGA 1NE6A 3FUOA 4AI0A 4R9CA 1REDA 1IS5A 4GH4C 4WZCA 5KHHA 1H1IA 1HQNA 4Y1VA 2VG9A 4M0NA 4IESA 4XJAA 2ZOEB 1QDCA 2CAVA 4XFGA 4P9JA 1G9CA 3BB6A 3SITA 1DIWA 4YW5A 4M3CB 5A32B 4YGBA 5T50A 1AUYA 1UMZA 3RMYA 5ACA1 4M0HA 1DYKA 2WL1A 5CFCA 2GC0A 4N7UA 1MQTA 1AX2A 2ILMA 3AMNA 1NZCA 1GZCA 3USUA 3VKOA 5I8SA 4WBBA 4E4DX 5I0SA 2UWAA 1XU1A 2ZGLA 3KB5A 4WV8A 3AYEA 1MZ6A 2O0OA 4CTEA 2B7YA 4FPCA 2XL7A 1SEFA 1R093 4DRRA 4EWAA 1H8VA 3RDIA 1NY71 1R1ZA 1AX1A 2R063 4AVAA 4FTEA 4Q4V2 4YW1A 1SDWA 2VU9A 3EQEA 4L2NA 2ZJCA 2ENRA 4E4SA 2PHWA 1C5IA 1WCSA 1YJKA 5CADA 2A71A 2QVSB 2D44A 3USSA 2YGLA 1YWKA 4XBQA 2XGXA 1VBB1 2UWBA 2P37A 3JB8A 3HWJA 2ZMKA 1OI6A 4XMAA 1KDMA 2EAKA 1PMIA 3GHNA 1LCLA 3VBSA 4JGZC 3MPBA 2HEWF 4QPIB 4Z82A 4AGGA 2IXIA 1GSLA 2JXAA 3D82A 3M8LA 1EV13 1KXGA 4LO7A 2VMIA 4Z2WA 2CWMA 2DF7A 2JD4A 5BYNA 1FMD2 3GZUC 2XWJB 2DCKA 1ZZBA 1R081 2X29A 3PVOA 1AR82 1HIXA 3AB0A 3TOJA 5KHKA 2R062 3IPVB 2AENA 3NKTA 1R092 2D43A 5JIUA 5AC91 3AKPA 5ABJA 5AC92 4M3CF 2RS53 3ZYJB 1PNGA 1ULEA 2DTYA 3AK0A 4A7KA 5BNQA 2WLQA 5ACA2 1DQ5A 4N43B 4XFHA 1HLCA 4DMIA 2AGSA 2IFRA 4COZA 1B09A 1TMF1 5FMOL 3RG0A 4AI2A 2K0GA 4BOWA 2R0HA 4S2FA 5DG1A 3AP7A 1AL0G 2CY6A 3ZFGB 4PIYA 3V56A 2A7AA 4NN0A 3IM0A 5GZFA 2H6BA 5ABJC 2P17A 4H3WA 4JDMA 2HKXA 3KS7A 5I93A 1MS4A 3OD0A 4ZU7A 5DDJ1 5DDJ2 2CGNA 1OFNA 3LCPA 2ZGKA 2NMOA 4Q2FA 3O0VA 3B00A 1PO12 3FBYA 1VBB2 3PMEA 1PO11 4R9DA 4I0WB 1RVF2 1N1VA 1VBB3 3ENRA 4KL1A 4YGEA 3TWIA 1V9U1 5KXCA 1S0JA 1TEIA 1W6PB 1AVBA 1K5MB 3WLUA 2YGMA 3JUUA 4R8HA 4AVCA 4YGDA 1KDKA 1URXA 1N1YA 1Y9QA 3ZIWA 4Q0QA 4XYXA 2GMMA 3QBQA 5AFBA 3FLRA 3PVEA 3VZNA 4KQ7A 4YVSB 1HXS2 3CNAA 3ZYRA 2RS31 4XQWA 4AEJA 2DCJA 1ZBE1 1L3JA 3D0JA 