4JDNA

Secreted chlamydial protein pgp3, c-terminal domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
144
structure length
144
Chain Sequence
KAFNNFPITNKIQCNGLFTPSNIETLLGGTEIGKFTVTPKSSGSMFLVSADIIASRMEGGVVLALVREGDSKPCAISYGYSSGVPNLCSLRTSITNTGLTPTTYSLRVGGLESGVVWVNALSNGNDILGITNTSNVSFLEVIPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virulence plasmid protein pGP3-D
publication title Structure of the Chlamydia trachomatis immunodominant antigen Pgp3.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Cell invasion
total genus 27
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1340 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jdnA00
4JDOA 4JDNA 4JDMA
chains in the Genus database with same CATH superfamily
4JTNA 4AVTA 1VBD2 1WCSA 2VZPA 3GZUC 3I4IA 5CIRA 4CPBA 5F1RA 4W50A 1PIV3 1SCRA 4MV2A 4Y33A 1O6UA 4LR4A 2ZAHA 4IESA 1UOGA 3AVRA 4NPRA 5J37A 4LKDA 4N9IA 2ZEXA 2JJ6A 3IT8A 4AAPA 2Y64A 1RITA 4EV0A 4O9GA 4EJRA 1LHUA 2F17A 5FYZA 2ZGUA 1WLTA 4EN0A 2E32A 1UU6A 4C90A 5LK5A 2ZGOA 4MGTA 1PZ9A 4BXSV 5KHIA 1O3RA 3DV8A 2FMDA 1JZ7A 3N9NA 5FUIA 4FI9A 3FC0A 4K8RB 5FQ0B 3SEPA 1W6NB 1S0FA 2R072 5HCAA 4RS5C 5EPAA 5AFEA 1LGCA 2IUWA 1PGW2 2K9ZA 1OUXA 3AMQA 1R1A1 4M3CF 3GHMA 3OBAA 1OD5A 1WLWA 4N7UA 2FCTA 4OHWA 1UO9A 5FDBA 2P37A 2YZ4A 2ZAAA 4PI2A 4Q0VA 1IQAA 2WKKA 3PTRB 4ZONA 3ZFFC 3ZM8A 3LZZA 1YYNA 3FX3A 5L19A 5IJRA 2PHRA 1VAMA 4FTEA 3HQUA 1A34A 2XBO1 2O14A 1W6PB 2EIDA 3NNLA 2DYCA 1COV1 3N9PA 1ASJ2 4MGSA 5FBZA 3VUOA 1MS8A 1Q56A 3VBFA 4K7JA 2JDUA 1S0IA 1SHWB 3LA7A 3D5OA 4JHTA 4Q4W1 1C8NA 5FBJA 5JIAA 4HSLA 5BUVA 1UX6A 2JDMA 4RHV1 5C4WA 2ENRA 4H14A 5T52A 4HKLA 4XPVA 1YNAA 5A3NA 1IQDC 2UYBA 3WHUA 1SPPA 3SISA 3SLIA 1BMV1 5AC93 2YPDA 2B8MA 1KDMA 4S2HA 4PI0A 3ZDVA 1LOBA 1RUD1 4IERA 1LNSA 1UYZA 2WYFA 1HN0A 3N9QA 4IV1A 3ZSJA 1SBDA 2GZWA 4PLMA 4XUTA 3KS7A 4YVWA 5LASA 3OYWB 5H9PA 2WZR1 3OBRA 1YLLA 3I2JA 4LIVA 5DAVA 3KZ4C 1UCXA 2LROA 4OZXA 1ULOA 4WM8C 5EJ1B 2Y33A 4Y20A 4YW5A 3ACGA 1FATA 5JXGA 1HIXA 1L3JA 2DVBA 4QM8A 1GMMA 5FZMA 5A6ZA 1BVP1 3ME2A 1E5RA 1YEWA 3AX4A 4QGMA 1H6YA 1GFF2 4JQTA 4QQOA 3URFA 3WQ1A 1DFQA 3SKVA 4Y5SA 2CAUA 2KM2A 2GC3A 4GZ9A 2DWRA 4XJ9A 2GC2A 2QZ2A 4YM3A 4QT6A 5AFBA 3A22A 4NRPA 3OJBA 3TB0A 3VZJA 3OGRA 4TN7A 2VUDA 3K46A 4XJ8A 3LSEA 3MIFA 2EXJA 2ZGSA 4NIGA 1UW8A 2P34A 2XKOA 2XLFA 4I30A 1EAH3 3AC0A 4AK3A 1FX5A 3CJIC 1AX0A 1VIWB 5HV4A 3AMNA 2ZXQA 2VE1A 4ASKA 4IETA 5FPVA 3PHMA 2W1WA 2ERFA 3VL9A 1XNDA 2RR13 3AKTA 3WCRA 1GWLA 1WMDA 4AEDC 2OPKA 3O0WA 5I0TA 4ZU4A 1GBGA 1FMD1 2WIIB 3R4DB 2BOIA 2DCKA 4HT1T 4KU7A 1GQPA 3LAGA 1LHVA 1SZBA 2IXJA 3JBG1 4MLOA 3KCCA 5FY1A 4CXXA 4P9YA 1EP0A 2BYVE 5JPMB 3V0BB 3IDEA 2HWC1 5T55A 2R061 2W46A 4MUVA 4YVSB 2AH2A 4LBLA 4PIYA 1HKDA 1I5PA 4D7SA 2XVKA 4PHZA 3IDAA 3ZIXA 2YBPA 1V9U1 3V65A 1I3HA 5G04L 2QDRA 2WSVA 3GCWA 1NOVA 4I3PA 5DDJ3 1TMF2 2BNOA 2OA2A 1DQ1A 1RUI1 1DBNA 5GALA 1KXGA 2WLPA 3G7DA 3WW2A 4QAWA 4AXOA 5LA1A 1O7FA 4LO6B 3VBHB 1V6OA 3R0RA 1H1MA 4AI2A 4K9SA 5FZFA 1REDA 3ZFFA 4CCJA 2AACA 5JOXA 1JODA 1UAIA 4BOWA 2WAOA 1EY2A 3HPNA 3USSA 4Q4X1 4WVVA 5EFUA 4JKKA 1R093 3OY8B 4DQAA 1YC61 3Q8AA 1XYNA 3UYJA 4TTGA 5LRSA 4ES9A 4DS0A 5HBAA 1K45A 2ZCWA 4DIQA 1RUJ3 4CA9A 4UWDA 5FMCA 2MHFA 3WW4A 2B9VA 4ET7A 1KEXA 1MEC3 2XBO2 1E5SA 4BJ0A 1O3TA 5F5AA 3IM0A 1GLHA 1W05A 1COV2 1QMJA 2VMIA 3O0VA 4NRQA 1QXRA 5KXDA 1ENQA 2YROA 3H7YA 2Z42A 3LD8A 1QQP3 1ODMA 3QBQA 4AVCA 3AMHA 2VVFA 3HNMA 1NCRC 2CDOA 3H0OA 4RHV2 4FP3A 3RWNA 4NJ4A 2VMFA 1NYWA 4LHLA 3VBSC 1SEFA 1F5JA 5KHKA 1T2XA 3POSA 1BMV2 1PM4A 2QCSB 2X5IC 3D6EA 3KCXA 4WM8A 1H4GA 1GWMA 2W95A 4I2OA 1JU4A 2VUAA 1W6MA 4P5HA 2Q4SA 4UFKA 3JUUA 4AFCA 2PFWA 3OD4A 2JIJA 4YW1A 5LA0A 4DUXA 5L7OC 1R64A 2RS31 3VD9A 3OPZA 2J7MA 1LAJA 4FPGA 4EQVA 1A8DA 3RZJA 3DEMA 1WGPA 3T1LA 1OQ1A 1X50A 2A3YA 3NJXA 5H9SA 4Q0UA 2MNGA 4P9GA 4UW5A 1LCLA 1V6LA 3LDRA 3HIFA 2ZOEB 4FFHA 4XETA 1S1AA 3E5XA 4QPGB 4QU2A 5CB7A 3CJIA 5JIUA 3SQOA 5LA9A 4JDNA 4CU6A 2VU9A 3GDBA 2OUJA 4LO5B 4B8EA 1J59A 3PJYA 3ZVXA 3POGA 3S57A 4YGBA 4AEDA 4YFZA 2E33A 1N1VA 5JI7A 3MIHA 3AK0A 4R9AA 4XILA 3E1F1 1CX4A 2AEZA 2VZTA 1VLNA 1HN1A 5GLTA 4AGRA 1QJX1 2GNBA 3I8TA 1LENA 4AW7A 1MS1A 2CGOA 2F4LA 2AGSA 2JD4A 4XQWA 1CQ9A 4CP9B 5JMOA 1SQ4A 1AR72 1A3KA 1RMU3 2HWB1 1HB4A 1DIWA 1F8VA 5T5JA 5D8AB 3S0MA 4CEYB 1GNHA 2E26A 1SLIA 1S0DA 1C1LA 1YHFA 1HJFA 2X29A 3M1HA 5DZEA 3CHXA 3K3OA 4K21A 3C7HA 1VRH3 4FPFA 2YG0A 2HWC2 2Q8CA 2R062 3MV11 3RDIA 3LEGA 1G86A 2VZSA 4ASLA 1OH4A 3PUAA 5E88A 3SXWA 3WDWA 1L7RA 5FPUA 2XPJA 3KHCA 1VBB3 3FFZA 1MPXA 1EUTA 1OVSA 4WVMA 3POEA 4XAAA 4QWNA 1NQDA 5I93A 4B4QA 4FFFA 4LT5A 2LTNA 5F5IA 2H6CA 3J7LA 1UMIA 2RS11 4JGYB 4Q4Y3 2XWJB 5BNPC 3H8UA 5FMBA 4QPIB 1GU3A 3NO8A 5FXVA 2A3XA 3MHZA 3ZFEA 2OW4A 1RTVA 3DKQA 1S55A 1OQEA 3N7MA 1PO11 4JRAA 2GC0A 1MZEA 3IDBB 4QQ2A 4QU1A 2WZEA 3AKRA 2ZEWA 3HN3A 5EZWA 4M01A 5JXJA 2FDGA 2CWSA 2HEYF 4OMCA 3HBKA 5JOWA 4IQPA 3WF1A 3V0AA 4CZSA 3POJA 3L2HA 1BKZA 4BZ4A 1CWPA 4MGYE 2NP0A 2Z79A 5I8YA 4Z2WA 3RZHA 2EVXA 3KQRA 4QXHA 3SCHA 3ZR5A 5A6QA 1CZSA 1O5UA 3O0XA 1CESA 3POWA 2FZ2A 3MFCA 1GZCA 2IXLA 3GBFA 4KL1A 5JCTA 2VAUA 