2R061 3LA3A 4LBNA 2R042 5I91A 1OFSA 4RGAA 1EAH1 1S0IA 3UKTA 5GLWA 4GXLA 5HBAA 2I45A 3OGJA 1CAWA 4DXZA 3DUIA 2GAUA 2GN7A 3J8F2 2OA2A 1PGSA 2JE7A 1DFQA 1WW4A 3J8F1 1W6NB 1ZZCA 2LUWA 1AXYA 1FOD3 3FFQA 4Z8BA 5T5LA 1CIWA 2AREA 3MDPA 1OQ1A 3KD4A 5HCFA 1MS0A 2EXIA 1QXPA 1W6PA 2BEOA 1ND2C 4FPKA 2RS12 4YLZA 5L36A 2ARXA 4FSJA 3HT2A 1OA2A 2EXHA 4Y1XA 3CEWA 2JJ6A 3GHMA 4MVTA 1OOPC 3MIEA 3SH3A 3ECQA 5A3LA 3RPQA 3CF6E 1MZEA 2FZ1A 1S0GA 4XF1A 1NCRA 4CP2A 1B35C 2JDZA 1ULGA 1W39A 4HPKB 1EP0A 4LUKA 4ISQA 1XXNA 3JB4C 4HVOA 1YRZA 1R091 1C28A 3EXUA 4AHWA 1RVF1 4AEMA 4AYUA 5LEJA 5FDBA 1V6LA 3AMMA 3V64A 2VXRA 2LM3A 2D97A 1CGPA 1RJ8A 1IKQA 3FMGA 5BNNB 2AZ5A 2I2SA 3I59A 4F83A 3DGTA 1PNFA 4OUMA 5C4WB 4OI0A 4Y24A 1RMU3 1HRV3 5ACA3 1JTZX 4XFCA 3PHMA 2ZX4A 3TB0A 3HAGA 4XJ9A 1HV0A 1YO8A 3NL1A 4SBVA 5C9AC 3M3OA 4GB31 3MIGA 1UU5A 4KNCA 4Q4W2 4RS5C 1AXKA 4E2SA 5JSOA 1Q43A 5HCAA 4ZU5A 2JG9B 4I3PA 2XJVA 1ZZ6A 3MIFA 5D8AC 4J1WA 1I3HA 3U11A 1DGWX 4YZ3A 2VGDA 2X5IB 2PLV1 1Z7S1 4LHLA 1PZ8A 3VZMA 5CFCB 1O4TA 2VULA 2ZHNA 4AFBA 3MLLA 1DQ0A 5EYYA 4FXKB 3RJRA 3ST7A 4Q1PA 4I02A 3VLBB 4QGLA 1MS9A 4XMIA 3D0SA 2QJVA 3CJIB 1CJPA 1POV0 1ZRFA 4Y22B 3ACLA 3HT1A 3CO2A 2Q1MA 3VDDB 3E6BA 5K0UB 3EHKA 3DN7A 1A6CA 4E4ZA 5FQ0A 2MEV2 3QH6A 4AEDB 1ZBA1 2RS32 2OZ6A 4K40A 4AVBA 2Q4SA 2XPJA 1QJU3 1EYBA 4WVWA 1CJDA 3ZFEA 4Q4Y2 4R9BA 5I0RA 4CYDA 1SBFA 1RUI3 4B4QA 1QKQA 4CDUC 1VJ2A 3H1WA 1TQ5A 1C1FA 5BNOA 1KD7A 2A75A 2YUEA 5JZGA 1U5IA 2ZX2A 2FZ2A 1VB4A 3THPA 4QPIC 4A3XA 2X8KA 2PTMA 1NQJA 4WVMB 1FT9A 2OZJA 5GZCA 1X82A 1WD4A 4XTMA 3VBSB 5FOJB 2DVFA 2B8MA 1QNWA 3KSCA 3USUB 3ZO0B 1Q8QA 1UKRA 1C1LA 4EN6B 4I09A 2VOKA 1V00A 2KM2A 4GIQA 1RITA 1ALYA 2AR6A 