4NRMA 2DTYA 1BK1A 3KVAA 5D21A 4E27A 4P5YA 1O3QA 1WD4A 2BGPA 4KNCA 2ZGQA 3W9AA 1SLCA 2WABA 1BJQA 4OHXA 2A6VA 1DGWX 3RNSA 3ACFA 4HK8A 2D97A 2ZHMA 2GMMA 5LW9A 2RS53 2WFF1 2RS32 5FZ3A 1H0BA 4XACA 4GWJA 4FFGA 3GHNA 4XBQA 2JDHA 1PX3A 2BTVC 1O4ZA 3POBA 1BBT1 1VBE2 2XL7A 4DXTA 3DYOA 4PLNA 1NCQC 3T08A 4J25A 2ZX4A 4XDPA 3AFGA 2OQ7A 1POV0 3O14A 4XJUA 3HQRA 1JYNA 2RG4A 3IZOA 4CCEA 1B35C 4NROA 4NIAA 2D40A 1H9PA 1QJZA 3K77A 1WA4A 3VKMA 3IWZA 4NPMA 3AZXA 2XLGA 4KMQA 4LOSA 1CAWA 2CNAA 3T4VA 4QQPA 3WF0A 3ZXGA 1QJX2 1WBLA 4CUGA 3DYMA 4R9CA 2CY6A 1HQLA 2P2KA 3X29B 4AVSA 1U12A 3K2OA 1AR93 2AC1A 1AYN2 1W0NA 3I3DA 2EIBA 1YQ8A 1HDKA 3LE0A 4WZCA 1IG0A 5FKCA 3PL0A 1OA3A 5AVAA 5KBFA 4HZFA 1CJDA 3B7MA 3BALA 3W20A 1JI6A 4X6QB 4AYUA 5BYNA 5C9AA 4E8CA 3VD4A 5GLVA 5EV7A 2D6OX 1YQ6A 4D6RA 2XMLA 3KCYA 4E9KA 2FQPA 3O1PA 5LA2A 3APBA 3ACLA 4LIUA 5DAQA 2GP5A 3J7MA 5A3TA 2QQNA 2HWD3 1C8M2 1W8FA 1K3IA 5EWSA 2VNGA 4AAXA 3NNFA 1GQGA 1RUF2 4UBHA 1AXZA 1ZVFA 3PVBB 2JENA 2YXSA 2WNVB 5AC91 5LCWL 1RJ7A 4QDRA 1GZWA 1OLMA 2WO3A 2E63A 3UKVA 2QQVA 4L8QA 3IIIA 5DAXA 1H2MA 2HYKA 3B00A 2AENA 1JYIA 2JG8B 3WX5A 1V6NA 4QB1A 3A0NA 2Q0AA 1CR7A 4Q2FA 1VAKA 4QHBA 3ZSKA 5J36A 1AR62 4NO4A 3HD8B 5FPAA 2WINB 2DCJA 2GAUA 2XHKA 5A33B 4GKXA 4LUMA 4UF0A 2WS92 3POFA 3M70A 2D3SA 4XJZA 3WLUA 3OGGA 5A80A 1LECA 5J48A 1W3VA 1VPHA 3NKTA 3VV1A 2VUJA 3NV1A 4Q4V1 1NX9A 1QJU2 3I49A 1JZ4A 2VULA 1K5MC 3P6BA 1AL0G 4GXLA 3THCA 1RHI3 1D2SA 4A7ZA 3O1RA 2YGLA 5A7WB 4R9BA 4FAHA 4L99A 4TLFA 5IFTA 4GH4B 3PVEA 4A6SA 4A7YA 1UY0A 2GH2A 3USUA 2VECA 5DABA 1IHMA 3ENRA 4CUBA 1ZZ9A 3SH5A 1EAH1 3NW4A 3NV2A 2ARBA 4B4PA 5K7PA 4GB33 1JYTA 4D7YA 4H55A 4TLGA 2ZACA 1JUHA 2FCVA 5APAA 2HYXA 1W06A 2X10A 2RR11 2WWUA 3GBWA 4Y5Z0 2VNOA 2JDZA 5E8AA 3IAPA 4FOQA 1W39A 4XAEA 1W2AX 4I0WB 2VQAA 5EJZB 5C3OA 1NCQA 5IHRA 2OUHA 5I91A 1N1YA 1UY1A 1XNBA 3BCWA 1BQPA 4W8JA 4IGPA 2WFF2 5BNOA 2HKXA 3ZFGB 4CTEA 5I8TA 2EA7A 4FPEA 2Y6JA 4RFRB 4YGDA 5JSPA 5JZGC 1X36A 2IWGB 2BW8A 2Y6LA 3CMGA 4D6SA 3TYJA 3VBRB 1AR81 5C6CA 1R082 2YYOA 1B35A 3KD4A 1BBT2 1HX6A 4HFSA 4WM7B 3VZOA 5I0DA 5GLWA 5CAZA 3O1MA 4Q1RA 2FDFA 1VR3A 5KR7A 1D7PM 4KWLA 2JX9A 3LA3A 1PVC1 1S0BA 5DDJ1 5KC6A 2C24A 1ULPA 2KR2A 4K3UA 3I59B 2Y38A 1QJFA 2J1AA 2VO5A 1NT0A 3O1UA 3UKNA 4OQ8A 1ZZBA 5C8CB 4MXWA 1GP4A 3N9MA 1JS9A 2P3JA 1SLBA 3AMPA 4XUPA 3L2YA 4M0HA 3N9OA 4HN1A 1O4TA 1HRI3 3EXUA 2X53S 4FFIA 4LKSA 4XE9A 4LBQB 1ZRIA 3T1MA 2KXLA 3VDDB 2WAAA 3BU7A 3T09A 1W8WA 2TBVA 5CEHA 3VBHC 2KA3A 3VBUA 2NM1A 1QIQA 4N90A 1RUC3 2Y34A 4GQ7A 1RUJ1 1GR3A 2W08A 4Y1YA 1MEC1 2UU8A 5KHHA 3IKWA 3U78A 4G4FA 1PO23 2GN3A 2XXZA 3I2IA 1Q8PA 4YM0A 1YJLA 4K40A 1C4RA 1MZFA 4LK6A 4BWOA 4DY5A 1UXXX 2IXKA 1J84A 3KHBA 3MLJA 1W6OB 3OG2A 4HKWA 3I54A 1YFYA 4XFBA 4R9DA 1XRUA 5FYCA 4AFAA 1QQP1 5FZDA 5FMOS 4NPLA 1D2QA 2RMU3 1W6QA 1WCUA 4KWKA 5ERLA 3NNJA 4YRDA 1PGSA 4CDUB 1JOPA 3THDA 4GMP0 3U4XA 2B9UA 3BTYA 1HB3A 2DFCA 5AC92 3UV9A 2W92A 1RC6A 5LATA 1AXKA 1FOD1 1W99A 3TN92 5JDBA 1D0HA 4TYSA 4XFGA 2ZMNA 4Q29A 4YLZA 4AFMA 2WNUA 3OGVA 1RUE1 3OYWA 2G4IA 1TQ5A 1K5MA 4P9WA 1I5ZA 4YW3A 3VLBB 3WNOA 4OHVA 3C7OA 4F7ZA 5DAWA 4DRRA 1Z7S1 4CP0A 5ACA3 1UYYA 1MQTB 1Z0HA 2WT1A 2R042 2VCAA 2NMOA 4N43B 4Q4V2 1UNBA 2P3YA 3EYPA 1QGLA 3NWKA 4QX5A 3UJOA 3WHTA 5K4LA 1LESA 1YCIA 1PGL1 3RYRA 4AVVA 3AZVA 3GZAA 2VC9A 2WZPP 4IE6A 3UT0A 3WNPA 4NHXA 5I8SA 3GZTB 3HJRA 1IKQA 1F2NA 3WW3A 1QJY3 2O8OA 1W2NA 3J7NA 3AKQA 3IAQA 1WKYA 2X05A 4GALA 4X6RB 4QPGC 3WY6A 4IEUA 3ILFA 4LHSA 3MO4A 4AGVA 4A7KA 4AEKA 5HCBA 4QX0A 5FY0A 5EP9A 5F5QA 3NJYA 5JZGA 5GJ6A 4E2GA 1H1AA 1US2A 2WN2A 3LEKA 3VL8A 1RMU1 3QACA 3WNMA 5K9YA 1YJKA 4S2FA 4XCAA 5T50A 4B7EA 2ZGNA 3QH7A 4RN5A 2NN8A 1GP6A 2HWF3 3M3CA 1ZM1A 5A1FA 3RWKX 3AFKA 5CKQA 3T3YA 5JOYA 3ZMNA 3V0BA 1RUH2 3VD7A 1VRH1 1HXS1 1REEA 1XNCA 1VBC3 5LY1A 4LNVA 1RVF3 1NA1B 4RQPC 1QNWA 2VMCA 1AR82 2NZ9A 4XF3A 1CAUB 1LR5A 4HVOA 1F4HA 1VBB1 1NY71 3WF2A 1OLQA 3CLPA 2IC1A 3DL3A 5D8AC 5H9RA 4BQ3A 4CEYC 1ND3B 1PVC2 4D69A 1W8UA 3ABZA 3Q8BA 3B69A 4LK7A 4ES8A 3GBGA 3OPWA 4CCNA 1POV3 3FHQA 1CJPA 1ZRDA 5KHJA 3MICA 2XJSA 2QQIA 4Q4Y1 3WCSA 5T5PA 2ZJCA 3M8LA 1CONA 3MLLA 3K51A 2GNDA 3D8CA 2WQ8A 5F39A 1TME3 3VZNA 1JOJA 3ACIA 3SEEA 2J1VA 4DINB 2I07B 4QX2A 3CQOA 3H8OA 4LBMA 3P5BA 3NSTA 3DPRB 1LOAA 4XDOA 2WA4A 3MIEA 1V00A 2JICA 2YU2A 3I7DA 2BQPA 5EYYA 3WNKA 4B29A 3W5MA 4JGYC 3SH3A 4MH0E 2UURA 2VL4A 4QPIC 4UFJA 2BUKA 3RMXA 4CCMA 4LLFA 5A6YA 4QDQA 5JWPA 1DYPA 1BEV3 2DV9A 4MVTA 2BGOA 3D3AA 3EBRA 1Y9MA 1MEC2 5FXZA 1XSQA 2ORZA 3C7FA 5CBLA 4Y5TA 3FUQA 4XMAA 4XXPA 2XJPA 4Y22B 3WUDA 3E97A 2IXHA 1TEIA 4Q5OA 4DOUA 4INDA 4UYBA 3U14A 3WP6A 4XJWA 3O1OA 1FPN2 2P1BA 4HETA 2GDFA 4PT6A 4A45A 2BDRA 4XURA 2Y6KA 4IEOA 2RM23 3E6BA 5GLUA 2R1DA 2EALA 4DRVA 4DUVA 4JDOA 5A3WA 3JD72 5DG2A 1ENXA 3RMYA 2V4AA 4IV3A 2WL1A 1FOD2 5FYUA 2BNMA 4AI0A 4SLIA 5E16A 1JN2P 4L2NA 4CCOA 4E4DX 3SH4A 3LGRA 3IMNA 2W1SA 5FMDA 3PUHA 5JPNB 1RUE2 4BCUA 2VQTA 3BTAA 5IVFA 1QXJA 2J42A 1ST8A 2YU1A 2BNNA 1Q5OA 2JXAA 2YDEA 1LTEA 3NAPC 4YYOA 3L9JT 1Z7S2 3ETQA 3RG0A 4UW3A 2A5ZA 1HQWA 2AZ5A 3MIGA 4P00B 3P3PA 4IDZA 3ES4A 4XBNA 1SLTA 1D4M2 1W3XA 5FZ1A 