2D6KA 5JSPA 4JTOA 4Y4YA 3ZXGA 2OW4A 2HYKA 1Q8VA 3ZXJA 2HWF1 4N53A 3WUCA 3TNQA 1D2QA 5CIRA 1WMFA 2A6XA 3PVBB 3M3CA 1C8M2 3VKMA 5GKAC 1C8M1 1SFYA 4CDXB 2R1BA 5KHGA 2Q5TA 4HBNA 3OD4A 1D0GA 2XWBB 2WNUB 3DKWA 2CNAA 2PELA 2EAAA 4Q27A 1QXJA 3U4XA 4Q8KA 1LOFA 4UBHA 4M3CE 1N47A 2RMU1 4KGGA 2DUPA 4LA2A 2QZ2A 3WP6A 1LOAA 3KLSA 1MEC1 1HKDA 1VR3A 4G9SB 4Y22A 1O3SA 3M70A 4N53C 4OFGA 1S55A 3QD6A 2A3WA 4WM7A 4YGCA 3HIFA 3ELNA 1S1AA 1H1AA 4C0HA 3DPRA 1DGRA 2A5ZA 3NO8A 5GLVA 4Q4Y1 2QDRA 1V6KA 1M06G 3A4UA 4UW5A 2R041 1ZRCA 4HK9A 1RUE2 3GBFA 2NMNA 4AF9A 3WG2A 5LEKA 2VVEA 2XB6C 3BIWE 5CFDB 2O8OA 2ZGSA 3H1YA 5ABJB 3FX3A 1Q8SA 3GBGA 1HW5A 1Z78A 4QT6A 1QQP1 4UW6A 3ZX7A 4HANA 5F6KA 1R1A3 4I01A 3VV1A 5BUVA 2Z69A 5L7OB 1PZ9A 4PLOA 4HKLA 4RR3C 5K0UC 4EROA 1VRH2 1VAKA 4XFBA 1Z0HA 5C33A 2ZA9A 3VUOA 1ND3A 3VKLA 5JOYA 1ULFA 5CNAA 2P3IA 1FX5A 5FLHA 2XJPA 3VHOA 2HWF2 2Q30A 5EZWA 3WX5A 5C4WA 4C1WA 2VECA 3OYWA 1HRV1 3AMPA 4KGQA 2P3KA 4YVSC 3W58A 1BYHA 2B5HA 4AVTA 1OSGA 1SCRA 4XJ8A 2E51A 2ZGOA 4HLTA 4L97A 2R49A 1WCKA 2UURA 3OBTA 2HWE1 2OIIA 1HQWA 5E16A 4YRDA 4P9XA 3VBFA 5T54A 2MHFA 2D6MA 4SLIA 3HN1A 1ENQA 4MGKE 3ZN6A 2N7GA 4FPOB 1JXNA 1LGNA 1VBC2 5CVRA 3X29B 1VBC1 4K20A 3W59A 1NCQB 3GF6A 2OVUA 4PIZA 3ASIA 3VBUA 4K3UA 2WNVB 2ZAAA 1KS5A 3WUDA 5C4WC 1AF9A 3NVCA 5CFCC 4P9YA 3T1LA 2WQ4A 3ILRA 3E5QA 4K21A 4GB32 4BYYA 2NQYA 1ZX5A 2SLIA 2YZ4A 1A8MA 4HPKA 3DPRB 2ZHKA 3WZ1A 4BMEA 4DOUA 3NV2A 2XLGA 1Q56A 5K9YA 1RUC2 1OLRA 4YFWA 4YG3A 3B3QE 3VBFC 5JDBA 1OHFA 1VRH3 2ZTNA 5E89A 1VAMA 2DV9A 4INDA 1BK1A 4LE3A 1VBC3 4QPGB 2E7AA 4ATEA 1DQ6A 5J7MA 3KQRA 4RSUA 1BVP1 4Q0VA 5BNPA 3E6DA 4BHPA 1ZZ8A 4IETA 2R043 2GALA 5BNNC 2RMU2 2ZGNA 1SACA 