1Y9GA 2GNTA 4JKMA 4QPGA 5FZ8A 5FZLA 1KRIA 4XZUG 2VTXA 4QX3A 3TOJA 3MZHA 1URXA 2JE8A 3VKFC 1VJ2A 3OSDA 2EF6A 2YHJA 4CCCA 5KWRA 2HEVF 4XQ4A 3RQ0A 3ZYPA 4D6QA 1G6NA 2K0GA 1AYM2 2DUPA 3KV6A 4IL7A 1JYVA 1QWRA 1UZYA 2PHUA 3MIDA 1UPIA 5LRRA 3LEIA 4FQ4A 1UD1A 1H8VA 3VGIA 4QQHA 1U5IA 4BMBA 4D3WA 5C71A 4WZFA 3FN9A 4AQ6A 4NHLA 3KT1A 3FLPA 5FZOB 1H30A 3BIWE 2QQOA 4XOGA 4FXGB 3LFIA 3MLKA 4CP9A 4OQ9A 1ZBA3 1AR91 1PK6C 2RJLA 2VCMA 4QMAA 1Q3EA 5I0UA 1AL23 3B5LB 4RQPA 1UIJA 1WW5A 3WG1A 4CCKA 4EWEA 1AR61 1S2BA 2WNEA 1HRV2 5F5CA 5IVVA 5D8AA 1OBNA 3MFAA 5CKMA 3ES1A 2VMEA 1IGOA 4NE9A 4CU9A 1WWYA 3THPA 4COYA 3BI3A 5JMCA 1HXS2 2A7AA 3VBOB 5DMYA 2FDIA 2JG9B 3ORJA 1YRZA 4KBZA 2HWD1 2V72A 2VBDA 4YZ4A 5A7QA 5C3PA 2QE3A 5FZIA 2WNOA 5E1RA 4HMZA 4YSFA 1HB1A 2LUWA 3NKGA 1FAYA 4CYDA 2VQ0A 4CEWB 2B39A 4AL9A 4D8MA 4FAGA 2F6BA 1ND2B 4ATFA 2HWE3 2R16A 3UESA 2VOWA 4UT5A 5EXOA 2EXIA 1F35A 5M0TA 1IS6A 1RUG3 2PLV3 4QPIA 1W0OA 5KXEA 5A7NA 3PNAA 1WW7A 1N3QA 1EV13 3PU3A 4GKYA 4JC1A 1JU3A 3MPPG 4JQRA 5CFCB 4I3GA 2WNVC 3SKJE 1RXGA 1UU4A 1VBA3 3O1SA 5FOBB 4XQDA 4FCAA 2FHRA 3MBWA 4FQZA 3RFRA 2VZ3A 3O7OA 4RS5A 2C4XA 3ZPYA 3WT3A 5F3EA 4NIIA 1SFPA 1ZBE3 3W21A 3PMEA 1GOHA 2WO7A 1WLDA 3KGLA 1OLRA 4BISA 4LLOA 2HBTA 1CGPA 1H2LA 3MI8A 4F3JA 1RHI1 2VCBA 2E51A 2R49A 2VY0A 4UOJA 1CZTA 2YMZA 4XFAA 3EB7A 3H3LA 1KFXL 3MW3A 1UN1A 5CISA 4IEPA 2GMEA 1R1A2 1XYPA 2YBSA 4XDQA 1PHMA 5IK4A 5LEKA 3T0BA 1DCSA 5JI9A 1PMIA 1ZZ6A 3QH6A 4GB31 2WDBA 4Y1VA 5DZGA 2X09A 1UYXA 5IATA 1UY3A 3O5SA 3MDPA 4V2VA 2AR6A 4N8MA 1G9DA 1VBD3 3NAPA 4GH4C 1N1TA 4OUMA 2V5YA 3SCGA 4CDXC 4RGKA 1UY2A 5CU1A 2IXIA 2D7FA 1OOPB 2OPWA 2BU9A 3RPQA 4YFWA 2JKXA 4D0QA 4CSWA 5E89A 4QGLA 3IPVA 5F2WA 2ZGTA 4ZPIA 4Y4YA 1ZREA 2GSYA 4Q4W2 1K5JA 1JZ8A 1POQA 1HW5A 2Q8DA 4M3CA 5T3NA 3IBMA 1X82A 1ZYBA 4MGIE 4XFFA 4NIHA 1ULDA 5FUNA 1HQNA 2YPJA 3AZZA 3CEWA 2WLQA 3HT1A 4KQ7A 4XJAA 4ZXKA 1G9CA 4W6XA 3GZEA 1X9PA 4O61A 1BZWA 5H9QA 5L36A 3ZYRA 1AF9A 2BFUL 3OUJA 1RUD2 4W4ZA 3GM8A 1TNFA 4AI9A 3ZFGC 1H2KA 1O59A 2R073 4U36A 3MF6A 4AOCA 1KS5A 3N3HA 3ZN6A 3MGUA 3BU0A 3VBRC 2Z5WA 2DF7A 2D5FA 4H2AA 2WZR2 1J83A 1YO8A 1GV9A 2ZGPA 1PK6A 3FWEA 4I02A 1WMFA 3VHRA 4AEJA 2QDNA 2BBAA 3AYDA 2PHXA 2QBXA 3U4SA 4AI1A 1W28A 4IW3A 4IEZA 3M3QA 4FT8A 4LJHA 5C8WA 1Y43B 4BMEA 5LK7B 1C28A 4LUKA 2LW8A 4LBNA 1AX2A 4BQ2A 4XIOA 5C8CC 2QQMA 1UY4A 2BP6A 4GD4A 4XIKA 4XXAA 5FPLA 4AHYA 4B4RA 2RJ2A 1RUC1 1ASJ3 1H6XA 3O1VA 3N7KA 1BLZA 3OUIA 1GUIA 4AI3A 3MIBA 3A23A 3KWVA 1UZZA 2ZMLA 3H3UA 3LIGA 2VZ1A 4Q0PA 1DQ5A 1WCKA 3FBYA 5A3UA 4FTSA 1PO21 1SG3A 2W52A 4BYYA 4AHZA 2JD9A 3UGFA 2EAKA 2NYYA 3WW1A 3BN6A 1WD3A 2PXJA 1OHFA 1ZZ7A 3MW4A 1NUKA 4XFCA 2XOMA 3ZYIB 2RMU1 4F8AA 3ETPA 2VNRA 5JSOA 2VXRA 1JBCA 2D44A 1ALYA 1STMA 4FVVA 4NWWA 1ZRFA 3E5UA 5A32A 1DZTA 1TE1B 3SMHA 2WNVA 1WZXA 2CTVA 1FMD2 2WN3A 3HMYA 5BNQA 1RUOA 1N3PA 4YVWB 5JLVA 3ZXJA 1XB9A 4P9LA 5FXXA 1QEXA 2YV8A 2G9FA 3JBG2 1WMEA 3E6CC 1AXYA 5FUPA 4M0NA 4ASMB 5A1LA 4Y20B 4Z07A 3D82A 2OX0A 4LKFA 3WP3A 2JB8A 4CDUC 1R1ZA 3Q8EA 3HBZA 1G8WA 1ONAA 4YW4A 4DEQA 1GYKA 3ZSMA 5ACA1 4WBBA 2QQPA 1V9U2 2PQQA 2UY9A 3AL6A 4H7LA 5K0UB 5J96B 2BBVA 1REFA 2XQRA 1OT5A 1RUI2 4QKNA 1VALA 4AQ2A 1OKOA 2BOJA 4FPCA 2I2SA 4W6YA 5GZCA 3EO6A 4XZPA 1CAXB 3E5QA 4MSVA 3WG2A 2JB4A 3KT7A 1U5YA 4PJYA 5GM0A 3OPTA 4CDXA 1O8PA 1QJY1 4HVQA 1G7YA 4Q8LA 4UW4A 4N43C 5F37A 4LXLA 2FBEA 2WC2A 2E53A 4OCTA 1GOFA 5FIXA 1OC1A 2GC1A 4WVZA 1C3HA 4Q4X2 3T2PA 3IB3A 1UIKA 3FE5A 4GB32 2XWBB 4E4HA 2R32A 2B45X 4LBJA 1NCRA 5J3UA 2DVAA 3WNXA 1F9KA 3QD6A 4XVHA 1RJ8A 5IFPA 5FKBA 2V73A 3BTZA 3VBSA 2MEV1 2ES3A 2QVSB 5A7OA 5F3IA 4F83A 4NMIA 2X5IA 3D0SA 5GZFA 1XQNA 1J58A 2D93A 1WCDJ 2JKBA 3VHNA 1W8NA 3MUZ1 3PDQA 1UOJA 3ZFGA 2A73B 4PF1A 2ZMKA 1T6BX 1PZ8A 1VBC1 1TMF3 1QOSA 1RVF1 3VBRA 5L7OA 3T0DA 1AX1A 1MS4A 3DGTA 2O0OA 2QQKA 4RGGA 3WQ0A 3ZO0B 1LHWA 4LA2A 2G9ZA 3S6PA 3ZFFB 1W04A 2AUYA 2RDQA 1CAVA 4LMFA 2XJQA 3NV4A 1NA1C 1TNRA 5FP7A 1NKGA 1PIV1 2OYZA 3ST7A 4CU8A 2VBBA 5FP9A 1TME1 4E2QA 2HLEA 3J7HA 1US3A 1ND3C 4PDWC 1DYKA 4DMIA 1XE0A 2LM3A 3BPZA 2ZHNA 1OA4A 3CO2A 3AYEA 5T54A 5FPBA 5FWJA 4BH9A 5HV0A 2D6NA 4HANA 3OEAA 4S2DA 1JZ2A 5FFOC 2XBO3 1A78A 1JOBA 1COV3 4RGAA 4DUWA 1V6IA 3PURA 4I09A 3GGLA 2JDPA 5BY5A 4BPZA 3AP6A 2OVUA 3WR0A 1DGLA 1GZ9A 2P4EA 3DPRC 4RHV3 4BQYA 2YC2A 4A6OA 1W8HA 3O1TA 3VHPA 4YG0A 3AP7A 4MGZE 5HPOA 4HONA 4O7XA 4NOTA 3MF9A 1OD3A 1RL3A 3HNBM 4OUEA 1JMUB 2Q1MA 4GWIA 4JDMA 3WQ7A 1H8TB 2BVVA 3ZXEA 3ACHA 3LKJA 2ZGRA 4N7IA 4HL0A 2R1BA 3C7EA 4LBOA 2HWB2 3I2GA 4BB3A 4AVBA 4XHXA 4FBFA 1XPWA 2XJRA 5J09A 4BK5A 2O1QA 5IVCA 4URTA 2PHFA 2A71A 1UZVA 2V09A 5FR3A 3SNMA 3AJYA 1V70A 3UGGA 1X33A 1X8EA 3B9IA 3ZYBA 3AP9A 1OXCA 3LFMA 4DY3A 4QXCA 2XUMA 4XEZA 5BNPA 3BPSA 4FPHA 5BPXA 4NIDA 5ACA2 3J9SA 4N53B 4AWDA 2ZHLA 3VB9A 1JH5A 5DZFA 3ZIWA 3UKTA 4BDVB 3ZPOA 4PLOA 3OF1A 3ZXAC 4AZZA 4ZZ8A 3E6DA 5L9BA 4OZOA 4AEDB 4CXYA 1GNYA 1PNGA 2RS12 4NVPA 1V0AA 1OPMA 1DP0A 4EE2A 1OA2A 3WP4A 1WCQA 1GZTA 4TXWA 5FPZA 2J1EA 2PYTA 4EWDA 2VUCA 4QQLA 5FYIA 1E5HA 2VZQA 5KC5A 1QDOA 3VHOA 3OBZA 1PO12 5BXXA 1J3QA 5E6HA 2XVLA 1BYHA 2WSUA 4EZ4A 3WNNA 4D7TA 1V6JA 3FFQA 1AR73 3BYWA 1AUYA 5T5LA 2VW1A 5CKNA 3GCXA 1UU5A 5F32A 2VOXA 2ADEA 3ZXDA 2A6WA 3FMGA 5CZKA 2Y60A 1ZZCA 2D5HA 1YXWA 4HLTA 1AL21 3FHAA 1O3SA 2D3RA 2W94A 3G6JB 2R063 2MEV2 4GWNA 1DHKB 2ZGMA 4QXBA 2H0BA 2JDNA 3TBDA 2VMGA 2QQJA 3DXTA 5FCCA 5J7MA 3CL1A 1NLRA 3KF3A 1D0GA 4AQTA 2VBPA 4MO3M 4AQSA 4LO7A 2Y8KA 3NMBA 5DUWA 1G9FA 4QHZA 4Q0SA 2FD8A 4IE5A 4WVMB 3LA2A 3U10A 5A70A 1NA1A 3T30A 1EPZA 1IZ3A 1CAUA 1LGNA 1Z78A 4BIFA 5HCFA 4CDQB 2Q30A 1N47A 2PAEA 2I45A 1JHJA 5A3OA 1H1IA 4QB2A 4AR2A 3H7JA 1DLLA 4PDWA 4COUA 3FBMA 2X8KA 4AVAA 1LULA 5GKAC 5FZGA 2HWE1 2LALA 3PU8A 4J1WA 4JZRA 4FPYA 1JXNA 5JAXA 5B4NA 1FNYA 2DCYA 4KGQA 3VBOC 2JG9C 2CL2A 2DCTA 3ZFEB 2RHPA 5IYYA 1OF3A 4QX8A 4Z82A 4XF1A 3VKOA 4NR1A 4AG4A 4Z1VA 5C70A 1PIV2 1RUG1 2GNMA 2PLV1 2H6BA 5SV8A 2FDKA 1G9BA 1EV11 4OI2A 2V5DA 4LO8A 1ND2C 3B01A 1VBA1 5B4XA 4Q8KA 3V0AB 3DPRA 4A44A 4QPYA 1WBFA 2WBKA 3M7AA 4LORA 1SMVA 4Z2AA 5CG8A 1UWWA 5FYYA 1DQ0A 5GZGA 3CDZB 1S4CA 2Z4FA 3AXDA 2WQZC 5F3GA 2YBKA 1VE0A 2J1TA 4YVSC 1OURA 3A4UA 1LOFC 4PIZA 5L73A 4AI8A 1YFUA 3IIAA 1YWKA 2VW0A 5FQ0A 2QNKA 1SFYA 5FP8A 4OHYA 2PAKA 4C1XA 1W6NA 2Z69A 3S30A 4BQ5A 1IS4A 2Y6HA 4AHXA 2KD7A 1DQ2A 1N1SA 2JDAA 2K46A 1XNTA 5ISLA 1R091 3BKZA 4P14A 3N7JA 1LHNA 4XBLA 4ZS2A 2PN5A 1QXPA 1BXHA 3WG3A 2C5DA 2RJKA 4BLIA 3CKHA 4BA6A 1DDLA 2L9LA 2RS33 1VAVA 1W6PA 5FZHA 2VTXJ 2ARCA 3DYPA 3M3IA 4ZZ5A 3VZMA 2OZJA 5IT6A 1XBFA 4KI5M 3WP5A 3LF7A 1VBE3 2VOKA 1J3RA 5ANQA 5FYVA 5I0RA 3BODA 4LBQD 1Y7BA 3GJBA 3OBTA 5IWFA 3A0KA 1DLCA 3M3OA 2YFUA 4DNYA 1F15A 4Y4RA 5FYMA 4BK4A 4L0PA 3I3BA 1DG6A 1DU3D 1OOPC 4K20A 4MYEA 1LOGA 3I3EA 3ON7A 5C5TA 3I2OA 3NV3A 3RJRA 1QY4A 2XL9A 1MS3A 4QKBA 3ZN5A 2GU9A 2VG9A 5HCHA 3WINE 2Y6GA 3LCPA 1F5FA 4XW3A 1AJOA 4B1LA 2PHDA 3I2HA 4QGNA 4CDWB 1JYCA 2R071 1KQRA 4XTPA 4EZHA 4EYUA 5ABJB 4Y1UA 2B42B 5C33A 1QJX3 1ENRA 1V6KA 1APNA 1WA6X 2LS6A 2DBNA 4KG8A 4ISRA 1UKRA 4IGOA 3ZSLA 1W03A 4JAAA 1IOAA 1AYN3 2ZPXA 2RDNA 3C2UA 1CIYA 5LEJA 2BRTA 2YUEA 3OGJA 2ZX0A 2E7TA 2V4VA 3F2ZA 4LBKA 5CVRA 5IVBA 5C9AB 3P3NA 3EQEA 1IG3A 2D6PA 2C9AA 4XUOA 3SHRA 2W0XA 4M4PA 4ONUA 3MEPA 2Q8EA 1ASJ1 2JE7A 5CFDB 4K1ZA 3KT4A 5A1AA 1C8M3 4AE2A 4YW2A 2FZ1A 2WWSA 2JE9A 4JV4A 4A2UA 1F4AA 1RUF3 5FYSA 1EAH2 1ZRCA 3CZUA 3VBOA 5FLIA 2JG9A 2YGMA 2CAVA 5DXDA 1OLME 3R6SA 1VMHA 1J3PA 3ATGA 5BNNB 2W91A 3UL2A 4ZKTB 1L7QA 2RR12 1NG0A 3TNPB 2HJIA 1SBEA 1H9WA 1XU2A 4GJYA 1XU1A 4IEVA 3T0AA 1XC6A 2Y26A 5FO8B 3AZWA 2ZZJA 2VD7A 2I74A 1E57A 5FK8A 2AREA 4DXZA 2TUNA 3HN1A 3VKNA 3T2TA 1AJKA 2C26A 1H2NA 2WS93 1KJLA 1RUG2 2PLV2 3FUOA 4MADA 4YVSA 1CIWA 5LY2A 4XF9A 4XCBA 1QJU3 4BLJA 3IDCB 3JXSA 2F4PA 1FXZA 1FI2A 5IW0A 5B2GB 1VBA2 2YC4A 1SDDB 4YVWC 5F6LB 1VP6A 2O8QA 4L92A 5DUUA 3AZYA 1E5IA 2SLIA 5DDJ2 3NVCA 2HBUA 2OIIA 1JZ5A 1ENSA 5A3MA 2VZOA 3RZKA 1W9SA 4JKLA 4NN0A 5TSWA 1UOFA 2W47A 2R6QA 3VBHA 3TEYA 4XUQA 1XE8A 2EXKA 3HWJA 2XG3A 1TG7A 1J1LA 4LITA 5IVJA 5K0UC 2ETEA 3BVCA 3HOBA 3OOXA 3WZ1A 2UWBA 1IPJA 3CNAA 5LZ6A 3AJZA 4GJZA 1DGRN 1GOGA 1MZ5A 2W5FA 4UW6A 1S2KA 2GP3A 2DVFA 1R092 2J1RA 3HVDA 1W2UA 3OY8A 4HPKB 4XTMA 3RGBA 4C0BA 2RDSA 2DBIA 1GICA 2P3KA 4I0AA 5IK8A 1NCQB 3ILNA 5IUQA 1RUJ2 4UBGA 4CUAA 3FHIB 2WFF3 3ZYFA 5BNOB 2A1XA 1OOPA 4S2GA 2DFBA 2P6CA 4H7MA 1FV3A 1XXNA 3LWCA 4BQ4A 3CU7A 4W65A 1R083 2GALA 2VMHA 2XB6C 1BBT3 3I3MA 1NAEA 1B35B 4ZY9A 1XJAA 1Q8QA 1QQP2 4ZHNA 4BQWA 3RRDA 5FO9B 1TMF1 4OI1A 2W9XA 1QOTA 4JGZB 3B9CA 2VCCA 4IE0A 1O8SA 2BZDA 1SFNA 2VQUA 4K8FA 4HOOA 1UL9A 4MXWB 2EAAA 3S5AA 4EWAA 4BIOA 5FYTA 3U75A 4P9IA 3H8XA 5FV3A 3NL1A 1UKGA 2FCUA 2BERA 2WZ8A 4AGGA 4LOTA 2VGDA 2XQXA 2RS51 1LOEA 4JRLA 1DQ6A 3ROUA 1GSLA 1MS5A 3J8F3 4UFHA 5KXCA 1UX7A 3HAGA 1YFWA 4NAOA 5D2AA 1OF4A 1FNZA 2DURA 2G1MA 5EQUA 1ZZ8A 3VBUB 4C0HA 3LQCA 1YI7A 4EN6B 3TNQA 3AKSA 5LBFA 2ZA9A 4FOVA 4RL7A 3S5QA 3H42B 3ZN4A 4LQRA 4NUBA 1F31A 1PGL2 3KSCA 1RGSA 1IPKA 3KM5A 5SV5A 1BHGA 2DU0A 3HQXA 3Q8CA 4B1MA 5HXMA 4Z92B 4GWMA 4ITCA 3T2OA 3VZKA 5LWBA 4J1XA 2W1QA 2E9QA 3NNMA 4OYUA 3U37A 1W6QB 3U11A 4E2SA 1NLQA 4COWA 5IAXA 2ARXA 3D0JA 1PX4A 1S0EA 1Y9QA 2WT0A 2JDYA 1TVGA 3H9AA 3OEBA 4HK9A 3WSOA 4OI0A 3R05A 3KVBA 2XUEA 1LB2A 2QQUA 2ZS6B 3TN93 1ZX5A 1LU1A 2WRAA 2XGXA 4BXFA 1I1EA 3BGAA 5JVVA 4D94A 1RMU2 2WNUB 3ZLIA 4QDSA 1I9RA 1QH7A 4FOYA 2ZEZA 1LKNA 3JB4C 1V6MA 1K5MB 1FV2A 4Q0QA 1QH6A 4L97A 4NHKA 5FTTC 3V64A 4CEYA 3WF4A 4NHMA 5JSRA 3LB9A 3PMSA 1M06G 2EICA 1H8TC 3IN9A 4FO9A 3W5NA 1VRH2 2R043 4FP2A 4NAMA 5J1XA 5KHGA 2SBAA 5A6XA 4Q4V3 4FPOB 3PVNA 3H1YA 4DPNA 4QKFA 4O9EA 1VBB2 1NY72 4I01A 5K0UA 3GALA 4R4XA 5K8SA 1LEMA 2BEOA 2J22A 3RI9A 4PBOA 1W9FA 2VM9A 4NWVA 5ANNA 3RZMA 4JGYA 2ATFA 4Q4Y2 3T2QA 3VD3A 3UNPA 4GULA 1CAXA 2IVIB 4ORFA 3UGHA 2LRPA 4N53C 3DUIA 4OVEA 4JVAA 2IFRA 1WUVA 4ZU5A 2DVGA 5FZCA 4RR3B 4YZ3A 4Y3OA 5A7SA 3WXPA 4XHBA 4CE8A 1Y4WA 1PMJX 2ZKNA 5JZGB 5FLHA 2VPVA 2GN7A 4E4SA 1UYPA 1AR71 4RFT0 3B93A 3JU9A 5FZ6A 3WUCA 2JG8C 1CPMA 1HLCA 2C0ZA 4LULA 5FY7A 3U07A 2VVEA 2ZX2A 3A21A 3GJAA 3PUSA 5GLZA 1Q43A 1RUH3 1EUUA 2ILMA 4IE7A 1MVEA 5I0SA 1C1FA 4C91A 3NJVA 1W8OA 2J1UA 1A6CA 1YIFA 3TAYA 1JW6A 1AR83 1UF2C 3PJQA 4FPKA 5LBBA 3THTA 3PLQA 2IXCA 2P5BA 1XE7A 3AKPA 2XONA 