5T5OA 4ISRA 1ENSA 3WQ7A 3ZFGC 1SLIA 2DU0A 1GZWA 2WT0A 4FT8A 3DF0A 4UXAA 4EN0A 5C8CC 3E6CC 2R071 4XILA 5IK7A 2EALA 2ZGQA 2XBO3 1DZRA 4LBQD 5KWRA 2RS52 4HMZA 4COYA 1AR72 1S0DA 5EFUA 2DWRA 2WZR1 3LSEA 3JQXA 2D6PA 3I54A 3WDUA 2DURA 1FATA 1YFYA 1FMD3 1GKBA 1I1EA 2LALA 2Z5WA 2A6VA 5JAXA 4UW3A 1HRI3 4QD2A 1W0OA 3J4UH 3IIAA 4QQLA 4Q0SA 4AWDA 3BALA 2VMGA 1I6XA 1QJX1 2YYOA 4XJUA 1WLCA 1H8TC 1WW7A 4YVWC 3FJSA 3WDTA 4PJYA 4BA6A 3KT1A 5AVAA 4I30A 1LR5A 1XU2A 2BBVA 5FBZA 4JGYB 4IEOA 3WD5A 2HWE3 4Q4X3 4HETA 4AFAA 4C1XA 4TZDA 3ALQA 3ZIXA 1TME2 1XYNA 4LBOA 4LT5A 3THTA 2HWD3 2PHTA 2E7TA 4TYSA 4XJWA 4XOGA 1ZREA 4R4ZA 3I8TA 1LESA 1ZZ9A 3AXDA 4RD7A 4TSVA 3I59B 1PIV2 2H0VA 4L8QA 1FV3A 4D7SA 3ZXDA 4CP0A 2GC2A 1RUJ3 2EF6A 4XQDA 1BCXA 5T3NA 4IV3A 2GU9A 1E57A 3O5SA 3Q9OA 1C8M3 1CD3G 1O3QA 1PGL2 1IQAA 5CBLA 5A33B 4CEWA 5FLIA 3A0KA 4N9IA 5GLZA 4FPHA 3B94A 1S0EA 2YHJA 4R4XA 5EV7A 4FQ4A 1WLDA 4YW4A 1F2NA 2WNUA 1OD5A 3UKNA 1M4WA 2XVLA 2R6QA 2BNNA 1AR93 1HV1A 4YM3A 2D6NA 4ASLA 1HRI1 4CDQC 4XFFA 4LO4B 3IDBB 2MPFA 2DVDA 2XJRA 4W6XA 1V6IA 1MZFA 2DVGA 5GZEA 1V6NA 4K6BA 2BPA2 2VNRA 2NPIA 2D7FA 4Q4W3 1Y7BA 4Z92B 1WLWA 3CL1A 4XF9A 4YM2A 1VB2A 2GNBA 1LKNA 4PCRA 2UY8A 1XNBA 1VIWB 1AYM2 3G7DA 4IV3B 5K0UA 4W6YA 3VBUB 5F6LB 2W68A 2ZMLA 4BWOA 3TAYA 1B35A 1RMU1 2B46X 5DZEA 1SLBA 1FNYA 1VBD3 4ZU4A 1O4YA 2H6CA 3RYPA 2ATFA 1IOAA 3FFZA 4E2QA 1H8TB 4FAHA 3BOPA 4MUVA 4Q4X2 1V6MA 1AL22 2HWE2 1N1TA 1H1MA 4Y5Z0 1PVC3 1DG6A 1MQTC 4P9GA 4DFSA 5AVPA 3WW2A 4GMP0 1OLQA 1VBA1 3V0BA 2VH9A 4YW3A 4CEYB 2D5HA 5IK5A 4HSJA 5T5JA 2ZGTA 3RS6A 4NHLA 4PDWC 1NCQC 1NYWA 3MGUA 4EWEA 2WNEA 2XLAA 2GZWA 1S0CA 1QOTA 4M01A 3N7KA 4IEUA 1PIV3 4WM7B 1D4M3 1QJX2 