4Q1PA 1KJRA 4DO0A 1PVC3 4LE3A 2Z2SB 3ZR6A 4CP1A 3BUCA 3ZKYA 1K42A 4MZUA 2DUQA 4GMP3 4IE4A 4V2WA 3CZJA 5FREA 5GZEA 1RB8G 5G05L 4A41A 2D43A 4EN7B 5IK7A 4ZU7A 5EYXA 1IS3A 4COZA 2W2IA 1P8JA 1EYBA 4ISQA 2RS52 1S0GA 3N36A 4CDQC 4DXRA 3EHKA 1G9AA 1CX1A 1RIRA 2D98A 3ZOIA 3P1IA 3KV4A 2C1FA 4A3XA 3I2KA 4KBBA 4IGQA 5FO7B 3H1WA 4UI9L 2A6XA 5FJKA 4W6WA 2EIGA 5GZDA 3BTXA 4JHZA 3ZFEC 4KH9A 1UXZA 3IMMA 4CPBD 1XNAA 3ZXLA 2PHWA 3ELNA 3ECQA 2WFPA 1X9TA 2HEWF 1LRHA 4WM7C 1CD3G 1T6GC 3ZSEA 1CN1A 2ZHKA 1FPN3 3PIGA 3ZYHA 4QB6A 1HRI1 1KGYA 4HKOA 3JZVA 3U0ZA 2B5HA 3N9LA 3JD73 3WOGA 2QQLA 2FMYA 1H8TA 4IV3B 1FOD3 4XABA 1JZ6A 1DZRA 2FDJA 4ZXEA 1AR92 1ACCA 2CHHA 2ORXA 1QKQA 3OB8A 3FJSA 1RUE3 4QKDA 3VBFB 3VDDC 2BWCA 2WA3A 2QFEA 3RI8A 3LIHA 5C4WB 5FZAA 3ZXFA 1Z7S3 1JZ3A 3KLSA 1HV1A 1QJEA 2Q1ZB 4L11A 4YWAA 1VBE1 3OGSA 1SPPB 2RE9A 3I2DA 4GAZA 4OI4A 4IEXA 1D4M3 2HWD2 4DFSA 5C3QA 2BPA2 1U5XA 2VMDA 1QHDA 2A3WA 1OH3A 3B94A 4TSVA 1DYOA 4N53A 4TZDA 4WVWA 4PQ9A 2CV6A 1SBFA 1C57A 1SDWA 2W3JA 4IV1B 2BJSA 2W39A 3RSJA 1MVQA 4DXSA 2ZTNA 3K4DA 3BOPA 1AYM3 4WV8A 2VOVA 5JUVA 1I6XA 1RINA 5FMOL 3JB8A 2JG8A 3HT2A 1PVXA 1LGBA 2QKDA 2Y6FA 1SACA 3M4FA 4XMIA 3HR9A 1O5LA 1GKBA 5CNAA 5A33A 5L9VA 3GNEA 2YFZA 3WDTA 4CDWC 4LHNA 1AYN1 1ULGA 2CWMA 4MHUA 4RQPB 2W1UA 1HRV3 4UAPA 1K12A 4LPLA 3WQBA 4BU2A 5ABJC 3VDCA 1HB2A 4IEYA 4URAA 3BB6A 3CF6E 5F2SA 3LDBA 3TEZA 1OQDA 1RHI2 4Y1ZA 2VZVA 5A7WA 1MQTC 1HXS3 1JTZX 2IFWA 4GH4A 4E4ZA 5FLJA 3PTYA 3WNLA 1C8M1 2D3PA 1YIPA 4P08A 3HNYM 5CG9A 1BK0A 4LA3A 4P02B 3WD5A 1XNKA 3SITA 1RUF1 5C9AC 2WQ4A 1XSRA 4OHZA 4KWUA 5CFDC 3FLRA 3ILRA 4YW6A 2XJVA 4HSJA 4MHRA 2BVBA 2A75A 4KU8A 4CDQA 4Q27A 2NPIA 2XKPA 2A70A 2QZ3A 4N9HA 3HEIA 2BWAA 1QOOA 5FRAA 3WDXA 3N35A 4BM8A 1AVBA 1Q8VA 2WO2A 3D4KA 4M00A 5JR2A 4BQXA 2ZGLA 4IXLA 3C7GA 3MW2A 3W59A 2VVDA 1QU0A 2HWF1 3M3EA 5C3SA 4P9JA 2JWPA 1RUNA 3WDYA 1OPOA 2WS91 2ET1A 5BNNC 1UMHA 2WT2A 4H3WA 4RS5B 1KS4A 4P9XA 1L7LA 1PMHX 4A4AA 1OUSA 2PA7A 3Q8FA 4WM7A 1QJU1 4YGEA 4A3ZA 5FPXA 1HJGA 4FSJA 1DGRA 1YFXA 4PCRA 2E31A 4AFBA 4IEWA 5JXHA 2VW2A 3I59A 4V1PA 4YG6A 1VMFA 5FZ7A 1RXFA 2PQSA 1POV1 1ODNA 1DQ4A 2TNFA 5C8CA 5F8PA 3PUIA 1R1A3 4ARYA 1S0CA 3JQWA 1ZA7A 4XYXA 1NE6A 1HRI2 4G9SB 4RYDA 1CVNA 3FLTA 4LBQA 3VDDA 3DF0A 1CZVA 3KGZA 4CXWA 3BIEA 2CDPA 3NAPB 1IS5A 4CU7A 4COVA 3K75B 2J1SA 2ZBJA 3VZLA 3H8RA 2DTWA 5FWEA 3OUHA 1RUC2 3UJQA 1BEV1 3IPVB 4JCKA 4Q4W3 4M3CE 4BQ1A 4META 3C3VA 2VXJA 1JHNA 5FAXA 1MS9A 3ZXKA 4M3CB 1PO22 3JQXA 3NNGA 5CADA 1UMZA 1TZOA 1C5HA 2JIGA 2P6HA 3DKWA 4PIXA 1R081 1W6OA 1AHSA 1GANA 1X7NA 2DCZA 3RYPA 5IK5A 2PHTA 3POYA 1XOYA 1UQXA 3DN7A 3LEMA 2RMU2 1KITA 2R0HA 2P3IA 4WM8B 1QF3A 4YW7A 5FYBA 2Q1FA 5FY5A 4AHWA 1RUD3 1ZRRA 1LU2A 1ULFA 1W6MB 2RM21 3KQ4B 3R4UA 4R8HA 1SCSA 4L9BA 4CDUA 4CUCA 3SCFA 5BNOC 4DZGA 4G3YC 4FXKB 4OMDA 2C6SA 3W58A 2VOTA 3ZN6B 4A42A 3J4UH 2FDHA 2AEYA 2WZR3 1LOCA 4J6GA 4CDWA 4EN8B 1O4YA 1LODA 1PK6B 1QDCA 1U0AA 2CGNA 2YC0A 3K4AA 4KG0A 3FL7A 5FOJB 3TEWA 1DF0A 3VDAA 1MZ6A 5ABJA 4GIQA 4HXCA 4JX0A 4PF5A 4JGZC 5FY9A 1Q8SA 1W2OA 1UZWA 3K48A 5CA6A 4UXAA 3J8F1 4LHKA 2PELA 1YQCA 2UWAA 4OUSA 2ARAA 2BV4A 1N3OA 4XC9A 2B4KA 2ZKLA 1MQTA 3CJIB 3J26N 3ITQA 3LDKA 1YQ5A 3B02A 3KB5A 4RSUA 5FXWA 1NE4A 4N43A 2ZX1A 3AYCA 1AR63 2K2SA 2G9GA 2H0VA 3EJKA 4LE4A 5F7UA 1DZQA 5A3PA 4AF9A 3PVOA 5CFDA 1SLAA 1ULEA 1S0JA 3DXUA 4R4ZA 5AVPA 3T4HB 1GWKA 3VBUC 2B46X 4BE3A 4LKEA 1D4VB 3NQHA 1QJY2 3ZX7A 2E7AA 1M4WA 5JR7B 2Q5TA 5LBCA 2IVJA 2CGPA 3TRSB 1BCXA 3RZZA 3WEZA 2ZZQA 2ZABA 5A32B 4MX3A 4ATEA 4C8DA 1FMD3 4CCLA 5LBEA 4YNIA 3OCPA 2HH9A 1PM7A 3K4ZA 2Y0IA 5BNNA 3TN91 2A6YA 3JBG3 1ZBA1 2C9KA 1OI6A 2D6KA 4Y26A 3K3NA 3S7EA 4E8DA 5F3CA 4C1WA 5JXIA 2HWC3 1OFSA 1PZ7A 4EROA 5CYYA 2RV9A 1QNYA 5FYHA 3O12A 4YPJA 4PBPA 2HWF2 5KXBA 1UOBA 1ZNPA 2ZEYA 3ALQA 1KFUL 5FZBA 1V9U3 5FY4A 2VR4A 4BHPA 3C8XA 1DGWA 2R041 1ULCA 3ZMOA 1VBC2 3RZGA 1OSGA 1RVF2 1RUI3 4SBVA 1W0PA 2XDVA 5DAPA 2WNUC 3BOWA 4YZ5A 3INAA 1W90A 2WJSA 3CIHA 3R4SA 2GMPA 4Z8BA 4EN9B 2P17A 1OVPA 2XLAA 1ND3A 2W68A 4XFIA 5EIYB 1NLSA 3WF3A 3AP5A 3AM2A 4CDXB 4CVUA 2PTMA 1LEDA 3DECA 5FP4A 4FPJA 4Q4X3 3V56A 3DCQA 3OD0A 4MOAA 1C5IA 1TME2 2XH6A 1W9YA 2OQ6A 3H1MA 3QOPA 2UY8A 4CEWC 3ZKUA 5HI0A 4MXVA 3S7IA 1Y3TA 3KV9A 1GP5A 1NCRB 3WVJA 3I97A 3EMRA 4FOWA 4HPKA 4IUGA 4Q26A 4UFMA 5DUXA 1U5ZA 1ZBE1 3SC7X 4RD7A 3VBSB 4Y24A 1EPWA 1LJ7A 3PIJA 4KWJA 1NZCA 1SLLA 3U1XA 3WV6A 3ZYJB 1W9TA 5CFCC 1AZDA 2X5IB 1BEV2 1WW6A 3H50A 4JTOA 3LPGA 4RR3C 4U2AA 2BFUS 1RUH1 2QTWB 4QD2A 4QX7A 3MPBA 2YB7A 2JDKA 4Y22A 2XJTA 2XJUA 5J98B 3QLQA 5FZEA 5L7OB 1A8MA 4X8PA 2ID4A 3WDVA 4B7KA 2N7GA 1GNZA 5FP3A 1FT9A 4JGZA 1O91A 2RM22 5A7PA 3RVHA 3N7LA 4X8NA 1VBD1 1CAVB 5FJHA 2ZGKA 3H3ZA 3MUY1 4GMP1 2VTFA 4QHOA 4XF0A 2R7EB 2WUHA 3RS6A 1J1TA 4CRQA 2NLRA 1IPSA 1XYOA 5F6KA 2JEMA 1JYWA 1UZ0A 3J8F2 4HBNA 4MGKE 4XUNA 2AYHA 1X8MA 5FZKA 2EXHA 2ZX3A 5D1IA 5F9TA 2RVAA 3F95A 1MS0A 2DDUA 2D6LX 3KF5A 2WWJA 3FZ3A 2E7QA 3TEXA 4LO4B 3RJ2X 3AB0A 1IKPA 1NQJA 1UPSA 3A7QA 4YM1A 3N4MA 1LHOA 2CU5A 4MG2A 1BVVA 1NXMA 5FZ4A 1JYXA 1YI9A 2MPFA 3GXUA 3QCWA 2ADDA 4YG3A 3AL5A 1NZIA 1PGW1 4XFHA 1YUDA 1Q8OA 2OT7A 