4EWDA 4K8FA 1KITA 1RHI2 3ZMNA 2CGOA 1LU2A 4CP1A 4JVAA 2PAKA 2JG8A 4RA0A 3FC0A 4ATFA 1GQHA 1XNKA 1YLLA 1XRUA 1G6NA 3IN9A 5D8AA 5L19A 4AG4A 2UU8A 3GZAA 4IV1B 4BZ4A 3APBA 2D3PA 4DQAA 4RS5A 3UK9A 4Z1VA 1FOD1 5JLVA 2Z79A 2QE3A 5F1RA 2HWB2 2R073 3WV6A 1H2NA 5CAZA 1NCQA 2W39A 4DPNA 4DY3A 2PHDA 3M4FA 1QH6A 3H1MA 1AR63 1AYN2 4MX3A 3ZFFA 4NVPA 5CB7A 2IWGB 1AHSA 3KT7A 4L11A 4KWLA 4YW2A 3RI9A 4IQPA 3WP5A 2V5YA 4C91A 3MF6A 2D40A 1IGOA 2W0XA 4RGGA 4FCAA 4HT1T 1YI9A 2PHFA 4YFZA 3TN92 4HKOA 1GFF2 1HXS3 1NXD1 4GALA 4WM8A 4YNIA 2ZMNA 2ETEA 2IFWA 2QUOA 1LHVA 3N7MA 1ASJ1 2V09A 1RUNA 1Z7S3 3WG3A 3ZFEC 3IPVA 1RB8G 2ZCWA 4FOWA 2WS93 1FV2A 4HN0A 4PBOA 1FMD1 5FQ0B 1R082 1FPN3 1DGRN 1RUD2 4JGYA 3CJIC 3WVJA 1BEV3 3S30A 1HDKA 4FPFA 1ND2B 4XXPA 5FCCA 5L7OA 5JZGB 1Y3TA 3J8F3 1NQDA 4QGNA 4WZFA 4HN1A 4L99A 1U5XA 1QU0A 1FNZA 3WCSA 1H2LA 1W6OA 2NP0A 1O3RA 4PBPA 1ENRA 2BNOA 1DYPA 2XJSA 4KG0A 5IUQA 3WDXA 1RHI1 4OLLA 2VMHA 2WNUC 1AYN3 4V1PA 2C9AA 2DCTA 4X6QB 1QOOA 4F7ZA 4JAAA 1NY72 3WDVA 2GH2A 1ZRRA 1JYIA 1GICA 4CDXC 1Q3EA 2G9GA 1JUHA 3ZYPA 2PAMA 5GLUA 4E27A 2D6OX 4FOVA 1KRIA 1WD3A 4NR1A 4ZKTB 3ZSKA 2PA7A 2ERFA 2QZ3A 4MGYE 1TE1B 2VVFA 1RUG1 1S0BA 2DCYA 4ONUA 3BODA 1VBA2 2R1DA 4G3YC 1RUH3 5BNPB 2A3YA 3MW2A 1PIV1 3NV1A 1V9U2 1AR83 3ZXFA 3WW1A 4LBQA 2WNVA 1ENXA 1O3TA 2BYVE 2WS92 3UKVA 5JOZA 1RTVA 4GULA 3AP5A 1KQRA 4Y20B 4BM8A 1PK6B 3O0WA 4X8PA 4OHXA 3LSDA 4RHV3 3K48A 1LHWA 2ZS6B 1AZDA 4GQ7A 4DY5A 1GANA 1ULCA 1NCRB 2RJLA 1X50A 4LHKA 4MZUA 5GALA 3L2HA 4I0BA 1ZBE2 4YM1A 4IEXA 2FBEA 1W6MB 1LHOA 1EY2A 4AQ6A 1RUG3 1AR62 5J3UA 3ZPYA 1FYUA 3IKWA 2AUYA 5J37A 4JRAA 5JVVA 3U07A 1J1LA 3JU9A 3M3IA 3MLJA 2XKPA 5BXXA 1ND2A 2A73B 4QQOA 3V0AB 2VW0A 1KFUL 5H9PA 4JTNA 3VBHB 1UU6A 1G9DA 1AJOA 4LLOA 3SMHA 3ZXLA 4AEKA 4DZGA 3E5XA 4LEJA 3WY6A 3H7JA 1PO13 1BBT3 4HKWA 2A3XA 4X6RB 1SMVA 1CESA 4HK8A 3IMNA 2ET1A 1EV12 4IEWA 1EV11 4IERA 1ZVFA 1XE7A 3IWZA 1QQP3 1ASJ2 4MLOA 4B4RA 5CA6A 1F31A 3ZDSA 2Z2SB 2GN3A 1WBFA 3RNSA 1RUD1 4F8AA 2ZZQA 1WCDJ 2E63A 1H9WA 1Q8PA 2WFF1 4M3CA 4I0AA 4YZ1A 5A32A 1S2KA 3OTFA 2IXLA 3SH4A 3EJKA 2P3JA 3ZXAC 5FMOS 1U12A 2PLV3 1H4GA 5AFEA 1KFXL 4FPYA 2IXHA 2WS91 2XUMA 2FHRA 4XIKA 2BUKA 4EN7B 1GNZA 1TMF2 1ASJ3 1XQNA 2ZHMA 4AI8A 1J1TA 1MEC3 4BQ1A 1POV3 2XVGA 1H4HA 2A6ZA 3B93A 1HXS1 4IEVA 4JC1A 4Q0UA 3RWNA 1Q5OA 3MLKA 4XIOA 3WOGA 5I0UA 4D69A 4AEDC 5FRAA 3TRSB 4FO9A 3H50A 3VL9A 1YXWA 4HL0A 3C3VA 2WLPA 3NV4A 3I2DA 3R4UA 2YXSA 1KJLA 1NA1A 1XYPA 1H30A 4YYOA 5GZGA 4FPGA 4E9KA 3AP6A 1REFA 1WMDA 5GLTA 5HXVA 2E53A 2UYAA 1PK6C 5HI0A 3WDWA 3VBOA 1MS5A 3AZZA 2Q0AA 1UIJA 2ZBJA 2PYTA 5E8AA 3J26N 4KBBA 5BNPC 3O7OA 1BZWA 1W6OB 1TNFA 3B01A 2WWSA 4E2GA 4CDUA 2R30A 5JR7B 2B9UA 2CTVA 3D8CA 2JICA 5C8CA 4G4FA 1NA1C 1QH7A 2QNKA 1UF2C 3I7DA 3MIBA 3N35A 4LBLA 5JMCA 3ZSEA 1ZBA2 2RS13 4C0BA 1YNAA 4LTAA 3WQ0A 4FXGB 2Y38A 4LA3A 4LBMA 4C90A 1QJY3 4B29A 1ULDA 1C8NA 2R32A 1XYOA 1AR73 5H9SA 3AFKA 1RJ7A 2VUAA 2G9FA 1ONAA 4AFMA 5D1IA 3VBRB 2WZPP 2DTWA 4OZXA 1RUF2 2GMPA 3OY8A 2X5IC 1DGLA 1SBDA 4N90A 3HQXA 3GYDA 1NXMA 5JPMB 5KXEA 4XF3A 1QHDA 2PHLA 4JGZA 1SQ4A 4ES8A 2ES3A 3MZHA 4PF5A 2CGPA 3U10A 3T1MA 4YVWA 3E97A 1EAH3 1KS4A 1LHNA 3PVNA 2IXKA 5BPXA 1LOEA 1DZQA 4LBQB 2RS11 5FFOC 1LTEA 3KGZA 1GZWB 5C6CA 2B39A 1WW5A 4N43C 5JIAA 4EJRA 1BQPA 4MV2A 3MYXA 3OBRA 1D2SA 2DUOA 4JDOA 3UV9A 1G8WA 4QX5A 2BTVC 2WIIB 2RR11 3JD71 5BNOB 2WFF3 3VHPA 1BJQA 1OA3A 