1KD7A 1CAWB 4QX1A 2VH9A 1CPNA 2PMWB 1RYYA 1FPN1 3VD5A 4LTAA 2VZRA 4RA0A 3WG4A 3WDUA 2WO1A 1W8ZA 3LOIA 3I2FA 2XR4A 1FYUA 2PHLA 2G19A 4YZ1A 1HV0A 2HWB3 2VJXA 3JD71 5FZOA 5HXVA 4B3NA 3UK9A 2UWCA 3LPFA 1H4HA 4Y1XA 1W8TA 3MV01 4IEQA 3AP4A 3I3QA 2CSGA 3KMHA 2YY1A 2OZ6A 1ZBA2 2DU1A 5DUVA 3LSDA 4O65A 5C3RA 1AL22 3RZLA 2EIEA 2E6VA 1W9WA 2DUOA 4AFDA 2VZUA 2JECA 3M2MA 3PUQA 4YGCA 2R30A 4KGGA 5FY8A 4QPWA 5BNPB 5C7GA 2PAMA 2Q8OA 2OKXA 4IV3C 4R52A 4LEJA 5IAVA 5DN2A 5FZ9A 4PQQA 2XVGA 5LB6A 1D4M1 2QUOA 3GYDA 4GA9A 5FZ0A 1WW4A 2VNVA 3AYAA 5DG1A 1GZWB 3VBFC 4OFGA 2RDRA 2QJVA 1VB2A 2RS13 3KV5A 4HVRA 4CEWA 2DVDA 1W2TA 5C4WC 2W87A 5EHDA 1ND2A 5BV6A 1S2EA 2WR9A 4MGQA 2HWE2 3ZYGA 4DB5A 3VKLA 2QQWA 4K1YA 1AYM1 3ASIA 3UETA 5IVEA 1PO13 4FTBA 4UF0B 3ZDSA 4YARA 1JUIA 3NRUA 1PNFA 2A6ZA 4UFLA 1LOFA 5CFCA 1MR5A 3LOBA 2NMNA 5FK7A 1EV12 3B3QE 4IV1C 5EJ3A 2UYAA 2GH8A 3OTFA 1ZA4A 4RR3A 4QM9A 1VMJA 3CBNA 2OS2A 3CJXA 2D6MA 2B7YA 4QXKA 1VB4A 5A3LA 5DQ0A 4UFIA 4TWTA 3RYKA 1ZBE2 1HRV1 2MEV3 4YM2A 2BGCA 4FPLA 4K6BA 1YQ2A 3Q9OA 4OLLA 4ZS3A 2R0FA 1OKQA 5L9RA 5T5OA 4YZ2A 4OULA 3USUB 1OFNA 5DPNA 5IVYA 3AMMA 2XHNA 2CYFA 3AVSA 5JOZA 2OXBA 1KDKA 1GQHA 5C5UA 3POIA 4M4RA 2NQYA 3MYXA 4NHYA 1VRBA 3GF6A 3JCIA 3TWIA 4CCDA 2WYSA 2IZWA 4I0BA 1NXD1 3VN4A 1WLCA 4ARXA 1MACA 2Y0OA 4CP2A 1B09A 1WMXA 2ET7A 3AXEA 4HG6B 1OMIA 3NJZA 4HN0A 4PDWB 4DEVA 4XF4A 2TEPA 3VDBA 4AEMA
chains in the Genus database with same CATH topology
4JTNA 4AVTA 1VBD2 1WCSA 3GZUC 3I4IA 5CIRA 5F1RA 1PIV3 1SCRA 4MV2A 4LR4A 2ZAHA 4IESA 4NPRA 4N9IA 2JJ6A 3IT8A 4EV0A 1RITA 4O9GA 4EJRA 1LHUA 2ZGUA 1WLTA 4EN0A 1UU6A 4C90A 5LK5A 2ZGOA 1PZ9A 5KHIA 1O3RA 3DV8A 2FMDA 3FC0A 5FQ0B 1W6NB 1S0FA 2R072 5HCAA 4RS5C 5AFEA 1LGCA 1PGW2 2K9ZA 4M3CF 3AMQA 1R1A1 4N7UA 3GHMA 1OD5A 1WLWA 4OHWA 5FDBA 2P37A 2YZ4A 2ZAAA 4Q0VA 1IQAA 2WKKA 3ZFFC 3LZZA 1YYNA 3FX3A 2PHRA 1VAMA 4FTEA 2XBO1 1W6PB 2DYCA 1COV1 1ASJ2 5FBZA 3VUOA 1MS8A 1Q56A 3VBFA 4K7JA 3LA7A 1S0IA 4Q4W1 5JIAA 3D5OA 1C8NA 4HSLA 5BUVA 1UX6A 4RHV1 5C4WA 2ENRA 4H14A 5T52A 4HKLA 4XPVA 1YNAA 2UYBA 3WHUA 3SISA 3SLIA 1BMV1 5AC93 2B8MA 1KDMA 4S2HA 1LOBA 1RUD1 4IERA 3ZSJA 4IV1A 1SBDA 2GZWA 4PLMA 4YVWA 3KS7A 3OYWB 5H9PA 2WZR1 3OBRA 1YLLA 3KZ4C 1UCXA 4OZXA 4WM8C 4YW5A 4Y20A 1FATA 1HIXA 1L3JA 2DVBA 4QM8A 1BVP1 3ME2A 3AX4A 4QGMA 1GFF2 4QQOA 3URFA 3WQ1A 1DFQA 2CAUA 2KM2A 2GC3A 2DWRA 4XJ9A 2GC2A 2QZ2A 4YM3A 4QT6A 5AFBA 3TB0A 3OJBA 3VZJA 4XJ8A 3LSEA 3MIFA 2EXJA 2ZGSA 1UW8A 2P34A 2XKOA 2XLFA 4I30A 1EAH3 4AK3A 1FX5A 3CJIC 1AX0A 1VIWB 3AMNA 4IETA 3PHMA 2ERFA 3VL9A 1XNDA 2RR13 3AKTA 3WCRA 1WMDA 4AEDC 2OPKA 3O0WA 5I0TA 4ZU4A 1GBGA 1FMD1 2WIIB 3R4DB 4HT1T 2DCKA 4KU7A 3LAGA 1LHVA 2IXJA 3JBG1 4MLOA 3KCCA 4P9YA 1EP0A 2BYVE 5JPMB 3V0BB 3IDEA 2HWC1 5T55A 2R061 4MUVA 4YVSB 2AH2A 4LBLA 4PIYA 1HKDA 4D7SA 2XVKA 3ZIXA 1V9U1 3V65A 1I3HA 2QDRA 2WSVA 4I3PA 1NOVA 5DDJ3 1TMF2 2BNOA 2OA2A 1DQ1A 1RUI1 1DBNA 5GALA 1KXGA 2WLPA 3G7DA 3WW2A 4AXOA 1O7FA 4LO6B 3VBHB 1V6OA 3R0RA 1H1MA 4AI2A 4K9SA 3ZFFA 1REDA 5JOXA 1UAIA 4BOWA 1EY2A 3USSA 4Q4X1 4WVVA 5EFUA 1R093 3OY8B 4DQAA 1XYNA 5LRSA 4ES9A 4DS0A 5HBAA 2ZCWA 1RUJ3 2MHFA 3WW4A 1MEC3 2XBO2 1O3TA 3IM0A 1GLHA 1COV2 1QMJA 2VMIA 3O0VA 1QXRA 5KXDA 1ENQA 2YROA 3H7YA 2Z42A 1QQP3 3QBQA 4AVCA 3AMHA 2VVFA 4RHV2 1NCRC 3H0OA 3RWNA 4FP3A 1NYWA 4LHLA 3VBSC 1SEFA 1F5JA 5KHKA 3POSA 1BMV2 2QCSB 2X5IC 3D6EA 3KCXA 4WM8A 1H4GA 4I2OA 2VUAA 1W6MA 4P5HA 2Q4SA 3JUUA 4AFCA 2PFWA 3OD4A 4YW1A 5L7OC 2RS31 3OPZA 4FPGA 1A8DA 1WGPA 1OQ1A 1X50A 2A3YA 5H9SA 4Q0UA 2MNGA 4P9GA 4UW5A 1LCLA 1V6LA 3HIFA 2ZOEB 4XETA 1S1AA 3E5XA 4QPGB 4QU2A 5CB7A 3CJIA 5JIUA 4JDNA 2VU9A 2OUJA 4LO5B 4B8EA 1J59A 3PJYA 3ZVXA 4YGBA 4AEDA 4YFZA 1N1VA 5JI7A 3MIHA 3AK0A 4R9AA 4XILA 1CX4A 1VLNA 5GLTA 4AGRA 1QJX1 2GNBA 3I8TA 1LENA 4AW7A 1MS1A 2CGOA 2JD4A 2AGSA 4XQWA 1CQ9A 1SQ4A 1AR72 1A3KA 1RMU3 2HWB1 1DIWA 1F8VA 5T5JA 5D8AB 3S0MA 4CEYB 1GNHA 1SLIA 1S0DA 1C1LA 1YHFA 3M1HA 2X29A 5DZEA 3T1LA 4K21A 5BY5A 3ZMOA 1VRH3 4FPFA 2HWC2 2R062 3RDIA 1G86A 4ASLA 3WDWA 5E88A 3SXWA 2XPJA 1VBB3 3FFZA 4WVMA 1NQDA 5I93A 4B4QA 4LT5A 2LTNA 2H6CA 2RS11 4JGYB 4Q4Y3 2XWJB 5BNPC 3H8UA 4QPIB 3NO8A 2A3XA 3ZFEA 2OW4A 1RTVA 1S55A 1OQEA 3N7MA 1PO11 4JRAA 2GC0A 1MZEA 3IDBB 4QQ2A 5EZWA 3AKRA 4M01A 2CWSA 2HEYF 5JOWA 4IQPA 3V0AA 4CZSA 3L2HA 1BKZA 4BZ4A 4MGYE 2NP0A 2Z79A 5I8YA 4Z2WA 2EVXA 3KQRA 3SCHA 1O5UA 3O0XA 1CESA 3POWA 2FZ2A 3MFCA 1GZCA 2IXLA 3GBFA 4KL1A 5JCTA 2DTYA 1BK1A 4E27A 1O3QA 1WD4A 4KNCA 2ZGQA 3W9AA 1SLCA 1BJQA 4OHXA 2A6VA 1DGWX 3RNSA 4HK8A 2D97A 2ZHMA 2GMMA 2RS53 2WFF1 2RS32 1H0BA 4XBQA 3GHNA 2BTVC 1O4ZA 1BBT1 1VBE2 2XL7A 4PLNA 1NCQC 2ZX4A 3AFGA 1POV0 3O14A 4XJUA 1B35C 2D40A 1H9PA 1QJZA 1WA4A 3VKMA 3IWZA 3AZXA 2XLGA 1CAWA 2CNAA 4QQPA 3ZXGA 1QJX2 1WBLA 4R9CA 2CY6A 1HQLA 2P2KA 3X29B 4AVSA 1U12A 1AR93 1AYN2 1HDKA 4WZCA 5KBFA 1OA3A 5AVAA 4HZFA 1CJDA 3B7MA 3BALA 4AYUA 5BYNA 4X6QB 5C9AA 5GLVA 5EV7A 2D6OX 3KCYA 4E9KA 2FQPA 3APBA 3ACLA 2HWD3 1C8M2 5EWSA 2VNGA 1GQGA 1RUF2 4UBHA 1AXZA 1ZVFA 3PVBB 2JENA 2YXSA 2WNVB 5AC91 1RJ7A 1GZWA 2E63A 3UKVA 4L8QA 1H2MA 2HYKA 3B00A 2AENA 1JYIA 2JG8B 3WX5A 1V6NA 3ZSKA 