4GB33 3LOBA 3N36A 2AH2A 3ZXEA 1YYNA 2ET7A 3OPZA 1OPMA 1LB2A 5K7PA 4M00A 2Q1ZB 4FTSA 2BVVA 4QM8A 2DFCA 3AKSA 1ZRDA 4JGZB 5DDJ3 4K7JA 3V0AA 2RE9A 3D5OA 2O8QA 4P9LA 4URTA 1YCIA 1VBD1 5IT6A 2QKDA 3ZMOA 1RGSA 4RR3B 4L92A 4NO4A 3URFA 2D98A 4FPEA 3WNXA 4H7LA 1RUJ1 4HSLA 3QLQA 2IC1A 4QM9A 1YIPA 3ZSJA 3HR9A 1BVVA 4LO6B 4COWA 3JBG1 1LEMA 3AKTA 3OGGA 4MXWA 2D93A 4Q4W1 2OUJA 4BPZA 1GBGA 4Q4V1 3VBFB 2DYCA 3ZSMA 4AE2A 5DUVA 1ZZ7A 5TSWA 4NWVA 2HWD1 1DGWA 2NZ9A 2PAEA 2RJKA 4ASMB 2BFUL 4QXKA 1CAXB 3NJZA 1CX4A 5T5PA 1OMIA 4XFAA 2JECA 4XTPA 3WQ1A 5B2GB 1YHFA 2XJUA 4YVSA 1LOFC 5DZFA 4COVA 4DRVA 3AZYA 4RQPB 5FOBB 1YFWA 1LOCA 4LUMA 5IK4A 2WT1A 2Y0OA 1MS1A 1W6MA 1CQ9A 2DVAA 3QCWA 1VP6A 4JV4A 1UZYA 4LBKA 5GZDA 1V6OA 4WM7C 4ES9A 4XDQA 5DUWA 5JI7A 1VALA 3ME2A 1AXZA 3C2UA 3DPRC 3VBOC 4FOYA 3NAPB 2A70A 2HWC2 2OUHA 5KC6A 1LRHA 3KCYA 1CVNA 3HD8B 5I8YA 1G7YA 3MF9A 3ILNA 2GC1A 3TYJA 1QF3A 4CEYC 2VPVA 1CPMA 4BMBA 5JWPA 4DB5A 3DV8A 3HBZA 1CR7A 3MFAA 1CAXA 1PVXA 2DCZA 3D4KA 4BIOA 4O9EA 4AHXA 1GZ9A 1VBD2 1X8EA 5F5QA 2TNFA 1APNA 1QNYA 4PDWA 2A6WA 4CDWC 1NG0A 1QJZA 4Y20A 1MZ5A 3N4MA 1RUF3 1NCRC 1UX6A 1BEV2 1ND3C 5AC93 2BW8A 2IXJA 2VNGA 2W08A 1WBLA 1OKQA 2XG3A 1WGPA 2EXJA 4CRQA 1R083 4R52A 2X5IA 3VDDC 3O14A 2WA4A 4AEDA 2JG9A 1PHMA 4FVVA 4XE9A 2PLV2 3NAPA 3RI8A 3ZFFC 4QPGC 5KC5A 1VBE3 4LHNA 3AJYA 3PJQA 2EVXA 1PGW2 3JD72 5BNOC 4MXVA 4P9IA 3LB9A 1MR5A 2R16A 3VBHA 5JOWA 4OUSA 4UW4A 3IDEA 4LR4A 3HMYA 2TEPA 4D94A 1PK6A 1Y43B 4B4PA 4MSVA 3RMXA 3LGRA 4AI1A 3V65A 1H2MA 1IS6A 4PDWB 4KWKA 1XNDA 3FWEA 1CAVA 4LE4A 3VDDA 3WHTA 2MEV1 4WM8B 5E1RA 2VQ0A 2JG8B 2PFWA 2GSYA 1RUJ2 4BH9A 3IBMA 2RS51 2YV8A 4PQ9A 1LGCA 3NAPC 1COV3 1QJY2 2B42B 4IEYA 