3A0NA 2Q0AA 1CR7A 4Q2FA 1VAKA 4QHBA 5J36A 4NO4A 3HD8B 2WINB 2DCJA 2GAUA 2XHKA 5A33B 4GKXA 4LUMA 2WS92 3M70A 2D3SA 4XJZA 3WLUA 3OGGA 1LECA 5J48A 3NKTA 3VV1A 2VUJA 3NV1A 4Q4V1 1QJU2 2VULA 1K5MC 1AL0G 4GXLA 1RHI3 1D2SA 4A7ZA 2YGLA 4R9BA 4FAHA 4L99A 4TLFA 4GH4B 3PVEA 4A7YA 2GH2A 3USUA 2VECA 1IHMA 3ENRA 1ZZ9A 3SH5A 1EAH1 3NW4A 3NV2A 2ARBA 4B4PA 5K7PA 4GB33 4D7YA 4H55A 2ZACA 1JUHA 2RR11 3GBWA 4Y5Z0 2VNOA 2JDZA 5E8AA 4FOQA 1W39A 4I0WB 2VQAA 1NCQA 2OUHA 5I91A 1N1YA 1XNBA 3BCWA 1BQPA 2WFF2 5BNOA 2HKXA 3ZFGB 4CTEA 5I8TA 2EA7A 4FPEA 5JSPA 4YGDA 5JZGC 1X36A 2IWGB 2BW8A 3TYJA 3VBRB 1AR81 5C6CA 1R082 2YYOA 1B35A 3KD4A 1BBT2 1HX6A 4HFSA 4WM7B 3VZOA 5GLWA 5CAZA 4Q1RA 1VR3A 4KWLA 2JX9A 3LA3A 1PVC1 1S0BA 5DDJ1 5KC6A 4K3UA 3I59B 2Y38A 3UKNA 1ZZBA 5C8CB 4MXWA 2P3JA 1SLBA 3AMPA 3L2YA 4M0HA 4HN1A 1O4TA 1HRI3 3EXUA 2X53S 4XE9A 4LBQB 3T1MA 2KXLA 3VDDB 3BU7A 2TBVA 3VBHC 2KA3A 3VBUA 2NM1A 4N90A 1RUC3 4GQ7A 1RUJ1 1GR3A 2W08A 4Y1YA 1MEC1 2UU8A 5KHHA 3IKWA 4G4FA 1PO23 2GN3A 1Q8PA 4YM0A 1YJLA 4K40A 1C4RA 1MZFA 4BWOA 4DY5A 2IXKA 3MLJA 3RQ0A 4HKWA 1W6OB 4AFAA 3I54A 1YFYA 4XFBA 4R9DA 1XRUA 1QQP1 5FMOS 1D2QA 2RMU3 1W6QA 4KWKA 4YRDA 1PGSA 4CDUB 4GMP0 3U4XA 2B9UA 5AC92 2DFCA 3UV9A 1RC6A 1AXKA 1FOD1 3TN92 5JDBA 1D0HA 4TYSA 4XFGA 2ZMNA 4Q29A 4YLZA 4AFMA 2WNUA 1RUE1 3OYWA 2G4IA 1TQ5A 1K5MA 4P9WA 1I5ZA 4YW3A 3VLBB 4OHVA 4F7ZA 4DRRA 1Z7S1 4CP0A 5ACA3 1MQTB 1Z0HA 2WT1A 2R042 2NMOA 4N43B 4Q4V2 3NWKA 1QGLA 4QX5A 3UJOA 3WHTA 1LESA 1YCIA 1PGL1 3RYRA 4AVVA 3AZVA 3GZAA 2WZPP 5I8SA 3GZTB 1IKQA 1F2NA 3WW3A 1QJY3 2O8OA 3AKQA 4GALA 4X6RB 4QPGC 3WY6A 4IEUA 3ILFA 4AGVA 4A7KA 4AEKA 5HCBA 5F5QA 5JZGA 5GJ6A 4E2GA 1H1AA 3VL8A 1RMU1 3QACA 5K9YA 1YJKA 4S2FA 5T50A 4B7EA 2ZGNA 3QH7A 2NN8A 2HWF3 3M3CA 1ZM1A 3AFKA 5JOYA 3ZMNA 3V0BA 1RUH2 1VRH1 1HXS1 1REEA 1XNCA 1VBC3 4LNVA 1RVF3 1NA1B 4RQPC 1QNWA 4XF3A 1AR82 2NZ9A 1CAUB 1LR5A 4HVOA 1VBB1 1NY71 1OLQA 3CLPA 2IC1A 3DL3A 5D8AC 5H9RA 4D69A 4CEYC 1ND3B 1PVC2 3B69A 4ES8A 3GBGA 1POV3 1ZRDA 1CJPA 5KHJA 3MICA 2XJSA 3WCSA 4Q4Y1 5T5PA 2ZJCA 3M8LA 1CONA 3MLLA 3K51A 2GNDA 3D8CA 1TME3 3VZNA 1JOJA 4DINB 2I07B 4LBMA 3NSTA 3DPRB 1LOAA 2WA4A 3MIEA 1V00A 2JICA 4B29A 3I7DA 2BQPA 5EYYA 4JGYC 3SH3A 4MH0E 2UURA 3RMXA 4QPIC 2BUKA 4LLFA 5JWPA 1DYPA 1BEV3 2DV9A 4MVTA 3EBRA 1MEC2 5CBLA 3FUQA 4XMAA 4XXPA 2XJPA 4Y22B 3WUDA 3E97A 2IXHA 1TEIA 4INDA 3WP6A 4XJWA 1FPN2 4HETA 2GDFA 4IEOA 2RM23 3E6BA 5GLUA 2R1DA 2EALA 4DRVA 4JDOA 3JD72 5DG2A 1ENXA 3RMYA 4IV3A 2WL1A 1FOD2 2BNMA 4AI0A 4SLIA 5E16A 1JN2P 4L2NA 4E4DX 3SH4A 3LGRA 3IMNA 5JPNB 1RUE2 4BCUA 3BTAA 1QXJA 3NAPC 2BNNA 1Q5OA 2JXAA 2YDEA 1LTEA 4YYOA 3L9JT 1Z7S2 3ETQA 3RG0A 4UW3A 2A5ZA 1HQWA 2AZ5A 3MIGA 3P3PA 3ES4A 4XBNA 1SLTA 1D4M2 2GNTA 4QPGA 1KRIA 3TOJA 3MZHA 1URXA 3VKFC 1VJ2A 5KWRA 2EF6A 2YHJA 2HEVF 4XQ4A 3ZYPA 1G6NA 2K0GA 1AYM2 2DUPA 4IL7A 1QWRA 1UZYA 2PHUA 3MIDA 1UPIA 5LRRA 4FQ4A 1UD1A 1H8VA 3VGIA 4QQHA 1U5IA 4BMBA 4D3WA 4WZFA 4AQ6A 4NHLA 3KT1A 3FLPA 1H30A 3BIWE 4XOGA 4FXGB 3MLKA 1ZBA3 1AR91 1PK6C 2RJLA 4QMAA 5I0UA 1Q3EA 1AL23 3B5LB 4RQPA 1UIJA 1WW5A 3WG1A 4EWEA 1AR61 1S2BA 2WNEA 1HRV2 5D8AA 3MFAA 3ES1A 1IGOA 3THPA 4COYA 5JMCA 1HXS2 2A7AA 3VBOB 2JG9B 1YRZA 2HWD1 4YZ4A 2QE3A 5E1RA 4HMZA 4YSFA 2LUWA 3NKGA 1FAYA 4CYDA 2VQ0A 4CEWB 2B39A 4FAGA 2F6BA 1ND2B 4ATFA 2HWE3 2R16A 2VOWA 5EXOA 2EXIA 1IS6A 1RUG3 2PLV3 4QPIA 1W0OA 5KXEA 3PNAA 1WW7A 1N3QA 1EV13 4GKYA 4JC1A 5L73A 5CFCB 3MPPG 4JQRA 4I3GA 2WNVC 1UU4A 1VBA3 5FOBB 4XQDA 4FCAA 2FHRA 4FQZA 3O7OA 4RS5A 3ZPYA 3WT3A 1ZBE3 3PMEA 1WLDA 3KGLA 1OLRA 4LLOA 1CGPA 1H2LA 3MI8A 4F3JA 1RHI1 2E51A 2R49A 2VY0A 2YMZA 4XFAA 1KFXL 3MW3A 1UN1A 4IEPA 2GMEA 1R1A2 1XYPA 4XDQA 1PHMA 5IK4A 5LEKA 5JI9A 1PMIA 1ZZ6A 3QH6A 4GB31 4Y1VA 5DZGA 3O5SA 3MDPA 2AR6A 1G9DA 1VBD3 3NAPA 4GH4C 1N1TA 4OUMA 2V5YA 3SCGA 4CDXC 5CU1A 2IXIA 2D7FA 1OOPB 3RPQA 4YFWA 5E89A 4QGLA 3IPVA 2ZGTA 4Y4YA 1ZREA 2GSYA 4Q4W2 1HW5A 4M3CA 5T3NA 3IBMA 1X82A 1ZYBA 4MGIE 4XFFA 1ULDA 1HQNA 2YPJA 3AZZA 3CEWA 2WLQA 3HT1A 4KQ7A 4XJAA 4ZXKA 1G9CA 4W6XA 1BZWA 5H9QA 5L36A 3ZYRA 1AF9A 2BFUL 1RUD2 1TNFA 3ZFGC 1H2KA 2R073 4U36A 3MF6A 1KS5A 3N3HA 3ZN6A 3MGUA 3VBRC 2Z5WA 2DF7A 2D5FA 2WZR2 1YO8A 2ZGPA 1GV9A 3FWEA 1PK6A 4I02A 3VHRA 1WMFA 4AEJA 2QDNA 3AYDA 2PHXA 4AI1A 4IEZA 3M3QA 4FT8A 5C8WA 1Y43B 4BMEA 5LK7B 1C28A 4LUKA 4LBNA 1AX2A 5C8CC 4XIOA 4AHYA 4XXAA 4XIKA 4B4RA 1RUC1 1ASJ3 3N7KA 4AI3A 3MIBA 1AR62 4DOUA 1UZZA 2ZMLA 3H3UA 4Q0PA 5J37A 4FTSA 1DQ5A 1WCKA 3FBYA 1PO21 2W52A 4BYYA 4AHZA 2EAKA 2NYYA 3WW1A 1WD3A 1OHFA 1ZZ7A 3MW4A 4XFCA 3ZYIB 2RMU1 4F8AA 2VNRA 5JSOA 2VXRA 1JBCA 2D44A 1ALYA 4FVVA 1ZRFA 4NWWA 3E5UA 5A32A 1DZTA 1TE1B 3SMHA 2WNVA 2CTVA 1FMD2 3HMYA 5BNQA 1RUOA 1N3PA 4YVWB 5JLVA 3ZXJA 4P9LA 3JBG2 2YV8A 2G9FA 1WMEA 3E6CC 1AXYA 4M0NA 4ASMB 4Y20B 4Z07A 3D82A 3WP3A 4CDUC 1R1ZA 3HBZA 1G8WA 1ONAA 4YW4A 1GYKA 3ZSMA 5ACA1 4WBBA 2QQPA 1V9U2 2PQQA 2UY9A 4H7LA 5K0UB 2BBVA 5J96B 1REFA 1RUI2 1VALA 4AQ2A 4FPCA 2I2SA 4W6YA 5GZCA 3EO6A 4XZPA 1CAXB 3E5QA 4MSVA 3WG2A 3KT7A 1U5YA 4PJYA 5GM0A 4CDXA 1QJY1 4HVQA 1G7YA 4Q8LA 4UW4A 4N43C 2FBEA 2WC2A 2E53A 4WVZA 2GC1A 1C3HA 4Q4X2 1UIKA 3FE5A 4GB32 