4YG6A 1HX6A 4S2HA 4FP2A 3SLIA 1ZBA3 5FO9B 3KCCA 4IEPA 1S0FA 1LU1A 5CG8A 1QDOA 4XBLA 2C1FA 1KJRA 2HWD2 4RHV1 3BPZA 2GC3A 2IXCA 5SV8A 3ZVXA 1YIFA 4H14A 1S2BA 4XQ4A 3ZFFB 2O1QA 1VRH1 2QFEA 3UL2A 3MW4A 1X36A 4Q29A 2QDNA 4CEWB 5CG9A 1BEV1 4YZ4A 4XBNA 3JD73 3WW3A 2ZX1A 5JSRA 2AYHA 1C3HA 4X8NA 3ZYGA 2KA3A 5FPZA 1GV9A 1OOPB 5I0TA 3ZFGA 4Q26A 3S7IA 4B7KA 1O91A 5JZGC 2XKOA 2ZX3A 2PQQA 4A7YA 2UWCA 2WQZC 3S0MA 3MPPG 1JHNA 5IK8A 2YMZA 4Q4V3 5KHIA 4CDXA 4AVVA 4KWJA 4DS0A 2RR12 1U5YA 3ES4A 4EV0A 1PGW1 1VBA3 4GH4B 4TLFA 4Y26A 4QU2A 4AI3A 2RHPA 4OVEA 2UYBA 4CZSA 1N3OA 1YI7A 2Q8OA 4K9SA 3QH7A 4LO8A 3WDYA 4CEWC 4NOTA 2B45X 1LENA 3WCRA 5DXDA 4RR3A 3RZZA 2EXKA 2GH8A 4RFT0 2YY1A 3H9AA 4K1YA 1MS8A 1OQDA 3AJZA 1NLRA 3AM2A 1AR92 2F4PA 3VHRA 1PM7A 4P9WA 4RQPA 3AX4A 2XH6A 3SCGA 4QPYA 5FREA 3JBG2 1QJY1 5I8TA 4B7EA 3R05A 3AKRA 4D3WA 5F9TA 4AFCA 1Q8OA 5J36A 2K2SA 4XHXA 1MACA 4YARA 1K5MC 1VBE2 4RHV2 1VBE1 1ZA4A 3OCPA 3MEPA 1BXHA 4Q8LA 5CFDA 3RRDA 1DF0A 1V6JA 3IDCB 2DU1A 3L9JT 3VBOB 2RM21 3GALA 1UU4A 3FZ3A 1MQTB 3I4IA 4U2AA 1U0AA 4XF4A 3AMHA 1JOJA 5C9AA 2BQPA 1DBNA 2ZACA 4I2OA 3ZN6B 2WA3A 3PTYA 2BWAA 2D3RA 5FO8B 1AYM1 3AZXA 2EA7A 3B7MA 3WP3A 3POSA 1F5JA 5D8AB 1HRV2 3MIHA 4LULA 2VW1A 4GWNA 4MYEA 3TN93 1DQ2A 1O7FA 3AYAA 3PMSA 1YUDA 4META 2NM1A 1N3QA 1AR71 4FBFA 1AL21 1D0HA 1J58A 2HJIA 2HWC1 2WZR2 4AXOA 3SH5A 4GKXA 1QY4A 1ZBE3 4Y1ZA 3NSTA 3VBHC 3ES1A 1VLNA 4RS5B 3LOIA 3PNAA 1RUI1 1PO23 1ND3B 2YDEA 4JDNA 3VHNA 2HWC3 4QGMA 5HCBA 1W6QB 4NHMA 1QJU1 3KGLA 3ZXKA 4QMAA 1A78A 4OULA 4CDQA 1LJ7A 3TNPB 4XZPA 4LO5B 4AQTA 4QQPA 1CPNA 1A8DA 1IHMA 1V9U3 1RUC3 4IEZA 4YG0A 2JKBA 1AR91 3LWCA 4H7MA 3AZVA 2HWF3 5A33A 4FTBA 3O0XA 1WW6A