2XWBB 2R32A 2B45X 4LBJA 1NCRA 5J3UA 2DVAA 3WNXA 1F9KA 3QD6A 1RJ8A 2V73A 3VBSA 2MEV1 2ES3A 2QVSB 4F83A 2X5IA 3D0SA 5GZFA 1XQNA 2JKBA 2D93A 1J58A 1WCDJ 3VHNA 3ZFGA 2A73B 2ZMKA 1PZ8A 1VBC1 1TMF3 1QOSA 1RVF1 3VBRA 5L7OA 1AX1A 1MS4A 3DGTA 2O0OA 4RGGA 3WQ0A 3ZO0B 1LHWA 4LA2A 3S6PA 3ZFFB 2AUYA 1CAVA 2XJQA 3NV4A 1NA1C 1TNRA 3ST7A 1PIV1 2OYZA 1TME1 4E2QA 1ND3C 4PDWC 1DYKA 4DMIA 3BPZA 2LM3A 2ZHNA 1OA4A 3CO2A 3AYEA 5T54A 4BH9A 2D6NA 4HANA 4S2DA 5FFOC 2XBO3 1A78A 1COV3 4RGAA 1V6IA 4I09A 4BPZA 3AP6A 2OVUA 3WR0A 1DGLA 1GZ9A 3DPRC 4RHV3 3VHPA 4YG0A 3AP7A 4MGZE 4NOTA 3MF9A 1RL3A 2Q1MA 3WQ7A 4JDMA 1H8TB 2BVVA 3ZXEA 3LKJA 4N7IA 2ZGRA 4HL0A 2R1BA 4LBOA 2HWB2 4AVBA 4XHXA 4FBFA 2XJRA 5J09A 2O1QA 4URTA 2PHFA 2A71A 2V09A 3SNMA 3AJYA 1V70A 1X33A 1X8EA 3B9IA 3AP9A 4DY3A 4XEZA 2XUMA 5BNPA 4FPHA 5BPXA 5ACA2 3J9SA 4N53B 4AWDA 2ZHLA 1JH5A 5DZFA 3ZIWA 3UKTA 4PLOA 3OF1A 3ZXAC 3E6DA 4AEDB 1PNGA 2RS12 4NVPA 1OPMA 1OA2A 3WP4A 5FPZA 2PYTA 4EWDA 4QQLA 5KC5A 1QDOA 3VHOA 1PO12 5BXXA 1J3QA 2XVLA 1BYHA 2WSUA 4D7TA 1V6JA 3FFQA 1AR73 1AUYA 5T5LA 2VW1A 1UU5A 2VOXA 3ZXDA 2A6WA 3FMGA 1ZZCA 2D5HA 1YXWA 4HLTA 1AL21 1O3SA 2D3RA 3G6JB 2R063 2MEV2 4GWNA 1DHKB 2ZGMA 2H0BA 3TBDA 2VMGA 5FCCA 5J7MA 3CL1A 1NLRA 1D0GA 4AQTA 4AQSA 4LO7A 5DUWA 1G9FA 4Q0SA 4WVMB 3LA2A 3U10A 1NA1A 1EPZA 1IZ3A 1CAUA 1LGNA 1Z78A 4BIFA 5HCFA 4CDQB 2Q30A 1N47A 2PAEA 2I45A 1H1IA 3H7JA 1DLLA 4PDWA 4COUA 3FBMA 2X8KA 4AVAA 1LULA 5GKAC 2HWE1 2LALA 4J1WA 4FPYA 1JXNA 5JAXA 1FNYA 2DCYA 4KGQA 3VBOC 2JG9C 2CL2A 2DCTA 3ZFEB 2RHPA 3VKOA 4Z82A 4XF1A 4NR1A 4AG4A 4Z1VA 1PIV2 1RUG1 2GNMA 2PLV1 2H6BA 5SV8A 1G9BA 1EV11 4OI2A 4LO8A 1ND2C 3B01A 1VBA1 4Q8KA 3V0AB 3DPRA 4QPYA 1WBFA 3M7AA 1SMVA 5CG8A 5GZGA 1DQ0A 3AXDA 2WQZC 4AI8A 4YVSC 3A4UA 1LOFC 4PIZA 1YFUA 3IIAA 1YWKA 2VW0A 5FQ0A 2QNKA 1SFYA 4OHYA 2PAKA 4C1XA 1W6NA 2Z69A 3S30A 1IS4A 4AHXA 1DQ2A 1N1SA 1R091 4P14A 3N7JA 1LHNA 4XBLA 2PN5A 1QXPA 1BXHA 3WG3A 2C5DA 2RJKA 4BLIA 4BA6A 1DDLA 2RS33 1VAVA 1W6PA 3M3IA 3VZMA 2OZJA 5IT6A 3WP5A 1VBE3 2VOKA 1J3RA 5I0RA 3BODA 4LBQD 1Y7BA 3OBTA 3A0KA 3M3OA 4DNYA 1DG6A 1DU3D 1OOPC 4K20A 4MYEA 1LOGA 3NV3A 3RJRA 1QY4A 2XL9A 1MS3A 3ZN5A 2GU9A 2VG9A 3WINE 3LCPA 1F5FA 4XW3A 1AJOA 4CDWB 2PHDA 4QGNA 1JYCA 2R071 1KQRA 4XTPA 5ABJB 4Y1UA 2B42B 5C33A 1QJX3 1ENRA 1V6KA 1APNA 4KG8A 4ISRA 1UKRA 3ZSLA 4JAAA 1IOAA 1AYN3 2ZPXA 3C2UA 5LEJA 2YUEA 3OGJA 2ZX0A 2E7TA 4LBKA 5CVRA 5C9AB 3P3NA 3EQEA 2D6PA 2C9AA 3SHRA 2W0XA 5CFDB 4ONUA 3MEPA 1ASJ1 2JE7A 4K1ZA 3KT4A 1C8M3 4AE2A 4YW2A 2FZ1A 2WWSA 2JE9A 4JV4A 4A2UA 1RUF3 1EAH2 1ZRCA 3VBOA 5FLIA 2JG9A 2YGMA 2CAVA 5DXDA 3R6SA 1J3PA 3ATGA 5BNNB 3UL2A 4ZKTB 2RR12 1NG0A 3TNPB 2HJIA 1SBEA 1H9WA 1XU2A 1XU1A 4IEVA 2Y26A 5FO8B 3AZWA 2ZZJA 2I74A 1E57A 2AREA 4DXZA 2TUNA 3HN1A 3VKNA 3T2TA 1AJKA 1H2NA 2WS93 1KJLA 1RUG2 2PLV2 3FUOA 4YVSA 1CIWA 4XF9A 1QJU3 4BLJA 3IDCB 1FXZA 1FI2A 2F4PA 5B2GB 1VBA2 4YVWC 5F6LB 1VP6A 2O8QA 4L92A 5DUUA 3AZYA 2SLIA 5DDJ2 3NVCA 2OIIA 1ENSA 4NN0A 5TSWA 2R6QA 3VBHA 1XE8A 2EXKA 3HWJA 2XG3A 1J1LA 5K0UC 2ETEA 3WZ1A 2UWBA 1IPJA 3CNAA 3AJZA 1DGRN 1MZ5A 4UW6A 1S2KA 1R092 2DVFA 3OY8A 4HPKB 1W2UA 4XTMA 4C0BA 1GICA 2P3KA 4I0AA 5IK8A 1NCQB 3ILNA 5IUQA 1RUJ2 4UBGA 3FHIB 2WFF3 5BNOB 4S2GA 1OOPA 2DFBA 4H7MA 1FV3A 1XXNA 3LWCA 3CU7A 4W65A 1R083 2GALA 2VMHA 2XB6C 1BBT3 1B35B 1Q8QA 1QQP2 3RRDA 5FO9B 1TMF1 4OI1A 4JGZB 1QOTA 3B9CA 1SFNA 4K8FA 1UL9A 4MXWB 2EAAA 4EWAA 4BIOA 4P9IA 3NL1A 1UKGA 4AGGA 2VGDA 2RS51 1LOEA 4JRLA 1DQ6A 3ROUA 1GSLA 1MS5A 3J8F3 5KXCA 3HAGA 1YFWA 1FNZA 2DURA 1ZZ8A 3VBUB 4C0HA 1YI7A 4EN6B 3TNQA 3AKSA 2ZA9A 4FOVA 4RL7A 3ZN4A 1F31A 1PGL2 3KSCA 1RGSA 1IPKA 3KM5A 5SV5A 3HQXA 2DU0A 4Z92B 4GWMA 4ITCA 3VZKA 4J1XA 2E9QA 1W6QB 3U11A 4E2SA 4COWA 2ARXA 3D0JA 1S0EA 1Y9QA 2WT0A 4HK9A 3H9AA 4OI0A 3R05A 1LB2A 2ZS6B 3TN93 1ZX5A 1LU1A 2XGXA 1I1EA 5JVVA 4D94A 1RMU2 2WNUB 1I9RA 1QH7A 4FOYA 3JB4C 1LKNA 4Q0QA 1V6MA 1K5MB 1FV2A 5FTTC 1QH6A 4L97A 4NHKA 4CEYA 3V64A 4NHMA 5JSRA 3LB9A 3PMSA 1M06G 3IN9A 1H8TC 4FO9A 1VRH2 2R043 4FP2A 5KHGA 2SBAA 4Q4V3 4FPOB 3PVNA 3H1YA 4DPNA 4O9EA 1VBB2 1NY72 4I01A 5K0UA 3GALA 4R4XA 5K8SA 1LEMA 2BEOA 3RI9A 4PBOA 4NWVA 4JGYA 2ATFA 4Q4Y2 4GULA 1CAXA 4ORFA 4N53C 3DUIA 4OVEA 4JVAA 2IFRA 1WUVA 4ZU5A 2DVGA 4RR3B 4YZ3A 3WXPA 4XHBA 2ZKNA 5JZGB 5FLHA 2VPVA 2GN7A 4E4SA 4RFT0 1AR71 3B93A 3JU9A 3WUCA 2JG8C 1CPMA 1HLCA 2C0ZA 4LULA 3U07A 2VVEA 2ZX2A 5GLZA 1Q43A 1RUH3 2ILMA 1MVEA 5I0SA 1C1FA 4C91A 1A6CA 1YIFA 3TAYA 1JW6A 1AR83 1UF2C 3PJQA 4FPKA 3THTA 5A3MA 3PLQA 2IXCA 1XE7A 3AKPA 4Q1PA 1KJRA 1PVC3 4LE3A 2Z2SB 4CP1A 4MZUA 2DUQA 4GMP3 5FREA 5GZEA 1RB8G 2D43A 4EN7B 5IK7A 4ZU7A 5EYXA 1IS3A 4COZA 1EYBA 4ISQA 2RS52 1S0GA 3N36A 4CDQC 3EHKA 1G9AA 1RIRA 2D98A 2C1FA 4A3XA 4KBBA 5FO7B 3H1WA 2A6XA 4W6WA 2EIGA 5GZDA 3ZFEC 4KH9A 3ZXLA 2PHWA 3ELNA 3ECQA 2WFPA 2HEWF 1LRHA 4WM7C 1CD3G 1T6GC 3ZSEA 1CN1A 2ZHKA 1FPN3 1HRI1 4HKOA 3JZVA 3U0ZA 2B5HA 3JD73 3WOGA 2FMYA 1H8TA 4IV3B 1FOD3 1DZRA 1AR92 1QKQA 3FJSA 1RUE3 3VBFB 3VDDC 2BWCA 2WA3A 2QFEA 3RI8A 5C4WB 3ZXFA 1Z7S3 3KLSA 1HV1A 4L11A 2Q1ZB 1VBE1 3I2DA 2RE9A 4OI4A 4IEXA 1D4M3 2HWD2 4DFSA 2BPA2 1U5XA 1QHDA 2A3WA 3B94A 4TSV